1RJ1A

Crystal structure of a cell wall invertase inhibitor from tobacco
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
148
structure length
148
Chain Sequence
GNNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords invertase inhibitor
publication title The invertase inhibitor Nt-CIF from tobacco: a highly thermostable four-helix bundle with an unusual N-terminal extension
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Protein binding
total genus 60
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 1rj1A00
1X90A 1X91A 1RJ1A 2CJ6A 2CJ5A 1RJ4A 2CJ8A 1X8ZA 1XG2B 2CJ7A 2XQRB 2CJ4A
chains in the Genus database with same CATH superfamily
5M4KA 3D9EA 1XFVA 2EBFX 1K8TA 1Y0VA 2BU2A 2EC5A 2ZDYA 2LFWA 2CJ7A 1RP3A 3MXLA 1SC5A 1LVCA 4L3ZA 4O5MA 4U83A 4MPCA 3TZ4A 5K3HA 4AKGA 4Q17A 2Q8IA 3VADA 1GKZA 3VKHA 3D9GA 3D2RA 4KTOA 2R03A 2AO2A 3KMLA 3TZ2A 2ZKJA 3CRLA 3S7WA 2YYKA 4Q4UA 1X91A 1PK0A 4H85A 3LG1A 2CJ6A 2FP1A 4WJYA 3SF6A 2RDZA 4L1FA 4JIZA 1GKXA 2YYGA 2UXWA 4RM7A 2CJ4A 2IX6A 1W07A 3PFDA 1XFUA 1IVHA 4Q5BA 3X0XA 3VKGA 1U8VA 1RX0A 2YGWA 5B5WA 3B96A 3C2PA 1S26A 2R0NA 2E80A 3OIBA 3GM6A 2CJ5A 1PI1A 1EGDA 2BU8A 3X0YA 4V25A 2A1TA 4Q1OA 4IV6A 1XFXA 2GBBA 2XS8A 2J7AA 3MDDA 1XFZA 2OR0A 2VIGA 3UBRA 4P13A 2QR4A 1Y8PA 2C0UA 5BRMA 2EBHX 5J6AA 1JM6A 1X8ZA 5K3JA 2XQRB 2YYMA 2IX5A 3Q24A 4JIOA 3CRKA 2HJNA 1XFYA 1RJ1A 2JBSA 3Q22A 4QICA 2YYLA 1FS7A 2FONA 5J71A 4DOYA 4L3YA 3BNGA 3D9DA 5GJVE 4E02A 2WBIA 4V26A 5GJWE 1K93A 4KS9A 2YYJA 2CJ8A 2CX9A 2Q8FA 1SIRA 3C46A 2D29A 2YYIA 2ZAFA 1IS2A 1R2JA 4KSAA 4LQQB 4OO2A 3L1TA 3MKHA 4N5FA 1SK6A 2JIFA 3BNHA 3TORA 5M4NA 2F6LA 1XFWA 1SIQA 3EOMA 3TZ0A 2Z1QA 2BU7A 4Q0TA 4IRNA 4XVXA 3AFEA 3P4TA 3RKHA 1X90A 2R02A 3MPIA 4E00A 1Y8OA 4G97A 2RF7A 4LQSB 2JBTA 3OWAA 4J1VA 1XG2B 1JQIA 3GQTA 2FP2A 1BUCA 4W9UA 2BU6A 5K3GA 3EONA 3MMOA 4H81A 4KSFA 4E01A 2OEVA 4G5EA 4NXLA 2XS1A 2OJQA 3SXQA 1GJVA 3HWCA 3OWMA 3D1IA 4HKRA 2EBAA 2Q8GA 3M9VA 4HR3A 1EGCA 1FS8A 2BU5A 3FCJA 5K3IA 2VR0A 3GNCA 3FO3A 3N0RA 4M9AA 4MP2A 2JBRA 2PG0A 4MPEA 3NF4A 3SWOA 4FF2A 2DDHA 3UU9A 4ZYJA 4H7QA 3MPJA 4P79A 4AKHA 3AFFA 4F0XA 3C3LA 2OEXA 3MDEA 3SCEA 5B6BA 3BNJA 4AKIA 4FF4A 4FF1A 1K90A 3LGQA 1QDBA 1Y8NA 2RFQA 4Q5CA 1UDYA 4KCFA 2DVLA 4X28C 2OT4A 1RJ4A 1GU6A 5BRKA 2C12A 4JEKA 1UKWA 1WS9A 2PO4A 5M4PA 2ZO5A 4FF3A 5M4MA 3D6BA 4DZYA 2BTZA 2VF1A 2ZDXA 2E81A 3R7KA 2E0AA 3Q0AA 4MPNA 1EGEA 2REHA 3BNFA 2PNRA 1R3BA 1OAHA 4MP7A 4HKSA 2R05A 3TTBA 4ZXVA 1FS9A 4AI6A 4FZ4A 1T9GA 3D9FA 5B5VA 2R0MA 3X29A 3CE2A 3F29A 4L38A 4X28A 3TZ5A 3II9A 3Q23A 4L3XA 2Q8HA 2AZEA
chains in the Genus database with same CATH topology
1X90A 1X91A 1RJ1A 2CJ6A 2CJ5A 1RJ4A 2CJ8A 1X8ZA 1XG2B 2CJ7A 2XQRB 2CJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X90 A;  1X91 A;  1RJ1 A;  2CJ6 A;  2CJ5 A;  1RJ4 A;  2CJ8 A;  1X8Z A;  1XG2 B;  2CJ7 A;  2XQR B;  2CJ4 A; 
#chains in the Genus database with same CATH topology
 5M4K A;  3D9E A;  1XFV A;  2EBF X;  1K8T A;  1Y0V A;  2BU2 A;  2EC5 A;  2ZDY A;  2LFW A;  2CJ7 A;  1RP3 A;  3MXL A;  1SC5 A;  1LVC A;  4L3Z A;  4O5M A;  4U83 A;  4MPC A;  3TZ4 A;  5K3H A;  4AKG A;  4Q17 A;  2Q8I A;  3VAD A;  1GKZ A;  3VKH A;  3D9G A;  3D2R A;  4KTO A;  2R03 A;  2AO2 A;  3KML A;  3TZ2 A;  2ZKJ A;  3CRL A;  3S7W A;  2YYK A;  4Q4U A;  1X91 A;  1PK0 A;  4H85 A;  3LG1 A;  2CJ6 A;  2FP1 A;  4WJY A;  3SF6 A;  2RDZ A;  4L1F A;  4JIZ A;  1GKX A;  2YYG A;  2UXW A;  4RM7 A;  2CJ4 A;  2IX6 A;  1W07 A;  3PFD A;  1XFU A;  1IVH A;  4Q5B A;  3X0X A;  3VKG A;  1U8V A;  1RX0 A;  2YGW A;  5B5W A;  3B96 A;  3C2P A;  1S26 A;  2R0N A;  2E80 A;  3OIB A;  3GM6 A;  2CJ5 A;  1PI1 A;  1EGD A;  2BU8 A;  3X0Y A;  4V25 A;  2A1T A;  4Q1O A;  4IV6 A;  1XFX A;  2GBB A;  2XS8 A;  2J7A A;  3MDD A;  1XFZ A;  2OR0 A;  2VIG A;  3UBR A;  4P13 A;  2QR4 A;  1Y8P A;  2C0U A;  5BRM A;  2EBH X;  5J6A A;  1JM6 A;  1X8Z A;  5K3J A;  2XQR B;  2YYM A;  2IX5 A;  3Q24 A;  4JIO A;  3CRK A;  2HJN A;  1XFY A;  1RJ1 A;  2JBS A;  3Q22 A;  4QIC A;  2YYL A;  1FS7 A;  2FON A;  5J71 A;  4DOY A;  4L3Y A;  3BNG A;  3D9D A;  5GJV E;  4E02 A;  2WBI A;  4V26 A;  5GJW E;  1K93 A;  4KS9 A;  2YYJ A;  2CJ8 A;  2CX9 A;  2Q8F A;  1SIR A;  3C46 A;  2D29 A;  2YYI A;  2ZAF A;  1IS2 A;  1R2J A;  4KSA A;  4LQQ B;  4OO2 A;  3L1T A;  3MKH A;  4N5F A;  1SK6 A;  2JIF A;  3BNH A;  3TOR A;  5M4N A;  2F6L A;  1XFW A;  1SIQ A;  3EOM A;  3TZ0 A;  2Z1Q A;  2BU7 A;  4Q0T A;  4IRN A;  4XVX A;  3AFE A;  3P4T A;  3RKH A;  1X90 A;  2R02 A;  3MPI A;  4E00 A;  1Y8O A;  4G97 A;  2RF7 A;  4LQS B;  2JBT A;  3OWA A;  4J1V A;  1XG2 B;  1JQI A;  3GQT A;  2FP2 A;  1BUC A;  4W9U A;  2BU6 A;  5K3G A;  3EON A;  3MMO A;  4H81 A;  4KSF A;  4E01 A;  2OEV A;  4G5E A;  4NXL A;  2XS1 A;  2OJQ A;  3SXQ A;  1GJV A;  3HWC A;  3OWM A;  3D1I A;  4HKR A;  2EBA A;  2Q8G A;  3M9V A;  4HR3 A;  1EGC A;  1FS8 A;  2BU5 A;  3FCJ A;  5K3I A;  2VR0 A;  3GNC A;  3FO3 A;  3N0R A;  4M9A A;  4MP2 A;  2JBR A;  2PG0 A;  4MPE A;  3NF4 A;  3SWO A;  4FF2 A;  2DDH A;  3UU9 A;  4ZYJ A;  4H7Q A;  3MPJ A;  4P79 A;  4AKH A;  3AFF A;  4F0X A;  3C3L A;  2OEX A;  3MDE A;  3SCE A;  5B6B A;  3BNJ A;  4AKI A;  4FF4 A;  4FF1 A;  1K90 A;  3LGQ A;  1QDB A;  1Y8N A;  2RFQ A;  4Q5C A;  1UDY A;  4KCF A;  2DVL A;  4X28 C;  2OT4 A;  1RJ4 A;  1GU6 A;  5BRK A;  2C12 A;  4JEK A;  1UKW A;  1WS9 A;  2PO4 A;  5M4P A;  2ZO5 A;  4FF3 A;  5M4M A;  3D6B A;  4DZY A;  2BTZ A;  2VF1 A;  2ZDX A;  2E81 A;  3R7K A;  2E0A A;  3Q0A A;  4MPN A;  1EGE A;  2REH A;  3BNF A;  2PNR A;  1R3B A;  1OAH A;  4MP7 A;  4HKS A;  2R05 A;  3TTB A;  4ZXV A;  1FS9 A;  4AI6 A;  4FZ4 A;  1T9G A;  3D9F A;  5B5V A;  2R0M A;  3X29 A;  3CE2 A;  3F29 A;  4L38 A;  4X28 A;  3TZ5 A;  3II9 A;  3Q23 A;  4L3X A;  2Q8H A;  2AZE A; 
#chains in the Genus database with same CATH homology
 1X90 A;  1X91 A;  1RJ1 A;  2CJ6 A;  2CJ5 A;  1RJ4 A;  2CJ8 A;  1X8Z A;  1XG2 B;  2CJ7 A;  2XQR B;  2CJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...