1RJNA

The crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
259
Chain Sequence
b'DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords menB
publication title The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 96
structure length 259
sequence length 280
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1rjnA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1rjnA01
1OD4A 1TG6A 3JU1A 2D3TA 5KDRA 2HW5A 1ON9A 3DORA 2ZL4A 4WZ8B 2VX2A 2A81A 3QK8A 5INIA 3U9TB 3R9QA 1XNVA 2F9IB 2PG8A 3Q7HA 2VREA 3H0QA 4GM2A 4I4ZA 5DU6A 3GLMA 4IZCA 4JWVA 2X58A 4K29A 2PPYA 3QREA 3K50A 4JCSA 4FNBA 1MJ3A 2BZRA 4ZDBA 4WYOB 4ZDFA 2F9YB 4QIIA 4GHNA 5G1SA 1PJHA 4FZWC 1RJNA 2Q34A 1XO6A 1XNWA 1FC6A 3HP0A 1NZYB 1K39A 3BEZA 3PZKA 3T89A 4EMPA 5KJPA 2F6QA 4JCRA 3SWXA 1JXZA 3FDUA 3H81A 4JSBA 4FZWA 2VSSA 5MGBA 2CBYA 3PE8A 3SLLA 5DZKA 3KQFA 1K32A 1ON3A 4K2NA 3H0JA 3OMEA 3NJDA 4EMLA 2FZSA 2VSUE 1OD2A 1Y7OA 4KNPA 4ELXA 3KTHA 3HINA 4FN7A 5DU4A 4ZDEA 4KD6A 4Q1IA 4U0GA 3ZWCA 1UYSA 3H02A 4JYJA 1EF8A 4HNKA 2A7SA 4HC8A 3GF7A 4QIJA 3TVUA 3ZWBA 2W3PA 2Q2XA 1VRGA 5INGA 1UYVA 5G1QA 5INFA 3QXZA 2WTBA 1HZDA 1WDKA 3GKBA 3MOYA 5FIFA 3HE2A 4F47A 3H0SA 1UYTA 3QMJA 4NEKA 3G64A 2ZL3A 3T88A 3IAVA 5CTCA 4WCZA 4IZBA 3M6NA 2A7KA 4JJTA 3ZW9A 4Z0MA 4ELSA 4ZDDA 3RSIA 3M6MA 4U1AA 3TT6A 3GF3A 3RRVA 4L8KA 3KTKA 2J5IB 3T3WA 3PEAA 2UZFA 2Q35A 2GTRA 4K3WA 2NP9A 1DCIA 2DUBA 4JCTA 5DZKH 1N6DA 3TRRA 1O8UA 4B3JA 4RCNA 5DU8A 4B3IA 1N6FA 3N6RB 4FB8A 3STAA 2EJ5A 4IZDA 1WDLA 3HLN1 2DEOA 5DKPA 4U0GH 4I52A 3V5EA 1SZOA 3R6HA 4JCQA 2J5GA 3P2LA 3MYBA 1UIYA 4Q0GA 5JBXA 3Q0GA 4YLHA 4U18A 3K8XA 3PGQA 3BPPA 1PIXA 2ZL0A 2J5SA 5DTWA 2F9YA 4ASIA 4MOUA 2ZQQA 5E0SH 5KDRB 1NZYA 4ELWA 3I47A 3LAOA 4KPKA 1YG8A 5G1RA 1W2XA 1WDMA 3QYRA 3Q1TA 2VSUC 3QXIA 2QQ3A 1TYFA 3FF6A 3U9SB 4QFEA 1HNOA 1DUBA 3OC7A 2VSUF 3WG5A 4FN8A 3KTGA 2ZL2A 3TLFA 3T8AA 3P5MA 4ZU2A 3V5IA 5DUCA 2VSUA 3VIVA 5E0SA 5C9GA 4JVTA 3HRXA 2C8TA 4JYLA 1Q52A 3TVWA 2J5GD 3DJAA 4DI1A 1FCFA 2FW2A 1J7XA 3TZ3A 3ZWAA 4FJWD 5JBWA 4EMMA 4LK5A 3TV5A 4FNDA 1SG4A 4JFCA 5DTPA 1YG6A 1N6EA 5IKLB 4U0HA 4OG1A 4G2RA 1EY3A 2F6IA 2CE3A 2VSSE 1FC7A 3KTJA 3ISAA 1WZ8A 2IEXA 2X24A 3Q0JA 1UYRA 3LKEA 3U9RB 4ZDCA 2ZQRA 3GMAA 2F9IA 3T8BA 4RYFH 1XNYA 5C90A 4MXIA 5DUFA 2J5II 4B3HA 2VSSF 4KWBA 4L6WA 4OMRA 4U19A 2J5IA 3IB9A 3BF0A 4OLQA 2PBPA 5E0NX 3QKAA 3H0UA 3IBBA 5DL1A 1X0UA 5FUSA 4RYFA 3QWDA 4JOTA 3L3SA 1HNUA 1Q51A 3ST9A 1EF9A 3NJBA 4MI2A 3TT7A 4I42A 4NNQA 5CTBA 3MT6A 1FC9A 3OT6A 3R9SA 3ZW8A 3P85A 3RSTA 1RJMA 3R0OA 3KTIA 1XX4A 3MFMA 3R9TA 2FBMA 3TDCA
chains in the Genus database with same CATH superfamily
1OD4A 1TG6A 3JU1A 2D3TA 5KDRA 2HW5A 1ON9A 3DORA 2ZL4A 4WZ8B 2VX2A 2A81A 3QK8A 5INIA 3U9TB 3R9QA 1XNVA 2F9IB 3L8IA 2PG8A 2P63A 3Q7HA 2VREA 3H0QA 4GM2A 4I4ZA 5DU6A 3GLMA 4IZCA 4GEHB 4JWVA 2X58A 4K29A 2PPYA 3QREA 3K50A 4JCSA 4FNBA 1MJ3A 2BZRA 4ZDBA 4WYOB 4ZDFA 2F9YB 4QIIA 4GHNA 5G1SA 1PJHA 5HUQA 4FZWC 1RJNA 2Q34A 1XO6A 1XNWA 1FC6A 3HP0A 1NZYB 1K39A 3BEZA 3PZKA 3T89A 4EMPA 5KJPA 2F6QA 4JCRA 3SWXA 1JXZA 4JSBA 3FDUA 3H81A 4FZWA 2VSSA 5MGBA 2CBYA 3PE8A 3SLLA 5DZKA 3KQFA 1K32A 1ON3A 4K2NA 3H0JA 3OMEA 3NJDA 4EMLA 2FZSA 2VSUE 1OD2A 1Y7OA 1UX5A 4KNPA 4ELXA 3KTHA 3HINA 4FN7A 5DU4A 4ZDEA 3O4XE 4KD6A 4Q1IA 4U0GA 3ZWCA 1UYSA 4NARA 3H02A 4JYJA 1EF8A 4HNKA 2A7SA 4HC8A 3GF7A 4QIJA 3TVUA 3ZWBA 2W3PA 2Q2XA 1VRGA 5INGA 1UYVA 5G1QA 5INFA 3QXZA 2WTBA 1HZDA 3BPTA 1WDKA 3GKBA 3MOYA 5FIFA 3RQFA 4F47A 3HE2A 3H0SA 1UYTA 3QMJA 4NEKA 3G64A 2ZL3A 4J2UA 3T88A 3IAVA 5CTCA 4WCZA 4IZBA 3M6NA 2A7KA 4JJTA 3ZW9A 4Z0MA 4ELSA 4ZDDA 3RSIA 3M6MA 4U1AA 3TT6A 3GF3A 3RRVA 4L8KA 3RQGA 3KTKA 2J5IB 3T3WA 3PEAA 2UZFA 2Q35A 2GTRA 4K3WA 2NP9A 1DCIA 2DUBA 3ADCA 3ADDA 4JCTA 5DZKH 1N6DA 3TRRA 4HDTA 1O8UA 4B3JA 4RCNA 5DU8A 4B3IA 1N6FA 3N6RB 4FB8A 3STAA 2EJ5A 4IZDA 1WDLA 3HLN1 2DEOA 5DKPA 4U0GH 4I52A 3RQEA 3V5EA 1SZOA 3R6HA 4JCQA 2J5GA 3P2LA 3MYBA 1UIYA 4Q0GA 5JBXA 3Q0GA 4YLHA 3AJMA 4U18A 3K8XA 3PGQA 3BPPA 1PIXA 2ZL0A 2J5SA 3A4MA 5DTWA 2F9YA 4ASIA 4MOUA 2ZQQA 5E0SH 5KDRB 1NZYA 4ELWA 3I47A 3LAOA 4KPKA 1YG8A 5G1RA 1W2XA 1WDMA 3QYRA 3Q1TA 2VSUC 3QXIA 2QQ3A 1TYFA 3FF6A 3U9SB 4QFEA 1HNOA 1DUBA 3OC7A 2VSUF 3WG5A 4FN8A 3W8HB 3KTGA 2ZL2A 3TLFA 3W8IB 3T8AA 3P5MA 4ZU2A 3IRBA 3V5IA 5DUCA 2VSUA 3VIVA 5E0SA 5C9GA 4JVTA 3HRXA 2C8TA 4JYLA 1Q52A 3TVWA 2J5GD 3DJAA 4DI1A 1FCFA 2FW2A 1J7XA 3TZ3A 3ZWAA 4FJWD 3L8JA 5JBWA 4EMMA 4LK5A 3TV5A 4FNDA 1SG4A 4JFCA 5DTPA 1YG6A 1N6EA 5IKLB 4U0HA 4OG1A 4G2RA 1EY3A 2F6IA 2CE3A 1Y64B 2VSSE 1FC7A 3KTJA 3ISAA 1WZ8A 2IEXA 2X24A 3Q0JA 1UYRA 3LKEA 3U9RB 4ZDCA 2ZQRA 1UX4A 3GMAA 2F9IA 3T8BA 3AM1A 4RYFH 1XNYA 5C90A 4MXIA 5DUFA 2J5II 4B3HA 2VSSF 4KWBA 4L6WA 4OMRA 4U19A 2J5IA 3IB9A 3A4NA 3BF0A 4OLQA 2PBPA 5E0NX 3QKAA 3H0UA 3IBBA 5DL1A 1X0UA 5FUSA 4RYFA 3QWDA 4JOTA 3L3SA 1HNUA 1Q51A 3ST9A 1EF9A 3NJBA 4MI2A 3TT7A 3A4LA 4I42A 2YJGA 4NNQA 5CTBA 3MT6A 1FC9A 3OT6A 3R9SA 3ZW8A 3P85A 3RSTA 1RJMA 3R0OA 3KTIA 1XX4A 3MFMA 3R9TA 2FBMA 3ADBA 3TDCA
chains in the Genus database with same CATH topology
1OD4A 1TG6A 3JU1A 2D3TA 5KDRA 2HW5A 1ON9A 3DORA 2ZL4A 4WZ8B 2VX2A 2A81A 3QK8A 5INIA 3U9TB 3R9QA 1XNVA 2F9IB 2PG8A 3Q7HA 2VREA 3H0QA 4GM2A 4I4ZA 5DU6A 3GLMA 4IZCA 4JWVA 2X58A 4K29A 2PPYA 3QREA 3K50A 4JCSA 4FNBA 1MJ3A 2BZRA 4ZDBA 4WYOB 4ZDFA 2F9YB 4QIIA 4GHNA 5G1SA 1PJHA 5HUQA 4FZWC 1RJNA 2Q34A 1XO6A 1XNWA 1FC6A 3HP0A 1NZYB 1K39A 3BEZA 3PZKA 3T89A 4EMPA 5KJPA 2F6QA 4JCRA 3SWXA 1JXZA 4JSBA 3FDUA 3H81A 4FZWA 2VSSA 5MGBA 2CBYA 3PE8A 3SLLA 5DZKA 3KQFA 1K32A 1ON3A 4K2NA 3H0JA 3OMEA 3NJDA 4EMLA 2FZSA 2VSUE 1OD2A 1Y7OA 4KNPA 4ELXA 3KTHA 3HINA 4FN7A 5DU4A 4ZDEA 4KD6A 4Q1IA 4U0GA 3ZWCA 1UYSA 4NARA 3H02A 4JYJA 1EF8A 4HNKA 2A7SA 4HC8A 3GF7A 4QIJA 3TVUA 3ZWBA 2W3PA 2Q2XA 1VRGA 5INGA 1UYVA 5G1QA 5INFA 3QXZA 2WTBA 1HZDA 3BPTA 1WDKA 3GKBA 3MOYA 5FIFA 3HE2A 4F47A 3H0SA 1UYTA 3QMJA 4NEKA 3G64A 2ZL3A 4J2UA 3T88A 3IAVA 5CTCA 4WCZA 4IZBA 3M6NA 2A7KA 4JJTA 3ZW9A 4Z0MA 4ELSA 4ZDDA 3RSIA 3M6MA 4U1AA 3TT6A 3GF3A 3RRVA 4L8KA 3KTKA 2J5IB 3T3WA 3PEAA 2UZFA 2Q35A 2GTRA 4K3WA 2NP9A 1DCIA 2DUBA 4JCTA 5DZKH 1N6DA 3TRRA 4HDTA 1O8UA 4B3JA 4RCNA 5DU8A 4B3IA 1N6FA 3N6RB 4FB8A 3STAA 2EJ5A 4IZDA 1WDLA 3HLN1 2DEOA 5DKPA 4U0GH 4I52A 3V5EA 1SZOA 3R6HA 4JCQA 2J5GA 3P2LA 3MYBA 1UIYA 4Q0GA 5JBXA 3Q0GA 4YLHA 4U18A 3K8XA 3PGQA 3BPPA 1PIXA 2ZL0A 2J5SA 5DTWA 2F9YA 4ASIA 4MOUA 2ZQQA 5E0SH 5KDRB 1NZYA 4ELWA 3I47A 3LAOA 4KPKA 1YG8A 5G1RA 1W2XA 1WDMA 3QYRA 3Q1TA 2VSUC 3QXIA 2QQ3A 1TYFA 3FF6A 3U9SB 4QFEA 1HNOA 1DUBA 3OC7A 2VSUF 3WG5A 4FN8A 3KTGA 2ZL2A 3TLFA 3T8AA 3P5MA 4ZU2A 3V5IA 5DUCA 2VSUA 3VIVA 5E0SA 5C9GA 4JVTA 3HRXA 2C8TA 4JYLA 1Q52A 3TVWA 2J5GD 3DJAA 4DI1A 1FCFA 2FW2A 1J7XA 3TZ3A 3ZWAA 4FJWD 5JBWA 4EMMA 4LK5A 3TV5A 4FNDA 1SG4A 4JFCA 5DTPA 1YG6A 1N6EA 5IKLB 4U0HA 4OG1A 4G2RA 1EY3A 2F6IA 2CE3A 2VSSE 1FC7A 3KTJA 3ISAA 1WZ8A 2IEXA 2X24A 3Q0JA 1UYRA 3LKEA 3U9RB 4ZDCA 2ZQRA 3GMAA 2F9IA 3T8BA 4RYFH 1XNYA 5C90A 4MXIA 5DUFA 2J5II 4B3HA 2VSSF 4KWBA 4L6WA 4OMRA 4U19A 2J5IA 3IB9A 3BF0A 4OLQA 2PBPA 5E0NX 3QKAA 3H0UA 3IBBA 5DL1A 1X0UA 5FUSA 4RYFA 3QWDA 4JOTA 3L3SA 1HNUA 1Q51A 3ST9A 1EF9A 3NJBA 4MI2A 3TT7A 4I42A 2YJGA 4NNQA 5CTBA 3MT6A 1FC9A 3OT6A 3R9SA 3ZW8A 3P85A 3RSTA 1RJMA 3R0OA 3KTIA 1XX4A 3MFMA 3R9TA 2FBMA 3TDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OD4 A;  1TG6 A;  3JU1 A;  2D3T A;  5KDR A;  2HW5 A;  1ON9 A;  3DOR A;  2ZL4 A;  4WZ8 B;  2VX2 A;  2A81 A;  3QK8 A;  5INI A;  3U9T B;  3R9Q A;  1XNV A;  2F9I B;  2PG8 A;  3Q7H A;  2VRE A;  3H0Q A;  4GM2 A;  4I4Z A;  5DU6 A;  3GLM A;  4IZC A;  4JWV A;  2X58 A;  4K29 A;  2PPY A;  3QRE A;  3K50 A;  4JCS A;  4FNB A;  1MJ3 A;  2BZR A;  4ZDB A;  4WYO B;  4ZDF A;  2F9Y B;  4QII A;  4GHN A;  5G1S A;  1PJH A;  4FZW C;  1RJN A;  2Q34 A;  1XO6 A;  1XNW A;  1FC6 A;  3HP0 A;  1NZY B;  1K39 A;  3BEZ A;  3PZK A;  3T89 A;  4EMP A;  5KJP A;  2F6Q A;  4JCR A;  3SWX A;  1JXZ A;  3FDU A;  3H81 A;  4JSB A;  4FZW A;  2VSS A;  5MGB A;  2CBY A;  3PE8 A;  3SLL A;  5DZK A;  3KQF A;  1K32 A;  1ON3 A;  4K2N A;  3H0J A;  3OME A;  3NJD A;  4EML A;  2FZS A;  2VSU E;  1OD2 A;  1Y7O A;  4KNP A;  4ELX A;  3KTH A;  3HIN A;  4FN7 A;  5DU4 A;  4ZDE A;  4KD6 A;  4Q1I A;  4U0G A;  3ZWC A;  1UYS A;  3H02 A;  4JYJ A;  1EF8 A;  4HNK A;  2A7S A;  4HC8 A;  3GF7 A;  4QIJ A;  3TVU A;  3ZWB A;  2W3P A;  2Q2X A;  1VRG A;  5ING A;  1UYV A;  5G1Q A;  5INF A;  3QXZ A;  2WTB A;  1HZD A;  1WDK A;  3GKB A;  3MOY A;  5FIF A;  3HE2 A;  4F47 A;  3H0S A;  1UYT A;  3QMJ A;  4NEK A;  3G64 A;  2ZL3 A;  3T88 A;  3IAV A;  5CTC A;  4WCZ A;  4IZB A;  3M6N A;  2A7K A;  4JJT A;  3ZW9 A;  4Z0M A;  4ELS A;  4ZDD A;  3RSI A;  3M6M A;  4U1A A;  3TT6 A;  3GF3 A;  3RRV A;  4L8K A;  3KTK A;  2J5I B;  3T3W A;  3PEA A;  2UZF A;  2Q35 A;  2GTR A;  4K3W A;  2NP9 A;  1DCI A;  2DUB A;  4JCT A;  5DZK H;  1N6D A;  3TRR A;  1O8U A;  4B3J A;  4RCN A;  5DU8 A;  4B3I A;  1N6F A;  3N6R B;  4FB8 A;  3STA A;  2EJ5 A;  4IZD A;  1WDL A;  3HLN 1;  2DEO A;  5DKP A;  4U0G H;  4I52 A;  3V5E A;  1SZO A;  3R6H A;  4JCQ A;  2J5G A;  3P2L A;  3MYB A;  1UIY A;  4Q0G A;  5JBX A;  3Q0G A;  4YLH A;  4U18 A;  3K8X A;  3PGQ A;  3BPP A;  1PIX A;  2ZL0 A;  2J5S A;  5DTW A;  2F9Y A;  4ASI A;  4MOU A;  2ZQQ A;  5E0S H;  5KDR B;  1NZY A;  4ELW A;  3I47 A;  3LAO A;  4KPK A;  1YG8 A;  5G1R A;  1W2X A;  1WDM A;  3QYR A;  3Q1T A;  2VSU C;  3QXI A;  2QQ3 A;  1TYF A;  3FF6 A;  3U9S B;  4QFE A;  1HNO A;  1DUB A;  3OC7 A;  2VSU F;  3WG5 A;  4FN8 A;  3KTG A;  2ZL2 A;  3TLF A;  3T8A A;  3P5M A;  4ZU2 A;  3V5I A;  5DUC A;  2VSU A;  3VIV A;  5E0S A;  5C9G A;  4JVT A;  3HRX A;  2C8T A;  4JYL A;  1Q52 A;  3TVW A;  2J5G D;  3DJA A;  4DI1 A;  1FCF A;  2FW2 A;  1J7X A;  3TZ3 A;  3ZWA A;  4FJW D;  5JBW A;  4EMM A;  4LK5 A;  3TV5 A;  4FND A;  1SG4 A;  4JFC A;  5DTP A;  1YG6 A;  1N6E A;  5IKL B;  4U0H A;  4OG1 A;  4G2R A;  1EY3 A;  2F6I A;  2CE3 A;  2VSS E;  1FC7 A;  3KTJ A;  3ISA A;  1WZ8 A;  2IEX A;  2X24 A;  3Q0J A;  1UYR A;  3LKE A;  3U9R B;  4ZDC A;  2ZQR A;  3GMA A;  2F9I A;  3T8B A;  4RYF H;  1XNY A;  5C90 A;  4MXI A;  5DUF A;  2J5I I;  4B3H A;  2VSS F;  4KWB A;  4L6W A;  4OMR A;  4U19 A;  2J5I A;  3IB9 A;  3BF0 A;  4OLQ A;  2PBP A;  5E0N X;  3QKA A;  3H0U A;  3IBB A;  5DL1 A;  1X0U A;  5FUS A;  4RYF A;  3QWD A;  4JOT A;  3L3S A;  1HNU A;  1Q51 A;  3ST9 A;  1EF9 A;  3NJB A;  4MI2 A;  3TT7 A;  4I42 A;  4NNQ A;  5CTB A;  3MT6 A;  1FC9 A;  3OT6 A;  3R9S A;  3ZW8 A;  3P85 A;  3RST A;  1RJM A;  3R0O A;  3KTI A;  1XX4 A;  3MFM A;  3R9T A;  2FBM A;  3TDC A; 
#chains in the Genus database with same CATH topology
 1OD4 A;  1TG6 A;  3JU1 A;  2D3T A;  5KDR A;  2HW5 A;  1ON9 A;  3DOR A;  2ZL4 A;  4WZ8 B;  2VX2 A;  2A81 A;  3QK8 A;  5INI A;  3U9T B;  3R9Q A;  1XNV A;  2F9I B;  3L8I A;  2PG8 A;  2P63 A;  3Q7H A;  2VRE A;  3H0Q A;  4GM2 A;  4I4Z A;  5DU6 A;  3GLM A;  4IZC A;  4GEH B;  4JWV A;  2X58 A;  4K29 A;  2PPY A;  3QRE A;  3K50 A;  4JCS A;  4FNB A;  1MJ3 A;  2BZR A;  4ZDB A;  4WYO B;  4ZDF A;  2F9Y B;  4QII A;  4GHN A;  5G1S A;  1PJH A;  5HUQ A;  4FZW C;  1RJN A;  2Q34 A;  1XO6 A;  1XNW A;  1FC6 A;  3HP0 A;  1NZY B;  1K39 A;  3BEZ A;  3PZK A;  3T89 A;  4EMP A;  5KJP A;  2F6Q A;  4JCR A;  3SWX A;  1JXZ A;  4JSB A;  3FDU A;  3H81 A;  4FZW A;  2VSS A;  5MGB A;  2CBY A;  3PE8 A;  3SLL A;  5DZK A;  3KQF A;  1K32 A;  1ON3 A;  4K2N A;  3H0J A;  3OME A;  3NJD A;  4EML A;  2FZS A;  2VSU E;  1OD2 A;  1Y7O A;  1UX5 A;  4KNP A;  4ELX A;  3KTH A;  3HIN A;  4FN7 A;  5DU4 A;  4ZDE A;  3O4X E;  4KD6 A;  4Q1I A;  4U0G A;  3ZWC A;  1UYS A;  4NAR A;  3H02 A;  4JYJ A;  1EF8 A;  4HNK A;  2A7S A;  4HC8 A;  3GF7 A;  4QIJ A;  3TVU A;  3ZWB A;  2W3P A;  2Q2X A;  1VRG A;  5ING A;  1UYV A;  5G1Q A;  5INF A;  3QXZ A;  2WTB A;  1HZD A;  3BPT A;  1WDK A;  3GKB A;  3MOY A;  5FIF A;  3RQF A;  4F47 A;  3HE2 A;  3H0S A;  1UYT A;  3QMJ A;  4NEK A;  3G64 A;  2ZL3 A;  4J2U A;  3T88 A;  3IAV A;  5CTC A;  4WCZ A;  4IZB A;  3M6N A;  2A7K A;  4JJT A;  3ZW9 A;  4Z0M A;  4ELS A;  4ZDD A;  3RSI A;  3M6M A;  4U1A A;  3TT6 A;  3GF3 A;  3RRV A;  4L8K A;  3RQG A;  3KTK A;  2J5I B;  3T3W A;  3PEA A;  2UZF A;  2Q35 A;  2GTR A;  4K3W A;  2NP9 A;  1DCI A;  2DUB A;  3ADC A;  3ADD A;  4JCT A;  5DZK H;  1N6D A;  3TRR A;  4HDT A;  1O8U A;  4B3J A;  4RCN A;  5DU8 A;  4B3I A;  1N6F A;  3N6R B;  4FB8 A;  3STA A;  2EJ5 A;  4IZD A;  1WDL A;  3HLN 1;  2DEO A;  5DKP A;  4U0G H;  4I52 A;  3RQE A;  3V5E A;  1SZO A;  3R6H A;  4JCQ A;  2J5G A;  3P2L A;  3MYB A;  1UIY A;  4Q0G A;  5JBX A;  3Q0G A;  4YLH A;  3AJM A;  4U18 A;  3K8X A;  3PGQ A;  3BPP A;  1PIX A;  2ZL0 A;  2J5S A;  3A4M A;  5DTW A;  2F9Y A;  4ASI A;  4MOU A;  2ZQQ A;  5E0S H;  5KDR B;  1NZY A;  4ELW A;  3I47 A;  3LAO A;  4KPK A;  1YG8 A;  5G1R A;  1W2X A;  1WDM A;  3QYR A;  3Q1T A;  2VSU C;  3QXI A;  2QQ3 A;  1TYF A;  3FF6 A;  3U9S B;  4QFE A;  1HNO A;  1DUB A;  3OC7 A;  2VSU F;  3WG5 A;  4FN8 A;  3W8H B;  3KTG A;  2ZL2 A;  3TLF A;  3W8I B;  3T8A A;  3P5M A;  4ZU2 A;  3IRB A;  3V5I A;  5DUC A;  2VSU A;  3VIV A;  5E0S A;  5C9G A;  4JVT A;  3HRX A;  2C8T A;  4JYL A;  1Q52 A;  3TVW A;  2J5G D;  3DJA A;  4DI1 A;  1FCF A;  2FW2 A;  1J7X A;  3TZ3 A;  3ZWA A;  4FJW D;  3L8J A;  5JBW A;  4EMM A;  4LK5 A;  3TV5 A;  4FND A;  1SG4 A;  4JFC A;  5DTP A;  1YG6 A;  1N6E A;  5IKL B;  4U0H A;  4OG1 A;  4G2R A;  1EY3 A;  2F6I A;  2CE3 A;  1Y64 B;  2VSS E;  1FC7 A;  3KTJ A;  3ISA A;  1WZ8 A;  2IEX A;  2X24 A;  3Q0J A;  1UYR A;  3LKE A;  3U9R B;  4ZDC A;  2ZQR A;  1UX4 A;  3GMA A;  2F9I A;  3T8B A;  3AM1 A;  4RYF H;  1XNY A;  5C90 A;  4MXI A;  5DUF A;  2J5I I;  4B3H A;  2VSS F;  4KWB A;  4L6W A;  4OMR A;  4U19 A;  2J5I A;  3IB9 A;  3A4N A;  3BF0 A;  4OLQ A;  2PBP A;  5E0N X;  3QKA A;  3H0U A;  3IBB A;  5DL1 A;  1X0U A;  5FUS A;  4RYF A;  3QWD A;  4JOT A;  3L3S A;  1HNU A;  1Q51 A;  3ST9 A;  1EF9 A;  3NJB A;  4MI2 A;  3TT7 A;  3A4L A;  4I42 A;  2YJG A;  4NNQ A;  5CTB A;  3MT6 A;  1FC9 A;  3OT6 A;  3R9S A;  3ZW8 A;  3P85 A;  3RST A;  1RJM A;  3R0O A;  3KTI A;  1XX4 A;  3MFM A;  3R9T A;  2FBM A;  3ADB A;  3TDC A; 
#chains in the Genus database with same CATH homology
 1OD4 A;  1TG6 A;  3JU1 A;  2D3T A;  5KDR A;  2HW5 A;  1ON9 A;  3DOR A;  2ZL4 A;  4WZ8 B;  2VX2 A;  2A81 A;  3QK8 A;  5INI A;  3U9T B;  3R9Q A;  1XNV A;  2F9I B;  2PG8 A;  3Q7H A;  2VRE A;  3H0Q A;  4GM2 A;  4I4Z A;  5DU6 A;  3GLM A;  4IZC A;  4JWV A;  2X58 A;  4K29 A;  2PPY A;  3QRE A;  3K50 A;  4JCS A;  4FNB A;  1MJ3 A;  2BZR A;  4ZDB A;  4WYO B;  4ZDF A;  2F9Y B;  4QII A;  4GHN A;  5G1S A;  1PJH A;  5HUQ A;  4FZW C;  1RJN A;  2Q34 A;  1XO6 A;  1XNW A;  1FC6 A;  3HP0 A;  1NZY B;  1K39 A;  3BEZ A;  3PZK A;  3T89 A;  4EMP A;  5KJP A;  2F6Q A;  4JCR A;  3SWX A;  1JXZ A;  4JSB A;  3FDU A;  3H81 A;  4FZW A;  2VSS A;  5MGB A;  2CBY A;  3PE8 A;  3SLL A;  5DZK A;  3KQF A;  1K32 A;  1ON3 A;  4K2N A;  3H0J A;  3OME A;  3NJD A;  4EML A;  2FZS A;  2VSU E;  1OD2 A;  1Y7O A;  4KNP A;  4ELX A;  3KTH A;  3HIN A;  4FN7 A;  5DU4 A;  4ZDE A;  4KD6 A;  4Q1I A;  4U0G A;  3ZWC A;  1UYS A;  4NAR A;  3H02 A;  4JYJ A;  1EF8 A;  4HNK A;  2A7S A;  4HC8 A;  3GF7 A;  4QIJ A;  3TVU A;  3ZWB A;  2W3P A;  2Q2X A;  1VRG A;  5ING A;  1UYV A;  5G1Q A;  5INF A;  3QXZ A;  2WTB A;  1HZD A;  3BPT A;  1WDK A;  3GKB A;  3MOY A;  5FIF A;  3HE2 A;  4F47 A;  3H0S A;  1UYT A;  3QMJ A;  4NEK A;  3G64 A;  2ZL3 A;  4J2U A;  3T88 A;  3IAV A;  5CTC A;  4WCZ A;  4IZB A;  3M6N A;  2A7K A;  4JJT A;  3ZW9 A;  4Z0M A;  4ELS A;  4ZDD A;  3RSI A;  3M6M A;  4U1A A;  3TT6 A;  3GF3 A;  3RRV A;  4L8K A;  3KTK A;  2J5I B;  3T3W A;  3PEA A;  2UZF A;  2Q35 A;  2GTR A;  4K3W A;  2NP9 A;  1DCI A;  2DUB A;  4JCT A;  5DZK H;  1N6D A;  3TRR A;  4HDT A;  1O8U A;  4B3J A;  4RCN A;  5DU8 A;  4B3I A;  1N6F A;  3N6R B;  4FB8 A;  3STA A;  2EJ5 A;  4IZD A;  1WDL A;  3HLN 1;  2DEO A;  5DKP A;  4U0G H;  4I52 A;  3V5E A;  1SZO A;  3R6H A;  4JCQ A;  2J5G A;  3P2L A;  3MYB A;  1UIY A;  4Q0G A;  5JBX A;  3Q0G A;  4YLH A;  4U18 A;  3K8X A;  3PGQ A;  3BPP A;  1PIX A;  2ZL0 A;  2J5S A;  5DTW A;  2F9Y A;  4ASI A;  4MOU A;  2ZQQ A;  5E0S H;  5KDR B;  1NZY A;  4ELW A;  3I47 A;  3LAO A;  4KPK A;  1YG8 A;  5G1R A;  1W2X A;  1WDM A;  3QYR A;  3Q1T A;  2VSU C;  3QXI A;  2QQ3 A;  1TYF A;  3FF6 A;  3U9S B;  4QFE A;  1HNO A;  1DUB A;  3OC7 A;  2VSU F;  3WG5 A;  4FN8 A;  3KTG A;  2ZL2 A;  3TLF A;  3T8A A;  3P5M A;  4ZU2 A;  3V5I A;  5DUC A;  2VSU A;  3VIV A;  5E0S A;  5C9G A;  4JVT A;  3HRX A;  2C8T A;  4JYL A;  1Q52 A;  3TVW A;  2J5G D;  3DJA A;  4DI1 A;  1FCF A;  2FW2 A;  1J7X A;  3TZ3 A;  3ZWA A;  4FJW D;  5JBW A;  4EMM A;  4LK5 A;  3TV5 A;  4FND A;  1SG4 A;  4JFC A;  5DTP A;  1YG6 A;  1N6E A;  5IKL B;  4U0H A;  4OG1 A;  4G2R A;  1EY3 A;  2F6I A;  2CE3 A;  2VSS E;  1FC7 A;  3KTJ A;  3ISA A;  1WZ8 A;  2IEX A;  2X24 A;  3Q0J A;  1UYR A;  3LKE A;  3U9R B;  4ZDC A;  2ZQR A;  3GMA A;  2F9I A;  3T8B A;  4RYF H;  1XNY A;  5C90 A;  4MXI A;  5DUF A;  2J5I I;  4B3H A;  2VSS F;  4KWB A;  4L6W A;  4OMR A;  4U19 A;  2J5I A;  3IB9 A;  3BF0 A;  4OLQ A;  2PBP A;  5E0N X;  3QKA A;  3H0U A;  3IBB A;  5DL1 A;  1X0U A;  5FUS A;  4RYF A;  3QWD A;  4JOT A;  3L3S A;  1HNU A;  1Q51 A;  3ST9 A;  1EF9 A;  3NJB A;  4MI2 A;  3TT7 A;  4I42 A;  2YJG A;  4NNQ A;  5CTB A;  3MT6 A;  1FC9 A;  3OT6 A;  3R9S A;  3ZW8 A;  3P85 A;  3RST A;  1RJM A;  3R0O A;  3KTI A;  1XX4 A;  3MFM A;  3R9T A;  2FBM A;  3TDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...