1RJ4A

Structure of a cell wall invertase inhibitor from tobacco in complex with cd2+
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords invertase inhibitor
publication title The invertase inhibitor Nt-CIF from tobacco: a highly thermostable four-helix bundle with an unusual N-terminal extension
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Protein binding
total genus 58
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 1rj4A00
2CJ7A 1X91A 1X90A 2CJ4A 2CJ6A 1RJ1A 1RJ4A 1X8ZA 2XQRB 2CJ8A 2CJ5A 1XG2B
chains in the Genus database with same CATH superfamily
1JQIA 4LQSB 4OO2A 2Q8GA 2ZDYA 1SIQA 2RF7A 4Q4UA 2DVLA 1RJ4A 5K3GA 2IX6A 2R03A 2ZO5A 4MP7A 3C2PA 3N0RA 4O5MA 3GM6A 3BNFA 4V26A 4XVXA 1IS2A 1BUCA 1XFVA 5M4MA 1X90A 2AZEA 3D1IA 2QR4A 4AKGA 1GKZA 3MXLA 3MDEA 3SWOA 2EBHX 4Q5BA 3VADA 1EGCA 1RP3A 1X91A 4Q5CA 4IRNA 2JBTA 4DZYA 5J71A 2YGWA 2Z1QA 4MPCA 4DOYA 4P79A 1RX0A 4NXLA 3SF6A 3FO3A 3EONA 2Q8FA 4KTOA 1EGDA 3Q0AA 4MP2A 1U8VA 4JIOA 4L38A 4L3ZA 3MMOA 2R0MA 3MDDA 2PO4A 1R2JA 1LVCA 4JEKA 2GBBA 2WBIA 3L1TA 4N5FA 4FF4A 2CJ7A 3X0YA 5BRMA 3X29A 4FZ4A 1K93A 2E0AA 1Y8OA 4L3XA 3D9EA 4G97A 2YYKA 2FP1A 1EGEA 3RKHA 2REHA 3UU9A 2JBSA 2F6LA 2R05A 2BU6A 2IX5A 4G5EA 5J6AA 3OIBA 2YYGA 2CJ6A 3CRKA 3SCEA 1R3BA 3AFFA 5M4NA 3KMLA 4ZXVA 4Q17A 4Q1OA 4P13A 1Y8PA 2E80A 3C3LA 4FF3A 1UDYA 3TORA 3VKGA 1K90A 4Q0TA 3C46A 3BNHA 2VIGA 1XFXA 3LGQA 1XG2B 2OT4A 4QICA 3TZ5A 1W07A 4J1VA 5GJVE 3B96A 3MKHA 3BNJA 3D6BA 2EBAA 2C0UA 1S26A 2JIFA 3M9VA 2CJ8A 2CJ5A 1Y0VA 1GKXA 4MPNA 3GQTA 5B5VA 2BTZA 2BU5A 3F29A 1GJVA 4X28C 2AO2A 3TZ2A 2JBRA 2YYIA 3D9FA 5BRKA 1OAHA 3P4TA 2C12A 2YYMA 4U83A 2OR0A 1FS8A 2PG0A 1X8ZA 2XQRB 3R7KA 2R02A 4E01A 4FF1A 2HJNA 1K8TA 3CRLA 3NF4A 1UKWA 2Q8HA 3PFDA 2DDHA 4V25A 4ZYJA 5K3HA 2R0NA 2EBFX 3HWCA 4W9UA 3SXQA 3TTBA 2OJQA 4WJYA 3MPIA 3TZ4A 2EC5A 2CJ4A 4AKHA 1XFWA 2RFQA 2XS8A 1XFZA 2RDZA 3UBRA 2OEXA 3OWMA 4HR3A 4L1FA 1PK0A 3X0XA 2ZDXA 3Q22A 2XS1A 4FF2A 3MPJA 4KS9A 2PNRA 4KSAA 1XFUA 3OWAA 4H7QA 4L3YA 1PI1A 2BU8A 3Q24A 4X28A 5GJWE 3TZ0A 1GU6A 3AFEA 4HKSA 2LFWA 1WS9A 4E02A 5M4KA 1IVHA 2VR0A 3II9A 4H85A 3Q23A 3D9GA 2YYLA 1SK6A 3LG1A 2FP2A 4JIZA 2OEVA 4HKRA 2J7AA 2BU7A 5K3JA 3D9DA 1SC5A 2CX9A 1XFYA 4IV6A 3EOMA 2ZAFA 4M9AA 2YYJA 4KCFA 2E81A 1JM6A 4RM7A 4H81A 4F0XA 2A1TA 1QDBA 4LQQB 4AI6A 3CE2A 2VF1A 3VKHA 4KSFA 1FS7A 3S7WA 4AKIA 2UXWA 3FCJA 1FS9A 3D2RA 4E00A 2FONA 2Q8IA 3GNCA 1T9GA 5B5WA 5K3IA 2D29A 1RJ1A 1Y8NA 1SIRA 2BU2A 3BNGA 2ZKJA 5B6BA 5M4PA 4MPEA
chains in the Genus database with same CATH topology
2CJ7A 1X91A 1X90A 2CJ4A 2CJ6A 1RJ1A 1RJ4A 1X8ZA 2XQRB 2CJ8A 2CJ5A 1XG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJ7 A;  1X91 A;  1X90 A;  2CJ4 A;  2CJ6 A;  1RJ1 A;  1RJ4 A;  1X8Z A;  2XQR B;  2CJ8 A;  2CJ5 A;  1XG2 B; 
#chains in the Genus database with same CATH topology
 1JQI A;  4LQS B;  4OO2 A;  2Q8G A;  2ZDY A;  1SIQ A;  2RF7 A;  4Q4U A;  2DVL A;  1RJ4 A;  5K3G A;  2IX6 A;  2R03 A;  2ZO5 A;  4MP7 A;  3C2P A;  3N0R A;  4O5M A;  3GM6 A;  3BNF A;  4V26 A;  4XVX A;  1IS2 A;  1BUC A;  1XFV A;  5M4M A;  1X90 A;  2AZE A;  3D1I A;  2QR4 A;  4AKG A;  1GKZ A;  3MXL A;  3MDE A;  3SWO A;  2EBH X;  4Q5B A;  3VAD A;  1EGC A;  1RP3 A;  1X91 A;  4Q5C A;  4IRN A;  2JBT A;  4DZY A;  5J71 A;  2YGW A;  2Z1Q A;  4MPC A;  4DOY A;  4P79 A;  1RX0 A;  4NXL A;  3SF6 A;  3FO3 A;  3EON A;  2Q8F A;  4KTO A;  1EGD A;  3Q0A A;  4MP2 A;  1U8V A;  4JIO A;  4L38 A;  4L3Z A;  3MMO A;  2R0M A;  3MDD A;  2PO4 A;  1R2J A;  1LVC A;  4JEK A;  2GBB A;  2WBI A;  3L1T A;  4N5F A;  4FF4 A;  2CJ7 A;  3X0Y A;  5BRM A;  3X29 A;  4FZ4 A;  1K93 A;  2E0A A;  1Y8O A;  4L3X A;  3D9E A;  4G97 A;  2YYK A;  2FP1 A;  1EGE A;  3RKH A;  2REH A;  3UU9 A;  2JBS A;  2F6L A;  2R05 A;  2BU6 A;  2IX5 A;  4G5E A;  5J6A A;  3OIB A;  2YYG A;  2CJ6 A;  3CRK A;  3SCE A;  1R3B A;  3AFF A;  5M4N A;  3KML A;  4ZXV A;  4Q17 A;  4Q1O A;  4P13 A;  1Y8P A;  2E80 A;  3C3L A;  4FF3 A;  1UDY A;  3TOR A;  3VKG A;  1K90 A;  4Q0T A;  3C46 A;  3BNH A;  2VIG A;  1XFX A;  3LGQ A;  1XG2 B;  2OT4 A;  4QIC A;  3TZ5 A;  1W07 A;  4J1V A;  5GJV E;  3B96 A;  3MKH A;  3BNJ A;  3D6B A;  2EBA A;  2C0U A;  1S26 A;  2JIF A;  3M9V A;  2CJ8 A;  2CJ5 A;  1Y0V A;  1GKX A;  4MPN A;  3GQT A;  5B5V A;  2BTZ A;  2BU5 A;  3F29 A;  1GJV A;  4X28 C;  2AO2 A;  3TZ2 A;  2JBR A;  2YYI A;  3D9F A;  5BRK A;  1OAH A;  3P4T A;  2C12 A;  2YYM A;  4U83 A;  2OR0 A;  1FS8 A;  2PG0 A;  1X8Z A;  2XQR B;  3R7K A;  2R02 A;  4E01 A;  4FF1 A;  2HJN A;  1K8T A;  3CRL A;  3NF4 A;  1UKW A;  2Q8H A;  3PFD A;  2DDH A;  4V25 A;  4ZYJ A;  5K3H A;  2R0N A;  2EBF X;  3HWC A;  4W9U A;  3SXQ A;  3TTB A;  2OJQ A;  4WJY A;  3MPI A;  3TZ4 A;  2EC5 A;  2CJ4 A;  4AKH A;  1XFW A;  2RFQ A;  2XS8 A;  1XFZ A;  2RDZ A;  3UBR A;  2OEX A;  3OWM A;  4HR3 A;  4L1F A;  1PK0 A;  3X0X A;  2ZDX A;  3Q22 A;  2XS1 A;  4FF2 A;  3MPJ A;  4KS9 A;  2PNR A;  4KSA A;  1XFU A;  3OWA A;  4H7Q A;  4L3Y A;  1PI1 A;  2BU8 A;  3Q24 A;  4X28 A;  5GJW E;  3TZ0 A;  1GU6 A;  3AFE A;  4HKS A;  2LFW A;  1WS9 A;  4E02 A;  5M4K A;  1IVH A;  2VR0 A;  3II9 A;  4H85 A;  3Q23 A;  3D9G A;  2YYL A;  1SK6 A;  3LG1 A;  2FP2 A;  4JIZ A;  2OEV A;  4HKR A;  2J7A A;  2BU7 A;  5K3J A;  3D9D A;  1SC5 A;  2CX9 A;  1XFY A;  4IV6 A;  3EOM A;  2ZAF A;  4M9A A;  2YYJ A;  4KCF A;  2E81 A;  1JM6 A;  4RM7 A;  4H81 A;  4F0X A;  2A1T A;  1QDB A;  4LQQ B;  4AI6 A;  3CE2 A;  2VF1 A;  3VKH A;  4KSF A;  1FS7 A;  3S7W A;  4AKI A;  2UXW A;  3FCJ A;  1FS9 A;  3D2R A;  4E00 A;  2FON A;  2Q8I A;  3GNC A;  1T9G A;  5B5W A;  5K3I A;  2D29 A;  1RJ1 A;  1Y8N A;  1SIR A;  2BU2 A;  3BNG A;  2ZKJ A;  5B6B A;  5M4P A;  4MPE A; 
#chains in the Genus database with same CATH homology
 2CJ7 A;  1X91 A;  1X90 A;  2CJ4 A;  2CJ6 A;  1RJ1 A;  1RJ4 A;  1X8Z A;  2XQR B;  2CJ8 A;  2CJ5 A;  1XG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...