1RJMA

Crystal structure of menb (rv0548c) from mycobacterium tuberculosis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
239
Chain Sequence
NPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords MenB
total genus 93
structure length 239
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.100 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 1rjmA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1rjmA01
3HINA 1XX4A 1XNVA 2W3PA 1ON9A 4B3JA 2X24A 2ZL3A 5DTPA 1NZYA 3DORA 1RJMA 1VRGA 3ISAA 3BPPA 2D3TA 2Q35A 3GF3A 2CE3A 4JYJA 5JBXA 1Q52A 2VSUF 4FB8A 4G2RA 4RYFH 5CTBA 1FC6A 3IBBA 2ZL4A 2X58A 3HLN1 4JSBA 1K39A 3Q7HA 3TLFA 4JFCA 2PBPA 5FUSA 4KD6A 4HC8A 4JCTA 5INGA 4U1AA 2A7KA 1N6FA 1DUBA 4I4ZA 3RRVA 4L6WA 3PGQA 3ZWBA 5KJPA 2BZRA 3H81A 3LAOA 3M6NA 1TG6A 4K2NA 3JU1A 3R0OA 4RYFA 3I47A 2F6QA 4FNDA 1XNYA 3TVUA 2F9YA 3QK8A 3GLMA 3QMJA 3QXIA 1TYFA 4ELWA 5G1QA 2Q2XA 4FN8A 3Q1TA 3QKAA 2J5GD 3QWDA 3N6RB 5DU6A 5DU4A 1RJNA 4OMRA 1EF8A 3T3WA 5C9GA 2J5SA 5G1RA 1EF9A 2A81A 4K29A 2VSSE 3M6MA 4FN7A 4KPKA 2FW2A 1YG6A 3Q0JA 2ZQQA 1WDLA 3NJBA 3GMAA 5INIA 3R9QA 5E0NX 3TZ3A 3V5EA 5E0SH 4JOTA 1UYVA 1YG8A 4K3WA 2EJ5A 4ZDBA 1K32A 1ON3A 3KTKA 3T88A 2ZQRA 4QFEA 4NNQA 2DEOA 4WZ8B 2F9IB 3OC7A 5MGBA 3DJAA 4Q0GA 3MOYA 1UYRA 4ELSA 5FIFA 5C90A 5DU8A 3BF0A 3G64A 1WZ8A 3KTJA 3RSIA 4FZWC 1MJ3A 3GKBA 4WYOB 5DKPA 3R9TA 3ZW9A 4NEKA 1N6DA 3H0SA 3LKEA 4GHNA 2VSUA 3TV5A 2F6IA 5CTCA 1O8UA 2F9IA 4GM2A 3BEZA 2WTBA 4Q1IA 4FZWA 3RSTA 3ZWAA 2C8TA 4U0GH 2VREA 5DTWA 3HP0A 3U9SB 3TDCA 3R9SA 2QQ3A 1Y7OA 3IB9A 4U0GA 2ZL2A 1X0UA 4ZDDA 3KTHA 3SWXA 2J5II 4ZU2A 4QIJA 1OD2A 5DL1A 2IEXA 3KQFA 2PG8A 3VIVA 5JBWA 4IZBA 3TT7A 4JVTA 1FC7A 3R6HA 4ZDFA 1Q51A 1XNWA 1N6EA 3FDUA 4EMLA 4QIIA 3L3SA 3H0QA 3U9TB 4Z0MA 3U9RB 3GF7A 2J5GA 4IZCA 2J5IB 3ZWCA 3IAVA 5INFA 2FZSA 2HW5A 5DZKA 1UYSA 1WDKA 2FBMA 2NP9A 3WG5A 3HRXA 4I42A 3PZKA 3KTIA 3T8AA 1HZDA 4ZDEA 4IZDA 4B3IA 4JCRA 3MFMA 4MI2A 3ZW8A 5DUFA 1UIYA 3P5MA 1PJHA 5E0SA 4OG1A 2CBYA 3ST9A 3PE8A 3T89A 4ZDCA 1DCIA 4ELXA 1PIXA 3QREA 1NZYB 2VSSA 4I52A 3NJDA 4MXIA 3HE2A 4DI1A 3P85A 1SZOA 2VX2A 1EY3A 4U18A 4FJWD 2PPYA 3FF6A 2UZFA 4JCQA 3T8BA 3H02A 3OMEA 2VSSF 3TVWA 5KDRB 4KNPA 5DUCA 4LK5A 4JWVA 4B3HA 1FCFA 1OD4A 2DUBA 3MYBA 3Q0GA 4OLQA 4ASIA 1SG4A 4U0HA 4EMPA 3STAA 3MT6A 3TT6A 4F47A 3PEAA 5KDRA 2VSUE 3H0JA 3OT6A 4FNBA 4JJTA 1UYTA 1WDMA 2VSUC 5G1SA 4EMMA 2F9YB 2Q34A 4JYLA 4U19A 5IKLB 1JXZA 4L8KA 3QYRA 4HNKA 1XO6A 3KTGA 2ZL0A 3K50A 1FC9A 4KWBA 4WCZA 3P2LA 2J5IA 3SLLA 3TRRA 1W2XA 4MOUA 4YLHA 1HNOA 2GTRA 1HNUA 5DZKH 3H0UA 3V5IA 3K8XA 3QXZA 4JCSA 2A7SA 1J7XA 4RCNA
chains in the Genus database with same CATH superfamily
1UX4A 3HINA 1Y64B 1XX4A 1XNVA 2W3PA 1ON9A 4B3JA 2X24A 2ZL3A 5DTPA 1NZYA 3DORA 2P63A 1RJMA 1VRGA 3ISAA 3BPPA 2D3TA 2Q35A 3GF3A 2CE3A 4JYJA 5JBXA 1Q52A 2VSUF 4FB8A 4G2RA 4RYFH 5CTBA 1FC6A 3IBBA 2ZL4A 2X58A 3HLN1 4JSBA 3TLFA 1K39A 3Q7HA 4JFCA 2PBPA 5FUSA 4KD6A 4J2UA 4HC8A 4JCTA 5INGA 4U1AA 2A7KA 1N6FA 1DUBA 4I4ZA 3RRVA 4L6WA 3PGQA 3ZWBA 5KJPA 3H81A 2BZRA 3LAOA 3M6NA 1UX5A 1TG6A 3RQEA 4K2NA 3JU1A 3R0OA 4RYFA 3I47A 2F6QA 4FNDA 1XNYA 3TVUA 2F9YA 3QK8A 3GLMA 3QMJA 3QXIA 1TYFA 4ELWA 5G1QA 2Q2XA 4FN8A 3Q1TA 3QKAA 2J5GD 3QWDA 3N6RB 5DU6A 5DU4A 1RJNA 4OMRA 1EF8A 3T3WA 5C9GA 2J5SA 5G1RA 1EF9A 2A81A 4K29A 2VSSE 3M6MA 4FN7A 4KPKA 5HUQA 2FW2A 3ADCA 1YG6A 3Q0JA 2ZQQA 1WDLA 3NJBA 3GMAA 3L8JA 5INIA 3R9QA 5E0NX 3TZ3A 3AJMA 3V5EA 5E0SH 4JOTA 1UYVA 1YG8A 4K3WA 2EJ5A 3A4LA 4ZDBA 1K32A 1ON3A 3KTKA 3T88A 2ZQRA 3RQGA 4QFEA 4NNQA 2DEOA 4WZ8B 2F9IB 3OC7A 5MGBA 3DJAA 4Q0GA 3MOYA 1UYRA 4ELSA 5FIFA 5C90A 5DU8A 3BF0A 3G64A 1WZ8A 3KTJA 3RSIA 4FZWC 1MJ3A 3GKBA 4WYOB 5DKPA 3R9TA 3ZW9A 4NEKA 1N6DA 3H0SA 3LKEA 4GHNA 2VSUA 3TV5A 2F6IA 5CTCA 3L8IA 1O8UA 2F9IA 4GM2A 3BEZA 2WTBA 4Q1IA 4FZWA 3RSTA 3ZWAA 2C8TA 4U0GH 2VREA 5DTWA 3HP0A 3U9SB 3TDCA 3R9SA 2QQ3A 1Y7OA 3IB9A 4U0GA 2ZL2A 1X0UA 2YJGA 4ZDDA 3KTHA 3BPTA 3SWXA 2J5II 4ZU2A 4QIJA 1OD2A 5DL1A 2IEXA 3KQFA 2PG8A 4NARA 3VIVA 5JBWA 4IZBA 3TT7A 4JVTA 1FC7A 3R6HA 4ZDFA 1Q51A 3O4XE 1XNWA 1N6EA 3FDUA 4EMLA 4QIIA 3L3SA 3H0QA 3U9TB 4Z0MA 3U9RB 3GF7A 2J5GA 4IZCA 2J5IB 3ZWCA 3IAVA 5INFA 2HW5A 2FZSA 5DZKA 3ADBA 1UYSA 1WDKA 4GEHB 2FBMA 2NP9A 3WG5A 3HRXA 4I42A 3IRBA 3PZKA 3KTIA 3T8AA 1HZDA 4ZDEA 4IZDA 4B3IA 4JCRA 3MFMA 4MI2A 3ZW8A 5DUFA 1UIYA 3P5MA 1PJHA 5E0SA 4OG1A 2CBYA 3ST9A 3PE8A 3T89A 4ZDCA 1DCIA 4ELXA 1PIXA 3QREA 1NZYB 2VSSA 4I52A 3NJDA 4MXIA 3HE2A 4DI1A 3P85A 2VX2A 1SZOA 1EY3A 4U18A 3W8HB 4FJWD 2PPYA 3FF6A 2UZFA 4JCQA 3T8BA 3H02A 3OMEA 2VSSF 3TVWA 5KDRB 4KNPA 5DUCA 4LK5A 4JWVA 4B3HA 1FCFA 1OD4A 2DUBA 3MYBA 3Q0GA 4OLQA 4ASIA 1SG4A 4U0HA 4EMPA 3STAA 3MT6A 3TT6A 4F47A 3PEAA 5KDRA 4HDTA 2VSUE 3H0JA 3OT6A 4FNBA 4JJTA 1UYTA 1WDMA 2VSUC 5G1SA 4EMMA 2F9YB 3A4NA 2Q34A 3A4MA 4JYLA 4U19A 3AM1A 3ADDA 5IKLB 1JXZA 4L8KA 3QYRA 4HNKA 1XO6A 3KTGA 2ZL0A 3W8IB 3K50A 1FC9A 4KWBA 4WCZA 3P2LA 3SLLA 2J5IA 3TRRA 1W2XA 4MOUA 4YLHA 1HNOA 2GTRA 1HNUA 5DZKH 3H0UA 3V5IA 3QXZA 3K8XA 4JCSA 3RQFA 2A7SA 1J7XA 4RCNA
chains in the Genus database with same CATH topology
1UX4A 3HINA 1Y64B 1XX4A 1XNVA 2W3PA 1ON9A 4B3JA 2X24A 2ZL3A 5DTPA 1NZYA 3DORA 2P63A 1RJMA 1VRGA 3ISAA 3BPPA 2D3TA 2Q35A 3GF3A 2CE3A 4JYJA 5JBXA 1Q52A 2VSUF 4FB8A 4G2RA 4RYFH 5CTBA 1FC6A 3IBBA 2ZL4A 2X58A 3HLN1 4JSBA 1K39A 3Q7HA 3TLFA 4JFCA 2PBPA 5FUSA 4KD6A 4J2UA 4HC8A 4JCTA 5INGA 4U1AA 2A7KA 1N6FA 1DUBA 4I4ZA 3RRVA 4L6WA 3PGQA 3ZWBA 5KJPA 2BZRA 3H81A 3LAOA 3M6NA 1UX5A 1TG6A 3RQEA 4K2NA 3JU1A 3R0OA 4RYFA 3I47A 2F6QA 4FNDA 1XNYA 3TVUA 2F9YA 3QK8A 3GLMA 3QMJA 3QXIA 1TYFA 4ELWA 5G1QA 2Q2XA 4FN8A 3Q1TA 3QKAA 2J5GD 3QWDA 3N6RB 5DU6A 5DU4A 1RJNA 4OMRA 1EF8A 3T3WA 5C9GA 2J5SA 5G1RA 1EF9A 2A81A 4K29A 2VSSE 3M6MA 4FN7A 4KPKA 5HUQA 2FW2A 3ADCA 1YG6A 3Q0JA 2ZQQA 1WDLA 3NJBA 3GMAA 3L8JA 5INIA 3R9QA 5E0NX 3TZ3A 3AJMA 3V5EA 5E0SH 4JOTA 1UYVA 1YG8A 4K3WA 2EJ5A 3A4LA 4ZDBA 1K32A 1ON3A 3KTKA 3T88A 2ZQRA 3RQGA 4QFEA 4NNQA 2DEOA 4WZ8B 2F9IB 3OC7A 5MGBA 3DJAA 4Q0GA 3MOYA 1UYRA 4ELSA 5FIFA 5C90A 5DU8A 3BF0A 3G64A 1WZ8A 3KTJA 3RSIA 4FZWC 1MJ3A 3GKBA 4WYOB 5DKPA 3R9TA 3ZW9A 4NEKA 1N6DA 3H0SA 3LKEA 4GHNA 2VSUA 3TV5A 2F6IA 5CTCA 3L8IA 1O8UA 2F9IA 4GM2A 3BEZA 2WTBA 4Q1IA 4FZWA 3RSTA 3ZWAA 2C8TA 4U0GH 2VREA 5DTWA 3HP0A 3U9SB 3TDCA 3R9SA 2QQ3A 1Y7OA 3IB9A 4U0GA 2ZL2A 1X0UA 2YJGA 4ZDDA 3KTHA 3BPTA 3SWXA 2J5II 4ZU2A 4QIJA 1OD2A 5DL1A 2IEXA 3KQFA 2PG8A 4NARA 3VIVA 5JBWA 4IZBA 3TT7A 4JVTA 1FC7A 3R6HA 4ZDFA 1Q51A 3O4XE 1XNWA 1N6EA 3FDUA 4EMLA 4QIIA 3L3SA 3H0QA 3U9TB 4Z0MA 3U9RB 3GF7A 2J5GA 4IZCA 2J5IB 3ZWCA 3IAVA 5INFA 2FZSA 2HW5A 5DZKA 3ADBA 1UYSA 1WDKA 4GEHB 2FBMA 2NP9A 3WG5A 3HRXA 4I42A 3IRBA 3PZKA 3KTIA 3T8AA 1HZDA 4ZDEA 4IZDA 4B3IA 4JCRA 3MFMA 4MI2A 3ZW8A 5DUFA 1UIYA 3P5MA 1PJHA 5E0SA 4OG1A 2CBYA 3ST9A 3PE8A 3T89A 4ZDCA 1DCIA 4ELXA 1PIXA 3QREA 1NZYB 2VSSA 4I52A 3NJDA 4MXIA 3HE2A 4DI1A 3P85A 1SZOA 2VX2A 1EY3A 3W8HB 4U18A 4FJWD 2PPYA 3FF6A 2UZFA 4JCQA 3T8BA 3H02A 3OMEA 2VSSF 3TVWA 5KDRB 4KNPA 5DUCA 4LK5A 4JWVA 4B3HA 1FCFA 1OD4A 2DUBA 3MYBA 3Q0GA 4OLQA 4ASIA 1SG4A 4U0HA 4EMPA 3STAA 3MT6A 3TT6A 4F47A 3PEAA 5KDRA 4HDTA 2VSUE 3H0JA 3OT6A 4FNBA 4JJTA 1UYTA 1WDMA 2VSUC 5G1SA 4EMMA 2F9YB 3A4NA 2Q34A 3A4MA 4JYLA 3AM1A 4U19A 3ADDA 5IKLB 1JXZA 4L8KA 3QYRA 4HNKA 1XO6A 3KTGA 2ZL0A 3W8IB 3K50A 1FC9A 4KWBA 4WCZA 3P2LA 2J5IA 3SLLA 3TRRA 1W2XA 4MOUA 4YLHA 1HNOA 2GTRA 1HNUA 5DZKH 3H0UA 3V5IA 3K8XA 3QXZA 4JCSA 3RQFA 2A7SA 1J7XA 4RCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIN A;  1XX4 A;  1XNV A;  2W3P A;  1ON9 A;  4B3J A;  2X24 A;  2ZL3 A;  5DTP A;  1NZY A;  3DOR A;  1RJM A;  1VRG A;  3ISA A;  3BPP A;  2D3T A;  2Q35 A;  3GF3 A;  2CE3 A;  4JYJ A;  5JBX A;  1Q52 A;  2VSU F;  4FB8 A;  4G2R A;  4RYF H;  5CTB A;  1FC6 A;  3IBB A;  2ZL4 A;  2X58 A;  3HLN 1;  4JSB A;  1K39 A;  3Q7H A;  3TLF A;  4JFC A;  2PBP A;  5FUS A;  4KD6 A;  4HC8 A;  4JCT A;  5ING A;  4U1A A;  2A7K A;  1N6F A;  1DUB A;  4I4Z A;  3RRV A;  4L6W A;  3PGQ A;  3ZWB A;  5KJP A;  2BZR A;  3H81 A;  3LAO A;  3M6N A;  1TG6 A;  4K2N A;  3JU1 A;  3R0O A;  4RYF A;  3I47 A;  2F6Q A;  4FND A;  1XNY A;  3TVU A;  2F9Y A;  3QK8 A;  3GLM A;  3QMJ A;  3QXI A;  1TYF A;  4ELW A;  5G1Q A;  2Q2X A;  4FN8 A;  3Q1T A;  3QKA A;  2J5G D;  3QWD A;  3N6R B;  5DU6 A;  5DU4 A;  1RJN A;  4OMR A;  1EF8 A;  3T3W A;  5C9G A;  2J5S A;  5G1R A;  1EF9 A;  2A81 A;  4K29 A;  2VSS E;  3M6M A;  4FN7 A;  4KPK A;  2FW2 A;  1YG6 A;  3Q0J A;  2ZQQ A;  1WDL A;  3NJB A;  3GMA A;  5INI A;  3R9Q A;  5E0N X;  3TZ3 A;  3V5E A;  5E0S H;  4JOT A;  1UYV A;  1YG8 A;  4K3W A;  2EJ5 A;  4ZDB A;  1K32 A;  1ON3 A;  3KTK A;  3T88 A;  2ZQR A;  4QFE A;  4NNQ A;  2DEO A;  4WZ8 B;  2F9I B;  3OC7 A;  5MGB A;  3DJA A;  4Q0G A;  3MOY A;  1UYR A;  4ELS A;  5FIF A;  5C90 A;  5DU8 A;  3BF0 A;  3G64 A;  1WZ8 A;  3KTJ A;  3RSI A;  4FZW C;  1MJ3 A;  3GKB A;  4WYO B;  5DKP A;  3R9T A;  3ZW9 A;  4NEK A;  1N6D A;  3H0S A;  3LKE A;  4GHN A;  2VSU A;  3TV5 A;  2F6I A;  5CTC A;  1O8U A;  2F9I A;  4GM2 A;  3BEZ A;  2WTB A;  4Q1I A;  4FZW A;  3RST A;  3ZWA A;  2C8T A;  4U0G H;  2VRE A;  5DTW A;  3HP0 A;  3U9S B;  3TDC A;  3R9S A;  2QQ3 A;  1Y7O A;  3IB9 A;  4U0G A;  2ZL2 A;  1X0U A;  4ZDD A;  3KTH A;  3SWX A;  2J5I I;  4ZU2 A;  4QIJ A;  1OD2 A;  5DL1 A;  2IEX A;  3KQF A;  2PG8 A;  3VIV A;  5JBW A;  4IZB A;  3TT7 A;  4JVT A;  1FC7 A;  3R6H A;  4ZDF A;  1Q51 A;  1XNW A;  1N6E A;  3FDU A;  4EML A;  4QII A;  3L3S A;  3H0Q A;  3U9T B;  4Z0M A;  3U9R B;  3GF7 A;  2J5G A;  4IZC A;  2J5I B;  3ZWC A;  3IAV A;  5INF A;  2FZS A;  2HW5 A;  5DZK A;  1UYS A;  1WDK A;  2FBM A;  2NP9 A;  3WG5 A;  3HRX A;  4I42 A;  3PZK A;  3KTI A;  3T8A A;  1HZD A;  4ZDE A;  4IZD A;  4B3I A;  4JCR A;  3MFM A;  4MI2 A;  3ZW8 A;  5DUF A;  1UIY A;  3P5M A;  1PJH A;  5E0S A;  4OG1 A;  2CBY A;  3ST9 A;  3PE8 A;  3T89 A;  4ZDC A;  1DCI A;  4ELX A;  1PIX A;  3QRE A;  1NZY B;  2VSS A;  4I52 A;  3NJD A;  4MXI A;  3HE2 A;  4DI1 A;  3P85 A;  1SZO A;  2VX2 A;  1EY3 A;  4U18 A;  4FJW D;  2PPY A;  3FF6 A;  2UZF A;  4JCQ A;  3T8B A;  3H02 A;  3OME A;  2VSS F;  3TVW A;  5KDR B;  4KNP A;  5DUC A;  4LK5 A;  4JWV A;  4B3H A;  1FCF A;  1OD4 A;  2DUB A;  3MYB A;  3Q0G A;  4OLQ A;  4ASI A;  1SG4 A;  4U0H A;  4EMP A;  3STA A;  3MT6 A;  3TT6 A;  4F47 A;  3PEA A;  5KDR A;  2VSU E;  3H0J A;  3OT6 A;  4FNB A;  4JJT A;  1UYT A;  1WDM A;  2VSU C;  5G1S A;  4EMM A;  2F9Y B;  2Q34 A;  4JYL A;  4U19 A;  5IKL B;  1JXZ A;  4L8K A;  3QYR A;  4HNK A;  1XO6 A;  3KTG A;  2ZL0 A;  3K50 A;  1FC9 A;  4KWB A;  4WCZ A;  3P2L A;  2J5I A;  3SLL A;  3TRR A;  1W2X A;  4MOU A;  4YLH A;  1HNO A;  2GTR A;  1HNU A;  5DZK H;  3H0U A;  3V5I A;  3K8X A;  3QXZ A;  4JCS A;  2A7S A;  1J7X A;  4RCN A; 
#chains in the Genus database with same CATH topology
 1UX4 A;  3HIN A;  1Y64 B;  1XX4 A;  1XNV A;  2W3P A;  1ON9 A;  4B3J A;  2X24 A;  2ZL3 A;  5DTP A;  1NZY A;  3DOR A;  2P63 A;  1RJM A;  1VRG A;  3ISA A;  3BPP A;  2D3T A;  2Q35 A;  3GF3 A;  2CE3 A;  4JYJ A;  5JBX A;  1Q52 A;  2VSU F;  4FB8 A;  4G2R A;  4RYF H;  5CTB A;  1FC6 A;  3IBB A;  2ZL4 A;  2X58 A;  3HLN 1;  4JSB A;  3TLF A;  1K39 A;  3Q7H A;  4JFC A;  2PBP A;  5FUS A;  4KD6 A;  4J2U A;  4HC8 A;  4JCT A;  5ING A;  4U1A A;  2A7K A;  1N6F A;  1DUB A;  4I4Z A;  3RRV A;  4L6W A;  3PGQ A;  3ZWB A;  5KJP A;  3H81 A;  2BZR A;  3LAO A;  3M6N A;  1UX5 A;  1TG6 A;  3RQE A;  4K2N A;  3JU1 A;  3R0O A;  4RYF A;  3I47 A;  2F6Q A;  4FND A;  1XNY A;  3TVU A;  2F9Y A;  3QK8 A;  3GLM A;  3QMJ A;  3QXI A;  1TYF A;  4ELW A;  5G1Q A;  2Q2X A;  4FN8 A;  3Q1T A;  3QKA A;  2J5G D;  3QWD A;  3N6R B;  5DU6 A;  5DU4 A;  1RJN A;  4OMR A;  1EF8 A;  3T3W A;  5C9G A;  2J5S A;  5G1R A;  1EF9 A;  2A81 A;  4K29 A;  2VSS E;  3M6M A;  4FN7 A;  4KPK A;  5HUQ A;  2FW2 A;  3ADC A;  1YG6 A;  3Q0J A;  2ZQQ A;  1WDL A;  3NJB A;  3GMA A;  3L8J A;  5INI A;  3R9Q A;  5E0N X;  3TZ3 A;  3AJM A;  3V5E A;  5E0S H;  4JOT A;  1UYV A;  1YG8 A;  4K3W A;  2EJ5 A;  3A4L A;  4ZDB A;  1K32 A;  1ON3 A;  3KTK A;  3T88 A;  2ZQR A;  3RQG A;  4QFE A;  4NNQ A;  2DEO A;  4WZ8 B;  2F9I B;  3OC7 A;  5MGB A;  3DJA A;  4Q0G A;  3MOY A;  1UYR A;  4ELS A;  5FIF A;  5C90 A;  5DU8 A;  3BF0 A;  3G64 A;  1WZ8 A;  3KTJ A;  3RSI A;  4FZW C;  1MJ3 A;  3GKB A;  4WYO B;  5DKP A;  3R9T A;  3ZW9 A;  4NEK A;  1N6D A;  3H0S A;  3LKE A;  4GHN A;  2VSU A;  3TV5 A;  2F6I A;  5CTC A;  3L8I A;  1O8U A;  2F9I A;  4GM2 A;  3BEZ A;  2WTB A;  4Q1I A;  4FZW A;  3RST A;  3ZWA A;  2C8T A;  4U0G H;  2VRE A;  5DTW A;  3HP0 A;  3U9S B;  3TDC A;  3R9S A;  2QQ3 A;  1Y7O A;  3IB9 A;  4U0G A;  2ZL2 A;  1X0U A;  2YJG A;  4ZDD A;  3KTH A;  3BPT A;  3SWX A;  2J5I I;  4ZU2 A;  4QIJ A;  1OD2 A;  5DL1 A;  2IEX A;  3KQF A;  2PG8 A;  4NAR A;  3VIV A;  5JBW A;  4IZB A;  3TT7 A;  4JVT A;  1FC7 A;  3R6H A;  4ZDF A;  1Q51 A;  3O4X E;  1XNW A;  1N6E A;  3FDU A;  4EML A;  4QII A;  3L3S A;  3H0Q A;  3U9T B;  4Z0M A;  3U9R B;  3GF7 A;  2J5G A;  4IZC A;  2J5I B;  3ZWC A;  3IAV A;  5INF A;  2HW5 A;  2FZS A;  5DZK A;  3ADB A;  1UYS A;  1WDK A;  4GEH B;  2FBM A;  2NP9 A;  3WG5 A;  3HRX A;  4I42 A;  3IRB A;  3PZK A;  3KTI A;  3T8A A;  1HZD A;  4ZDE A;  4IZD A;  4B3I A;  4JCR A;  3MFM A;  4MI2 A;  3ZW8 A;  5DUF A;  1UIY A;  3P5M A;  1PJH A;  5E0S A;  4OG1 A;  2CBY A;  3ST9 A;  3PE8 A;  3T89 A;  4ZDC A;  1DCI A;  4ELX A;  1PIX A;  3QRE A;  1NZY B;  2VSS A;  4I52 A;  3NJD A;  4MXI A;  3HE2 A;  4DI1 A;  3P85 A;  2VX2 A;  1SZO A;  1EY3 A;  4U18 A;  3W8H B;  4FJW D;  2PPY A;  3FF6 A;  2UZF A;  4JCQ A;  3T8B A;  3H02 A;  3OME A;  2VSS F;  3TVW A;  5KDR B;  4KNP A;  5DUC A;  4LK5 A;  4JWV A;  4B3H A;  1FCF A;  1OD4 A;  2DUB A;  3MYB A;  3Q0G A;  4OLQ A;  4ASI A;  1SG4 A;  4U0H A;  4EMP A;  3STA A;  3MT6 A;  3TT6 A;  4F47 A;  3PEA A;  5KDR A;  4HDT A;  2VSU E;  3H0J A;  3OT6 A;  4FNB A;  4JJT A;  1UYT A;  1WDM A;  2VSU C;  5G1S A;  4EMM A;  2F9Y B;  3A4N A;  2Q34 A;  3A4M A;  4JYL A;  4U19 A;  3AM1 A;  3ADD A;  5IKL B;  1JXZ A;  4L8K A;  3QYR A;  4HNK A;  1XO6 A;  3KTG A;  2ZL0 A;  3W8I B;  3K50 A;  1FC9 A;  4KWB A;  4WCZ A;  3P2L A;  3SLL A;  2J5I A;  3TRR A;  1W2X A;  4MOU A;  4YLH A;  1HNO A;  2GTR A;  1HNU A;  5DZK H;  3H0U A;  3V5I A;  3QXZ A;  3K8X A;  4JCS A;  3RQF A;  2A7S A;  1J7X A;  4RCN A; 
#chains in the Genus database with same CATH homology
 1UX4 A;  3HIN A;  1Y64 B;  1XX4 A;  1XNV A;  2W3P A;  1ON9 A;  4B3J A;  2X24 A;  2ZL3 A;  5DTP A;  1NZY A;  3DOR A;  2P63 A;  1RJM A;  1VRG A;  3ISA A;  3BPP A;  2D3T A;  2Q35 A;  3GF3 A;  2CE3 A;  4JYJ A;  5JBX A;  1Q52 A;  2VSU F;  4FB8 A;  4G2R A;  4RYF H;  5CTB A;  1FC6 A;  3IBB A;  2ZL4 A;  2X58 A;  3HLN 1;  4JSB A;  1K39 A;  3Q7H A;  3TLF A;  4JFC A;  2PBP A;  5FUS A;  4KD6 A;  4J2U A;  4HC8 A;  4JCT A;  5ING A;  4U1A A;  2A7K A;  1N6F A;  1DUB A;  4I4Z A;  3RRV A;  4L6W A;  3PGQ A;  3ZWB A;  5KJP A;  2BZR A;  3H81 A;  3LAO A;  3M6N A;  1UX5 A;  1TG6 A;  3RQE A;  4K2N A;  3JU1 A;  3R0O A;  4RYF A;  3I47 A;  2F6Q A;  4FND A;  1XNY A;  3TVU A;  2F9Y A;  3QK8 A;  3GLM A;  3QMJ A;  3QXI A;  1TYF A;  4ELW A;  5G1Q A;  2Q2X A;  4FN8 A;  3Q1T A;  3QKA A;  2J5G D;  3QWD A;  3N6R B;  5DU6 A;  5DU4 A;  1RJN A;  4OMR A;  1EF8 A;  3T3W A;  5C9G A;  2J5S A;  5G1R A;  1EF9 A;  2A81 A;  4K29 A;  2VSS E;  3M6M A;  4FN7 A;  4KPK A;  5HUQ A;  2FW2 A;  3ADC A;  1YG6 A;  3Q0J A;  2ZQQ A;  1WDL A;  3NJB A;  3GMA A;  3L8J A;  5INI A;  3R9Q A;  5E0N X;  3TZ3 A;  3AJM A;  3V5E A;  5E0S H;  4JOT A;  1UYV A;  1YG8 A;  4K3W A;  2EJ5 A;  3A4L A;  4ZDB A;  1K32 A;  1ON3 A;  3KTK A;  3T88 A;  2ZQR A;  3RQG A;  4QFE A;  4NNQ A;  2DEO A;  4WZ8 B;  2F9I B;  3OC7 A;  5MGB A;  3DJA A;  4Q0G A;  3MOY A;  1UYR A;  4ELS A;  5FIF A;  5C90 A;  5DU8 A;  3BF0 A;  3G64 A;  1WZ8 A;  3KTJ A;  3RSI A;  4FZW C;  1MJ3 A;  3GKB A;  4WYO B;  5DKP A;  3R9T A;  3ZW9 A;  4NEK A;  1N6D A;  3H0S A;  3LKE A;  4GHN A;  2VSU A;  3TV5 A;  2F6I A;  5CTC A;  3L8I A;  1O8U A;  2F9I A;  4GM2 A;  3BEZ A;  2WTB A;  4Q1I A;  4FZW A;  3RST A;  3ZWA A;  2C8T A;  4U0G H;  2VRE A;  5DTW A;  3HP0 A;  3U9S B;  3TDC A;  3R9S A;  2QQ3 A;  1Y7O A;  3IB9 A;  4U0G A;  2ZL2 A;  1X0U A;  2YJG A;  4ZDD A;  3KTH A;  3BPT A;  3SWX A;  2J5I I;  4ZU2 A;  4QIJ A;  1OD2 A;  5DL1 A;  2IEX A;  3KQF A;  2PG8 A;  4NAR A;  3VIV A;  5JBW A;  4IZB A;  3TT7 A;  4JVT A;  1FC7 A;  3R6H A;  4ZDF A;  1Q51 A;  3O4X E;  1XNW A;  1N6E A;  3FDU A;  4EML A;  4QII A;  3L3S A;  3H0Q A;  3U9T B;  4Z0M A;  3U9R B;  3GF7 A;  2J5G A;  4IZC A;  2J5I B;  3ZWC A;  3IAV A;  5INF A;  2FZS A;  2HW5 A;  5DZK A;  3ADB A;  1UYS A;  1WDK A;  4GEH B;  2FBM A;  2NP9 A;  3WG5 A;  3HRX A;  4I42 A;  3IRB A;  3PZK A;  3KTI A;  3T8A A;  1HZD A;  4ZDE A;  4IZD A;  4B3I A;  4JCR A;  3MFM A;  4MI2 A;  3ZW8 A;  5DUF A;  1UIY A;  3P5M A;  1PJH A;  5E0S A;  4OG1 A;  2CBY A;  3ST9 A;  3PE8 A;  3T89 A;  4ZDC A;  1DCI A;  4ELX A;  1PIX A;  3QRE A;  1NZY B;  2VSS A;  4I52 A;  3NJD A;  4MXI A;  3HE2 A;  4DI1 A;  3P85 A;  1SZO A;  2VX2 A;  1EY3 A;  3W8H B;  4U18 A;  4FJW D;  2PPY A;  3FF6 A;  2UZF A;  4JCQ A;  3T8B A;  3H02 A;  3OME A;  2VSS F;  3TVW A;  5KDR B;  4KNP A;  5DUC A;  4LK5 A;  4JWV A;  4B3H A;  1FCF A;  1OD4 A;  2DUB A;  3MYB A;  3Q0G A;  4OLQ A;  4ASI A;  1SG4 A;  4U0H A;  4EMP A;  3STA A;  3MT6 A;  3TT6 A;  4F47 A;  3PEA A;  5KDR A;  4HDT A;  2VSU E;  3H0J A;  3OT6 A;  4FNB A;  4JJT A;  1UYT A;  1WDM A;  2VSU C;  5G1S A;  4EMM A;  2F9Y B;  3A4N A;  2Q34 A;  3A4M A;  4JYL A;  3AM1 A;  4U19 A;  3ADD A;  5IKL B;  1JXZ A;  4L8K A;  3QYR A;  4HNK A;  1XO6 A;  3KTG A;  2ZL0 A;  3W8I B;  3K50 A;  1FC9 A;  4KWB A;  4WCZ A;  3P2L A;  2J5I A;  3SLL A;  3TRR A;  1W2X A;  4MOU A;  4YLH A;  1HNO A;  2GTR A;  1HNU A;  5DZK H;  3H0U A;  3V5I A;  3K8X A;  3QXZ A;  4JCS A;  3RQF A;  2A7S A;  1J7X A;  4RCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...