1RJNA

The crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
259
Chain Sequence
DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords menB
total genus 96
structure length 259
sequence length 280
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1rjnA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1rjnA01
1WDMA 4ZDDA 4JYJA 3SWXA 3GF7A 1MJ3A 3MYBA 4DI1A 4K29A 3TT7A 3T89A 3R0OA 1UYSA 3NJBA 4FJWD 4KNPA 3QYRA 5E0NX 5G1QA 2ZQRA 1HZDA 2VSSF 4FB8A 4LK5A 4U0GH 4JVTA 2J5GA 4ASIA 4EMPA 1PJHA 3TV5A 4OLQA 4GM2A 1X0UA 4JCQA 5INFA 2ZL2A 2F6IA 4JYLA 3H0SA 3P2LA 3BF0A 1PIXA 5C9GA 2X58A 3LAOA 1WDKA 3FF6A 1HNUA 3Q0JA 2PPYA 1Q52A 4OMRA 1N6FA 3DJAA 3QMJA 5KJPA 4B3IA 3IAVA 1NZYA 3PEAA 4HNKA 1O8UA 5DKPA 3H0JA 3V5IA 3VIVA 3P5MA 1K32A 5CTCA 2VSUF 2W3PA 2Q34A 3QWDA 4IZDA 4ELXA 2C8TA 4U1AA 3GF3A 3TVUA 3ZWCA 3L3SA 4KD6A 4I52A 1Y7OA 3TRRA 4I42A 3GMAA 2FW2A 2D3TA 4EMMA 4FN7A 3KTGA 2DEOA 3HP0A 4IZBA 2F6QA 5FIFA 4OG1A 5IKLB 4YLHA 4GHNA 3IB9A 2EJ5A 2VREA 5DTPA 5G1SA 5INGA 2VSUE 3G64A 2A7KA 3QREA 4ZDFA 3R9TA 4ZDEA 4KPKA 2DUBA 2GTRA 3M6MA 4ZDBA 1RJMA 2CBYA 4L8KA 1SG4A 5JBWA 4JJTA 2X24A 2J5SA 3ZWAA 3GKBA 1EF8A 3OT6A 3BPPA 5E0SH 4U18A 4MI2A 1Q51A 5E0SA 2FZSA 5CTBA 4U19A 4RYFH 5DUFA 5MGBA 4FZWA 3MOYA 1K39A 4U0HA 4ELSA 1DCIA 4IZCA 1FC9A 3T3WA 4U0GA 2F9YA 1UYVA 3GLMA 3K50A 4G2RA 3PE8A 4L6WA 2F9IA 3P85A 3OMEA 3ST9A 5KDRB 2HW5A 4FNBA 3ZWBA 4JCRA 4NEKA 3OC7A 3V5EA 4WZ8B 3ZW9A 4QIJA 2PBPA 3TZ3A 3KTHA 1HNOA 3U9SB 3HINA 4MXIA 2VSSA 1ON3A 3NJDA 4Q1IA 4KWBA 1XO6A 3ISAA 3H81A 5KDRA 1YG8A 2VX2A 3QKAA 2ZL4A 3TLFA 3H0UA 3IBBA 5DUCA 1XX4A 2ZL0A 3HLN1 1ON9A 4F47A 3T8AA 2PG8A 3QXZA 5DL1A 1FC6A 5DU6A 2J5IB 3RSTA 3TVWA 2FBMA 3U9TB 3BEZA 4JWVA 1TG6A 4RYFA 3HE2A 3RRVA 3ZW8A 4FN8A 2A81A 4QIIA 3TT6A 2ZQQA 4Q0GA 3U9RB 4RCNA 1TYFA 3LKEA 4NNQA 1FC7A 2ZL3A 4Z0MA 2NP9A 4WYOB 3KTIA 3HRXA 2J5IA 1FCFA 3MFMA 3Q7HA 4B3JA 3MT6A 5DU8A 3DORA 4JCSA 4B3HA 2J5II 4ZU2A 3KTKA 3Q1TA 3T8BA 1WZ8A 4QFEA 2VSUC 1XNYA 1UYTA 2UZFA 1OD2A 1RJNA 1W2XA 1EY3A 1J7XA 5INIA 1UIYA 3T88A 3KTJA 3PZKA 4ZDCA 2F9YB 1SZOA 4ELWA 1YG6A 5JBXA 4MOUA 2BZRA 2Q35A 4EMLA 5FUSA 4I4ZA 1UYRA 4FNDA 1EF9A 4HC8A 3I47A 1JXZA 3QK8A 3M6NA 3TDCA 3KQFA 3JU1A 3PGQA 2IEXA 4JFCA 3K8XA 2J5GD 4K3WA 2F9IB 1N6DA 1NZYB 4JCTA 2VSSE 2CE3A 3R9QA 1XNWA 4JOTA 5C90A 3FDUA 3H0QA 5DTWA 2WTBA 1DUBA 3H02A 1OD4A 1VRGA 3N6RB 5G1RA 4JSBA 2A7SA 2VSUA 2QQ3A 1N6EA 3R6HA 3WG5A 1XNVA 4WCZA 3STAA 4FZWC 2Q2XA 5DZKA 3Q0GA 4K2NA 3RSIA 1WDLA 3R9SA 5DZKH 5DU4A 3SLLA 3QXIA
chains in the Genus database with same CATH superfamily
1WDMA 4ZDDA 4JYJA 3SWXA 3GF7A 1MJ3A 3MYBA 4DI1A 4K29A 3TT7A 3T89A 3R0OA 1UYSA 3NJBA 4FJWD 4KNPA 3QYRA 5E0NX 5G1QA 2ZQRA 1HZDA 2VSSF 4FB8A 4LK5A 4U0GH 4JVTA 2J5GA 4ASIA 4EMPA 1PJHA 3TV5A 4OLQA 4GM2A 1X0UA 4JCQA 5INFA 2ZL2A 2F6IA 4JYLA 3H0SA 3P2LA 3BF0A 1PIXA 5C9GA 2X58A 3LAOA 1WDKA 3FF6A 1HNUA 3Q0JA 2PPYA 1Q52A 4OMRA 1N6FA 3DJAA 3QMJA 3AJMA 5KJPA 4B3IA 3IAVA 1NZYA 3PEAA 4HNKA 1O8UA 5DKPA 3H0JA 3V5IA 3VIVA 3P5MA 1K32A 3ADCA 2YJGA 5CTCA 2VSUF 2W3PA 2Q34A 3QWDA 4IZDA 4ELXA 2C8TA 4U1AA 3GF3A 3TVUA 3ZWCA 3L3SA 4KD6A 4I52A 1Y7OA 3TRRA 4I42A 3GMAA 2FW2A 2D3TA 4EMMA 4FN7A 3KTGA 2DEOA 3HP0A 4IZBA 2F6QA 5FIFA 4OG1A 5IKLB 3RQEA 4YLHA 4GHNA 3IB9A 2EJ5A 2VREA 5DTPA 5G1SA 4NARA 5INGA 2VSUE 3G64A 2A7KA 3QREA 4ZDFA 3R9TA 4ZDEA 4KPKA 2DUBA 2GTRA 3M6MA 4ZDBA 3O4XE 1RJMA 2CBYA 4L8KA 1SG4A 5JBWA 3L8IA 4JJTA 2X24A 2J5SA 3ZWAA 3GKBA 1EF8A 3OT6A 3BPPA 5E0SH 4U18A 4MI2A 1Q51A 5E0SA 2FZSA 5CTBA 4U19A 4RYFH 5DUFA 5MGBA 4FZWA 3MOYA 1K39A 4U0HA 4ELSA 1DCIA 4IZCA 1FC9A 2P63A 3ADDA 3T3WA 4U0GA 2F9YA 3A4MA 1UYVA 3GLMA 3K50A 4G2RA 3PE8A 4J2UA 4L6WA 2F9IA 3P85A 3OMEA 3ST9A 5KDRB 2HW5A 4FNBA 3ZWBA 4JCRA 4NEKA 3OC7A 3V5EA 4WZ8B 3ZW9A 4QIJA 2PBPA 3TZ3A 3AM1A 3KTHA 1HNOA 4HDTA 3U9SB 3HINA 4MXIA 2VSSA 1ON3A 3BPTA 3NJDA 4Q1IA 4KWBA 1XO6A 3W8HB 1UX4A 3ISAA 3H81A 5KDRA 1YG8A 2VX2A 3QKAA 2ZL4A 3TLFA 3H0UA 3IBBA 5DUCA 1XX4A 2ZL0A 3HLN1 1ON9A 3W8IB 4F47A 3T8AA 2PG8A 3QXZA 5DL1A 4GEHB 1FC6A 5DU6A 2J5IB 3A4LA 3RSTA 3TVWA 2FBMA 3U9TB 3BEZA 3L8JA 4JWVA 1TG6A 4RYFA 3HE2A 3RRVA 3ZW8A 4FN8A 2A81A 4QIIA 3TT6A 2ZQQA 4Q0GA 3U9RB 4RCNA 1TYFA 3LKEA 4NNQA 1FC7A 2ZL3A 4Z0MA 2NP9A 4WYOB 3KTIA 3HRXA 2J5IA 1FCFA 3RQGA 3MFMA 3Q7HA 4B3JA 3MT6A 1UX5A 5DU8A 3DORA 1Y64B 4JCSA 4B3HA 2J5II 4ZU2A 3KTKA 3Q1TA 3T8BA 1WZ8A 4QFEA 2VSUC 1XNYA 1UYTA 2UZFA 1OD2A 1RJNA 1W2XA 1EY3A 1J7XA 5INIA 1UIYA 3T88A 3RQFA 3ADBA 3KTJA 3PZKA 4ZDCA 2F9YB 1SZOA 4ELWA 1YG6A 5JBXA 4MOUA 2BZRA 2Q35A 4EMLA 5FUSA 4I4ZA 1UYRA 4FNDA 1EF9A 3IRBA 4HC8A 3I47A 1JXZA 3QK8A 3M6NA 3TDCA 3KQFA 3JU1A 3PGQA 2IEXA 4JFCA 3K8XA 2J5GD 4K3WA 2F9IB 1N6DA 1NZYB 4JCTA 2VSSE 2CE3A 3R9QA 1XNWA 4JOTA 5C90A 3FDUA 3H0QA 5DTWA 2WTBA 1DUBA 3H02A 1OD4A 1VRGA 3N6RB 5G1RA 4JSBA 2A7SA 5HUQA 2VSUA 2QQ3A 3A4NA 1N6EA 3R6HA 3WG5A 1XNVA 4WCZA 3STAA 4FZWC 2Q2XA 5DZKA 3Q0GA 4K2NA 3RSIA 1WDLA 3R9SA 5DZKH 5DU4A 3SLLA 3QXIA
chains in the Genus database with same CATH topology
1WDMA 4ZDDA 4JYJA 3SWXA 3GF7A 1MJ3A 3MYBA 4DI1A 4K29A 3TT7A 3T89A 3R0OA 1UYSA 3NJBA 4FJWD 4KNPA 3QYRA 5E0NX 5G1QA 2ZQRA 1HZDA 2VSSF 4FB8A 4LK5A 4U0GH 4JVTA 2J5GA 4ASIA 4EMPA 1PJHA 3TV5A 4OLQA 4GM2A 1X0UA 4JCQA 5INFA 2ZL2A 2F6IA 4JYLA 3H0SA 3P2LA 3BF0A 1PIXA 5C9GA 2X58A 3LAOA 1WDKA 3FF6A 1HNUA 3Q0JA 2PPYA 1Q52A 4OMRA 1N6FA 3DJAA 3QMJA 5KJPA 4B3IA 3IAVA 1NZYA 3PEAA 4HNKA 1O8UA 5DKPA 3H0JA 3V5IA 3VIVA 3P5MA 1K32A 2YJGA 5CTCA 2VSUF 2W3PA 2Q34A 3QWDA 4IZDA 4ELXA 2C8TA 4U1AA 3GF3A 3TVUA 3ZWCA 3L3SA 4KD6A 4I52A 1Y7OA 3TRRA 4I42A 3GMAA 2FW2A 2D3TA 4EMMA 4FN7A 3KTGA 2DEOA 3HP0A 4IZBA 2F6QA 5FIFA 4OG1A 5IKLB 4YLHA 4GHNA 3IB9A 2EJ5A 2VREA 5DTPA 5G1SA 4NARA 5INGA 2VSUE 3G64A 2A7KA 3QREA 4ZDFA 3R9TA 4ZDEA 4KPKA 2DUBA 2GTRA 3M6MA 4ZDBA 1RJMA 2CBYA 4L8KA 1SG4A 5JBWA 4JJTA 2X24A 2J5SA 3ZWAA 3GKBA 1EF8A 3OT6A 3BPPA 5E0SH 4U18A 4MI2A 1Q51A 5E0SA 2FZSA 5CTBA 4U19A 4RYFH 5DUFA 5MGBA 4FZWA 3MOYA 1K39A 4U0HA 4ELSA 1DCIA 4IZCA 1FC9A 3T3WA 4U0GA 2F9YA 1UYVA 3GLMA 3K50A 4G2RA 3PE8A 4J2UA 4L6WA 2F9IA 3P85A 3OMEA 3ST9A 5KDRB 2HW5A 4FNBA 3ZWBA 4JCRA 4NEKA 3OC7A 3V5EA 4WZ8B 3ZW9A 4QIJA 2PBPA 3TZ3A 3KTHA 1HNOA 4HDTA 3U9SB 3HINA 4MXIA 2VSSA 1ON3A 3BPTA 3NJDA 4Q1IA 4KWBA 1XO6A 3ISAA 3H81A 5KDRA 1YG8A 2VX2A 3QKAA 2ZL4A 3TLFA 3H0UA 3IBBA 5DUCA 1XX4A 2ZL0A 3HLN1 1ON9A 4F47A 3T8AA 2PG8A 3QXZA 5DL1A 1FC6A 5DU6A 2J5IB 3RSTA 3TVWA 2FBMA 3U9TB 3BEZA 4JWVA 1TG6A 4RYFA 3HE2A 3RRVA 3ZW8A 4FN8A 2A81A 4QIIA 3TT6A 2ZQQA 4Q0GA 3U9RB 4RCNA 1TYFA 3LKEA 4NNQA 1FC7A 2ZL3A 4Z0MA 2NP9A 4WYOB 3KTIA 3HRXA 2J5IA 1FCFA 3MFMA 3Q7HA 4B3JA 3MT6A 5DU8A 3DORA 4JCSA 4B3HA 2J5II 4ZU2A 3KTKA 3Q1TA 3T8BA 1WZ8A 4QFEA 2VSUC 1XNYA 1UYTA 2UZFA 1OD2A 1RJNA 1W2XA 1EY3A 1J7XA 5INIA 1UIYA 3T88A 3KTJA 3PZKA 4ZDCA 2F9YB 1SZOA 4ELWA 1YG6A 5JBXA 4MOUA 2BZRA 2Q35A 4EMLA 5FUSA 4I4ZA 1UYRA 4FNDA 1EF9A 4HC8A 3I47A 1JXZA 3QK8A 3M6NA 3TDCA 3KQFA 3JU1A 3PGQA 2IEXA 4JFCA 3K8XA 2J5GD 4K3WA 2F9IB 1N6DA 1NZYB 4JCTA 2VSSE 2CE3A 3R9QA 1XNWA 4JOTA 5C90A 3FDUA 3H0QA 5DTWA 2WTBA 1DUBA 3H02A 1OD4A 1VRGA 3N6RB 5G1RA 4JSBA 2A7SA 5HUQA 2VSUA 2QQ3A 1N6EA 3R6HA 3WG5A 1XNVA 4WCZA 3STAA 4FZWC 2Q2XA 5DZKA 3Q0GA 4K2NA 3RSIA 1WDLA 3R9SA 5DZKH 5DU4A 3SLLA 3QXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDM A;  4ZDD A;  4JYJ A;  3SWX A;  3GF7 A;  1MJ3 A;  3MYB A;  4DI1 A;  4K29 A;  3TT7 A;  3T89 A;  3R0O A;  1UYS A;  3NJB A;  4FJW D;  4KNP A;  3QYR A;  5E0N X;  5G1Q A;  2ZQR A;  1HZD A;  2VSS F;  4FB8 A;  4LK5 A;  4U0G H;  4JVT A;  2J5G A;  4ASI A;  4EMP A;  1PJH A;  3TV5 A;  4OLQ A;  4GM2 A;  1X0U A;  4JCQ A;  5INF A;  2ZL2 A;  2F6I A;  4JYL A;  3H0S A;  3P2L A;  3BF0 A;  1PIX A;  5C9G A;  2X58 A;  3LAO A;  1WDK A;  3FF6 A;  1HNU A;  3Q0J A;  2PPY A;  1Q52 A;  4OMR A;  1N6F A;  3DJA A;  3QMJ A;  5KJP A;  4B3I A;  3IAV A;  1NZY A;  3PEA A;  4HNK A;  1O8U A;  5DKP A;  3H0J A;  3V5I A;  3VIV A;  3P5M A;  1K32 A;  5CTC A;  2VSU F;  2W3P A;  2Q34 A;  3QWD A;  4IZD A;  4ELX A;  2C8T A;  4U1A A;  3GF3 A;  3TVU A;  3ZWC A;  3L3S A;  4KD6 A;  4I52 A;  1Y7O A;  3TRR A;  4I42 A;  3GMA A;  2FW2 A;  2D3T A;  4EMM A;  4FN7 A;  3KTG A;  2DEO A;  3HP0 A;  4IZB A;  2F6Q A;  5FIF A;  4OG1 A;  5IKL B;  4YLH A;  4GHN A;  3IB9 A;  2EJ5 A;  2VRE A;  5DTP A;  5G1S A;  5ING A;  2VSU E;  3G64 A;  2A7K A;  3QRE A;  4ZDF A;  3R9T A;  4ZDE A;  4KPK A;  2DUB A;  2GTR A;  3M6M A;  4ZDB A;  1RJM A;  2CBY A;  4L8K A;  1SG4 A;  5JBW A;  4JJT A;  2X24 A;  2J5S A;  3ZWA A;  3GKB A;  1EF8 A;  3OT6 A;  3BPP A;  5E0S H;  4U18 A;  4MI2 A;  1Q51 A;  5E0S A;  2FZS A;  5CTB A;  4U19 A;  4RYF H;  5DUF A;  5MGB A;  4FZW A;  3MOY A;  1K39 A;  4U0H A;  4ELS A;  1DCI A;  4IZC A;  1FC9 A;  3T3W A;  4U0G A;  2F9Y A;  1UYV A;  3GLM A;  3K50 A;  4G2R A;  3PE8 A;  4L6W A;  2F9I A;  3P85 A;  3OME A;  3ST9 A;  5KDR B;  2HW5 A;  4FNB A;  3ZWB A;  4JCR A;  4NEK A;  3OC7 A;  3V5E A;  4WZ8 B;  3ZW9 A;  4QIJ A;  2PBP A;  3TZ3 A;  3KTH A;  1HNO A;  3U9S B;  3HIN A;  4MXI A;  2VSS A;  1ON3 A;  3NJD A;  4Q1I A;  4KWB A;  1XO6 A;  3ISA A;  3H81 A;  5KDR A;  1YG8 A;  2VX2 A;  3QKA A;  2ZL4 A;  3TLF A;  3H0U A;  3IBB A;  5DUC A;  1XX4 A;  2ZL0 A;  3HLN 1;  1ON9 A;  4F47 A;  3T8A A;  2PG8 A;  3QXZ A;  5DL1 A;  1FC6 A;  5DU6 A;  2J5I B;  3RST A;  3TVW A;  2FBM A;  3U9T B;  3BEZ A;  4JWV A;  1TG6 A;  4RYF A;  3HE2 A;  3RRV A;  3ZW8 A;  4FN8 A;  2A81 A;  4QII A;  3TT6 A;  2ZQQ A;  4Q0G A;  3U9R B;  4RCN A;  1TYF A;  3LKE A;  4NNQ A;  1FC7 A;  2ZL3 A;  4Z0M A;  2NP9 A;  4WYO B;  3KTI A;  3HRX A;  2J5I A;  1FCF A;  3MFM A;  3Q7H A;  4B3J A;  3MT6 A;  5DU8 A;  3DOR A;  4JCS A;  4B3H A;  2J5I I;  4ZU2 A;  3KTK A;  3Q1T A;  3T8B A;  1WZ8 A;  4QFE A;  2VSU C;  1XNY A;  1UYT A;  2UZF A;  1OD2 A;  1RJN A;  1W2X A;  1EY3 A;  1J7X A;  5INI A;  1UIY A;  3T88 A;  3KTJ A;  3PZK A;  4ZDC A;  2F9Y B;  1SZO A;  4ELW A;  1YG6 A;  5JBX A;  4MOU A;  2BZR A;  2Q35 A;  4EML A;  5FUS A;  4I4Z A;  1UYR A;  4FND A;  1EF9 A;  4HC8 A;  3I47 A;  1JXZ A;  3QK8 A;  3M6N A;  3TDC A;  3KQF A;  3JU1 A;  3PGQ A;  2IEX A;  4JFC A;  3K8X A;  2J5G D;  4K3W A;  2F9I B;  1N6D A;  1NZY B;  4JCT A;  2VSS E;  2CE3 A;  3R9Q A;  1XNW A;  4JOT A;  5C90 A;  3FDU A;  3H0Q A;  5DTW A;  2WTB A;  1DUB A;  3H02 A;  1OD4 A;  1VRG A;  3N6R B;  5G1R A;  4JSB A;  2A7S A;  2VSU A;  2QQ3 A;  1N6E A;  3R6H A;  3WG5 A;  1XNV A;  4WCZ A;  3STA A;  4FZW C;  2Q2X A;  5DZK A;  3Q0G A;  4K2N A;  3RSI A;  1WDL A;  3R9S A;  5DZK H;  5DU4 A;  3SLL A;  3QXI A; 
#chains in the Genus database with same CATH topology
 1WDM A;  4ZDD A;  4JYJ A;  3SWX A;  3GF7 A;  1MJ3 A;  3MYB A;  4DI1 A;  4K29 A;  3TT7 A;  3T89 A;  3R0O A;  1UYS A;  3NJB A;  4FJW D;  4KNP A;  3QYR A;  5E0N X;  5G1Q A;  2ZQR A;  1HZD A;  2VSS F;  4FB8 A;  4LK5 A;  4U0G H;  4JVT A;  2J5G A;  4ASI A;  4EMP A;  1PJH A;  3TV5 A;  4OLQ A;  4GM2 A;  1X0U A;  4JCQ A;  5INF A;  2ZL2 A;  2F6I A;  4JYL A;  3H0S A;  3P2L A;  3BF0 A;  1PIX A;  5C9G A;  2X58 A;  3LAO A;  1WDK A;  3FF6 A;  1HNU A;  3Q0J A;  2PPY A;  1Q52 A;  4OMR A;  1N6F A;  3DJA A;  3QMJ A;  3AJM A;  5KJP A;  4B3I A;  3IAV A;  1NZY A;  3PEA A;  4HNK A;  1O8U A;  5DKP A;  3H0J A;  3V5I A;  3VIV A;  3P5M A;  1K32 A;  3ADC A;  2YJG A;  5CTC A;  2VSU F;  2W3P A;  2Q34 A;  3QWD A;  4IZD A;  4ELX A;  2C8T A;  4U1A A;  3GF3 A;  3TVU A;  3ZWC A;  3L3S A;  4KD6 A;  4I52 A;  1Y7O A;  3TRR A;  4I42 A;  3GMA A;  2FW2 A;  2D3T A;  4EMM A;  4FN7 A;  3KTG A;  2DEO A;  3HP0 A;  4IZB A;  2F6Q A;  5FIF A;  4OG1 A;  5IKL B;  3RQE A;  4YLH A;  4GHN A;  3IB9 A;  2EJ5 A;  2VRE A;  5DTP A;  5G1S A;  4NAR A;  5ING A;  2VSU E;  3G64 A;  2A7K A;  3QRE A;  4ZDF A;  3R9T A;  4ZDE A;  4KPK A;  2DUB A;  2GTR A;  3M6M A;  4ZDB A;  3O4X E;  1RJM A;  2CBY A;  4L8K A;  1SG4 A;  5JBW A;  3L8I A;  4JJT A;  2X24 A;  2J5S A;  3ZWA A;  3GKB A;  1EF8 A;  3OT6 A;  3BPP A;  5E0S H;  4U18 A;  4MI2 A;  1Q51 A;  5E0S A;  2FZS A;  5CTB A;  4U19 A;  4RYF H;  5DUF A;  5MGB A;  4FZW A;  3MOY A;  1K39 A;  4U0H A;  4ELS A;  1DCI A;  4IZC A;  1FC9 A;  2P63 A;  3ADD A;  3T3W A;  4U0G A;  2F9Y A;  3A4M A;  1UYV A;  3GLM A;  3K50 A;  4G2R A;  3PE8 A;  4J2U A;  4L6W A;  2F9I A;  3P85 A;  3OME A;  3ST9 A;  5KDR B;  2HW5 A;  4FNB A;  3ZWB A;  4JCR A;  4NEK A;  3OC7 A;  3V5E A;  4WZ8 B;  3ZW9 A;  4QIJ A;  2PBP A;  3TZ3 A;  3AM1 A;  3KTH A;  1HNO A;  4HDT A;  3U9S B;  3HIN A;  4MXI A;  2VSS A;  1ON3 A;  3BPT A;  3NJD A;  4Q1I A;  4KWB A;  1XO6 A;  3W8H B;  1UX4 A;  3ISA A;  3H81 A;  5KDR A;  1YG8 A;  2VX2 A;  3QKA A;  2ZL4 A;  3TLF A;  3H0U A;  3IBB A;  5DUC A;  1XX4 A;  2ZL0 A;  3HLN 1;  1ON9 A;  3W8I B;  4F47 A;  3T8A A;  2PG8 A;  3QXZ A;  5DL1 A;  4GEH B;  1FC6 A;  5DU6 A;  2J5I B;  3A4L A;  3RST A;  3TVW A;  2FBM A;  3U9T B;  3BEZ A;  3L8J A;  4JWV A;  1TG6 A;  4RYF A;  3HE2 A;  3RRV A;  3ZW8 A;  4FN8 A;  2A81 A;  4QII A;  3TT6 A;  2ZQQ A;  4Q0G A;  3U9R B;  4RCN A;  1TYF A;  3LKE A;  4NNQ A;  1FC7 A;  2ZL3 A;  4Z0M A;  2NP9 A;  4WYO B;  3KTI A;  3HRX A;  2J5I A;  1FCF A;  3RQG A;  3MFM A;  3Q7H A;  4B3J A;  3MT6 A;  1UX5 A;  5DU8 A;  3DOR A;  1Y64 B;  4JCS A;  4B3H A;  2J5I I;  4ZU2 A;  3KTK A;  3Q1T A;  3T8B A;  1WZ8 A;  4QFE A;  2VSU C;  1XNY A;  1UYT A;  2UZF A;  1OD2 A;  1RJN A;  1W2X A;  1EY3 A;  1J7X A;  5INI A;  1UIY A;  3T88 A;  3RQF A;  3ADB A;  3KTJ A;  3PZK A;  4ZDC A;  2F9Y B;  1SZO A;  4ELW A;  1YG6 A;  5JBX A;  4MOU A;  2BZR A;  2Q35 A;  4EML A;  5FUS A;  4I4Z A;  1UYR A;  4FND A;  1EF9 A;  3IRB A;  4HC8 A;  3I47 A;  1JXZ A;  3QK8 A;  3M6N A;  3TDC A;  3KQF A;  3JU1 A;  3PGQ A;  2IEX A;  4JFC A;  3K8X A;  2J5G D;  4K3W A;  2F9I B;  1N6D A;  1NZY B;  4JCT A;  2VSS E;  2CE3 A;  3R9Q A;  1XNW A;  4JOT A;  5C90 A;  3FDU A;  3H0Q A;  5DTW A;  2WTB A;  1DUB A;  3H02 A;  1OD4 A;  1VRG A;  3N6R B;  5G1R A;  4JSB A;  2A7S A;  5HUQ A;  2VSU A;  2QQ3 A;  3A4N A;  1N6E A;  3R6H A;  3WG5 A;  1XNV A;  4WCZ A;  3STA A;  4FZW C;  2Q2X A;  5DZK A;  3Q0G A;  4K2N A;  3RSI A;  1WDL A;  3R9S A;  5DZK H;  5DU4 A;  3SLL A;  3QXI A; 
#chains in the Genus database with same CATH homology
 1WDM A;  4ZDD A;  4JYJ A;  3SWX A;  3GF7 A;  1MJ3 A;  3MYB A;  4DI1 A;  4K29 A;  3TT7 A;  3T89 A;  3R0O A;  1UYS A;  3NJB A;  4FJW D;  4KNP A;  3QYR A;  5E0N X;  5G1Q A;  2ZQR A;  1HZD A;  2VSS F;  4FB8 A;  4LK5 A;  4U0G H;  4JVT A;  2J5G A;  4ASI A;  4EMP A;  1PJH A;  3TV5 A;  4OLQ A;  4GM2 A;  1X0U A;  4JCQ A;  5INF A;  2ZL2 A;  2F6I A;  4JYL A;  3H0S A;  3P2L A;  3BF0 A;  1PIX A;  5C9G A;  2X58 A;  3LAO A;  1WDK A;  3FF6 A;  1HNU A;  3Q0J A;  2PPY A;  1Q52 A;  4OMR A;  1N6F A;  3DJA A;  3QMJ A;  5KJP A;  4B3I A;  3IAV A;  1NZY A;  3PEA A;  4HNK A;  1O8U A;  5DKP A;  3H0J A;  3V5I A;  3VIV A;  3P5M A;  1K32 A;  2YJG A;  5CTC A;  2VSU F;  2W3P A;  2Q34 A;  3QWD A;  4IZD A;  4ELX A;  2C8T A;  4U1A A;  3GF3 A;  3TVU A;  3ZWC A;  3L3S A;  4KD6 A;  4I52 A;  1Y7O A;  3TRR A;  4I42 A;  3GMA A;  2FW2 A;  2D3T A;  4EMM A;  4FN7 A;  3KTG A;  2DEO A;  3HP0 A;  4IZB A;  2F6Q A;  5FIF A;  4OG1 A;  5IKL B;  4YLH A;  4GHN A;  3IB9 A;  2EJ5 A;  2VRE A;  5DTP A;  5G1S A;  4NAR A;  5ING A;  2VSU E;  3G64 A;  2A7K A;  3QRE A;  4ZDF A;  3R9T A;  4ZDE A;  4KPK A;  2DUB A;  2GTR A;  3M6M A;  4ZDB A;  1RJM A;  2CBY A;  4L8K A;  1SG4 A;  5JBW A;  4JJT A;  2X24 A;  2J5S A;  3ZWA A;  3GKB A;  1EF8 A;  3OT6 A;  3BPP A;  5E0S H;  4U18 A;  4MI2 A;  1Q51 A;  5E0S A;  2FZS A;  5CTB A;  4U19 A;  4RYF H;  5DUF A;  5MGB A;  4FZW A;  3MOY A;  1K39 A;  4U0H A;  4ELS A;  1DCI A;  4IZC A;  1FC9 A;  3T3W A;  4U0G A;  2F9Y A;  1UYV A;  3GLM A;  3K50 A;  4G2R A;  3PE8 A;  4J2U A;  4L6W A;  2F9I A;  3P85 A;  3OME A;  3ST9 A;  5KDR B;  2HW5 A;  4FNB A;  3ZWB A;  4JCR A;  4NEK A;  3OC7 A;  3V5E A;  4WZ8 B;  3ZW9 A;  4QIJ A;  2PBP A;  3TZ3 A;  3KTH A;  1HNO A;  4HDT A;  3U9S B;  3HIN A;  4MXI A;  2VSS A;  1ON3 A;  3BPT A;  3NJD A;  4Q1I A;  4KWB A;  1XO6 A;  3ISA A;  3H81 A;  5KDR A;  1YG8 A;  2VX2 A;  3QKA A;  2ZL4 A;  3TLF A;  3H0U A;  3IBB A;  5DUC A;  1XX4 A;  2ZL0 A;  3HLN 1;  1ON9 A;  4F47 A;  3T8A A;  2PG8 A;  3QXZ A;  5DL1 A;  1FC6 A;  5DU6 A;  2J5I B;  3RST A;  3TVW A;  2FBM A;  3U9T B;  3BEZ A;  4JWV A;  1TG6 A;  4RYF A;  3HE2 A;  3RRV A;  3ZW8 A;  4FN8 A;  2A81 A;  4QII A;  3TT6 A;  2ZQQ A;  4Q0G A;  3U9R B;  4RCN A;  1TYF A;  3LKE A;  4NNQ A;  1FC7 A;  2ZL3 A;  4Z0M A;  2NP9 A;  4WYO B;  3KTI A;  3HRX A;  2J5I A;  1FCF A;  3MFM A;  3Q7H A;  4B3J A;  3MT6 A;  5DU8 A;  3DOR A;  4JCS A;  4B3H A;  2J5I I;  4ZU2 A;  3KTK A;  3Q1T A;  3T8B A;  1WZ8 A;  4QFE A;  2VSU C;  1XNY A;  1UYT A;  2UZF A;  1OD2 A;  1RJN A;  1W2X A;  1EY3 A;  1J7X A;  5INI A;  1UIY A;  3T88 A;  3KTJ A;  3PZK A;  4ZDC A;  2F9Y B;  1SZO A;  4ELW A;  1YG6 A;  5JBX A;  4MOU A;  2BZR A;  2Q35 A;  4EML A;  5FUS A;  4I4Z A;  1UYR A;  4FND A;  1EF9 A;  4HC8 A;  3I47 A;  1JXZ A;  3QK8 A;  3M6N A;  3TDC A;  3KQF A;  3JU1 A;  3PGQ A;  2IEX A;  4JFC A;  3K8X A;  2J5G D;  4K3W A;  2F9I B;  1N6D A;  1NZY B;  4JCT A;  2VSS E;  2CE3 A;  3R9Q A;  1XNW A;  4JOT A;  5C90 A;  3FDU A;  3H0Q A;  5DTW A;  2WTB A;  1DUB A;  3H02 A;  1OD4 A;  1VRG A;  3N6R B;  5G1R A;  4JSB A;  2A7S A;  5HUQ A;  2VSU A;  2QQ3 A;  1N6E A;  3R6H A;  3WG5 A;  1XNV A;  4WCZ A;  3STA A;  4FZW C;  2Q2X A;  5DZK A;  3Q0G A;  4K2N A;  3RSI A;  1WDL A;  3R9S A;  5DZK H;  5DU4 A;  3SLL A;  3QXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...