1RJNA

The crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
259
Chain Sequence
DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords menB
total genus 96
structure length 259
sequence length 280
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1rjnA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1rjnA01
3R9SA 5C9GA 3TVUA 3H0JA 4K29A 3RRVA 3QMJA 4GM2A 5G1SA 3V5EA 2F6QA 4U19A 1J7XA 2J5GA 3P85A 4L6WA 4MXIA 1YG6A 1RJMA 2GTRA 3ISAA 3PE8A 5E0NX 5CTBA 3H0SA 3ZWCA 3TT7A 3HP0A 3N6RB 1HZDA 1XNYA 3P5MA 5JBXA 3VIVA 4ELSA 1TG6A 1ON3A 4U0GH 5KDRA 3T3WA 3MFMA 4HC8A 3PEAA 3R9QA 4RYFA 4JJTA 1YG8A 4OMRA 2A7SA 4I42A 3SWXA 5INFA 3TVWA 3HINA 3HLN1 5KJPA 4F47A 4FB8A 2VSSE 3ZWAA 1SZOA 2VSUA 2J5GD 5FIFA 2J5IB 4DI1A 2VSUC 4G2RA 3QYRA 4KNPA 3R0OA 5E0SH 4I52A 4EMPA 3TRRA 3TLFA 2VSUF 3H81A 4ELXA 2J5SA 4FJWD 4FZWA 2ZL0A 3TDCA 3T89A 1PIXA 2EJ5A 5IKLB 1DUBA 4ZU2A 4WCZA 3H0UA 3K50A 3QXZA 3DORA 4FNDA 5DU4A 2HW5A 5DKPA 3TZ3A 2PG8A 2DEOA 3WG5A 3I47A 4MOUA 2DUBA 3OMEA 4JYLA 1VRGA 4JYJA 4FN7A 2ZL4A 4RCNA 4HNKA 2CE3A 3T88A 1ON9A 1FC6A 3V5IA 4WYOB 4MI2A 4RYFH 2NP9A 3QWDA 4OLQA 3TT6A 2F9YB 1SG4A 3JU1A 1MJ3A 4JFCA 5DZKA 3T8AA 2UZFA 3GF3A 3L3SA 3H0QA 2W3PA 3BPPA 3M6NA 4K2NA 1X0UA 3MYBA 4FN8A 1OD4A 3BF0A 2F9IA 3Q7HA 1FC7A 1UIYA 3T8BA 4KPKA 2Q35A 3U9RB 4EMMA 5DTWA 4QFEA 4ZDCA 4OG1A 2J5II 5MGBA 2X58A 4L8KA 4Z0MA 3QK8A 1DCIA 1XX4A 3MOYA 1HNUA 1O8UA 2A7KA 3KTKA 3RSTA 3U9SB 4IZBA 5KDRB 1FCFA 1FC9A 5G1QA 3NJBA 3FF6A 3Q0GA 3RSIA 3TV5A 5DUFA 3MT6A 3OT6A 3R9TA 3FDUA 3KTGA 4FZWC 1NZYB 3KTJA 2D3TA 1PJHA 1UYSA 2X24A 4ZDBA 2J5IA 2QQ3A 5CTCA 3R6HA 1Q51A 5DU6A 2ZL3A 3HRXA 4YLHA 2C8TA 2VSUE 5C90A 4QIIA 2FZSA 5FUSA 4ELWA 4B3JA 1EF8A 4KWBA 3DJAA 1W2XA 4EMLA 4JCSA 5DTPA 1UYTA 3ZW9A 4JCQA 4ZDEA 1K39A 3QREA 3NJDA 2ZQRA 4FNBA 4KD6A 1HNOA 2VSSF 4LK5A 1XNVA 3ST9A 1N6EA 1XNWA 2ZL2A 4IZCA 3IB9A 2F6IA 4Q1IA 2FBMA 4U1AA 1N6DA 4ZDFA 4NNQA 1EF9A 4IZDA 2PPYA 5INGA 1WDMA 4GHNA 1Q52A 4ZDDA 3U9TB 3M6MA 2WTBA 2ZQQA 1K32A 3LKEA 1N6FA 3GLMA 3G64A 3KTHA 2VREA 1NZYA 3LAOA 4QIJA 1EY3A 5INIA 3SLLA 3KQFA 3KTIA 4JCTA 4NEKA 2CBYA 5JBWA 4JVTA 4B3HA 3K8XA 4U18A 3OC7A 3P2LA 3QKAA 4Q0GA 4B3IA 2F9YA 5DZKH 3Q1TA 5DU8A 3ZW8A 3Q0JA 2FW2A 3GF7A 2IEXA 3GMAA 1TYFA 1UYVA 4JSBA 2F9IB 4ASIA 3H02A 2Q34A 1Y7OA 5DUCA 1RJNA 4JWVA 3STAA 1OD2A 4U0GA 5G1RA 3IBBA 3GKBA 5DL1A 4K3WA 4I4ZA 1UYRA 2VX2A 2BZRA 4JCRA 4U0HA 3PGQA 1XO6A 3BEZA 1WZ8A 4JOTA 3PZKA 3ZWBA 5E0SA 2Q2XA 2VSSA 4WZ8B 3HE2A 2A81A 3IAVA 1JXZA 1WDKA 3QXIA 2PBPA 1WDLA
chains in the Genus database with same CATH superfamily
3R9SA 5C9GA 3TVUA 3H0JA 4K29A 3A4LA 1UX5A 3RRVA 3QMJA 4GM2A 5G1SA 3V5EA 2F6QA 4U19A 1J7XA 2J5GA 3P85A 4L6WA 4NARA 4MXIA 1YG6A 1RJMA 2GTRA 3ISAA 3PE8A 5E0NX 5CTBA 2P63A 1Y64B 3H0SA 3ZWCA 3TT7A 3HP0A 3N6RB 1HZDA 1XNYA 3P5MA 3W8IB 5JBXA 3VIVA 4ELSA 1TG6A 1ON3A 4U0GH 5KDRA 3T3WA 3MFMA 4HC8A 3PEAA 3L8JA 3R9QA 4RYFA 4JJTA 1YG8A 4OMRA 2A7SA 4I42A 3SWXA 5INFA 3TVWA 3HINA 3HLN1 5KJPA 4F47A 4FB8A 2VSSE 3ZWAA 1SZOA 3RQGA 2VSUA 2J5GD 5FIFA 2J5IB 4DI1A 2VSUC 4G2RA 3QYRA 4KNPA 3R0OA 5E0SH 4I52A 4EMPA 3TRRA 3TLFA 2VSUF 3H81A 4ELXA 2J5SA 4FJWD 4FZWA 2ZL0A 3TDCA 3T89A 1PIXA 2EJ5A 5IKLB 1DUBA 4ZU2A 3AM1A 4WCZA 3H0UA 3K50A 3QXZA 3A4NA 3DORA 4FNDA 5DU4A 2HW5A 5DKPA 3TZ3A 2PG8A 2DEOA 3WG5A 3I47A 4MOUA 2DUBA 3OMEA 4JYLA 1VRGA 4JYJA 4FN7A 2ZL4A 2YJGA 4RCNA 4HNKA 2CE3A 3T88A 1ON9A 1FC6A 3V5IA 4WYOB 4MI2A 4RYFH 2NP9A 3QWDA 4OLQA 3TT6A 2F9YB 1SG4A 3JU1A 1MJ3A 4JFCA 5DZKA 3T8AA 2UZFA 3GF3A 3L8IA 3L3SA 3H0QA 2W3PA 3BPPA 3M6NA 4K2NA 1X0UA 3MYBA 4FN8A 1OD4A 3BF0A 2F9IA 3Q7HA 1FC7A 1UIYA 3T8BA 4KPKA 2Q35A 3U9RB 3BPTA 4EMMA 5DTWA 4QFEA 4ZDCA 4OG1A 2J5II 5MGBA 2X58A 3ADDA 4L8KA 4Z0MA 3QK8A 1DCIA 1XX4A 3MOYA 1HNUA 1O8UA 2A7KA 3KTKA 3RSTA 3U9SB 4IZBA 5KDRB 1FCFA 1FC9A 5G1QA 3NJBA 3FF6A 3Q0GA 3RSIA 3TV5A 5DUFA 3MT6A 3OT6A 3R9TA 3FDUA 5HUQA 3KTGA 4FZWC 1NZYB 3KTJA 2D3TA 1PJHA 1UYSA 2X24A 4ZDBA 3RQFA 2J5IA 2QQ3A 3ADBA 5CTCA 3R6HA 1Q51A 5DU6A 2ZL3A 3HRXA 4YLHA 2C8TA 2VSUE 5C90A 4QIIA 2FZSA 5FUSA 4ELWA 4B3JA 1EF8A 4KWBA 3DJAA 1W2XA 3IRBA 4EMLA 4JCSA 5DTPA 1UYTA 3W8HB 3ZW9A 4JCQA 4ZDEA 3O4XE 1K39A 3QREA 3NJDA 2ZQRA 4FNBA 4KD6A 1HNOA 2VSSF 4LK5A 1XNVA 3ST9A 1N6EA 1XNWA 2ZL2A 4IZCA 3IB9A 2F6IA 4Q1IA 2FBMA 4U1AA 1N6DA 4ZDFA 4NNQA 1UX4A 1EF9A 4IZDA 4J2UA 2PPYA 5INGA 1WDMA 4GHNA 1Q52A 4ZDDA 3U9TB 3M6MA 2WTBA 2ZQQA 1K32A 3LKEA 1N6FA 4HDTA 3GLMA 3G64A 3KTHA 2VREA 1NZYA 3LAOA 4QIJA 1EY3A 5INIA 3SLLA 3KQFA 3KTIA 4JCTA 4NEKA 3ADCA 2CBYA 3A4MA 5JBWA 4JVTA 4B3HA 3AJMA 3K8XA 4U18A 3OC7A 3P2LA 3QKAA 4Q0GA 4B3IA 2F9YA 5DZKH 3Q1TA 5DU8A 3ZW8A 3Q0JA 2FW2A 3GF7A 2IEXA 3GMAA 1TYFA 1UYVA 4JSBA 2F9IB 4ASIA 3H02A 2Q34A 1Y7OA 5DUCA 1RJNA 4JWVA 3STAA 1OD2A 4U0GA 5G1RA 3IBBA 3GKBA 5DL1A 4K3WA 4I4ZA 1UYRA 2VX2A 2BZRA 4JCRA 4U0HA 3PGQA 1XO6A 3BEZA 4GEHB 1WZ8A 4JOTA 3PZKA 3ZWBA 5E0SA 2Q2XA 3RQEA 2VSSA 4WZ8B 3HE2A 2A81A 3IAVA 1JXZA 1WDKA 3QXIA 2PBPA 1WDLA
chains in the Genus database with same CATH topology
3R9SA 5C9GA 3TVUA 3H0JA 4K29A 3RRVA 3QMJA 4GM2A 5G1SA 3V5EA 2F6QA 4U19A 1J7XA 2J5GA 3P85A 4L6WA 4NARA 4MXIA 1YG6A 1RJMA 2GTRA 3ISAA 3PE8A 5E0NX 5CTBA 3H0SA 3ZWCA 3TT7A 3HP0A 3N6RB 1HZDA 1XNYA 3P5MA 5JBXA 3VIVA 4ELSA 1TG6A 1ON3A 4U0GH 5KDRA 3T3WA 3MFMA 4HC8A 3PEAA 3R9QA 4RYFA 4JJTA 1YG8A 4OMRA 2A7SA 4I42A 3SWXA 5INFA 3TVWA 3HINA 3HLN1 5KJPA 4F47A 4FB8A 2VSSE 3ZWAA 1SZOA 2VSUA 2J5GD 5FIFA 2J5IB 4DI1A 2VSUC 4G2RA 3QYRA 4KNPA 3R0OA 5E0SH 4I52A 4EMPA 3TRRA 3TLFA 2VSUF 3H81A 4ELXA 2J5SA 4FJWD 4FZWA 2ZL0A 3TDCA 3T89A 1PIXA 2EJ5A 5IKLB 1DUBA 4ZU2A 4WCZA 3H0UA 3K50A 3QXZA 3DORA 4FNDA 5DU4A 2HW5A 5DKPA 3TZ3A 2PG8A 2DEOA 3WG5A 3I47A 4MOUA 2DUBA 3OMEA 4JYLA 1VRGA 4JYJA 4FN7A 2ZL4A 2YJGA 4RCNA 4HNKA 2CE3A 3T88A 1ON9A 1FC6A 3V5IA 4WYOB 4MI2A 4RYFH 2NP9A 3QWDA 4OLQA 3TT6A 2F9YB 1SG4A 3JU1A 1MJ3A 4JFCA 5DZKA 3T8AA 2UZFA 3GF3A 3L3SA 3H0QA 2W3PA 3BPPA 3M6NA 4K2NA 1X0UA 3MYBA 4FN8A 1OD4A 3BF0A 2F9IA 3Q7HA 1FC7A 1UIYA 3T8BA 4KPKA 2Q35A 3U9RB 3BPTA 4EMMA 5DTWA 4QFEA 4ZDCA 4OG1A 2J5II 5MGBA 2X58A 4L8KA 4Z0MA 3QK8A 1DCIA 1XX4A 3MOYA 1HNUA 1O8UA 2A7KA 3KTKA 3RSTA 3U9SB 4IZBA 5KDRB 1FCFA 1FC9A 5G1QA 3NJBA 3FF6A 3Q0GA 3RSIA 3TV5A 5DUFA 3MT6A 3OT6A 3R9TA 3FDUA 5HUQA 3KTGA 4FZWC 1NZYB 3KTJA 2D3TA 1PJHA 1UYSA 2X24A 4ZDBA 2J5IA 2QQ3A 5CTCA 3R6HA 1Q51A 5DU6A 2ZL3A 3HRXA 4YLHA 2C8TA 2VSUE 5C90A 4QIIA 2FZSA 5FUSA 4ELWA 4B3JA 1EF8A 4KWBA 3DJAA 1W2XA 4EMLA 4JCSA 5DTPA 1UYTA 3ZW9A 4JCQA 4ZDEA 1K39A 3QREA 3NJDA 2ZQRA 4FNBA 4KD6A 1HNOA 2VSSF 4LK5A 1XNVA 3ST9A 1N6EA 1XNWA 2ZL2A 4IZCA 3IB9A 2F6IA 4Q1IA 2FBMA 4U1AA 1N6DA 4ZDFA 4NNQA 1EF9A 4IZDA 4J2UA 2PPYA 5INGA 1WDMA 4GHNA 1Q52A 4ZDDA 3U9TB 3M6MA 2WTBA 2ZQQA 1K32A 3LKEA 1N6FA 4HDTA 3GLMA 3G64A 3KTHA 2VREA 1NZYA 3LAOA 4QIJA 1EY3A 5INIA 3SLLA 3KQFA 3KTIA 4JCTA 4NEKA 2CBYA 5JBWA 4JVTA 4B3HA 3K8XA 4U18A 3OC7A 3P2LA 3QKAA 4Q0GA 4B3IA 2F9YA 5DZKH 3Q1TA 5DU8A 3ZW8A 3Q0JA 2FW2A 3GF7A 2IEXA 3GMAA 1TYFA 1UYVA 4JSBA 2F9IB 4ASIA 3H02A 2Q34A 1Y7OA 5DUCA 1RJNA 4JWVA 3STAA 1OD2A 4U0GA 5G1RA 3IBBA 3GKBA 5DL1A 4K3WA 4I4ZA 1UYRA 2VX2A 2BZRA 4JCRA 4U0HA 3PGQA 1XO6A 3BEZA 1WZ8A 4JOTA 3PZKA 3ZWBA 5E0SA 2Q2XA 2VSSA 4WZ8B 3HE2A 2A81A 3IAVA 1JXZA 1WDKA 3QXIA 2PBPA 1WDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9S A;  5C9G A;  3TVU A;  3H0J A;  4K29 A;  3RRV A;  3QMJ A;  4GM2 A;  5G1S A;  3V5E A;  2F6Q A;  4U19 A;  1J7X A;  2J5G A;  3P85 A;  4L6W A;  4MXI A;  1YG6 A;  1RJM A;  2GTR A;  3ISA A;  3PE8 A;  5E0N X;  5CTB A;  3H0S A;  3ZWC A;  3TT7 A;  3HP0 A;  3N6R B;  1HZD A;  1XNY A;  3P5M A;  5JBX A;  3VIV A;  4ELS A;  1TG6 A;  1ON3 A;  4U0G H;  5KDR A;  3T3W A;  3MFM A;  4HC8 A;  3PEA A;  3R9Q A;  4RYF A;  4JJT A;  1YG8 A;  4OMR A;  2A7S A;  4I42 A;  3SWX A;  5INF A;  3TVW A;  3HIN A;  3HLN 1;  5KJP A;  4F47 A;  4FB8 A;  2VSS E;  3ZWA A;  1SZO A;  2VSU A;  2J5G D;  5FIF A;  2J5I B;  4DI1 A;  2VSU C;  4G2R A;  3QYR A;  4KNP A;  3R0O A;  5E0S H;  4I52 A;  4EMP A;  3TRR A;  3TLF A;  2VSU F;  3H81 A;  4ELX A;  2J5S A;  4FJW D;  4FZW A;  2ZL0 A;  3TDC A;  3T89 A;  1PIX A;  2EJ5 A;  5IKL B;  1DUB A;  4ZU2 A;  4WCZ A;  3H0U A;  3K50 A;  3QXZ A;  3DOR A;  4FND A;  5DU4 A;  2HW5 A;  5DKP A;  3TZ3 A;  2PG8 A;  2DEO A;  3WG5 A;  3I47 A;  4MOU A;  2DUB A;  3OME A;  4JYL A;  1VRG A;  4JYJ A;  4FN7 A;  2ZL4 A;  4RCN A;  4HNK A;  2CE3 A;  3T88 A;  1ON9 A;  1FC6 A;  3V5I A;  4WYO B;  4MI2 A;  4RYF H;  2NP9 A;  3QWD A;  4OLQ A;  3TT6 A;  2F9Y B;  1SG4 A;  3JU1 A;  1MJ3 A;  4JFC A;  5DZK A;  3T8A A;  2UZF A;  3GF3 A;  3L3S A;  3H0Q A;  2W3P A;  3BPP A;  3M6N A;  4K2N A;  1X0U A;  3MYB A;  4FN8 A;  1OD4 A;  3BF0 A;  2F9I A;  3Q7H A;  1FC7 A;  1UIY A;  3T8B A;  4KPK A;  2Q35 A;  3U9R B;  4EMM A;  5DTW A;  4QFE A;  4ZDC A;  4OG1 A;  2J5I I;  5MGB A;  2X58 A;  4L8K A;  4Z0M A;  3QK8 A;  1DCI A;  1XX4 A;  3MOY A;  1HNU A;  1O8U A;  2A7K A;  3KTK A;  3RST A;  3U9S B;  4IZB A;  5KDR B;  1FCF A;  1FC9 A;  5G1Q A;  3NJB A;  3FF6 A;  3Q0G A;  3RSI A;  3TV5 A;  5DUF A;  3MT6 A;  3OT6 A;  3R9T A;  3FDU A;  3KTG A;  4FZW C;  1NZY B;  3KTJ A;  2D3T A;  1PJH A;  1UYS A;  2X24 A;  4ZDB A;  2J5I A;  2QQ3 A;  5CTC A;  3R6H A;  1Q51 A;  5DU6 A;  2ZL3 A;  3HRX A;  4YLH A;  2C8T A;  2VSU E;  5C90 A;  4QII A;  2FZS A;  5FUS A;  4ELW A;  4B3J A;  1EF8 A;  4KWB A;  3DJA A;  1W2X A;  4EML A;  4JCS A;  5DTP A;  1UYT A;  3ZW9 A;  4JCQ A;  4ZDE A;  1K39 A;  3QRE A;  3NJD A;  2ZQR A;  4FNB A;  4KD6 A;  1HNO A;  2VSS F;  4LK5 A;  1XNV A;  3ST9 A;  1N6E A;  1XNW A;  2ZL2 A;  4IZC A;  3IB9 A;  2F6I A;  4Q1I A;  2FBM A;  4U1A A;  1N6D A;  4ZDF A;  4NNQ A;  1EF9 A;  4IZD A;  2PPY A;  5ING A;  1WDM A;  4GHN A;  1Q52 A;  4ZDD A;  3U9T B;  3M6M A;  2WTB A;  2ZQQ A;  1K32 A;  3LKE A;  1N6F A;  3GLM A;  3G64 A;  3KTH A;  2VRE A;  1NZY A;  3LAO A;  4QIJ A;  1EY3 A;  5INI A;  3SLL A;  3KQF A;  3KTI A;  4JCT A;  4NEK A;  2CBY A;  5JBW A;  4JVT A;  4B3H A;  3K8X A;  4U18 A;  3OC7 A;  3P2L A;  3QKA A;  4Q0G A;  4B3I A;  2F9Y A;  5DZK H;  3Q1T A;  5DU8 A;  3ZW8 A;  3Q0J A;  2FW2 A;  3GF7 A;  2IEX A;  3GMA A;  1TYF A;  1UYV A;  4JSB A;  2F9I B;  4ASI A;  3H02 A;  2Q34 A;  1Y7O A;  5DUC A;  1RJN A;  4JWV A;  3STA A;  1OD2 A;  4U0G A;  5G1R A;  3IBB A;  3GKB A;  5DL1 A;  4K3W A;  4I4Z A;  1UYR A;  2VX2 A;  2BZR A;  4JCR A;  4U0H A;  3PGQ A;  1XO6 A;  3BEZ A;  1WZ8 A;  4JOT A;  3PZK A;  3ZWB A;  5E0S A;  2Q2X A;  2VSS A;  4WZ8 B;  3HE2 A;  2A81 A;  3IAV A;  1JXZ A;  1WDK A;  3QXI A;  2PBP A;  1WDL A; 
#chains in the Genus database with same CATH topology
 3R9S A;  5C9G A;  3TVU A;  3H0J A;  4K29 A;  3A4L A;  1UX5 A;  3RRV A;  3QMJ A;  4GM2 A;  5G1S A;  3V5E A;  2F6Q A;  4U19 A;  1J7X A;  2J5G A;  3P85 A;  4L6W A;  4NAR A;  4MXI A;  1YG6 A;  1RJM A;  2GTR A;  3ISA A;  3PE8 A;  5E0N X;  5CTB A;  2P63 A;  1Y64 B;  3H0S A;  3ZWC A;  3TT7 A;  3HP0 A;  3N6R B;  1HZD A;  1XNY A;  3P5M A;  3W8I B;  5JBX A;  3VIV A;  4ELS A;  1TG6 A;  1ON3 A;  4U0G H;  5KDR A;  3T3W A;  3MFM A;  4HC8 A;  3PEA A;  3L8J A;  3R9Q A;  4RYF A;  4JJT A;  1YG8 A;  4OMR A;  2A7S A;  4I42 A;  3SWX A;  5INF A;  3TVW A;  3HIN A;  3HLN 1;  5KJP A;  4F47 A;  4FB8 A;  2VSS E;  3ZWA A;  1SZO A;  3RQG A;  2VSU A;  2J5G D;  5FIF A;  2J5I B;  4DI1 A;  2VSU C;  4G2R A;  3QYR A;  4KNP A;  3R0O A;  5E0S H;  4I52 A;  4EMP A;  3TRR A;  3TLF A;  2VSU F;  3H81 A;  4ELX A;  2J5S A;  4FJW D;  4FZW A;  2ZL0 A;  3TDC A;  3T89 A;  1PIX A;  2EJ5 A;  5IKL B;  1DUB A;  4ZU2 A;  3AM1 A;  4WCZ A;  3H0U A;  3K50 A;  3QXZ A;  3A4N A;  3DOR A;  4FND A;  5DU4 A;  2HW5 A;  5DKP A;  3TZ3 A;  2PG8 A;  2DEO A;  3WG5 A;  3I47 A;  4MOU A;  2DUB A;  3OME A;  4JYL A;  1VRG A;  4JYJ A;  4FN7 A;  2ZL4 A;  2YJG A;  4RCN A;  4HNK A;  2CE3 A;  3T88 A;  1ON9 A;  1FC6 A;  3V5I A;  4WYO B;  4MI2 A;  4RYF H;  2NP9 A;  3QWD A;  4OLQ A;  3TT6 A;  2F9Y B;  1SG4 A;  3JU1 A;  1MJ3 A;  4JFC A;  5DZK A;  3T8A A;  2UZF A;  3GF3 A;  3L8I A;  3L3S A;  3H0Q A;  2W3P A;  3BPP A;  3M6N A;  4K2N A;  1X0U A;  3MYB A;  4FN8 A;  1OD4 A;  3BF0 A;  2F9I A;  3Q7H A;  1FC7 A;  1UIY A;  3T8B A;  4KPK A;  2Q35 A;  3U9R B;  3BPT A;  4EMM A;  5DTW A;  4QFE A;  4ZDC A;  4OG1 A;  2J5I I;  5MGB A;  2X58 A;  3ADD A;  4L8K A;  4Z0M A;  3QK8 A;  1DCI A;  1XX4 A;  3MOY A;  1HNU A;  1O8U A;  2A7K A;  3KTK A;  3RST A;  3U9S B;  4IZB A;  5KDR B;  1FCF A;  1FC9 A;  5G1Q A;  3NJB A;  3FF6 A;  3Q0G A;  3RSI A;  3TV5 A;  5DUF A;  3MT6 A;  3OT6 A;  3R9T A;  3FDU A;  5HUQ A;  3KTG A;  4FZW C;  1NZY B;  3KTJ A;  2D3T A;  1PJH A;  1UYS A;  2X24 A;  4ZDB A;  3RQF A;  2J5I A;  2QQ3 A;  3ADB A;  5CTC A;  3R6H A;  1Q51 A;  5DU6 A;  2ZL3 A;  3HRX A;  4YLH A;  2C8T A;  2VSU E;  5C90 A;  4QII A;  2FZS A;  5FUS A;  4ELW A;  4B3J A;  1EF8 A;  4KWB A;  3DJA A;  1W2X A;  3IRB A;  4EML A;  4JCS A;  5DTP A;  1UYT A;  3W8H B;  3ZW9 A;  4JCQ A;  4ZDE A;  3O4X E;  1K39 A;  3QRE A;  3NJD A;  2ZQR A;  4FNB A;  4KD6 A;  1HNO A;  2VSS F;  4LK5 A;  1XNV A;  3ST9 A;  1N6E A;  1XNW A;  2ZL2 A;  4IZC A;  3IB9 A;  2F6I A;  4Q1I A;  2FBM A;  4U1A A;  1N6D A;  4ZDF A;  4NNQ A;  1UX4 A;  1EF9 A;  4IZD A;  4J2U A;  2PPY A;  5ING A;  1WDM A;  4GHN A;  1Q52 A;  4ZDD A;  3U9T B;  3M6M A;  2WTB A;  2ZQQ A;  1K32 A;  3LKE A;  1N6F A;  4HDT A;  3GLM A;  3G64 A;  3KTH A;  2VRE A;  1NZY A;  3LAO A;  4QIJ A;  1EY3 A;  5INI A;  3SLL A;  3KQF A;  3KTI A;  4JCT A;  4NEK A;  3ADC A;  2CBY A;  3A4M A;  5JBW A;  4JVT A;  4B3H A;  3AJM A;  3K8X A;  4U18 A;  3OC7 A;  3P2L A;  3QKA A;  4Q0G A;  4B3I A;  2F9Y A;  5DZK H;  3Q1T A;  5DU8 A;  3ZW8 A;  3Q0J A;  2FW2 A;  3GF7 A;  2IEX A;  3GMA A;  1TYF A;  1UYV A;  4JSB A;  2F9I B;  4ASI A;  3H02 A;  2Q34 A;  1Y7O A;  5DUC A;  1RJN A;  4JWV A;  3STA A;  1OD2 A;  4U0G A;  5G1R A;  3IBB A;  3GKB A;  5DL1 A;  4K3W A;  4I4Z A;  1UYR A;  2VX2 A;  2BZR A;  4JCR A;  4U0H A;  3PGQ A;  1XO6 A;  3BEZ A;  4GEH B;  1WZ8 A;  4JOT A;  3PZK A;  3ZWB A;  5E0S A;  2Q2X A;  3RQE A;  2VSS A;  4WZ8 B;  3HE2 A;  2A81 A;  3IAV A;  1JXZ A;  1WDK A;  3QXI A;  2PBP A;  1WDL A; 
#chains in the Genus database with same CATH homology
 3R9S A;  5C9G A;  3TVU A;  3H0J A;  4K29 A;  3RRV A;  3QMJ A;  4GM2 A;  5G1S A;  3V5E A;  2F6Q A;  4U19 A;  1J7X A;  2J5G A;  3P85 A;  4L6W A;  4NAR A;  4MXI A;  1YG6 A;  1RJM A;  2GTR A;  3ISA A;  3PE8 A;  5E0N X;  5CTB A;  3H0S A;  3ZWC A;  3TT7 A;  3HP0 A;  3N6R B;  1HZD A;  1XNY A;  3P5M A;  5JBX A;  3VIV A;  4ELS A;  1TG6 A;  1ON3 A;  4U0G H;  5KDR A;  3T3W A;  3MFM A;  4HC8 A;  3PEA A;  3R9Q A;  4RYF A;  4JJT A;  1YG8 A;  4OMR A;  2A7S A;  4I42 A;  3SWX A;  5INF A;  3TVW A;  3HIN A;  3HLN 1;  5KJP A;  4F47 A;  4FB8 A;  2VSS E;  3ZWA A;  1SZO A;  2VSU A;  2J5G D;  5FIF A;  2J5I B;  4DI1 A;  2VSU C;  4G2R A;  3QYR A;  4KNP A;  3R0O A;  5E0S H;  4I52 A;  4EMP A;  3TRR A;  3TLF A;  2VSU F;  3H81 A;  4ELX A;  2J5S A;  4FJW D;  4FZW A;  2ZL0 A;  3TDC A;  3T89 A;  1PIX A;  2EJ5 A;  5IKL B;  1DUB A;  4ZU2 A;  4WCZ A;  3H0U A;  3K50 A;  3QXZ A;  3DOR A;  4FND A;  5DU4 A;  2HW5 A;  5DKP A;  3TZ3 A;  2PG8 A;  2DEO A;  3WG5 A;  3I47 A;  4MOU A;  2DUB A;  3OME A;  4JYL A;  1VRG A;  4JYJ A;  4FN7 A;  2ZL4 A;  2YJG A;  4RCN A;  4HNK A;  2CE3 A;  3T88 A;  1ON9 A;  1FC6 A;  3V5I A;  4WYO B;  4MI2 A;  4RYF H;  2NP9 A;  3QWD A;  4OLQ A;  3TT6 A;  2F9Y B;  1SG4 A;  3JU1 A;  1MJ3 A;  4JFC A;  5DZK A;  3T8A A;  2UZF A;  3GF3 A;  3L3S A;  3H0Q A;  2W3P A;  3BPP A;  3M6N A;  4K2N A;  1X0U A;  3MYB A;  4FN8 A;  1OD4 A;  3BF0 A;  2F9I A;  3Q7H A;  1FC7 A;  1UIY A;  3T8B A;  4KPK A;  2Q35 A;  3U9R B;  3BPT A;  4EMM A;  5DTW A;  4QFE A;  4ZDC A;  4OG1 A;  2J5I I;  5MGB A;  2X58 A;  4L8K A;  4Z0M A;  3QK8 A;  1DCI A;  1XX4 A;  3MOY A;  1HNU A;  1O8U A;  2A7K A;  3KTK A;  3RST A;  3U9S B;  4IZB A;  5KDR B;  1FCF A;  1FC9 A;  5G1Q A;  3NJB A;  3FF6 A;  3Q0G A;  3RSI A;  3TV5 A;  5DUF A;  3MT6 A;  3OT6 A;  3R9T A;  3FDU A;  5HUQ A;  3KTG A;  4FZW C;  1NZY B;  3KTJ A;  2D3T A;  1PJH A;  1UYS A;  2X24 A;  4ZDB A;  2J5I A;  2QQ3 A;  5CTC A;  3R6H A;  1Q51 A;  5DU6 A;  2ZL3 A;  3HRX A;  4YLH A;  2C8T A;  2VSU E;  5C90 A;  4QII A;  2FZS A;  5FUS A;  4ELW A;  4B3J A;  1EF8 A;  4KWB A;  3DJA A;  1W2X A;  4EML A;  4JCS A;  5DTP A;  1UYT A;  3ZW9 A;  4JCQ A;  4ZDE A;  1K39 A;  3QRE A;  3NJD A;  2ZQR A;  4FNB A;  4KD6 A;  1HNO A;  2VSS F;  4LK5 A;  1XNV A;  3ST9 A;  1N6E A;  1XNW A;  2ZL2 A;  4IZC A;  3IB9 A;  2F6I A;  4Q1I A;  2FBM A;  4U1A A;  1N6D A;  4ZDF A;  4NNQ A;  1EF9 A;  4IZD A;  4J2U A;  2PPY A;  5ING A;  1WDM A;  4GHN A;  1Q52 A;  4ZDD A;  3U9T B;  3M6M A;  2WTB A;  2ZQQ A;  1K32 A;  3LKE A;  1N6F A;  4HDT A;  3GLM A;  3G64 A;  3KTH A;  2VRE A;  1NZY A;  3LAO A;  4QIJ A;  1EY3 A;  5INI A;  3SLL A;  3KQF A;  3KTI A;  4JCT A;  4NEK A;  2CBY A;  5JBW A;  4JVT A;  4B3H A;  3K8X A;  4U18 A;  3OC7 A;  3P2L A;  3QKA A;  4Q0G A;  4B3I A;  2F9Y A;  5DZK H;  3Q1T A;  5DU8 A;  3ZW8 A;  3Q0J A;  2FW2 A;  3GF7 A;  2IEX A;  3GMA A;  1TYF A;  1UYV A;  4JSB A;  2F9I B;  4ASI A;  3H02 A;  2Q34 A;  1Y7O A;  5DUC A;  1RJN A;  4JWV A;  3STA A;  1OD2 A;  4U0G A;  5G1R A;  3IBB A;  3GKB A;  5DL1 A;  4K3W A;  4I4Z A;  1UYR A;  2VX2 A;  2BZR A;  4JCR A;  4U0H A;  3PGQ A;  1XO6 A;  3BEZ A;  1WZ8 A;  4JOT A;  3PZK A;  3ZWB A;  5E0S A;  2Q2X A;  2VSS A;  4WZ8 B;  3HE2 A;  2A81 A;  3IAV A;  1JXZ A;  1WDK A;  3QXI A;  2PBP A;  1WDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...