1RIVL

Anti-cocaine antibody m82g2 complexed with meta-oxybenzoylecgonine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGYTYLHWFLQRPGQSPQLLIYRVSNLASGVPDRFSGSGSGTAFTLRFSRVEAEDVGVYYCMQHLEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPQDITVSWKIDGAERSSGVLNSWTDQDSSDSTYSMSSTLTLTKDEYERHSSYTCEATHKTSTSPITKSFNRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab M82G2, Light Chain
publication title Carving a Binding Site: Structural Study of an Anti-Cocaine Antibody in Complex with Three Cocaine Analogs
rcsb
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivL01
3EO1A 2EDNA 4YWGL 1AR1C 3RKDC 1EJOL 1NUNB 4W6YB 1MVUB 4JGUA 5HPMA 1GRWA 3U46B 1ZAGA 2OI9B 4PJXA 3QUMA 3PWJA 2HT2C 3DYPA 4JB9H 5TH2A 5K59E 3NGBC 3LKRB 4ZDHA 4MVBD 1NAMA 3VWKD 2D7QA 3VMPA 3IU4L 1JHTB 1RI8A 4XTRD 3QJHA 5B3JF 4PRAB 4WFED 5DRNA 3CDFA 3L1OL 1N4XL 2A9NH 1EH9A 2WUBH 3OXSA 5ICXB 4HBCL 4FA8A 4ETQA 2GJZA 2VLMD 3WN5C 1H3UA 2YSSB 4OZIF 4RGMB 4O4YH 2ZUQC 1NBYB 1NANI 2C7UA 4X6DB 1OAXH 1W0WA 5AZ2H 1JUFA 3UTTE 2IG2L 4M3JA 5I8EB 4YHOL 2FH6A 3LKQB 3UYOD 1A3RL 3IDIA 1T1YA 1NUFA 2DJ4A 2YRPA 4P48A 1DVFC 2BX5A 5HGHA 3U7WH 5J3HD 2YC1B 1FZJA 3KPOB 5DD6B 2P8PA 3VW3L 5DI8A 5EZLA 3WO3B 4QY8A 3VXPB 4M7JH 3D2UD 5FGRA 5HYSG 1MFAH 2AABH 3H0TA 1AO7A 2MOVA 5D5MF 2VMFA 4F2MB 5L9DH 2RHEA 4ODVL 3CNKA 4MNQA 3LSOB 3K74B 1S7TA 4J4PA 4FQQA 3ARGB 5D7LE 3NBNA 1I8KA 3ZYZA 5GS1A 2AXFB 2IFGA 4OFYD 4B5EA 4G9DA 1MWAA 2YN5A 3H9HA 3VG0H 25C8L 4NNYA 1R3HB 4C56B 3ZE0E 3A6BL 1AGDA 1KJ2H 4L4VD 2WZPD 3MZTA 2B0SH 5DD0H 5FYLE 5E9DB 3P30H 4CN6A 32C2B 1DQJB 1KCLA 3HE7D 4GAFB 4PRDB 1OW0A 2OTUB 2J5LB 1G7MA 4EI5C 5J6GA 4YNYB 4Z0XA 3DMMC 4YUEH 4YAQA 3P40A 5E1AA 1FO0A 2APVA 3ECBA 3TH3T 1U8JA 5TGBB 1ZEAL 3U7YL 4W70A 2YD3A 3OX8A 1BQSA 3L3KA 3X12B 2XG5A 1EFQA 1NCBH 2BOBB 1D5BB 2CSPA 1JWUA 5EUOB 3L3DA 1P84J 1GL4B 35C8H 1BJ1H 1DSFL 2MCG1 3U82B 4GO6B 5FGCE 4AIXA 2YD4A 4ONHB 5C70A 5EA0L 1DLFH 3T0AA 3BZ4A 4O00A 3SDCA 3KXFB 3STLA 1ZGLP 5C08A 2ZCHH 5EBMA 5H37G 4WI5A 3MGOA 2VXVL 3FAWA 3KDMB 4JHBA 2AW2A 4PJ9D 2OL3A 3EYOA 1KACB 5D7JD 4DKEH 1F3DJ 5CIPB 2AJSH 1BZ9A 5JW3H 3U9UA 3RY5A 1U93A 4HIEA 3GK8H 5ICYB 2K3TA 5FCSH 5T3XL 2X1OA 4POZC 4O2EB 2F5AH 1T5WB 1UKQA 4NQEB 1CZ8L 3HB3C 1MRDL 3INUL 1MH5A 2CMRH 4K3EH 3KWWA 1IAII 1VENA 2P8LB 3WL9A 3O4LB 2ICWA 3ARDB 5KZCB 2C5DC 4M6OL 3TYFA 4L8SB 1TJHL 4KKBD 4NM8H 4AH2A 3DRTA 3MUGB 5JPMB 5D1XC 1IQDA 2PNDA 4NBZB 3QIBA 3OXRA 3RWHB 1EHLL 4HFUH 4TYUA 1DTUA 4I2XB 3AXLB 4G9FB 1YY8A 1CLOL 4JM2A 5EU7C 4L4TB 2VL4A 4TSCH 1TQBC 1A6ZA 1QSFD 2OJEB 1S7SB 2VJXA 1T03H 2VDQH 2VZ1A 4ZUUB 3JSSA 4JFDD 3T4AB 12E8L 4N0RA 3S9DB 1AD0B 2VWEE 2E7LA 3MLXH 3ZL4H 3ZT7A 4DZBB 2ZUYA 2Y9RT 1T66C 4AYFA 1H3WM 1KIRA 3QI9D 1EEUA 4LIQE 1G7LB 1CLZH 1SJXA 2PO6B 2P1YA 2WWKT 3BH9A 5TPWH 5DEFB 3ZKXB 4FQ1L 4YFEA 4U0RB 5EN2B 3QDJD 1RUAH 3OR6A 2DM4A 4Y4FC 1K8DB 5K9OA 3NIFF 5F9WB 2YR3A 3LZFH 2FSEA 4Q58C 1HINH 3S35X 1AQKL 4DCQB 2O93L 1AKJD 2J8OA 5FHAL 2NY4B 3EJZD 3QUML 2OZ4L 3IDGB 2BFVH 2ZOKB 4PJBF 4S2SB 4U4BA 2VDKL 5E4IA 1MCJA 3E6FA 1GGTA 4OAWB 1NAML 1WZ1L 2O5YL 5D8JH 4PG9B 4NUGL 4UQ2A 1S7WB 5JOFA 3C08L 1NGWB 4N9GB 2NY2D 1IKNA 3W0WB 4P0DA 1N8ZA 3DV6A 1SEQH 2WANA 1LE9B 3PJSB 5IB5A 1CWVA 3OKEA 1HDMA 1JK8A 4M7ZC 3T0VA 5C9KA 2A0LD 5JR1H 2AJZA 5H35B 2Q20A 2VKXA 4MS8C 4FFZL 1AC6A 4NQDA 3WNOA 3DX9A 1YEKL 1WBYB 2JK5B 1MCEA 4HZAA 2XN9B 3LB6C 2WINA 1FN4A 1AFVH 1AD9A 3TO4A 1FVDA 2F53E 1NEZA 3QUXC 4LGRB 7CGTA 2OR9L 2YOCA 3UTQA 1WIPA 4N8VA 3TLRA 3S8WA 4M5ZH 1NBZB 2A6JA 4PJ8C 3UJIL 2Z0BA 5T3XD 5KSVB 1A7BA 2Z31B 2F54D 3ZHDA 2NXZB 5I1LA 5ITBL 3HCVA 2R0KH 1AGCA 4JFFB 4ESKA 3BW9B 3N9GH 2QSCH 3CH1B 5FA4A 5EPMB 3P9MB 1G7QA 2VAAB 3FRUA 4FQIL 3MLUL 4XB8A 3C6LD 1ZT7B 5FYKD 4LDEB 3L7EA 3P73B 4A6YH 2H26A 4X4XB 4WJ5B 5CCKH 2YBRB 4LVNB 1TFHA 3UTSB 4IMLB 5IMLA 1SHMA 2HG5A 2HJKB 4L3CB 3VRIB 3Q3GB 3GMRB 5JDSB 2LTQB 4M5YL 4MX7A 1CFVL 5JNYA 3C9NB 2CRIA 4MQTB 2XIDA 5BZWB 3PXJA 4PJAE 2BVQA 1L0YA 2VYRE 1X4YA 3BIKA 5IF0A 3LN5A 3KYNA 3MR9B 1AI1L 4GBXD 2X4TB 1RHHB 1FO0L 1TZGH 2IPUG 3MRRB 4XP6L 1IKFL 3MXWL 5LBSH 4G8GE 5ACMA 4UNTA 1JGLH 5KTEH 5T1MA 5GRJH 4L29A 2F74A 2CKBH 4CN1A 2IALA 3MOBL 3BO8B 4JGMA 1QNZL 1Q9LA 3BAEL 1CI5A 5EU6D 1OP3K 4B7LA 1RU9L 2WBJA 4MQXD 2JKXA 4OD1H 2Q86B 5DK0B 1FFNA 3T0XA 1EAPB 4OZGB 1RZGB 3PNWB 4P49A 3UTPD 1TQCC 4Z76B 2ESVA 2W60B 3U2SA 1OAZH 4YHIB 4IRJC 4TOYH 4DN4L 2VH5L 1QP1A 1BOYA 1NKRA 4KZDH 2FO4A 3PF2A 4ETYA 4HWUA 4LPVA 3ULSB 2Z4QA 2IADA 4MAYB 3KPRE 1T21A 4GRWF 4Z7UA 4ZO8A 3H3BC 1CF8L 1MRCL 1XMWA 4JFEA 4NZRH 3SQBA 4S1QL 5C6TH 2HVJB 5I66B 1NMAH 3SE9H 3N1GC 1JF6A 3RKDD 2A6DA 4KROC 3WKNA 1KF9B 4UV4L 4JLRA 4XZUB 1X6NA 4NQXB 1MRFL 1E27B 2ADGB 1AP2A 1J0ZA 4RAUB 3MYJA 2HT2D 4UI2A 2FIKA 3O4OB 3H3PH 5SX4H 2ICEB 4QT5B 4JKKA 3HE6C 4LNRB 1LO4L 1LP9A 4I0CC 4CVXA 2DDQH 1I8MB 5L8KB 3S97C 1R3LA 4ERSH 4X6DE 5BV7C 3E0GA 1T6WA 1OTSC 4RAHA 3WIFA 2HRLA 3U36B 3QIWD 5E94A 1Z5LA 4WUUD 4GKSB 1IGTA 1KCSH 3EFFB 3MLZL 3D18A 3TBVB 2VUOA 2EYRA 3BP6A 3FFDB 1NCWH 2ARJB 1GGBH 2COQA 2DQTL 5IFHL 4P4KC 3B6SA 3V0VB 3MACL 3MRIB 1DVFD 1RZFL 3DLQR 1XF3A 1BZ7B 1TTUA 3CCHB 1NGZA 2AGJH 1KOAA 3GJFB 1LO5B 3VD7A 1RJCA 3CDYA 3MFFA 1MCBA 1NDGA 5GGUB 1JF1A 4C56E 3WFDL 2WBKA 5E70A 3BVNA 4APQC 1G6RH 1MY7A 2FLRT 3NZ8A 4HEPG 5KVEH 1GAFL 4OI9A 1UM6L 5BZDA 4QRPD 3RX8A 3RAJH 2FNBA 5JIPA 5E9DE 3TZVC 4WFFE 2XT1B 1BQLH 2C26A 3WO4C 2DBLL 3GSWB 4U33A 4DFIA 3DYOA 4ZAKC 2NMSA 2IFFH 3B5GA 4I5BB 1BQUA 2R2BB 4TVPD 2BY3A 4KKCC 4P3DA 3DUHA 5F71A 5KANG 4FXKA 1AR2A 1WWAX 3MRQA 4PJEA 4Z7NE 1B9ZA 1Z3GH 3V4VH 4Y89A 5CHNB 2NY1C 2ZPKH 3C5ZA 4XNYL 3HI6H 4HDIB 4KJPC 3QEHB 4EI5D 3OKOA 5EUOE 3DMMD 1VFAB 4UTAH 3S37X 1QLRB 1WK0A 4HKBB 5IGXL 3D48R 5T5NG 1I1AC 4LCWD 1CLYH 3KPPB 5I0DA 1RUPL 3O41A 4PJFA 3NCYP 4NT6B 4HKXA 1FE8L 5H2BA 1G7PB 3LV3A 1K2DA 3KXFE 5GGVL 1A4KA 1E6JH 5E24E 4JN2B 5MERB 5A2IH 1IT9L 4WI8A 4WU7B 4L9LB 4BZYA 3QEQD 4ZMAT 4QHUB 4KTYA 2IANA 2CDGB 1VCAA 4OCRL 4OD3L 5T1KD 5IESH 1IGYA 1RUML 3DTXA 5HYSB 4EUPH 4Y5YB 4ZUTA 2NCMA 4KDTC 2XQBH 3GRWH 4LAJH 2LQRA 2XICA 4GAYA 4N8VG 5I16B 3O8XC 2WIIA 2VAJA 4NQEE 3VFOB 3MV8B 3TNMB 5D71H 4JHAH 2ILLA 1DBBL 3AU1B 4X83A 2YHGA 3G6JB 4HK0A 3GMNB 3O4LE 1UM5L 1D5ZA 4HKJA 4EJ1C 4POZD 4EEEA 2PYFB 1WBXB 4OZHB 4ODWB 5CEZE 4K23H 5AEAA 3HB3D 4Z7VB 1Z0NA 1E4XI 1XF2B 4IOSD 4F7PB 1LGVA 3SKMA 4HX1B 4GKNB 4ZS6C 1QRNA 5FUCC 2PW1A 2Z35A 2X44D 3P4NA 5LGJB 4QTIH 4I2XE 3VXUB 4TN9A 4D3CL 4G9FE 3PDOA 3VFUB 4QKXB 4PTTB 4L4TE 2BY2A 5D1XD 43C9A 2BHUA 3UYPA 4RGOL 5F9JA 5T3ZD 3GSOB 1VFBA 3P4OA 3AS3A 4HS8H 1BLNA 4NQVB 4ZS7L 3DI2B 2WAHA 4XP5L 1Z9LA 2F58L 1JYWA 2AJVL 1XGUA 2Q76A 4Z7QE 1Q72H 1H8NA 3VFNB 5F1OB 3K1KC 2W91A 2VLKA 5TE6H 3MNVA 3JV4B 2M1KA 3QUYC 4OSUH 1U8HB 4GW4A 3QPXH 1I7TA 2CJUL 1T66D 5BRZD 5IW3A 5JLZA 2BMKB 2H2PD 3Q6FB 2G75B 4NO0B 5HYQB 3CMOL 1ZLSL 3HG1A 5B39A 3IDNA 5F7DA 1IAKA 3O45B 4KHTH 2ZSVA 1CGUA 4LCCA 2QLVB 3W5MA 3I6KA 4MDJB 2G5RA 2A83B 2HRPL 5B21A 1RZ8A 4Y4FD 2H32H 4OZ4B 2B2XH 3C60A 3CPLA 1T0NA 5CKAA 1Q38A 5IB3B 2D9QB 4NO2A 4LEOB 4LSUH 2GIYA 2NYYC 2MKWA 2PXYA 3W0WE 3WV0A 1MCNA 4F15B 2KZWA 1RZKL 3RWJA 4JVPA 4U6XB 3TFKC 2A74B 5CGYC 4LCIH 3U4EB 1X5AA 5HHVH 4LSVH 2Y5EA 2DIBA 3ARRA 3PQYA 2Z91A 1WVZA 1QVOB 2XN9E 4G7VL 3RWCB 5ID0A 4IHOA 3ARUA 1JHLH 3IS1X 4KZEH 3DSNA 4X6CB 4GW1B 1WZKA 3KYOB 4MS8D 3C8HA 3GSXB 1D6VH 4ZPVA 4XMLH 2FEEL 2YPVH 5K59F 3LB6D 5BS0B 4KU1A 4HIXL 3PHSA 3QUXD 2EO1A 5E0QA 1AXTH 3DX8B 2A6IB 2BNRA 4FQLH 1KXVC 4N0YL 2OYPA 2GTWA 5A16A 3TPUA 3T2PA 4JFFE 1IGCL 1XZ0A 3MBEC 4PJ8D 5JHLL 5BV7L 1FFOA 1A2YB 4WO4A 1MCPL 3FB7A 2OS7A 3SBWC 3TEUA 3U4BL 5DMKB 3ARFA 4GBXB 3QWRD 4UDTA 4AEIH 1DEDA 1I8IA 3UTSE 1QR1A 2BNQD 2IAMA 2NY3C 3B83A 3SCMB 1FV1A 2PCPA 5MEPB 1MCIA 2V5RA 4W4OC 5DHXB 5SWZD 2F5BH 1RURH 5DJ6B 3PG2A 2DAVA 1R5IB 3BDBA 1F11B 1MHEB 4HXBL 4JO2H 1QFUH 5ICZA 3SDDA 2FZ3A 4Y5XA 4OZFA 4NQCD 1DN0B 2HT3C 5C9JA 2V7NB 1CGSH 4KK5C 1MF2L 5ILTH 3H7BB 2MCPL 1EEZA 1RVFL 5HPMB 5F9OH 4PJXB 4RFNB 3WFEH 3QUMB 3PWJB 5L88H 2E27H 3MOQA 5HYIA 5TH2B 3SE4C 4DN3L 2UZYB 3O3EA 4P46D 4ZDHB 1NAMB 2R0LH 4LFHG 3PP4L 3K2MC 3KPSD 4P5MA 4Z77B 3MJ9A 3KAAA 3QJHB 2AXGB 2AJXH 4OZGE 5HI5C 1IFHH 3OXSB 2XWTA 3ZE0F 4PV9A 3O9WA 4ETQB 3NCEB 2GJZB 3PE9A 4LKCA 3HTLX 4WFEE 3CZFB 1T04A 5DK2A 2NLJA 3U7AA 4GRLA 4XPAL 3HNTL 3PHQA 2C7UB 3MV01 3WHE0 3EYUH 1W0WB 1JUFB 4H26A 4FQJL 2AV1A 3UJJH 5I74B 2OMNA 1I3RA 1T1YB 3IDIB 4KXZH 5HGHB 4LMQE 4NQSA 4IRJD 2P8PB 4GAJL 2YRZA 5DI8B 1S7UA 5EZLB 5FHBH 4QY8B 5DJXA 4OM1H 4B7IA 3F7PC 2EH8L 1PSKL 1KGCE 1UWEL 4Z95L 5JO5B 3QNZA 1TTGA 2FJFA 3D9AH 1DQML 3H0TB 1AO7B 2OJZL 4HUNB 4MNQB 4UDUB 3AY4C 3TBYB 1S7TB 5A2FA 1G0DA 4JO3H 4YDIL 2X40A 4FQQB 1BFVL 5I75B 4KROD 3U0WH 1I8KB 5GS1B 4XXCA 4L8BA 4TNWK 5EC1A 4LPTA 4OLEA 2CK0L 1TVBA 1RSFA 5D1QC 3F7QA 3H9HB 4LLQA 5HDQL 4NNYB 4P5TC 2VDOH 4N68A 3BP7A 3HE6D 5HDBE 3OWEA 1AGDB 5E6IA 2DQUL 3LS4L 3WXVL 1JHKL 5EZIH 3MXVL 2F8OA 4F37K 4F9LA 2BCKA 3VWJA 2DQIL 3RA7L 1N5AA 1VB9A 5CD3B 2XQYG 4H20H 1A64A 1LDSA 1G7MB 4L4VE 5J6GB 2G60L 1PG7X 4YAQB 5E1AB 1FO0B 2APTA 1J0HA 3P4LA 1U8JB 5C7XH 4MLSA 4N0CC 1V7NL 3CJJA 5L7XL 4D9LL 2ED8A 5DJ0B 2WLYA 5L0QB 4P4KD 1JWUB 1YMHA 2BRQA 3GJFK 4I3SL 3NPZB 3L3DB 3MRHA 1FNHA 1KLUA 1BBDL 1BFTA 4JDTH 3DV4B 4JVUA 3BZ4B 3H6JA 4N5UA 3SDCB 5DJCA 3IDUA 3SKNB 1IJ9A 5EBMB 4QRRD 1A14H 4PRPD 3U30C 3MGOB 4Y16A 3NCFB 2GAZA 2X89A 2XKNA 3RWGA 4APQD 3EYOB 2A9ML 4YK4B 1SBBA 5E8DL 5CZXC 3R8BB 5B39G 1BZ9B 2HFTA 3U9UB 4HIEB 5E4EB 5GRZA 2W59A 3TZVD 3WSQL 3BSZH 4NO5A 4YDLB 4QXGH 4P3CL 4ZSOA 4ZAKD 4ZTOL 4OZIA 1I3VA 1FGVH 4QNPE 4X7SH 4KKCD 1MH5B 4OCYL 1DP0A 2VR4A 4X5WA 3WL9B 3EAKA 2ICWB 2AERT 2ZCLL 3AMLA 3VXOA 3TYFB 4F9PC 4KJPD 4DQOL 1B3JA 4IOIA 4AH2B 3S5LB 3DRTB 1IQDB 5HHMD 4O9HH 1I1AD 4AIOA 5C0CA 1TJIL 3QIBB 4X7CC 2HMIC 3QEGH 1HHIA 4NWTH 3B2UC 5D5MA 4IRSA 5DUPH 1YY8B 1MFCH 3LQAL 4JM2B 3OSKA 1S7XA 4ZQKA 2DLEA 1YECL 4E42A 1QBML 1A6ZB 2BRRH 4WHDA 3HKFA 4URTB 4GQ9H 4KWUA 2FECL 4U7KA 3G6JE 5DGRA 1DBJL 3VGGA 3ARTA 3O8XD 3SGJC 1RAMA 5K9JH 1Q0YH 2AXHA 2PYED 3K3QA 3LQMA 4N8CH 4OZHE 3RZCC 1P7KA 4Z7VE 1KG0A 2D4DA 3AFLA 1RIHL 1OT1A 1K6QH 1TNMA 5HVGB 4Y2DC 5CJ8A 3OR6B 5K9OB 4MA1C 1MIML 2PR4H 1CFNB 2FSEB 4WW2F 1I3GL 3L95A 2ARWA 4YZFE 2DYPA 4LP4A 4ZUVA 3AC0A 3RDTC 4M9OA 4XNUL 1T4KA 4P23C 5L2KD 1U8OA 3AS0A 3T1FA 1OCWL 2R15A 4XWGH 5I1KH 2EXWC 4ZS6D 4MXVE 3E6FB 1G84A 4OZFG 4R2GB 2J8HA 4EOWL 2B1AL 1Q1JH 1Q9KA 4UQ2B 5JOFB 4PP2A 2NR6C 3MJ9L 5SWQA 3RWDA 2B4CH 5J12B 3IFOA 2ERJC 4OF0A 3BYYA 1N8ZB 2WMPA 3DV6B 2O61A 3QQ9C 3RWIA 2R0WL 3P0GB 5IB5B 1PX3A 3OKEB 4TSBH 4JO1H 1VADA 5DSCA 4OKVA 2AJUH 4Z7WA 5INDA 4NQDB 3DX9B 3FO2A 4KJQC 5DYOA 4BQ8A 1IZJA 1MLCA 5I1JL 5L8LB 1FN4B 5F93C 1AD9B 1XF5A 1FVDB 4KVCH 1NEZB 2XZCL 1T2JA 3QUYD 3UTQB 4N8VB 1IAMA 1WICA 4D9RD 3TM6A 5B4MC 4OF5A 2A6JB 3BH8B 3ULVL 4LVOB 4ALAH 3HCVB 4BFBD 3QNYA 1B2WL 5E2TL 5I1AA 1E4WH 5C0BD 5JIIA 5CJQL 2DBJA 4WW1A 4GQPH 3A6OA 1AGCB 2E7CA 5FA4B 1OAQH 3T2NH 5DS8A 4BJLA 2F54E 1N26A 1G7QB 5L2JB 1R3IH 3G9AB 1NCAH 3FRUB 3JUZA 3Q48A 2UUDK 1J8HA 3UO1L 2NYYD 3L7EB 3BE1L 3I6GA 5EORL 4PG2A 1CFTA 2VLJA 1K85A 1QLEH 2P47B 5J8OA 1C08A 3BGFB 2HG5B 3TFKD 4X6CE 5GHWH 4JM4L 4Y5VA 4MDIA 4MX7B 2DICA 1XR9A 5JNYB 2FRGP 3BGAA 4XVTL 4Y19A 1ORSA 5ISZA 4HIHA 1CLCA 5IBTH 5HGDB 2BVQB 3QFJD 5BS0E 1ADQA 3QCTH 2DLHA 1WZLA 3QNXA 2XYCA 1OSPH 3KYNB 2UWEF 1A7QL 3EYFA 4HGKC 5D96C 5DZNA 5T1MB 4L29B 2FEDD 3TJEH 1E4KC 2IALB 1WISA 1Q9LB 2YZ8A 5IT2H 2XZZA 2OK0L 4CMHC 4IJ3B 5BMFH 2WBJB 3HPLB 3WJLA 1FFNB 3MBED 3V2AR 4PJBA 4X6DF 2YRLA 2GT9A 4BUHA 4P46B 1S7QA 2HLAB 4K71B 2ESVB 5AWNH 1QSED 3U2SB 4BH8A 4LVHB 2YWZA 2DQDL 5FUOH 2NY3D 3L3IA 1A7RH 1JPTH 4N9OB 1MHHA 4O4YL 3QCUH 1JMZA 2ZKHH 3GMOA 1T1XA 3BKYL 4TVSa 3E3QC 4HFWA 1IAOA 1OAXL 1N2RA 5DRZA 2FO4B 3MRFB 2IADB 4PJXE 1T21B 3U7WL 4XP9H 3GIVA 4U1HA 3MNZB 4JFEB 4HUVA 5MEQB 4FQXA 4KY1H 4MCZB 2HT3D 3B9KC 4KK5D 3I2CH 5CP3A 5J1AB 4P2QA 4HT1H 1PKQA 1E4JA 2A6DB 4M7JL 4JLRB 3KLAA 4PBWD 2FX9H 3IDJA 1AP2B 3FB5A 1LD9A 3MYJB 4GMSH 2FIKB 1HYSC 3SPVA 5L9DL 4WGVB 1T0PB 2QQLL 3ZSSA 5IB2A 3OKMA 5IVXA 3VDCA 3PWUA 2VZSA 1LP9B 4CVXB 3AS1A 1MJ8H 1ZSDA 3T0EA 4LLYB 2H45A 2M26A 3SE8L 5HI5D 1GGIH 1R3LB 2B20A 4LASH 5D7SL 5E8EA 3VXRD 4BFIB 1HQ4A 3WIFB 5E94B 1KJ2L 1Z5LB 5FM8A 1IGTB 1J12A 4LHUB 3BKJH 2DD8H 4I48A 2EYRB 2GEEA 3BP6B 1MCOL 2ENSA 2I60H 4DTGL 1HEZA 5EUOF 4KQ3H 3B6SB 2F8XC 5C0AD 3V7AG 1BAFL 3GUTA 4XP1L 1AO7E 2AK1L 2DLFH 4YUEL 2J4WL 1XF3B 4Y4KA 1MFEH 4MNQE 1WV7T 1NGZB 1KPUA 1UACH 1A0QL 5LXGH 1IILE 4ZODA 3G6DH 1WBZA 1NCBL 3Q5OA 1SMAA 1KJVA 1FLRH 3MFFB 1NDGB 1JF1B 4IRZL 3W39A 4DKFL 2I07A 3V52H 4J3TA 2R4RL 3NIGE 1FAIH 4JKMA 1YNTA 4JJHA 2LABA 3BVNB 3NZ8B 1DLFL 1JZ4A 3EJYC 3MUJA 3QXVA 1KTRL 4PBXA 1G7IA 3BD5A 2EEDA 2I26N 4LBEA 15C8H 4HG4J 3RTQA 5D1QD 1MLBA 1JYXA 4DGIH 4P5TD 5GSRA 5DEZA 4YHYB 2D03H 1NUDA 4P3DB 3TA3A 2FL5A 1S5IH 4FXKB 3DIFA 2AJSL 2NY0B 3MRQB 4PJEB 4XWOC 2KKQA 2VKWA 2YKLH 3MYZA 5DUBA 1AE6H 3C5ZB 4X9HA 3WXWH 4KJYA 2EZ0C 4LPWA 3OKOB 3T04D 3MODL 3G5XB 3PHOA 2CMRL 4WWID 1CD8A 3FL7A 3O41B 4MNHA 2EDDA 2QEJA 5E99L 3DVIA 4N0CD 4HKXB 5H2BB 1KULA 3HNVH 2CIIA 3GBMH 3LV3B 2W0FA 3PWPA 5A2LH 2BC4A 2G9HA 1A4KB 1KV3A 4NKIH 4R9HA 4HG4K 1UC6A 1C7SA 4S1RH 3VA2C 1CDGA 3VXNA 3PGCA 4R8WH 3MJGX 2HFEA 1Z9SA 3D39D 4GXVL 1CE1L 2Y36L 2EDEA 4WTWA 2IANB 1GOFA 4ZFZB 3TCLA 1IGYB 3NA4A 1A02N 3DTXB 3QRFM 1F4XH 4YDKH 1IM3A 3OKKA 3BPLB 1UQSA 4ZUTB 2ATPA 2HJFA 4GAYB 3DUUA 5DT1L 3L3GB 4O2FA 1PYWA 4Z7QF 5IKCA 3LN4A 2WIIB 1JF5A 1CXEA 4F7EA 2H3NA 1U3HD 2VDQL 2NW3A 1XGYH 4K3GA 4CN4A 5AYUH 4ISVB 2FO1A 1EFXA 4K7FA 3C09C 4HK0B 2DIJA 5GS0H 4UT7L 2EIDA 5HHNA 2W9EL 3KPMA 4ODXA 2ADFH 1D5ZB 4HKJB 1ETZA 1NGPH 3TO4C 4I9WD 6FABL 3TYGL 3BHBA 5K9QI 3QQ4A 4L3ED 3GMPA 3OB0H 1YNLH 5E56A 3P0YH 3RU8L 4EXKA 1YJDC 4E9LA 4P59H 3FJTA 1ADQL 3SKMB 4S0TD 3WUWA 1KBGH 4OV6F 4QXUH 2PW1B 3P4NB 1RUAL 5AAWA 2GK0B 3PDOB 4XVSH 4RAVA 3LZFL 4U49A 2XRAH 4HXAL 5CSZB 3BQUC 3TT3H 4KMTL 43C9B 2DL9A 2UVEA 5JW5B 3BFOA 3JWDH 4BKLA 1KIPA 2HMID 1VFBB 3P4OB 5KG9A 4E41D 3B2UD 3MBXL 5T1DH 1R5WA 3ZYIA 1U8NA 1EHAA 3CK0L 1IE5A 2RB8A 1IARB 3B8YA 1XGUB 2Q76B 3CU7A 4IMKA 4KDWA 1X5ZA 2VLRA 5EDXA 2R0ZH 2XA3A 3EYSL 2VLKB 3NPSC 1VDGA 1L7TH 3MNVB 5ALBL 2C3HA 3VDAA 1F6AB 1HSAA 4GW4B 5CJBA 1I7TB 3C2AL 1CVRA 1MCRA 5DFWH 5MEND 1T2QH 2QQNL 3RZCD 3AUVA 1C16A 4MA7H 4NJAL 5B39B 3IDNB 1BIHA 4CAGA 1IAKB 2ZSVB 2P5EA 4Y1AA 4LCCB 4XMKH 3I6KB 5C09D 1MJUH 1JTPA 1OSZA 1NC2D 1YUHA 4FZ8H 4Y2DD 1RZ8B 1BM3H 4KKLC 2D0FA 1YEJH 4M5ZL 3BXNA 5DJ8A 2DTSA 1IC4H 3CPLB 4OGXH 5C86A 1T0NB 5EZJA 3RDTD 3AREA 4NO2B 3CX5J 2PXYB 4D0BA 1TIUA 4P23D 4LLVB 5J57B 4MNGA 3OPZH 2X4OB 1KCVL 4MYWB 5I19H 2R1WA 2EXWD 5E08H 3L5JA 4ZOAA 1JPST 3RWJB 3EZ8A 2KBGA 1C1EH 4B50A 4QHMB 4JRYA 4LRIC 4OIIH 1FVCA 2G5BA 3MRGA 4YR6B 3HI5H 5CMAA 4NQDE 2NR6D 1FFPA 4A6YL 3ROOB 3PIQB 1GC1H 2Z91B 3EO9H 5ID0B 5HSFA 1BF8A 4IHOB 4KHXH 3VGAB 3LDBB 5I18H 1N59A 4NBYB 1K8IA 3O6LH 4RMVA 1N64H 5DMIL 1I9IH 3Q5YA 3MRDA 2BY1A 4OLXH 4HWBA 3SGEH 3QHZL 4X6FA 4KJQD 1RULL 4EBQH 5FK9A 3OAZH 1HKFA 4U31A 4D9QE 4Y7MA 4X6EA 1AIFA 1FG2A 4U6TA 1NGQL 1T3FA 2BNRB 5E5RB 2GTWB 5A16B 3TPUB 3OGCA 4JFZH 5B4MD 4OZGF 2A77H 5C92A 1XZ0B 1Q94A 3O3DA 4FNLH 1OAYL 2OTWA 3QZWA 1VFMA 3ARFB 4C57C 2XZAL 2A2QT 3DO3A 4UDTB 2WV3A 5IVZA 3T8XB 3TBWA 2RJMA 4XAKE 1I8IB 4V2CB 4K3HA 4RBPK 4WFHD 7FABL 1FV1B 2FH8A 4OD1L 5KW9H 3ZT5A 5KSBB 4WHYG 4KC3B 3DSFH 5ICZB 5FYJH 5MP6H 4GRWH 1T20A 5IB1A 3SDDB 2FZ3B 1P5VA 3GI8H 2BNQE 3N0PB 3VDBA 4HIIA 4Y5XB 4TOYL 3N1PC 4OZFB 4CDHA 4AJ0A 2VIRA 1QBLL 1UB6A 4PJ7F 2EC8A 5LWYH 3IFNH 1B6DA 4M6ML 4PTUA 3ULUH 1EEZB 4Z78A 4LVEA 1IEAB 4KZDL 4OCNC 5ADOH 1JRHI 3UTZA 4G6AC 3O11A 3O3EB 3DI3B 4MD0B 1OOAA 4TNWF 1BVZA 2D7PA 1NMAL 1BFOA 1CS6A 1EO5A 4ZFOA 4P5MB 4R0LA 3BZEA 1DEEB 2P49B 3VMOA 2ZCKL 4TSAH 3QG6A 5KVFH 1H5BC 2XWTB 3H3PL 4PV9B 2ESVE 4YDJA 5HDBF 3SOBL 4F37F 4UUJB 4OFIA 4RRPA 5JUEH 3F6LA 1KN2L 2VUYA 1W72H 3UAJC 1FJ1A 1I7RA 3W9EA 1T04B 5DK2B 2NLJB 5ESAA 3K4DA 1Y6NR 3PHQB 4ERSL 1RIVL 3JVGA 4H26B 4UIKL 2AV1B 3M17A 3DETC 4XPBH 1I3RB 4NQSB 3QG7H 5IWLC 2VQUA 1LMKA 4JFEE 3RRQA 1F8TL 4R7DA 1MJJA 5IHZB 5AZEH 1S7UB 5M7QA 5DJXB 1JGVH 3DVNA 4WNQA 3VXRB 2W0KA 4LSSH 2L4OA 3V6ZA 1I1FA 2OMBA 3AM8A 1HILA 4X6BB 3UJTL 3QNZB 3F7VA 3LPWA 3LEVL 4H1LA 3KJ4C 2FBJL 1J0IA 4QCIA 3B9KD 1Y0LA 4KMQA 1RFDL 3TT1H 1VACB 3O6KH 3TVMC 5F21B 2HN7A 4TTGA 1PKOA 2LU3A 5EC1B 2DQJL 3FQWA 1TVBB 4TULH 2DKUA 1TETL 3A67L 3CDGA 1HYSD 1SYSA 5SX5H 4P9HH 4LLQB 1UT9A 2Y6SC 5C08D 4UILH 5E6IB 3NTCL 4K94H 2GJ6D 3X3GH 4I18B 5FF6A 5EOCH 2RAMA 3HR5A 2BCKB 5D1ZA 1GZQA 3VWJB 2E7HA 8FABA 1KIUA 1N5AB 3TBSA 3WUWG 5BVJA 3NACH 4QNPF 1N5YH 2IFFL 5CBEA 3UTTA 1A6WH 1BFSA 1X4ZA 4JPVH 5TQ2L 3ROLB 4LK4A 5EOQH 4D0DB 1Z3GL 1JZ5A 1PVHA 4WWKA 3HI6L 3STZA 1YMHB 1KC5L 3T1WA 3G5VA 2EDLA 2C3VA 4EVNA 4UTAL 1FVEA 1ZHLA 4P2OA 3MRHB 3V6BR 1CDIA 1KLUB 5CJ5A 5MHSD 4NP4H 3RNKA 3FMGH 3FO9A 4GLRI 1WT5A 4LSQH 4PS4H 2DWDA 5DJCB 5ERWA 5BOPA 4K9EH 4UT6H 1P53A 4BH7A 2CIKA 1U8QA 4JFQB 2ID5A 4Y16B 1ZA6A 2GAZB 4M00A 4RFOL 1D5MA 3RBGA 3RWGB 5KS9A 3I9GH 4RISH 4KDVA 3G6JF 4O58L 3EJYD 3T4YA 1TMCB 3MV9D 3MLSH 4KVNL 4PJEE 1QG3A 3GJEA 1IM9D 1ZA3A 3OG4B 1NH6A 4PRPE 3VXSD 4NO5B 2DLIA 4QYOA 3E2HB 2LAGB 4OZIB 3CUPA 4Z7VF 4ENEC 1X5LA 3AROA 4JHAL 4OBSA 4X0KB 2CR3A 4XWOD 4X5WB 4ZTPL 4OJFL 4NO3A 1FZOA 2IQ9H 2VDLH 2BSED 3VXOB 1JI1A 1U3HB 4ZUSB 1PFCA 4YZFF 2EZ0D 4PJIA 4HWBL 4IOIB 1YZZA 4R7NA 5C0CB 4MXVF 3C60C 3RWEA 3RGHA 5LKNA 2IANE 1UM4L 4IIQA 2W1NA 4NHCH 1JZ8A 1HHIB 3QUZA 1IEBA 1QYGH 4QTIL 5D5MB 4K7PL 4IRSB 5ECJE 3LIZH 4HUUA 5I30H 5CILH 4YBLB 1J1XH 5HHME 1S7XB 4ZQKB 2Y06L 3WFCL 4E42B 4HUWA 1QFPA 1GPOH 5E2WL 2DS4A 4WENB 3KR3L 3WS3B 1KCRH 2YUXA 1DQQA 5B38A 4UT9L 1ZANH 4Q6IA 4WCYH 1P4LA 3IKCA 4NBXB 2IH1A 2I5YH 3S4SA 1AGBA 4LQ1A 1P7KB 5TE6L 2F9BT 1KG0B 2GUOA 3ALWA 2CUIA 1OGAD 1DBKH 3CLFH 3KPLA 5K33A 2X4RB 4PB9L 4XI5C 3D0LA 2CGRH 1TPXB 3L95B 3HC0B 4ZUVB 2DYPB 1AXSA 4S10A 5J13B 1T4KB 1P6AB 4MJ2A 1YEHL 4WO4C 3IYLW 3MLTA 1XFPA 2IMNA 4L5FH 5MENB 1MQKL 3GHEH 2VE6A 5C71A 1Q9KB 2HTKC 3PV6A 4ZFOL 5B3NA 4CU8A 4YHML 2IAMC 5I1GH 4BSVA 4PP2B 5SWQB 4OLZH 3RWDB 4PRHD 3BQUD 4OIBA 1OWRM 3IFOB 1P4BH 3O0RH 2Q7NA 2FR4A 3EDJA 3NA9H 3RWIB 5EOTA 4XCFH 2EDXA 3O3AA 1B0WA 1KIQA 4X6CF 3KS0J 4BFEA 5F44A 3ZSTA 1UWXH 1FYTD 1VADB 2EDKA 2Q6WA 4OKVB 4NOFA 2J6EA 4Z7WB 5INDB 4LSVL 3FO2B 3IAPA 2BOCA 1MLCB 3KNBA 2Y7QA 2HWZH 3QDAA 1XF5B 4DGVH 5ADPH 3R8QA 2IPTH 5EO9A 4ODTH 3BGMB 1OAUH 1KJ3H 4RRPG 2P48B 2MJWA 1QEWA 5EO1A 2EDJA 5FO8B 4XMLL 3FQNA 2YPVL 4FS0A 4KPHH 4NPYA 5KSAA 3C8KA 4JPWL 5EU3A 3QNYB 5I1AB 2EDWA 2NY6B 4L4JA 4WW1B 4QF1A 3OZ9H 3WE6A 2X1XR 3O9WC 5DS8B 4KKLD 1ZMYA 1GOHA 2MHAA 5MI0C 3SO3C 1YNKL 1J8HB 3I6GB 1AHWA 4WI3A 3RKPA 1CFTB 2VLJB 2DM7A 4GRLC 5D72L 2DOCA 3GMLA 3AS2A 4H1LG 3RL1A 1RURL 4MDIB 4CVZA 5HGAA 1XR9B 2AEQH 2OP4H 5DMGC 4PJXF 1ORSB 3VXQB 5ISZB 4HIHB 4DJMA 1WF5A 3U83A 1YYML 2CLVA 2B4CC 1A7PH 2ZUWA 3OKYA 1AGEA 2V9RA 3CVHA 4NKMA 3QNXB 4U1SA 1ZK9A 4HJGB 5ILTL 2BNRE 1TJGH 1I75A 4JFOA 2F53A 4ZO9A 3EYFB 3ELAT 3QFJE 1D9KA 4G8IB 3CFCH 2KQNA 4Q7DA 2CKNA 2R0LL 1FPTH 5FYLH 2FGWH 1I85C 2AI0L 1CGWA 1A1MA 1D5IH 4G5ZH 1A21A 2D2OA 9CGTA 4QRTA 4PJBB 5KSBE 4NDMA 2GT9B 4AM0A 1P7QD 3AAZA 1S7QB 3SGDH 3MOAL 1IGMH 5TFSH 3FHQA 4F9LC 4BH8B 1W0YT 1XGTA 2AK4D 3MREA 4JKPL 2RIKA 2V5MA 3L3IB 3VH8G 5I1HH 1T1XB 2VISA 2DL2A 4HFWB 1IAOB 1N2RB 1FORH 5DRZB 3GI9H 1H0DA 2FYYA 2ZG2A 4MQSB 4RMQA 1P1ZA 4U1HB 5IHUH 4HUVB 4XCYA 1NAKH 3DOSA 1V5JA 3KHQA 3LKNA 4FQXB 3N1QC 1JGEA 4WU5A 5E5UB 4OFKA 4P2QB 1PKQB 3JWOH 3HZYB 2BJML 1QSVA 3P9WB 4LKXB 4G6MH 5IMKA 3KLAB 3U9PL 4F8QA 4R6UA 3IDJB 4WUKH 3FB5B 3NIGF 1LD9B 4G6AD 3SPVB 4GRMB 2QSTA 3TBTA 4I0PA 1RZJL 1LEIA 5C2BL 3IDYB 3OKMB 5IVXB 3PWUB 1SJVA 2AEPH 3G5ZB 3U0WL 1NFDE 3T0EB 4JG1L 4A6YB 4PJ5D 2BNUA 2NTSP 1KELH 5BXFB 1G0YR 4EDWL 4EIZC 1HQ4B 1ZLVK 1JN6A 1GVIA 3U48A 3JXAA 2X05A 2Q3ZA 4K07A 1T1ZA 3SEPA 4LEXH 3UAJD 2X6MA 5DQ9A 4LFHD 1ZLWK 4I48B 3LHPH 3VXRE 3CAFA 3ULVE 4NNPL 4Q9QH 2P46B 5EIVA 2JJSA 2ZP0T 1BD2D 1F3DH 3HC4H 3DETD 1MVUA 4WGWB 3ZYJA 1AY1H 3MO1A 4Y4KB 2D3VA 3MV7D 1OP9A 3KPRA 1NC4D 1DQDH 3V9FA 1A3LL 2KH2B 1KPUB 3JTSA 3S6CA 3LKRA 4YE4H 1WBZB 3ARXA 3WFBH 4JZJC 1WUNT 3W39B 3O2DA 5B38G 1NDMA 1P9MC 2UWEA 1KTDA 2J6EH 4HGMA 4PRAA 4DK3A 4WY7H 4JDTL 4JVWA 1A1OA 2Y5TA 3TVMD 3P0VL 3KLDA 3S4SG 1AJ7L 1ES0A 1G7IB 1K3ZA 2GITA 1PZ5B 3QWOA 1B6UA 5IJKA 2L7JA 3BN9C 4LIQH 1MLBB 1OARH 1JPGB 5BCAA 2Y6SD 5GSRB 2Y23A 5DA0B 3ZHLA 4ONGH 3TA3B 2FL5B 3JV6A 3DIFB 1MREH 4ZOEA 1HIML 4H88L 4PR5A 3T3PE 3SJVD 2DLGA 4ODBD 5JHDD 2VDPH 4RWYH 5DUBB 5T33H 1MCHA 1MHCA 4OB5H 2VTFA 2XZQH 5KVDL 1FGVL 3VXPA 1TVDA 1TXKA 3PHOB 4MNHB 5AG9A 5D70L 5I71B 4NM4H 1MAML 1SBSL 3PWPB 2W0FB 3FAXA 2G9HB 1BECA 4JM2F 4FQHA 3VXNB 2W9DL 3PGCB 1QRND 2YUVA 4JHWH 2HFEB 3B9VA 2Z8VC 1J9CT 4YHZL 3HR6A 1F3JA 2CDFA 4ZD3L 3NCBB 4M02A 3TCLB 1A5FL 4ODUB 4F57H 1DLHA 1X5HA 4HHAA 4KFZC 4UIMB 4WFGE 1V7MH 5HTSA 5C07D 4FXGA 4MJID 4P4RA 2W0PA 1IM3B 3OKKB 2NX5D 3HC3L 1UQSB 1MFCL 1ACZA 2HJFB 3C5SA 3DUUB 3QDGD 4O2FB 3HAEH 1PYWB 2P7TA 5IKCB 2NNAA 3FRPA 3LN4B 5DK3A 5BQ7A 2BRRL 2H3NB 3IFPA 5F96H 5FO9A 4OZIE 4JANA 2NW3B 5E9DA 5F7NC 5TDPA 4Z0BL 1PZUB 4JE4B 5GS2H 4GQ9L 1EFXB 2FATH 1V3MA 4RGNB 4PUBL 2EDRA 4G6KH 3HUJA 5HHNB 1CT8A 4ODXB 1SY6A 1ETZB 3V6OC 3MRJA 3SO5A 3BP5A 1MFDH 3BHBB 1U92B 4OCWH 4UTBH 3QQ4B 5D93B 1MI5A 3GGWA 2CRYA 5EWIH 5GJSH 3X12A 4ENED 4S11A 4N90E 4GKZA 5C0CE 2MFNA 1MFBH 5EUOA 3X3FH 1KB5A 1LO2H 1K6QL 1LEGA 3CVHL 3IRZA 1ACYL 5D5ME 3LS5L 1NBVL 3OG6B 5IQ9A 3UDWA 1VFOA 1KPRA 2YMXH 4RAVB 5T5NF 3V7AE 3WJJC 2EDBA 4Q9RH 4UB0H 1QLFA 1N0XH 3OHXA 1CVSC 2KL6A 2FHBA 1BJ1J 2OX5A 3C60D 4OLVH 3VJ6B 4BKLB 2DQEH 1KIPB 5I1KL 3STBA 5KG9B 1E6OH 1KPVB 1XGQB 3BP4A 1R5WB 2R8SL 3FQUB 1U8NB 3UTOA 5LAXA 1MIEH 4Y2OA 3SDAC 1FNSL 2B4CL 3RGVA 5DUMH 1FGNH 4LLMB 2WQ8A 1F00I 4LSPH 4Y5VC 3REWA 2HP4A 4NN6C 5JMRA 1VERA 3BI9X 4PRBA 3PUCA 2AJUL 4EKXA 4TQEH 3LKPA 5D2LF 1OP3H 3V4PL 3H9SD 1KUMA 3F7YA 2F8VA 1C16B 2VXTH 1QFOA 5F7HA 3S3SA 4L8SA 4Y1AB 2E5EA 1F5WA 4YH6A 5TJWK 2YD5A 4EN3C 5GS0C 2XTLA 1YUHB 3LY6A 5JPMA 2BZDA 4YJZL 2VR5A 1NFIA 4U1GB 5CLWA 5MENE 3BXNB 4XI5D 5DJ8B 1YMMD 5DLML 5F6HJ 3RWHA 4AMKL 3QXTA 5EZJB 5SX4I 3O3UN 1HZHL 1YN7A 3AREB 5E2JA 1U9KA 3AXLA 1JFQL 1NCCL 4P3WA 5D7KE 4MNGB 4HH8A 1CR9H 4WO4D 2CUHA 3PV7A 1IBGH 1OAQL 4FZEH 4JRYB 4XVJH 3TPKA 1FVCB 2G5BB 3MRGB 4Y4HA 1NCAL 1XCTA 2HTKD 4ZUUA 1FRGL 4Z7WE 5CMAB 4BFGA 5CEXA 2CLRB 2YPLD 3MFGB 5BO1L 1G9ML 4V1DD 1F02I 1N59B 3JWDC 2DMCA 5F3BA 1FNAA 4NN5B 3I02A 2JTDA 4JO4L 1G7LA 3TWCH 3HHRB 3MRDB 3RUGB 5DEFA 4H25A 4WHTB 5JW4R 1PEZA 3OMZA 5FK9B 4JPKH 1U3JA 4X6EB 5I8CA 3MUY1 3QCTL 1FG2B 1K8DA 3SQOH 5BVPL 4U3XA 1T3FB 4TNVK 5KAQF 2MPAH 3PWLA 3OGCB 4G6FD 1ZVSA 3QH3A 3O3DB 3QIUC 3O3BA 4KUCD 1OD9A 4YLQT 1YEEL 2ITDB 4M7LH 3TJEL 2OTWB 3QZWB 1J8HE 5FYJU 5I8KH 5DURB 4PG9A 2VLJE 5IVZB 3TBWB 1W0VA 5BMFL 3O2DL 3FHAA 5J11B 3SY0A 3L5XL 2BDNL 2Q8BH 1FG9C 3TN0C 2C3GA 1LE9A 5TQ0H 4FP8L 4X7DC 4ZFGH 5ISZE 5IB1B 4PGCA 1Z0MA 3JUYA 5H35A 4HIIB 2VN7A 2X4QA 3OF6A 4L1DA 1A7RL 1WBYA 1UB6B 2JJTA 1NGYA 3FO0L 3LQZA 5J9PA 1BGXH 4KQ4L 4M1DH 4PTUB 5TE7H 4Z78B 5DMGD 3QQNA 1IAIL 5C0JB 1Q8MA 3VFWA 1WEJH 1GC1C 5SWSA 3O11B 4KY1L 1NBZA 1IVLA 4BK5A 3QA3A 5KSVA 2C4FU 2HJLA 4PRID 3Q2CA 1BFOB 3QDHA 4ZFOB 4X5LA 1TVHA 4R0LB 4L8CA 4FFYH 4FQ2H 3BZEB 1EUTA 4HCRA 5J0BA 2ZUSA 5BW7A 1U8KA 3QG6B 4YX2H 3VXMA 4YDJB 1T7ZA 1BMGA 5DRWA 1A6TA 3F58H 1PY9A 4X8XA 3RTQC 2Z8WC 1FJ1B 1I7RB 4HW6A 3W9EB 4Q97A 1WWCA 2XTJB 3FN0H 5F7EL 4IMLA 1JGUH 4P2RA 4I77H 5LCVL 4GOSA 1GHFH 4XHQA 3GMRA 1A6UH 5I9QB 3M17B 3QCVH 1LO3L 1HNGA 3S35H 4R7DB 5A43C 1MJJB 5FCUH 4H8WH 2MQ0A 1G9NL 4WNQB 1PKQE 1KCUH 5D2NA 2VXSL 3S96B 4KV5F 3V6ZB 4KQ3L 3MR9A 1HHKA 5IMOA 1SY6L 3F7VB 4FTVB 4K7PX 4H1LB 5EG6C 3QBTB 3SE3A 3HNSH 4QCIB 1Y0LB 3FRPG 5CIPH 1HCFX 5EIQA 5IVXE 3OAYK 2HN7B 4NRZA 3T2OA 1HH6A 3S7GA 3T0EE 1T89A 4HBQA 3DO7B 1KFAH 5CBAA 5JXED 3CDGB 1SYSB 1ZS8B 1FAIL 4IDJH 1WAAA 3N85H 4OQ1A 5D6DC 4OZGA 1DDHA 5ETUA 4PJEF 5IP4A 2IGFL 3L7FA 3VWKA 2AP2A 1R0AH 3HR5B 2WUCH 5D1ZB 5IHBA 3OBAA 8FABB 4LOUD 4N0UA 4MXWL 1FFRA 5BJTA 5BVJB 5C6PB 4J6RL 1S7RB 5CBEB 5DHVA 3FT4B 4MAUH 1JNLH 4PLKC 4NC1C 3UTTB 5TE4H 3ULSA 4YPGB 4RMTA 3PL6B 4QOKD 2YKLL 3KYMA 3EYQC 1AE6L 4WWKB 3STZB 4JY5L 4PJ7A 2C3VB 3QPQC 4EVNB 1ZHLB 4P2OB 1E27A 2UZIH 2X9WA 5JHDB 4XPTH 5F7YC 3RNKB 3CSGA 1T6VN 3FO9B 2XY1A 2DWDB 5I15L 4NUJA 3HNVL 1YN6A 4GJTB 2R4SL 3HRPA 5ERWB 4NC0B 4C54A 4NKIL 4HKZA 4BH7B 5DC4B 2CIKB 3D2UA 1U8QB 4MD4A 2PKDA 3S3JA 1KN4H 1ZA6B 3EGSA 1D5MB 3QO1A 4DFHA 3FB6A 5KS9B 1FNFA 2NXYD 1S9VA 3T4YB 5CS7A 3O2VL 3NH7H 4I3GA 2EIZA 3WIIL 3GJEB 1ZA3B 3DJ9A 4Q0XH 4GKSA 2NPLX 1BX2A 3BN9D 4QYOB 5CGTA 3BKML 1AGFA 4OFYA 3ISWA 3TESA 3CUPB 3JBG7 4P9HC 4CDGC 3BEVA 2ARJA 2CH8A 4L4VA 4K94C 4KJWC 1KNOB 4NO3B 1FZOB 2F15A 1LNUA 3PWPE 4MMXC 4OGAC 4K7PY 5T5FL 4PJIB 1JNJA 3HE7A 2B5IC 3GJFA 3P0YL 4ZOBA 4HPYH 3DROA 3QWQB 3P2TA 4R7NB 2YEZA 1VGKB 1CQYA 3RWEB 3GSNA 1LK3H 1KBGL 4IIQB 4KTEH 4FABH 3QUZB 1IEBB 1OLZA 2QHRL 4BK4A 4J8RB 3Q5TA 4XVSL 5J89A 1DBAL 4HUUB 2XRAL 2FB4L 5F3HA 3MROA 3D5OF 1CFBA 2DQFA 4HUWB 1UJ3A 4UAOC 4Y88A 1PBYA 3JWDL 1G6VK 5EBLA 4O2CA 1X3DA 1S78C 3N06B 4RGNE 5HYJD 1N7ML 3EFDL 5I1IL 1U0QA 1DQQB 5B38B 3MUZ1 4JHZA 4K9EC 1Q0XH 4Q6IB 5F6IC 3IKCB 2IH1B 3MLRL 2LVCA 2VC2H 2APFA 4HUKB 3S4SB 3L6FA 3OV6A 3WIHH 1L7TL 4PJ9A 3VFRB 2GUOB 1O0VA 5D7JA 5A2KH 3CH8A 3DX6B 4YO0A 3KPLB 5ITFB 3CXDH 3NN8A 3D0LB 4NT6A 1K4DA 1G7PA 3HMXH 3RVXC 3S34L 1AXSB 3RY4A 1INQA 2C1OA 2GTZA 3NVQA 2BSTB 4ZG1A 1YEJL 2IF7A 2VE6B 3OJMB 4OGXL 3R1GH 4ZXBC 1AH1A 5HDOA 4HCRL 1T1WA 2H1PH 2FR4B 1UWGH 2EYSA 5LQBL 5EOTB 1M71B 3O3AB 3EJJX 1KIQB 1CL7H 5IROA 2ADIA 3VFOA 4PP1C 3GHBH 2Q6WB 5JTWA 3AU1A 2DIAA 3FT3A 3SDAD 3WD5H 3G6JA 3CFDA 2P45B 2BOCB 4KXZI 5GXBB 3KNBB 2Y7QB 4KHXL 1QSFA 3QO0A 4Y19D 2VQTA 1EGJH 2DKSA 3F5WA 5EO9B 3O6LL 3ZTNH 4Y1AE 1WBXA 4M43H 5KVGH 2QADB 1HHGA 3BDYH 3D25A 2UYLA 5E2VH 4U6VL 1QEWB 3CVIL 3FOMA 4GFTB 2R9HC 3NOIA 3QDMD 4OTXH 3FQNB 4O51A 2NTFA 5KSAB 3C8KB 1MUJA 5LGJA 5EU3B 5GSVA 3QI9A 3K8LA 3V0WH 1MCWM 3I6LD 2HFFA 3TCXA 3GSQA 4MNGE 4QF1B 4PTTA 3DPBA 4EN3D 5EU4B 5GS0D 1EVTC 4R90H 5KSBF 3KHOA 4JRYE 2W38A 4Q9CA 2J12B 2HFGH 2DI7A 3QDJA 4XPFL 5DD5L 4NQVA 1M05B 1AHWB 1QA9A 2H9GA 1FIGH 2K9UA 3GMLB 1DJSA 3JVGC 1MCKA 1GXEA 3VFNA 4CVZB 2AQ3A 4M9PA 1INEH 5HGAB 4XC1H 1ZVHA 3RUGE 5EZOH 4HWZA 1HI6A 2CLVB 5AG8A 4K2UH 3K80A 3CVHB 4NKMB 4U1SB 3AM8C 2G75A 5HYQA 1HOCA 4GAGH 3ULUL 4JFOB 5I6XB 4HEME 4BQ6A 1YEFH 1D9KB 2O5XL 1F2QA 4OZ4A 1MEXH 2BVOA 4XAWL 3S37L 3N50A 1NFDF 1ND0A 5E95B 4PD4K 1A1MB 1OD7A 4JY6A 1CFQA 5GJTL 3H42L 5HXMA 4XH2A 3QIUD 4QRTB 2WWKO 4R26H 4NDMB 4JPIA 3VFPA 4AM0B 4OFVA 2DLTA 3PABA 2F54A 5JQ6L 1XGTB 2HYMA 3MREB 4WEBH 3DVGA 5CZKA 1HKLL 2VDML 1OM3L 3TN0D 4YHLL 3ULVF 5FB8A 1FCCA 2VISB 3AB0B 2IQAA 4CKVX 4OM0H 5IBUG 2FYYB 1ERNA 2EYTA 1FSKB 4GW1A 3C6LA 4TUJA 1CU4H 4C59B 1P1ZB 3QG7L 1RZ7H 3VD3A 4WU5B 3LKNB 3GEWB 2YS4A 5F1NA 5AZEL 1X5KA 1JGVL 1JCKA 2V2XA 4ZUWA 3UCRA 1E4XL 1O7SA 4M7KH 3NAAL 4JG0H 1SM3H 2V5SA 3OJVC 1S5HA 3TBTB 3NFNB 4I0PB 1A4JA 3O6FC 2OSLA 1P4IL 1EJOH 1CDYA 3H9ZA 4YWGH 1LEIB 5TF1L 2AAVA 2E7BA 4MXQC 2N7AA 5IV2A 1UCBL 3FT2A 4NNXA 1S9WA 1B0GB 4GBXA 3GSNL 2XTJE 3NCCB 1JNHA 3MA9L 2BNUB 5C0NC 4TULL 2JB6A 3LPGA 5DJ6A 1JN6B 3WDIA 1F11A 3M45A 4M1GL 4BSJA 1T1ZB 1HSBA 3T3PF 5EU6A 5DQ9B 3VMNA 2FGZA 5A1AA 5JDJA 4CNIA 1WIUA 3JWNC 3K2UL 2Z92A 4WV1C 1CK0L 5GGTA 4E0RA 4FTVE 3BPNB 2V5YA 3MO1B 1A6WL 4NOBA 2O5ZL 3KPRB 4JPVL 2OZ4A 3JTSB 2IG2H 4LRNL 5CAYB 4YHOH 4XNZB 1EXUA 5JMOC 5J06A 4QTHA 1A3RH 1FHGA 4KRPD 4R96A 2NY7L 5FYJD 4UINL 3E8UH 3VW3H 2QQQA 4Z77A 1A47A 1NDMB 2UWEB 1KTDB 2AXGA 4PGDB 4DZ8A 1A1OB 1U91A 2Y5TB 5TDNA 1CICD 5CJXA 1ES0B 3JWOC 3ULUD 2P4AB 2GITB 5HYFA 1K9TA 4UT6L 3QWOB 5DJYA 4PJHA 1YEGL 3CZFA 1DN2A 1CGYA 4WI4A 3JV6B 2WWMC 4KK9C 4PR5B 1P6FA 4NFBA 3VGFA 4KKAC 25C8H 4G8FA 2YK1L 1E0OB 3BKCH 3A6BH 1VPOH 1MHCB 2NXYB 4PLKD 4F33A 3QIWA 5JHDE 2ZSWA 2FX8L 5JO5A 4WUUA 1X5GA 3WN5A 4M93B 2UVFA 3EYQD 2VDLL 1CQKA 4ODSL 3MLPA 4JN1L 4UDUA 2JIXD 3TBYA 4FQHB 2QQKL 4X9FA 4QXWA 4EQ3A 1NUGA 2D4FA 4HQQL 3IJSB 1ZEAH 2IPKB 4R3SA 3U7YH 1DVFA 1F3JB 1UVQA 2CDFB 3KJ6L 3DURA 1R5VA 5KS9E 2R56L 5H37H 1DLHB 4HHAB 5FDWA 2GCYA 1QYGL 4Y8AA 4FXGB 4I4WA 3WNPA 3D69B 1HQRB 4P4RB 3LIZL 4P9ML 5CILL 2ZG1A 1DSFH 3C5SB 1G7JA 2DTML 2P7TB 2NNAB 5BQ7B 3IFPB 5FO9B 4JANB 5TDPB 1XIWC 2UV3A 3N1MC 5KVMC 2RCSL 5CD3A 2VWEC 3ALXA 2VLRD 3VGBA 3HUJB 1CT8B 2C3XA 1HYRC 2VXVH 5B8CC 3MRJB 3BP5B 2ARJQ 1ZANL 4DKAA 4WCYL 1H8OA 1TENA 4PJIE 2I5YL 1EO8L 4UBDC 1B88A 1MI5B 3GGWB 5DJ0A 3PP3K 4GKZB 3R06A 4KJWD 1A3QA 1KB5B 2UUDH 1X7QA 1LEGB 1ED3A 2P8MA 5ENWA 2XKUA 3W2DL 4DEPC 2XG4A 4M8VA 5JW4N 5MEOA 4OGAD 5IQ9B 4JR9L 1KPRB 1CBVL 1MRDH 1QBBA 3INUH 3DV4A 1JE6A 4NQTA 1QLFB 5GGRY 3SKNA 3OHXB 4EI5A 3AGVA 3DMMA 5IW1A 1FYHB 4M6OH 5CINL 4LCWA 4R97C 4L5FL 3BP4B 5F72S 2Y4SA 4Z7WF 3IRPX 1IL1A 4HS6A 5LAXB 5DR5H 4MJ5A 2HKHH 3RGVB 3O0RL 3V6FA 1ZGLM 1EHLH 3REWB 3D85D 3QEQA 4XCFL 2P5WD 4YXKH 5LJYH 1S78D 1CLOH 4XMPL 1P84K 5T1KA 4PRBB 2DB8A 2MSPA 5HVHC 3BESR 3LKPB 4ONOA 1H9VA 6CGTA 4TNVF 1QZ1A 1IC7L 2I9TA 4L9DA 12E8H 3FFCD 3F7YB 2HWZL 5ADPL 1CG9A 3ARBC 5FYKL 1WCBA 1KJ3L 3H2WA 3S5LA 1VKXA 2VOTA 2OXHA 1NFIB 1MJ7H 5GS3A 3IXTA 3LEYL 2Q8AL 4FFWC 3SKJL 1YN7B 4N5EC 5EU5B 4OT1H 2EE3A 4WW2C 2CQVA 2DQCH 4FQ1H 1YY9C 3EOYG 5DD3L 3OZ9L 3EO0A 1RD6A 5JORA 1FDLL 3ABZA 4F7CA 1FC1A 4G7YL 4Y4HB 4ZXBD 1XCTB 5FHAH 1W8NA 2GY7B 2VXUL 4B0MM 3QUMH 1FZMA 5CEXB 2X7LA 4NJ9H 1EMTH 3QUKA 2VDKH 4YQXL 4IOFC 1CE6A 4NCC2 1NAMH 5D1XA 1I1RA 5F3BB 3Q0HA 3I02B 4PP1D 2AEQL 1PAMA 1CXFA 4H25B 3QYCA 1PW3A 1IGIL 4NN7B 2YD2A 1O7VA 1PG7W 5I8CB 5GGTL 5HJ3A 4YXHH 1PG7L 1KB9J 3QT2A 4YFLF 1TJGL 4FFZH 4M62H 4AEHL 1CFNA 1CTNA 3PWLB 1MCDA 1ZVSB 1QO3A 3QH3B 2R9HD 3CFBB 1DL7L 3O3BB 3ZO0A 5BRZA 2OR9H 5ESVA 4J7RA 1W0VB 4U1NA 3UJIH 5HPOA 4XP4L 3SY0B 1IGFH 4GH7B 4HF5L 5ITBH 1NL0H 4Y4FA 5F7KC 3LD8C 1IGML 4QHKI 5TFSL 4PGCB 2X4QB 1UH2A 1KB9K 4ELKA 1NGYB 3LQZB 3MLUH 4FQIH 3SDXA 1U8PB 5F9DC 5J9PB 2EE9A 5I1HL 3KGRA 1EIBA 2AXJA 4P5KA 1FORL 3RPIA 1WTLA 2OI9C 1MWAH 4AZ8A 3N1FC 3VFWB 5IHUL 5SWSB 4JRWA 5FV1L 3OQ3B 1EEQA 4M5YH 5IVXF 3QA3B 1CFVH 3BH8A 5D2LA 2HJLB 5DVKA 2D0GA 1TVHB 4L8CB 1MNUL 3L5HA 5KJRH 1U8KB 1J0JA 4RMRA 4ELMF 4M8QA 3VXMB 4HJJL 1AI1H 1ORQA 5DRWB 3EOAA 1FO0H 5L2JA 1A6TB 1XF4A 3QUXA 2R69H 3MXWH 2H8PA 1ZGLB 4RGMC 3R4DA 2E6QA 3NCJH 5GRUL 1YQ2A 4P2RB 1NSNL 3IETA 1QNZH 4PJ8A 3PGFL 3MV11 3NABL 1BVLA 3QWRA 5I73B 1OWWA 4OD2B 5HGDA 2FDBP 1BJ8A 2BNQA 3BPOB 4UV7H 3B8SA 4CL7A 5SWZA 2DWEA 3QHFH 2EH7H 5D2NB 1EK3A 1C5BL 2ZNWA 3HC4L 3RY6C 1HHKB 5IMOB 1EEYA 2LU7A 1AY1L 1QPPA 2VH5H 4GMTL 3UYRL 2AEIT 2OL3H 2YZ1A 4J1UB 3RJQB 3WBDA 3OKLA 3BMWA 4CGTA 3ARGC 4NQCA 3MRBA 5CLTA 2X4NA 4RDQF 4NRZB 4TVPL 1HH6B 1J10A 1CF8H 2VZTA 1MRCH 2EEBA 2VDRL 4HIJB 3WFBL 5CBAB 4S1QH 3HPLA 1B4JL 3IFLH 4U6HB 4BM7A 3O6FD 5JA8B 1NCDL 4MXQD 1F90L 4P46A 5D7LD 1MRFH 1DDHB 5ETUB 2HLAA 3L7FB 3VWKB 3HMWL 4JQVA 4OCMC 3KPSA 5C0ND 5FIEA 2APBA 4WRLA 2LU4A 1L6XA 2HVKA 4N0UB 1OARL 5A3IC 5BJTB 2J5LC 3DNKA 1CICB 3C8DA 5DHVB 5E2UL 1XH3A 4ONGL 4BZ2L 3V5KA 3GIZL 1PLGH 4LU5H 5FYLD 3MRFA 2C9AA 5GISL 1LE5B 1J5OL 4KI5E 3KYMB 5CP7A 3MNZA 3C5JA 5MEQA 4QHNA 4MCZA 2ATKA 3WLBA 4OB5L 5J1AA 4YXLH 2XZQL 3DYMA 1AR1D 5DWUL 4PJ7B 5JW4Q 3BRGC 1T0MA 2WNGA 2UWEE 3U79A 4IRJA 4MD5A 4NM4L 3VXTA 4H8WC 4NUJB 4AG4L 1YN6B 5IBUB 3MACH 4CJ0A 1RZFH 4HKZB 5C0IB 1UENA 3GKWL 3D2UB 4JHWL 4MD4B 5C3LD 3NFSL 1MHPL 5EFIA 4O02H 4LLYA 3U6RA 3EGSB 1UGNA 3QO1B 3FB6B 4BFIA 2Q7YB 4F57L 1S9VB 2JIXB 1N6QL 2A6KA 5I17B 2EIZB 3MA7A 4M6NL 3VU2A 5GPRA 4Q2ZA 2JB5L 1BX2B 4W81A 2Y07H 4LHUA 3WFDH 3Q6GL 1AGFB 3IT8D 2EO9A 3S5LG 1GAFH 3LRGA 4DGYH 1MAJA 3P11L 3U1SL 3BEVB 1A7OH 3V5DB 2XXCB 5EH1A 5IQ7L 3IDXL 2WWMD 2ADJB 4MCYA 5T1LD 1A7NH 4G6KL 1NCUA 4KK9D 4L4VB 3BJLA 4KKAD 1ZOXA 3ARDC 1KENH 3SGEI 2DI9A 1LNUB 5T3ZL 3S36H 4FQCL 1KEGL 4OCWL 4UTBL 4L8SC 5HHOD 1FAKT 3BPCA 3HE7B 4NGHL 4KI1A 3DROB 2YEZB 2AKRA 5D9SA 5I1CL 3GSNB 3X3FL 2HAZA 43CAA 2L0DA 1XCQA 2YMXL 4MLIA 5IGXH 3ZDYE 2CDEB 2PN5A 5F3HB 1RUPH 3MROB 4P4KA 1FL6A 5FO7A 2DQFB 1UJ3B 1FE8H 2MQ3A 4OLVL 3I3DA 4FXLA 5GGVH 1A6VL 4BQ9A 4OFDA 4NRYB 1ZLUH 5EBLB 1RV6X 4O2CB 4CU7A 3SGKC 1E6OL 1IT9H 4YDVB 1YJDH 3HUJE 4OQTA 5IK3A 3CSBA 4NZJA 4Z8FH 4OCRH 4OD3H 4XRCA 4QRRA 1YQVH 4LSPL 1RUMH 1GGCH 4PRPA 1XIWD 3ZE1E 3L6FB 4QHKJ 4X9BA 1MI5E 2PO6C 1PY4A 4PJ9B 4APQA 3ZKXC 5D7JB 1M4KA 4U0RC 4YO0B 4TRPL 3G5XA 5IFJA 5F9WC 2BVYA 3NN8B 3TZVA 1PD6A 3I3EA 1DBBH 4HSQA 4OLUL 4UBDD 1K4DB 3IU3A 2VXTL 4ZAKA 2NY4C 3ES6A 1UM5H 1T7VA 1VEPA 5C0RH 1INQB 2C1OB 2GTZB 3I50L 1NMCB 5A40E 4X4ZA 5D7IA 1MCSA 2JCCB 3DUSA 4YC2B 4ZFZA 5DVMA 1PQZA 5ABDE 4N1CA 3UPAA 1NEZG 1T1WB 2X10A 1VGEH 2EYSB 2QSQA 3L3GA 1IBGL 1OLLA 2VRAA 1DQLH 4PGZA 2ADIB 3RIFK 3RUGF 4ISVA 1UXWA 3FT3B 2X9YA 3CFDB 4PLJC 5FFLA 1QSFB 1JVKA 3QO0B 4CMMA 4ZS7H 3F5WB 4XP5H 2F58H 4JFDB 4GSDL 1HHGB 2AJVH 3D25B 2AVGA 4JRXD 2UYLB 1EA9C 2L7UA 3FOMB 4KDTA 4LSRL 2Z31C 4O51B 3O8XA 2NXZC 2NTFB 1MUJB 2DRUA 3QRGL 5GSVB 1MOEA 4U7MA 3QI9B 2PYEA 5DC0A 3SQOL 1MPAL 2GK0A 2HFFB 3ARBD 5GS2D 2CRMA 3GSQB 2CJUH 5BW7C 4LLAA 4D2NA 1NLDH 5CSZA 1W2KT 1WFOA 3CMOH 2E9JA 1ZLSH 5JW5A 3QDJB 3VFGL 2QKIA 4FFWD 4N5ED 4U1IA 2GHWB 3MLYL 4JFXA 1YY9D 3BMVA 4LVNC 1AKJB 1QA9B 2H9GB 1CGVA 3EW3B 3O2WL 3GB7A 5L2KA 4B41A 1T5XB 3MLWH 2LTQC 1RIUL 3KPQA 5TQ0L 5I73C 5CEYA 4ZFGL 3MCG1 4HWZB 1F6AA 1HI6B 4IOFD 2AS5M 2HA1A 1RZKH 3F12A 2NY2B 5KAQG 3LH2L 3OAUH 4RX4A 2KPNA 5F89A 1UFUA 3B9EA 4HC1A 4OF6A 1HOCB 1RUKL 1XR8A 5JOPE 3W11C 1DBML 3MRLA 4G7VH 1H3PL 4GS7B 4XBGA 4KAQL 1KTKE 2BVOB 4YHPA 1L7IL 1I8LA 3J7HA 4M61A 1ND0B 3QUYA 4JY6B 1CFQB 4LLVA 4FFYL 4G8GD 2X4OA 4XH2B 4HIXH 4JPIB 2XOTA 3VFPB 1XGRA 4YX2L 3PABB 4N0YH 2CO6B 4QHMA 2F54B 5F88A 4YR6A 3G6AB 3TF7C 1IGCH 5C0BA 2X09A 5JHLH 1RQ5A 3DVGB 3ROOA 2E8YA 1MCPH 3PIQA 3UXFA 4YIQA 5F7WC 5FB8B 1ZTXH 2ZZUT 4BSWA 1YEDB 3QAZB 4I3RL 4JQXC 2IQAB 4XBEL 1UEYA 4MAYC 2EYTB 1A6UL 4CVUA 4ZNCD 3C6LB 1UXSB 4TUJB 1U3ZA 3UBXI 2X4PA 3BUYA 5SWSE 3VG9B 3MRKA 4J3OC 5F1NB 5HHXL 1F4WH 1EHXA 1KCUL 5DF0A 2V2XB 5ACLA 4ZUWB 1YPZF 5F7MC 1R3KA 1IEHA 4EQ2A 1F6FB 4OUUB 3QULA 4S0SD 4UU9A 3O4OC 1MF2H 3BZDA 3VXME 1S5HB 3QFJA 5HGBB 1RJZA 3WNNA 2MCPH 3H8NA 4LHUG 1A4JB 2OSLB 1UZ8A 1RVFH 3ZKQD 5K9QG 5IV2B 1D3CA 3FT2B 3MSPA 4NNXB 1S9WB 4NWUL 4XPGH 3T8XA 1JNHB 1KFAL 2FBOJ 4U7SA 3L3JB 4P2RE 1U2CA 4DW2L 2JB6B 3VGDA 4U1MA 2ED7A 1IC5H 3PP4H 4N1HB 4IDJL 3N85L 5KSBA 4R4FL 3B2VL 5F9AC 1HSBB 1UYWL 5EU6B 3CIQA 3CD4A 5IFAL 4XC3L 4CNIB 2JLLA 2WUCL 4CBPA 1T83C 3CSPA 3MBEA 5D2NE 2Z92B 4U3CA 2FJGB 4PJGA 4WHCA 5H8DA 3IS0X 4E0RB 3OAZK 1CGXA 1HWGB 4OQTL 3QXUA 4JFHE 3L5IA 3SBWA 1JNLL 1IEAA 2R29H 1LO0L 1QSEA 2YD6A 3HNTH 4DAGH 1KJMA 4W4OA 8CGTA 3V5HB 5F1KC 1WJ3A 1EXUB 2WW8A 5F7UA 4QTHB 4MD0A 2X1QA 2VERN 4R96B 4Z9KB 1F4YH 4GAJH 4L1HA 3FQRA 5E8OA 3ZDXF 1DEEA 5KS9F 1WAAE 4XPTL 1EO7A 1PSKH 4DZ8B 3KG5A 1UWEH 1J1PL 4Z95H 3ARGD 1U91B 1ZHNA 3LMJL 5TDNB 4WDIA 4TUOA 4UUJA 1ONQA 5M95B 1BVKB 4HULB 2OJZH 5DJYB 4PJHB 1KSRA 2UY7A 1NMBH 3ZDZE 1NFDA 3J8F7 4N0UE 4C56D 1QHOA 4YDIH 2WK2A 1BFVH 4G43A 3SE4A 1S9YA 3NGBB 2JELL 3DGGB 3ULUE 2BSRA 1I3UA 1J0YA 2VLME 5E9DD 4WFFD 3D0VA 4G8FB 3F65A 4G42A 1QKZL 5IHZA 5A3ID 4PJIF 4RWHA 5M94B 2DQUH 4RZCA 3VXRA 3WXVH 4PJ7E 5DD1L 5K9KA 4F33B 1GGUA 3T08A 3QIWB 2DQIH 5E5MA 2ZSWB 4X6BA 5ID1A 4WUUB 3WN5B 4HS3B 2ZUQB 4GUPB 4X80H 2CD0A 2G60H 5DC9B 1VACA 1JPFA 4L9LC 3S3PA 4R3SB 5C0AA 5L7XH 5CSBA 1DVFB 1ZVYA 4D9LH 1UVQB 3DURB 1LK3L 4BA8A 5GGSY 1R5VB 4KTEL 4FMKA 3CFJA 5FDWB 2GCYB 3KXFD 5HHOB 4I4WB 4Y5YC 1ZV5A 3KYKL 1YC7A 4XB7A 1G7JB 1BBDH 4I18A 3BIBX 5IROC 4UOW1 1A9EA 1OTSD 5FECB 3M8OL 4LQFH 2W07A 4QRPB 2B1HH 3RQ3A 4WTZA 2VN4A 3ROLA 4NQED 5AAMA 4D0DA 1I1YB 3HZKA 2R2HA 5D1QA 5E8DH 5LGHL 4ZPTB 4P5TA 1X5IA 3REVB 3CC5A 2Z8RA 3WSQH 5IOPA 3O4LD 3R06B 1JRHL 1X7QB 3ARDD 1ED3B 1KXQE 2P8MB 5ENWB 5KZCD 4P3CH 4ZTOH 4HC1L 2CK2A 1RY7B 5MEOB 3CXDL 2FWOA 2DI8A 4OCYH 1MFNA 2IC2A 3QHTC 1NLBH 4EI5B 3DMMB 5IW1B 3GNMH 3RNQA 4LCWB 3DARA 4JFQA 4G9FD 1X4XA 4HV8B 2V2WB 3R1GL 1IL1B 4MMZC 4HS6B 4L4TD 3SGDI 1TJIH 2VSCA 2QSVA 4MJ5B 1J87A 3V6FB 4NCC1 1JYNA 3V4UL 3QEQB 3D39A 1I7ZB 3NFPA 3LQAH 5T1KB 1CD0A 1QBMH 3G5YB 4X0KA 3TV3L 3DVFA 4ORZC 2I9TB 2RQ8A 4WTXA 4DK6A 1F3RB 2NY1D 2PO6D 1U3HA 4JQIL 1DBJH 4ZUSA 1CG9B 3P9LA 2UY6A 3QXDB 2KQMA 4M43L 1WCBB 3A6CL 4GXUM 1VKXB 4XNMA 5I2IA 5E8NA 3D3VD 2JCCE 3IXTB 5J6HA 4OTXL 2YD1A 1N6VA 4L3EA 2NY4D 2P44B 4OZFH 4JRXB 5FGBA 5L6YH 4F15C 2B39A 3EO0B 2ZOLA 1KJ2A 4AIZA 5JORB 1MIMH 4F7TA 5CZVL 3S88L 3OKDA 2F19L 1CXKA 4F7CB 2FX7H 4XNUH 1BEYH 4YEEA 1FZMB 4WEUD 4OKDA 2X7LB 4F9PA 3QUKB 1WFTA 3WS3A 3W0WD 2ITCA 3QQ3A 3UC0L 1CE6B 5D1XB 5GGQL 1QSFE 2AJYL 4EOWH 2B1AH 1JBJA 2JJUA 4JFDE 3MJ9H 1GIGH 3MGTB 4E41A 5HDLA 2VL5B 5I8OL 5I76A 2VLLA 4PJCB 2XN9D 5IM7B 4OBRA 4K2UL 1TQBB 3KPNA 4DVRL 1ZWIA 5HJ3B 2X4RA 3E1F1 2D7TL 3GM8A 3JTTB 5CFHA 3HC0A 1EDQA 4U1JA 2J8UF 1QO3B 5I1JH 1F45A 2Z31D 1YEFL 3QDJE 2NXZD 3SGJA 5BRZB 5MENA 5ESVB 1ZLWH 4GBXC 3K7UA 3RZCA 3SCMC 4U1LA 1BJMA 3MRCA 4JFFD 4U1NB 4MA3A 3ULVH 5C09A 4R26L 1NC2A 1CD1A 4Y2DA 1GJIA 1B2WH 5E2TH 4Y4FB 5CJQH 4AT6A 4KTDL 1Q9WA 3I75B 2OR8A 3VFVA 5J56B 2EDHA 3RDTA 5F7FA 1OB1A 1NPUA 3OL2A 3UTSD 4P23A 1C5CH 3MC0A 4ELKB 4IS6A 3SDXB 4S1SL 2UZXB 3UO1H 3BE1H 1M6OA 4WEMB 4P5KB 4D8PA 4F80A 3RPIB 3OKNA 4RFNC 3BGMA 5DJ2A 1RZ7L 4JM4H 1U3YA 5FO8A 1QOKA 4JEGB 2EKJA 4XVTH 5D2LB 1YYLL 4M7ZB 1G9EA 3W11D 2OR7A 1F4HA 4JFPA 2EE6A 4PB0H 1I9RL 4M8QB 3MRMA 5T3XE 3B9AA 1ORQB 3EOAB 1XF4B 1A7QH 3CLEL 1C5DA 2DKMA 3NZHL 1LILA 3QUXB 3G04A 2H8PB 2VNCA 3K0WA 1UWXK 2ZUUA 1F4AA 2GK2A 1NJ9A 4N0FA 3HZVA 4BZ1L 3IETB 4X99B 4PJ8B 3ZYOA 4HWEL 5I74C 2OK0H 4HLZH 4TUKH 2V9TA 5CGYD 2YA1A 5FYKE 3THML 1BVLB 3VXQA 1F6LL 1INDH 4KI5F 2BNQB 3SKUD 3TP4A 5SWZB 3GO1L 2DWEB 1CDCA 3QIWC 4HJGA 4MAYD 5DQJA 1J88A 2DQDH 2BVPA 1EEYB 3NMEA 1OVZA 3G9VA 1ITBB 3BKYH 4YGAB 5DVNA 1CXIA 4J4PC 3OKLB 2EC9T 4G8IA 3ZKMC 4NQCB 5I75C 3MRBB 4JB9L 4UNVA 3CXHJ 3EDFA 3WFHA 1KGCD 3TGXA 2X4NB 5GS1C 1IGJA 5TDOA 1F58H 3E8UL 3WS6A 1Q9OA 2A9NL 4WTZG 2WUBL 5C1MB 5DFTA 1OL0A 1BQHB 5EU6E 1YC8A 1NCNA 5DVLA 3KPSB 2QQLH 2HVKB 4HLZG 3UP1A 3UTPE 1OW0C 2BVTA 1E4KA 1XH3B 2NY5H 3HZMA 3V5KB 2CR6A 4LSDA 5AZ2L 3SE8H 3CXHK 4J3UA 1U8IA 5D7SH 5CP7B 3C5JB 4XT1C 3EDKA 4QHNB 1S9KC 5L0QC 3BKCL 2ATKB 1VPOL 1ZT1A 3WLBB 1TQCB 1L0QA 5IG7A 1TCRA 4DWHA 1FBIH 3HZYA 1T0MB 1WIOA 4HWNA 5C0GA 4LKXA 5JIHA 1MCOH 5E6ZA 4IRJB 4MD5B 4DTGH 4ZNEA 1MFAL 2AABL 3VXTB 5I1EH 3SDCC 4GRMA 2QL1A 4CADA 1II4E 1X6LA 5J1TC 5C0FB 3ZDYF 1BAFH 1EX0A 4XP1H 2AK1H 2J4WH 1K3IA 4PJHE 3G5ZA 2EDTA 1SQ2N 5EFIB 4A6YA 3U6RB 1A0QH 3MTRA 3ARPA 5CWSA 4YK4C 5BXFA 1IMHC 3B9KA 4MJ6B 3VG0L 2BK8A 4ELMA 2A6KB 3HUJF 4YGVA 3L9RB 3MA7B 4P99A 4IRZH 3GMQA 4KROB 4DKFH 5E4EC 4Q2ZB 2R4RH 4YDLC 3VGHA 2B0SL 5DD0L 4PYHA 3UROR 2VITA 3ZE1F 2VQ1A 1UKTA 2X4SA 3WUZA 3P30L 5EC2A 1ZT4A 3HE6B 4W4NA 4MCYB 3IJHA 1MCFA 5F7LB 4WUUE 2GJ6A 4HPOH 1KLFA 2EKSA 3RVUC 4GW5A 3ORJA 5BV7B 3BPCB 5ELIA 4XNXH 2AKRB 2CKBA 2VSDA 1WWWX 1H8SA 3QJFA 5D9SB 3QIBC 5LG1A 5IVNA 3BN3B 4C83B 3IKKA 35C8L 43CAB 5HHOE 3U4AA 1XCQB 3MODH 4JM2C 2WM0A 5E99H 4P4KB 2P24A 1FL6B 5FO7B 3HN3A 1PZ5A 3RIFF 2ZCHL 3VRLF 1JPGA 1OQOA 2E7LC 3F62A 1HXMA 4PY8I 4AEFA 4GXVH 5IK3B 4DKEL 4QRPE 4EI6A 1CE1H 1SEBB 2RR3A 2Y36H 1BIIA 5DR5L 3KLHC 2HKHL 4XRCB 5JW3L 1GOGA 4QRRB 1FCGA 3DXAD 3GK8L 3MV8D 4PRPB 2Z93A 4YXKL 1I1CA 2EICA 1A22B 4APQB 2F5AL 5HHQA 4TVPE 1Z2KA 5DT1H 5DEGA 1RZIA 5F8QC 3MV9A 4H5SB 5IFJB 4K3EL 2WSKA 1IM9A 4X98A 4M6AA 3TZVB 4U0QB 4XNQA 3UZVB 3VXSA 4Q9BA 3WO4B 1KT2A 3IU3B 4ZAKB 4UT7H 3ES6B 2W9EH 6FABH 4NM8L 3TYGH 4LCWE 3IJYA 3VXUD 2H2PC 5DXWA 4CVWA 4R2GC 2VXQH 5D7IB 1MJ7L 2BVEA 3DUSB 3RU8H 2H6PA 2NY1B 3WNLA 4ODUA 4HFUL 4UIMA 1PQZB 2H2SC 5J12C 4OT1L 1ADQH 1IKNC 2DQCL 3QEQE 5HHMB 4TSCL 1I1AB 1REIA 3D3VB 3UPRA 3EZJB 1UH3A 2V17H 4GG6F 1T03L 4HXAH 4KMTH 1D5XA 3TIEA 5CZXD 1UXWB 4NJ9L 1EMTL 3ILQC 3T77A 3MLXL 2ENYA 3ZL4L 1HXYA 3MBXH 4CMMB 4KKNA 1G7HA 1U92A 3UPCA 4MSWA 3CK0H 3F6IA 4FRWA 1CLZL 5AYQA 2HLFC 5JZ7C 5TPWL 5ACZA 3EYSH 4NO0D 3BEWA 4LVOC 3O8XB 4G3YH 4J12A 5ALBH 4PREA 2PYEB 2RBLA 4NYLB 4YXHL 3HI1A 4JRXE 3C2AH 2BHZA 4M62L 2N7BA 1HINL 4MGXA 1G6RA 2BFVL 2QQNH 4NJAH 3VJ6A 2QKIB 1OGAA 4OGZA 1KPVA 1XGQA 3PGDA 4U1IB 5D8JL 3PDGA 4JFXB 2JJVA 3FQUA 5FOBA 3BGFC 5CP3H 3GB7B 5L2KB 2IBBA 1IGFL 4LLMA 5T3ZE 1SEQL 3FQXA 3KPQB 4HUMB 1NL0L 1ZHBA 3ALPA 5CEYB 1KCVH 4NKOA 4PJCE 1NBQA 3OAYH 5EU7E 5JR1L 4PRHA 3BQUA 3F12B 4HK3J 5F89B 1L6ZA 4BYHA 3EHBC 3GBNH 1AFVL 1XR8B 1FYTA 3ESUF 3MRLB 3O6MH 2V9QA 1EVUA 1MWAL 4D94A 5BS0D 1G1CA 5BRZE 4HMEA 4XBGB 5DMIH 2GQHA 4YHPB 5ANMB 2VABA 3QHZH 4IJ3C 2WBJC 4M61B 4FFVC 4LLDA 1RULH 2R0KL 3QUYB 1GZPA 1HHHA 4EUPA 4J3WA 4P46C 5KJRL 3GRWA 1NGQH 1XGRB 3N9GL 1H3XA 2QSCL 4K71C 4MHHG 1BOGA 4JQVC 4WHYH 4LVHC 5F88B 4YBQC 3SCMD 2R69L 5C0BB 1DE4A 2CLRA 5JPNB 1H15A 3AMKA 1OAYH 3NCJL 4YIQB 3SDXE 3QQ9D 5CCKL 1J05B 4BSWB 2XZAH 5JQHC 3BUTA 3U0PA 7FABH 4PBVC 5IEKA 2X4PB 4M4PA 2OTPA 3BUYB 3RUGA 1BPVA 3MRKB 5KBNC 4WHTA 5D2LE 4UV7L 2XPGA 3CX5K 3MLVH 3VA6A 1BWMA 2EDYA 3QHFL 2EH7L 3RVTC 1LWRA 4LRIA 5FA3A 1R3KB 1M7IA 3X17A 3QULB 4UU9B 4BUGA 4RIRA 1TZGL 1QBLH 5E6YA 1WAAF 4JCLA 1RZKC