1RJ4A

Structure of a cell wall invertase inhibitor from tobacco in complex with cd2+
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The invertase inhibitor Nt-CIF from tobacco: a highly thermostable four-helix bundle with an unusual N-terminal extension
pubmed doi rcsb
molecule keywords invertase inhibitor
molecule tags Protein binding
source organism Nicotiana tabacum
total genus 58
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 1rj4A00
1X8ZA 1X91A 2CJ5A 2CJ7A 2CJ6A 1X90A 2CJ4A 1RJ1A 2XQRB 1RJ4A 1XG2B 2CJ8A
chains in the Genus database with same CATH superfamily
1K93A 1R3BA 3VADA 3X0XA 3TORA 1GKZA 2EC5A 2YYLA 1R2JA 5M4NA 4L3ZA 2E81A 2RF7A 2RDZA 1X8ZA 1X91A 2CX9A 2YYJA 4FZ4A 4LQQB 5M4MA 4MPCA 2F6LA 2ZDYA 2FP2A 1K8TA 2BU8A 4MP2A 4O5MA 3X0YA 3S7WA 5K3HA 4FF4A 2Q8GA 3UU9A 5BRMA 3VKGA 4Q0TA 3C46A 2OT4A 4MPEA 3BNFA 4P79A 4QICA 4Q1OA 1LVCA 5M4PA 2GBBA 2EBFX 3II9A 5M4KA 3M9VA 5GJWE 4IV6A 1Y8PA 2VF1A 5K3IA 2EBAA 3MPJA 2REHA 3FO3A 1WS9A 3GQTA 2ZKJA 2DVLA 4HKSA 4L3YA 1UDYA 2R0MA 3D1IA 2JBTA 2OJQA 3MMOA 4XVXA 2R03A 1IS2A 2BTZA 3LG1A 3CRLA 2OR0A 3Q24A 5K3JA 3P4TA 2BU7A 1GU6A 4NXLA 1SIQA 1OAHA 3Q22A 5J71A 3KMLA 2JIFA 1IVHA 4X28A 3TZ4A 4DOYA 2OEVA 3PFDA 1JQIA 4KS9A 3X29A 1Y8OA 4U83A 3SWOA 3CE2A 4ZXVA 2Q8IA 5J6AA 1FS8A 1PI1A 3N0RA 2E80A 4KTOA 2ZAFA 3RKHA 4FF3A 1SIRA 2AZEA 2XS8A 2QR4A 3NF4A 2CJ7A 3BNJA 2R05A 4E02A 2A1TA 1S26A 3AFFA 4Q17A 1RJ4A 5B5VA 2D29A 2Z1QA 3SF6A 1XFVA 4KSFA 4HKRA 4Q5CA 3D9GA 4ZYJA 2VR0A 1K90A 3LGQA 1EGEA 4L1FA 4JIZA 1FS7A 2FP1A 2Q8HA 4JIOA 2FONA 1RP3A 1SK6A 2IX5A 4MPNA 3OIBA 1T9GA 4V25A 4LQSB 1EGCA 3TZ2A 3MDDA 2UXWA 2OEXA 2XS1A 3D9EA 1RJ1A 4G97A 4H81A 4N5FA 4WJYA 2R02A 3TZ5A 2RFQA 1U8VA 1GKXA 1JM6A 3EONA 4HR3A 1XFUA 4MP7A 3BNHA 4FF1A 1UKWA 3OWAA 3HWCA 4W9UA 2Q8FA 4KCFA 3Q0AA 2DDHA 2VIGA 4IRNA 4L3XA 4F0XA 2XQRB 2CJ8A 2PG0A 2BU5A 2CJ5A 5B6BA 4AKHA 1PK0A 2WBIA 1GJVA 4Q5BA 2E0AA 4G5EA 4E01A 1XFWA 2BU2A 4L38A 2CJ4A 4X28C 3R7KA 3VKHA 1XG2B 5B5WA 2YYIA 1EGDA 3MKHA 4Q4UA 5K3GA 3L1TA 2J7AA 4V26A 3FCJA 4J1VA 2IX6A 2LFWA 2BU6A 2C0UA 3D6BA 2ZO5A 1QDBA 4FF2A 4DZYA 2YYMA 3EOMA 5BRKA 3D9DA 3GM6A 3TTBA 4H85A 2C12A 4JEKA 1FS9A 3TZ0A 3C3LA 2CJ6A 2YYGA 2YGWA 1X90A 1BUCA 3BNGA 3D9FA 3GNCA 4H7QA 3CRKA 4AI6A 1RX0A 2R0NA 2PO4A 3B96A 3C2PA 2YYKA 3D2RA 1Y8NA 1W07A 2PNRA 4RM7A 3MPIA 2EBHX 3SXQA 3MDEA 4OO2A 3UBRA 4E00A 4AKIA 4KSAA 4P13A 4M9AA 3SCEA 1SC5A 2JBRA 3F29A 3AFEA 1XFZA 3OWMA 1Y0VA 4AKGA 1XFXA 3MXLA 3Q23A 2ZDXA 5GJVE 2JBSA 2HJNA 2AO2A 1XFYA
chains in the Genus database with same CATH topology
1X8ZA 1X91A 2CJ5A 2CJ7A 2CJ6A 1X90A 2CJ4A 1RJ1A 2XQRB 1RJ4A 1XG2B 2CJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Z A;  1X91 A;  2CJ5 A;  2CJ7 A;  2CJ6 A;  1X90 A;  2CJ4 A;  1RJ1 A;  2XQR B;  1RJ4 A;  1XG2 B;  2CJ8 A; 
#chains in the Genus database with same CATH topology
 1K93 A;  1R3B A;  3VAD A;  3X0X A;  3TOR A;  1GKZ A;  2EC5 A;  2YYL A;  1R2J A;  5M4N A;  4L3Z A;  2E81 A;  2RF7 A;  2RDZ A;  1X8Z A;  1X91 A;  2CX9 A;  2YYJ A;  4FZ4 A;  4LQQ B;  5M4M A;  4MPC A;  2F6L A;  2ZDY A;  2FP2 A;  1K8T A;  2BU8 A;  4MP2 A;  4O5M A;  3X0Y A;  3S7W A;  5K3H A;  4FF4 A;  2Q8G A;  3UU9 A;  5BRM A;  3VKG A;  4Q0T A;  3C46 A;  2OT4 A;  4MPE A;  3BNF A;  4P79 A;  4QIC A;  4Q1O A;  1LVC A;  5M4P A;  2GBB A;  2EBF X;  3II9 A;  5M4K A;  3M9V A;  5GJW E;  4IV6 A;  1Y8P A;  2VF1 A;  5K3I A;  2EBA A;  3MPJ A;  2REH A;  3FO3 A;  1WS9 A;  3GQT A;  2ZKJ A;  2DVL A;  4HKS A;  4L3Y A;  1UDY A;  2R0M A;  3D1I A;  2JBT A;  2OJQ A;  3MMO A;  4XVX A;  2R03 A;  1IS2 A;  2BTZ A;  3LG1 A;  3CRL A;  2OR0 A;  3Q24 A;  5K3J A;  3P4T A;  2BU7 A;  1GU6 A;  4NXL A;  1SIQ A;  1OAH A;  3Q22 A;  5J71 A;  3KML A;  2JIF A;  1IVH A;  4X28 A;  3TZ4 A;  4DOY A;  2OEV A;  3PFD A;  1JQI A;  4KS9 A;  3X29 A;  1Y8O A;  4U83 A;  3SWO A;  3CE2 A;  4ZXV A;  2Q8I A;  5J6A A;  1FS8 A;  1PI1 A;  3N0R A;  2E80 A;  4KTO A;  2ZAF A;  3RKH A;  4FF3 A;  1SIR A;  2AZE A;  2XS8 A;  2QR4 A;  3NF4 A;  2CJ7 A;  3BNJ A;  2R05 A;  4E02 A;  2A1T A;  1S26 A;  3AFF A;  4Q17 A;  1RJ4 A;  5B5V A;  2D29 A;  2Z1Q A;  3SF6 A;  1XFV A;  4KSF A;  4HKR A;  4Q5C A;  3D9G A;  4ZYJ A;  2VR0 A;  1K90 A;  3LGQ A;  1EGE A;  4L1F A;  4JIZ A;  1FS7 A;  2FP1 A;  2Q8H A;  4JIO A;  2FON A;  1RP3 A;  1SK6 A;  2IX5 A;  4MPN A;  3OIB A;  1T9G A;  4V25 A;  4LQS B;  1EGC A;  3TZ2 A;  3MDD A;  2UXW A;  2OEX A;  2XS1 A;  3D9E A;  1RJ1 A;  4G97 A;  4H81 A;  4N5F A;  4WJY A;  2R02 A;  3TZ5 A;  2RFQ A;  1U8V A;  1GKX A;  1JM6 A;  3EON A;  4HR3 A;  1XFU A;  4MP7 A;  3BNH A;  4FF1 A;  1UKW A;  3OWA A;  3HWC A;  4W9U A;  2Q8F A;  4KCF A;  3Q0A A;  2DDH A;  2VIG A;  4IRN A;  4L3X A;  4F0X A;  2XQR B;  2CJ8 A;  2PG0 A;  2BU5 A;  2CJ5 A;  5B6B A;  4AKH A;  1PK0 A;  2WBI A;  1GJV A;  4Q5B A;  2E0A A;  4G5E A;  4E01 A;  1XFW A;  2BU2 A;  4L38 A;  2CJ4 A;  4X28 C;  3R7K A;  3VKH A;  1XG2 B;  5B5W A;  2YYI A;  1EGD A;  3MKH A;  4Q4U A;  5K3G A;  3L1T A;  2J7A A;  4V26 A;  3FCJ A;  4J1V A;  2IX6 A;  2LFW A;  2BU6 A;  2C0U A;  3D6B A;  2ZO5 A;  1QDB A;  4FF2 A;  4DZY A;  2YYM A;  3EOM A;  5BRK A;  3D9D A;  3GM6 A;  3TTB A;  4H85 A;  2C12 A;  4JEK A;  1FS9 A;  3TZ0 A;  3C3L A;  2CJ6 A;  2YYG A;  2YGW A;  1X90 A;  1BUC A;  3BNG A;  3D9F A;  3GNC A;  4H7Q A;  3CRK A;  4AI6 A;  1RX0 A;  2R0N A;  2PO4 A;  3B96 A;  3C2P A;  2YYK A;  3D2R A;  1Y8N A;  1W07 A;  2PNR A;  4RM7 A;  3MPI A;  2EBH X;  3SXQ A;  3MDE A;  4OO2 A;  3UBR A;  4E00 A;  4AKI A;  4KSA A;  4P13 A;  4M9A A;  3SCE A;  1SC5 A;  2JBR A;  3F29 A;  3AFE A;  1XFZ A;  3OWM A;  1Y0V A;  4AKG A;  1XFX A;  3MXL A;  3Q23 A;  2ZDX A;  5GJV E;  2JBS A;  2HJN A;  2AO2 A;  1XFY A; 
#chains in the Genus database with same CATH homology
 1X8Z A;  1X91 A;  2CJ5 A;  2CJ7 A;  2CJ6 A;  1X90 A;  2CJ4 A;  1RJ1 A;  2XQR B;  1RJ4 A;  1XG2 B;  2CJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...