1RK0A

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rk0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1rk0A01
4RGMC 3RAJL 3FHAA 1KB5L 3KYKH 1VA9A 5DS8A 5F9JB 5EOTB 5KVFL 4U1IB 3X12B 1GGIH 1HEZB 3NIGE 2DRUA 4RISH 4PJEE 4UI2A 5ESAB 1CDGA 2BNRD 3GK8L 2EDLA 4TN9A 3QUZC 1KJMB 1P5UA 5FECB 4AT6B 2YPKA 4JY6A 1TDQA 2R9HD 1PZUB 1YUHA 4P46A 1AGCB 1ZHBA 4ODTL 4HLZH 5HHMB 5IW1B 3F7RA 3O6KL 3QFJE 3BSZL 4I9WE 5CSZA 4FXGB 4X4XA 43C9B 4JKPL 5SV4A 3KXFD 2EEDA 5IROC 1SM3H 1X3DA 4LOUC 4KK6C 4PTUB 2VNCA 3WDJA 5DC0A 1EMTH 3LEYH 2FJFB 4OF3A 1A7RH 2X4OB 5BZWA 3BPCB 4G9FB 5J56B 1VEPA 3VG9B 3T77B 4OZGA 3PWNB 4BUHA 4ZUSB 4HJ0C 4MB3A 4M62L 3H9HA 1HDMA 4OCLC 2QQKH 4WFFD 3I6GB 2VLLA 2EXYC 2IFFH 2QHLA 4KKBC 4X7EC 4KI1A 3VXUA 4MS8D 4AIXA 1JGLL 5DR5H 1K2DB 3MTRA 2IAMD 4HEME 3PABA 2VDPH 1KNOB 4O02H 5IVXA 5E8NB 5F1SA 2CK0H 2DQHH 2J8UF 2VXSH 5IQ7L 5TE4H 4EN3A 2FB4L 2OTPA 4WI5A 1W0WB 3RKDC 5DGQA 2NNAB 1K5NB 3IDGA 4YE4H 4Q9QH 5MENA 3L5XL 3Q5YA 1KTLA 2HLAB 3R06A 3RZWA 1T0PB 3M8OH 4G7YH 4WTXA 1INEH 3HNTL 1F6AA 1Z6JT 4OFYA 1KEML 3H0TB 4HXBH 4OCXL 3PGDB 3ZO0A 3TF7A 2VZ3A 3L6FB 3UDWC 3P4LA 1JZ7A 4LEXH 1HXYB 1RJZA 3U0WH 3MZGB 4D0DB 1ED3B 4XVTH 1DN2A 2R23A 1FH5L 3HZVB 2R2HB 4Y2DD 4JLRB 3LPWA 4HS8H 2GITB 3RVWD 4FMKA 3QIWC 4HV8A 1MJ7H 3VI4F 4PV8B 4IBLT 4L9DA 5B3JF 4ONFH 2ADIA 1Z0NA 4LBEA 2YA1A 4O9HH 3QEUB 4TQEH 1VFAB 5D9SA 5GQBA 4JO3H 4HHAA 3F6IA 3DROA 5EOQH 5ETUB 4KK5C 1EJOH 2NYYC 3MLVH 3O41A 1I4FA 2YN5A 1QFOA 4XMLH 3P4MA 4OF7A 2R2EB 3L3OB 2BJML 2MSPA 3F7VA 4RMVA 3V52H 1LO0H 1T89A 1WT5C 3V4VL 1MCCA 3MLZH 4QXGH 2MHAA 4XCCL 4EUPG 5IJKA 3OR7A 2WUCH 5IHBA 4U6YA 4WWKC 1FZJB 4KVNH 5MEPB 3VWJA 5LBSL 1H8OA 2FZ3A 4MJIB 4OV5B 5BXFB 3MQIA 3C60D 1JYXA 3EYUL 4OZGE 4OJFH 1KULA 5B8CB 4FP8L 3SE8H 4ZUUA 1WZKA 3CVHA 3U4EA 5KOMC 1R0AH 5IBLC 4EQ2A 3VXUE 3MLUL 3QQ4B 3WS3A 1HH6A 4ZSOA 5CMAA 1OWRM 2D3VA 2X1XR 1G7QB 1P7KB 2Z8RA 12E8L 5IVXE 1F4AA 1JFMA 1VADA 1LD9A 4N1CA 4OF0A 5EA0L 1UADC 3S37X 3HAEB 3TZVC 2Q3AA 2GAZB 2ZSWA 5C0RL 2DQUH 3PL6D 1D9KD 4P2RB 3WFEH 1QBML 2VXVH 5F9DC 5B39A 5MENE 2QADB 4Z95H 4JE4B 5DMIL 3GFUA 4YHZH 1S7QA 1AGBB 5GGSA 3JSSA 1CK0L 5L0QC 3ZHLA 3QPQC 3O6FB 2PYFB 5C0IB 2ZCKH 3RWGA 4JQIL 1YMMA 3KPNB 3MJ9A 1A6VL 2FX9H 4E42A 5ACZA 4BFIA 5IMLB 2B20A 4ZS7L 3VWKD 2DJUA 2OI9C 3NABH 3K8KA 4QWWD 3QG7L 3IF1A 3OZ9L 4FQIL 5LXGL 1RULH 3BPLB 2VDML 2J8HA 3WKMH 4NT6B 4HC1A 4HK0A 1BEYH 4JDZA 2BVOA 2R4RH 4JB9H 5FOJA 1RIUH 4YDLC 2MQ3A 3M07A 1GGUA 4OUOA 5F7EL 4U3HA 3ZT6A 2YMXH 5EO1A 4FQ1H 1MHHB 1XH3A 1IAIM 2XNAA 1G7IB 3MUGA 5DHYB 1GZPA 2DN7A 3U2SA 3UP1A 4XC1H 2Q6WB 4Y88A 3IVKB 4PJDA 3KLHD 2YKLL 4JQVA 4QRPB 3QJFA 4G6FB 5TQ2L 2ICEA 3SKJL 1EV2E 3VH8A 4JZOA 5LWYH 1OTUD 5L8JB 3HZMA 1U8JA 3IXAA 4DGVL 5IFHH 2ADGA 2DQFA 1NGWA 3OKEB 2HFEA 1QBAA 1IQWH 1H5BC 2VABA 1RUKL 1T83A 4QKXB 2ITCB 4QRTA 3S34H 1LQVA 2P8PB 4W81A 2VLJD 5L6YL 2D7PA 1EO8H 4JPIA 4DZBA 1FNLA 4PB9L 1NBVL 4RWYH 1Q9LA 1F42A 5I6XB 2C1PA 4XPBL 5CGYD 3BW9A 5INCA 1B3JA 2AJXL 4MLSA 5C0BD 1N0XH 3OXRA 1B0GB 4UT7L 5EN2A 2DMKA 4D9LH 5IM7A 1DEEB 2ZWLT 3HRPA 1NCBL 3OKOB 3SDDD 3W82A 1KB9K 1WZMA 3VGDA 5SWSB 5HPOA 3GMRA 4OCYL 1JK8A 3GM8A 4EI5B 1A1MB 2VITB 4D0CA 1NFDA 1NDGB 1Z0MA 3FQTA 5KSUB 1U3ZA 4EI6A 4E9LA 3MRCA 4RFEA 1P53A 2PR4H 4M8QA 3SHSA 4ZAKC 4MQ7A 3NPZB 1MFAH 3ILPA 2FYYB 4LCUA 4Y8DC 3MLWH 3B8YA 3WFDH 3ARFA 3C6LC 4OD3L 2YBRA 5ILTH 5D72L 3L95A 1YMME 3BGMA 3HE6B 1AJ7L 3QHFL 4LVNB 4GQ9L 4U1KB 4CDHA 1KN4L 3MUJA 3O11A 3SKNB 4J3WA 2WW8A 2ERJC 5DZOA 4XRCB 1DFBH 4MDIA 3LCYA 3GIVB 3MA7B 1L4IA 4PLJC 3V0AC 1B6UA 1YMHB 2PCPB 3UTTD 3V4UH 1BOGB 1QLRB 3DECA 3QIBB 4Q0XL 1OGTA 5I1AA 4PJBF 1UEMA 2V9QA 3WSQH 4JZJB 3QNXB 2QLVB 3RRQA 1HYSC 4NQVB 1GCFA 1DL7H 3MGOB 4P2QB 4G3YL 1KTDA 4PJDE 1N5YH 4XPAL 3QDGA 4LARL 3RGVB 4QYOB 5CCKL 1PZ5B 4PJHF 1WFTA 4BZ1H 3QI9A 2W38A 3FQRB 2APFA 2CGRH 4ZOEA 1F3JA 3SDCA 3GSUA 2AJ3A 3HG1A 1FFPA 4ODBD 4XAKE 1M7DA 5AYUH 4ZXBA 2EIEA 1U42A 2I5YL 4ISVA 4ZFOA 3O3AB 2OM5A 3FFDB 3BI9X 2C26A 4V1DD 1UWEH 2OSLA 1DBMH 5C0NC 1FO0A 4J1UA 3UJJH 1AHWB 5E5MB 4HQQL 4EQ3A 4UINL 2VDRL 2W65B 3QDJB 4ZFGL 2PO6B 2HJFB 2VDNL 2ADJA 1KG0A 2VUOA 4N0YL 2EDXA 4NWUL 1WTLA 3SGDI 5FYLH 4KUZH 1EAJA 2H2SD 3AFLA 3KS0H 2BXYA 3EUUA 3L3KA 4PB0L 4GBXC 3P9WB 3O4OB 1FE8H 2YPLB 1I7UA 1OAZH 4MAUH 1R5VA 3HHRB 2CPCA 4XVUD 4JPKL 2C4FU 5GGVL 5T3ZD 3CVHL 4LNVA 4Y16B 1VENA 4I0PC 1NAKL 3S3JA 3MRPB 3C5SB 1BQLH 1JWSB 1NFDE 2PW1A 1BM3L 3HPLA 1IMHC 3FMGH 4KVCH 2P5ED 1OT2A 5JOFB 3UTQA 2L7UA 3UROR 5HYSA 2X7LA 5ID1B 4ODSL 4MXWL 4MGXA 2DQGL 3V95A 5DD5H 5GGQH 3W0WB 4GW1A 3NA4A 3RAJH 1U8IB 2YS4A 1KB5H 4WFHE 3PWVA 2CUMA 5BRZA 4MAYC 5KVFH 3O8XA 4CVZB 3T0EA 2V2XB 2H3NA 3MJ9L 4QHKJ 4Y1AA 3GK8H 3V5HB 2V9TA 4TUKL 1YY8A 3LHPL 1Z9SA 5SX4H 4X6FA 3L3GB 2Z4QB 2ICES 5IMKB 4ODTH 1VSCA 3O6KH 4HC1L 4D8PB 3BSZH 3BN9C 4G8GD 4NQCA 4PJ9B 4JKPH 4NYLB 1WWBX 3RDTB 3P4OB 4OGZA 3K2MC 2ID5A 1VPOL 3QDGE 4LPTA 4LGPB 5E94A 4DUXA 4JFDD 4XH2A 2MOVA 1L0XA 5HDOA 5K9KB 1ES0A 2XWBA 4IS6B 4M62H 4ELKA 4LVOB 2KQNA 5MERB 3UX9B 1ZGLA 1H3WM 4ODXA 2HFTA 4YZFE 2X5PA 3HG1E 4WI6A 4NN7C 4NUGL 5IB3A 5IVNA 1JGLH 4AIZB 2EYSB 3QUYA 1JRHL 1X44A 5CFHA 3DUHA 3QDMA 3HRZB 1AGFA 1GGTA 5AWNL 5IQ7H 1FSKB 2Q7NA 5H94A 3QCVL 2FB4H 3F58L 1FCCA 2DLHA 3O6LL 3F12A 4HW6A 1OTSD 3L5XH 2OTWA 2NY3B 2CDGB 2DKUA 3BXNB 4F7CB 1PKQB 1NLDL 4ZS6C 3DURA 3HNTH 3TIDA 3BX7C 3D25A 1KEMH 4OCXH 5ENWB 4LCWA 4MDJB 1K85A 1DANU 2GW5A 5HYQB 3C5ZB 4NN5B 4HS6B 4TNVF 1U92B 3I3EA 5FV1L 1KGCD 2BXZA 2AP2A 4U1LA 4ENED 2I24N 1TPXB 1FH5H 3GB7A 5AAWA 4CADA 1BQHG 5F7WC 3VXMD 1R3LB 1G0XA 5TGBA 2HFFA 4U1JA 3KPQB 4KRNA 2LTQC 2NPLX 5HHOA 1MCDA 3QHTC 3QULB 1MAKA 3LQMA 1WIPA 2AJYL 3QEHA 5I8EA 4RZCB 2OS7A 1AKJD 1BFTA 5BRZE 3UPRA 4MZ2A 1CTNA 2BZDA 2BHZA 2D0HA 3TM6A 3E2HC 3T0EE 1A9BA 3UEZA 1UACL 2CO6B 4Y1AE 4G42B 3IKCB 4LCIL 2ENSA 5FIEA 1I7TA 3RNKA 5C0CB 3WDIA 1G7LA 5EUOA 2VXQL 2BJMH 2C3VA 1HHHB 4XNZB 4HK3N 1K4CA 1F11B 4Y19A 4NQCE 3V4VH 3MMEB 4R6UA 1VEOA 3O3EA 2IBZY 4XCCH 1YEFL 4TSCL 1IGJB 4LF3A 3OF6D 5E6ID 1AGDA 4A6YB 1UZ8B 1ZS8B 5LBSH 4KJQC 3MRDB 4N0UA 1ONQB 5IR1A 3EYUH 4H5SA 2ESVD 3PXHA 4AH2B 4FP8H 3ARGA 2WLZA 4X98B 3SGKC 3C5JB 4GRMB 3AREA 3NCBB 3IDNB 5AEAA 3BZEA 3T4YA 3D0VA 3WEXB 3MLUH 2GYSA 2HFGL 4NQXA 4X5WA 3BYYA 1MI5A 4PREB 3JBG7 12E8H 2WQRA 4HS3A 1AR1D 3QDME 4IHOB 3ZKSD 4NKDB 4LLVB 4C58B 4QCIA 5EA0H 4Y5XC 3UYOD 2WBJC 1RJLB 4JGJA 3LRHA 3WL9A 1ZLSL 5C0RH 2X9YA 1WAAF 1QBMH 3X14A 3S98A 5KSVA 4QHNB 4NFCA 1FO0L 1AE6L 4UT6L 5DMIH 2Z35A 3F8UB 1CK0H 1JPSL 4NHCL 4JQIH 4LCWE 1VDGA 1A6VH 3ZHDA 4ZS7H 1RK0B 1NC4D 1T7WA 3QG7H 2H26A 3MPCA 3RP1A 3OZ9H 4FQIH 1TZHA 5LXGH 3GJFK 3STZA 3ES6B 2BRRL 3GMQA 2VDMH 4NNXA 1CD8A 3O4LB 4X5XA 1QBLL 1MFNA 3MREB 4RGNE 4P5KB 4LSRL 2H45A 3OKDB 4M48L 3OGCB 3HC4L 5HHOE 3EFFA 4DKDC 3HI6L 1BGXL 4GRWF 5F7EH 1G6VK 2E6JA 2R1XB 4P4KB 4N0CC 1DE4B 4XWOD 3EGSA 4KQ3L 3AS3A 3J7HA 5E6ZA 3BIKA 2E6QA 3H9SE 2YKLH 1PG7X 5TE6L 2XXMB 3EBAA 2IWGA 2LFGA 3QUXA 5TQ2H 3SKJH 4WUUA 5JW4M 3TN0B 1RZKL 1HSAB 4NBYB 4HJGB 4DGVH 5EUOE 4RFNC 1RUKH 4C56B 4Y19E 1A4JB 4J8RA 2X10A 1Z5LA 2BNRA 5C09B 5L6YH 3UTPE 2AW2A 3QXAB 4JFPA 3CLEL 5I74B 4PB9H 1YJDL 1H3PL 1NBVH 1RHHB 1U8KB 4XPBH 3WXVL 2V7HA 4N0UE 2VYRE 4F9PA 1WC7A 2VL5B 1NMCB 2AJXH 3O2DL 2EECA 3CFKB 3KXFA 1TZGL 4R3SB 5ERWB 1XGPB 4UT7H 1LNUB 4WTZA 4NCC1 4UV4L 1NCBH 4NRXB 3KHQA 2FEDC 4RBPH 2Q8AL 1I3GL 1IGFL 3S36X 1WFOA 3U36B 1MI5E 4MB5A 5ISZD 4OCYH 4XBPB 2CSPA 1Q0XL 4J3UA 1T5WA 1C08B 4OIAA 3HUJB 1XR8B 3D2UB 3PWPD 4MS8A 2FX8L 2H6PB 2J5LC 4HUXB 2YD5A 2IAMA 1PYWB 3MLTA 4I2XB 4Q6IC 1BF2A 3NIGF 4OD3H 1R3IL 5D72H 5DYOB 3ARDB 3TA3D 3B9AA 1AJ7H 2NXYD 4CN1A 3QHFH 4LK4A 4GQ9H 1BIIB 5DVMA 1KN4H 5F6IC 3WS6A 4QF1A 1T1ZA 4NFDA 1FORL 1F2XK 5A2FA 1S9KC 3LMJL 3OB0K 3VFNB 2FECI 1AGEB 2UZXB 3IS0X 2BRQA 4HSQA 4PRPB 3BKYL 3M17B 4Q0XH 3CSYB 3GSNA 3SBWA 1T7VA 1G7JA 3FT4B 3GMNA 4UOW0 3KNBB 5KOVC 5AYQA 4G3YH 4Y2DA 4PRAA 5DA4A 5CZXD 4XPAH 3I3DA 3MV8B 4JVWA 2XWJA 4LARH 3L3IA 5CCKH 4HKJB 1LO5A 2EEAA 5C9JA 3MCG1 4WUUE 3IJHA 4QRQB 1EXUB 4DUVA 2P1YA 1VESA 4K3DL 3SEPA 4Y4FD 3NA9L 3IAPA 4YK4B 1TENA 3DRTB 3OR6B 4R97B 3JWOC 1P69B 4JGUA 5DJXA 4PJIF 1D5IL 3LB6C 3VGFA 3G5XA 5EH1A 1BFSA 1BVLB 2CR6A 2I5YH 3BP7B 2BNRE 1CFBA 4X7SL 1U3HB 1IBGL 3T4AA 3UYRL 3NIDE 2GTWA 2A1WL 3HE7B 3RZCC 5KW9L 5KN5B 4HQQH 4UINH 2VDRH 2HMID 3NCYS 4ZFGH 2YUVA 2VDNH 3MYZA 4LLUB 4N0YH 1DBKL 4NWUH 3KXFE 5F88B 4PB0H 2MPAL 4YBLC 4HLZG 2NY2D 1O0VA 3HLAB 1E6JL 3H9ZA 2NY6B 4JPKH 3STBA 5GGVH 3K3QA 3CVHH 5IHUL 3QO0A 4XP1L 1NAKH 4JR9L 1CFSB 3VFMB 4WFFE 1W72A 1WCBA 1J11A 2X9XA 3GI9L 1BM3H 2HJLA 3WJJC 4GO6B 2UZIL 2RHEA 2VISA 4GMSL 4U0RC 1R3HB 2W9LA 4ODSH 4MXWH 4HF5L 2DQGH 4L3EB 1BBDL 1L7TL 3P2TA 5F8QC 4Y5VC 5D2NB 3TNMA 3PL6A 1D9KA 1AY1L 5E00A 1MCFA 2RIKA 4U6TA 4XBGA 4UU9A 3TYGL 3U7WL 2X89D 3MJ9H 1C1EL 3DTXB 3OXSA 3HPJB 4ZAKB 2Q1EA 4TUKH 5E8OA 3IFPA 5IESL 1HWHB 3LHPH 1OWWA 3MXWL 2LV4A 1IQDA 1LO2L 4LHUB 5BQ7B 2V2TA 4EIZC 3GMMA 4MXVE 4YHYB 3RFZC 4UQ2A 5FA3A 1IAII 1Q9OB 3BYTA 1M7XA 2SEBA 3DUSA 4HC1H 4WW1B 4BKLA 5CD5D 3T3PF 1F45A 2KZ1B 2A83A 5DQ9A 4OZGF 5FGBA 3JTCA 1VPOH 1AH1A 2K7PA 4Z7VA 2I9TB 2PNDA 2OJEB 5LGJB 4XXCC 5GGRA 1MCNA 4I0CC 1EIBA 2WWMD 3VXRB 3LV3A 1E4KA 1YN6B 1JPFB 4PYGA 2NTSP 1BVKB 5IVXF 5HDLA 4LPXA 5D1QC 4NUGH 2QQLL 3LKSB 5IBTL 4X83A 2FWOB 1G9EA 1JRHH 3KDMA 1OTTD 1PLGL 5AWNH 1PDKA 4ZQKB 3RGHA 3BDBA 3CU7A 1FPTL 3QCVH 3F58H 3GEWB 5MEOA 4OD2A 3DMMD 3RTQC 3VG0L 2EE9A 2VLJA 3HR5A 3O6LH 1L0YA 3HC3L 1GOHA 4G59A 5FB8A 1L8JA 4KK9C 1NLDH 1CG9B 2LVCA 4GRLD 2EDJA 3GRWL 2MTPA 4M5ZL 3T3ME 5DJ8A 3BO8A 5C0BA 4Y89A 3W11D 5LAXB 3WLWC 3HTLX 2X42A 1BQSA 5J3HD 5FUCC 3AY4C 5FDYA 4F37K 3VXTA 5FA4A 4WHTB 4L4TB 3SDDA 5DJAA 1I3RB 1QRNB 4W68A 2EKSA 2FLBT 2XOTA 2E6PA 4W4OC 4Q9RL 3PQYB 4MJ6B 4NKMB 4K7PY 3R8BB 3MRHA 2AJYH 2ZOLB 3IFNL 1FLRL 3RL2B 4G6JL 1BREA 1PG7W 5J4MA 3U6RA 3RX5A 5L2JA 2F8VA 2GSIA 1UACH 3RPIA 4LCIH 1CL7L 4S1DC 1Q0YL 1NFIA 1TTUA 4WFED 3T0DA 4BQCA 3DLQR 2VXQH 1U8OA 5JORB 5D7JD 3TBYB 4PLNC 3BPOC 1JGUL 3GSNL 1YEFH 4GKSA 4TSCH 5E4IA 5HYJD 3UTTA 3MRKA 4YDVA 1J7VR 4OF5A 2VQ1A 1A1OB 3C08L 3LRSB 4Z7VE 3MV7D 4APQC 5FEBA 2HTKC 3S96B 2IMNA 4NRYA 3CDGB 1MLBB 1M6OB 4M4RA 3MRLB 1EZVY 5KSAB 4NQDA 2GIYA 3MJ8B 4MXQC 4PJ7A 2AKRA 3BEWB 4ONHA 4KZEL 1KF9B 3LKQA 5J9PA 2HFGH 4HG4J 4YGVB 5D1ZD 3IRZA 4IJ3B 2APTA 1TQBB 3U79A 4YNYB 3G6AB 1S7XA 2FRGP 2CDEB 2FR4A 4LU5L 3P4NA 5HY9A 5H35B 1ZLSH 3MXVL 4HMCA 3H9YA 2VLJE 3MRQB 4V1DA 1J5OL 1FO0H 5ID0A 1AE6H 4ZUTB 3SDAD 3WJLC 2AK4B 4JRXD 4FQXD 4UT6H 1KCKA 5C0GA 5HYIA 5C0FA 4KKAD 4YLQT 1JPSH 3HB3C 4RFOL 4NHCH 1FGNL 3TCLB 2PF6A 3Q5TA 5CJ5A 2JK5B 4U3CA 4WV1A 4XZUA 5C0BE 5IB1A 3QZWB 2E5EA 1ETZB 4P5TB 5DUPL 4UT9L 2GK0A 1XGTA 5DJYB 2BRRH 5F21B 1WTGT 4MA1B 1I8MB 1QBLH 3REWA 2NTFA 1W72L 2GJZA 4YFEA 3EO0B 4LSRH 5A43C 4M48H 3ZL4L 4CGTA 3PGCA 3HC4H 1I1AD 3AM8C 5GISL 1Z9OA 3HI6H 1BGXH 1JTPA 1UGNA 3PV7A 5IB2B 1ZWIB 4KQ3H 1FZOB 2P5EA 3WD5L 4DFHA 3ZDZE 2BHUA 3WLBA 5TE6H 2QTEA 1XCQB 1QO3B 4M6NL 1MF2L 1S7UB 5AG9A 5F9WC 1RZKH 3EYVA 1JNHA 3VRLE 1ZT1A 1IZKA 3LKPB 1CXEA 2KUTA 4IIQA 1A7QL 4RMWA 4OGAC 3OJDA 1YEHL 1SJEB 1C12A 4K7FA 3UTTE 3CLEH 4OKVA 1WWCA 1YJDH 1H3PH 4AEHL 1TQCB 1TZIB 4Q6YA 3UTOA 2BCKB 5HHQA 3WXVH 1XIWD 4LNRA 4XP4L 5HYEA 2OMNA 4L3AA 4G8GA 3O2DH 2ZCLL 3RWCA 1U8LA 1TZGH 3SJVB 1IGYA 4NQDE 4O2EB 4P46C 4PJ7E 1X4YA 3O9WB 4UV4H 1ZSDB 4JFDA 1BZ7A 3VDCA 2EDNA 4HMDA 1OCWL 3VMPA 4WDIA 3BP4A 4JFOB 2Q8AH 5K9QI 5FF6B 1I3GH 1NFDF 1IGFH 4JY4B 3G5VA 4FFVC 3FOMA 3D3VD 1ZHLA 3IDJA 3V2AR 3THML 1HI6B 1CD0A 4PGCA 3ARBD 4F33A 3Q1SL 4OUUA 1Q0XH 1K8DA 5H2BB 1E6OL 2FX8H 4E5XB 1HHIA 4V1DE 1Z9MA 3KYMA 1FGVL 1C5DB 4D2NA 4ELMB 4FABL 3JV6A 4MQXD 4Z78A 2XWTB 4X6CF 1R3IH 5I1JL 4IRJB 1NBYB 4G8EB 4D9RD 5HBBA 4XI5D 2JB6B 1MLCA 3N85L 3C8DA 1FORH 5DMKA 3LMJH 1A0QL 4EN3C 1J0YA 1KIQA 1IARB 5ESVA 2VSDA 1HQRA 3C2SA 4JQXA 2UUDK 1XGUB 3IKKA 4PJHB 3BKYH 4LKCA 5T3ZE 5DMGD 3EO9L 1MCKA 4XHJC 1I8LA 1HOCB 4KJPD 5IHZB 2EDDA 2Q8BL 4PP2B 5ICYA 3X13B 2HH0L 3TBVB 1U8NB 1LK2A 4KRPC 4ZUVB 3TF7C 2NR6D 1MHEA 1SY6A 5L8KB 2P5EE 1FAIL 3VXMA 1T22A 3X11B 4HKXB 1SHMA 3R0NA 3DX9A 1KTKE 4N5UA 3EJYD 2VERN 5I1LA 2AJSL 3P9MB 5EU6B 4K3DH 3Q2CA 1CICB 3U9UB 2C3XA 3ROOB 1AKJA 3NA9H 1R5IA 4PS4L 4DAGL 3RIAF 3UTSB 4E41B 3WE6B 1D5IH 5D6DA 1HHKA 1KCRL 5J57B 1VERA 3FT3A 3QSKB 3MODL 4X7SH 5EU4B 1NGZB 1IILE 1KCUL 4LLWB 2LU4A 3TYFB 1IBGH 1WVZA 3UYRH 3MLPA 2FH6A 5INDA 1FIGL 2A1WH 3EYFA 5DUBA 5KW9H 4U05A 5FYKE 7CGTA 4G8GE 4Y4KA 5CJQL 5DRXB 1JGVL 1V8HA 1DBKH 4PJGA 4LKXA 3RUGB 4CW1B 5CBAA 5E6IA 1N4XL 2MPAH 2QKIA 3SGJA 3UMTA 3VFGL 2BNQA 5D93B 5JO5A 4JFDE 4PG9B 4MCYB 1T89C 1E6JH 1MH5A 5T5FH 3SCMB 2R4SH 1EH9A 3GSOB 4JFQA 2E3VA 5E8PA 5IHUH 2ESVA 4XP1H 5IJKC 4FMFA 4JR9H 1YN7B 2EDTA 1SYVA 2D7NA 4YDJB 3VFOB 3ZMRA 3GI9H 1PVHA 4BZ2L 3VWJC 1BVZA 3IDUA 3MRNB 3MLSL 4L29A 5T1MB 2UZIH 4JAMB 2HYMA 2VZ1A 5KANG 4RMTA 4GMSH 2HA1A 1RY7B 1GZQA 2EIBA 3OG4B 3ARSA 1CFQB 4HF5H 1BBDH 3EJJX 1L7TH 4KGLA 3V9FA 2R69L 3QXDB 5E2VL 3AROA 1AY1H 4POYA 5FYJD 4OD1L 3VCLA 1S9YB 2HG5B 1KLUB 2NY1B 3TYGH 3U7WH 1CGVA 2BVQA 1C1EH 2W0FA 3S97C 1XFPA 2K7QA 1KCSL 4JO2L 5IESH 5D6CA 3L7EB 4WO4B 3MXWH 3NFNB 1URLA 1LO2H 2XI9A 5EUKB 5EU3A 2FJGA 2DQCL 1NC4A 4LMQI 3TH4T 4D94A 4F3FA 4FQHB 1UH2A 5T3ZL 5I8KL 2BSRB 1DQJB 4IOIA 3VXME 5CWSA 5FGSA 1KELL 2BY0A 4FRWA 3KPLA 5D2LA 5GSRA 4R4ND 5J13C 4UNTA 1X5LA 1QFHA 1CGYA 3B43A 1IGML 4X4YB 3ILQC 5C8JB 2B5IB 1BZQK 1U8PA 1NEZB 4M1GL 4QY8B 3ZDYF 3SO3B 2AJZB 3PHQA 1JYWA 3GJFA 2QQLH 2XFXB 5IBTH 4KUCD 1P7HL 1ROWA 1OB1A 2L7JA 4CBPA 5F1NB 3WUWG 5I18L 3M1BB 4XCFL 1PLGH 4EKXA 1F3RB 2EXWC 3LQZB 4JQVC 2HN7B 1FPTH 2W91A 4BH7A 2IBZX 2XZQL 3GSXA 3VG0H 4PJGE 3TO2A 3HC3H 3FQNB 3VXQA 3MR9A 4G6ML 1NGYB 1LE5A 2BNQE 1KYOK 5DO2D 2IGFL 1J1OL 3GRWH 2R56L 1YZZA 1UC6A 3CDCA 5TDNB 1RFDL 4M5ZH 5GS3A 2ESVE 4OQTA 2FIKB 3IETB 3KHOA 1LDSA 5J11B 5FXCH 3CNKA 1GYAA 1T66C 2UWEF 5HVGB 4IM8A 1A6TB 3CFJA 3D85D 5FCSH 5L7XL 4Q9RH 3V0VA 4QHMB 3LKRA 3WIHL 1XF3B 1R5WB 3L3DA 2X70B 4JM2B 3UCRA 3DVGA 3T0VA 3IFNH 3PWPA 4PJ5B 5HHMD 1FLRH 5DJ0B 4G6JH 1J05A 4MNHB 3CPLA 1WEJL 4UDUA 5EUOF 3LVEA 3KPTA 3SE9L 1CL7H 1Q0YH 4LHQB 4Z77B 5LQBL 5BVJA 4G9FD 4RRPA 2GT9B 4KJYB 5HJ3A 1TTGA 3ARFC 1MHCB 1DBAL 4B7LA 3CH1A 1JGUH 1QVOB 3GSNH 2ATPA 2NY4C 4KK8D 3KWWB 1I9RL 3V5KA 3C08H 1NCCL 2YUWA 4QNPE 2GSGA 4NPYA 5BS0B 1SY6L 2IH1A 4XMKL 1VFBB 1FNEB 3GMLA 3P0YL 3BRGC 2HJKB 2WINB 1U8MB 4HIXL 1MCJA 2UY7A 1LO3L 5GIRA 4JFEB 2X4UA 1X5YA 4KZEH 5DEFA 1XF4B 3C60B 3K1KC 5JMOC 1S8DA 1RK1A 5EBMB 1BMGA 2EIZA 2NZ9C 3NFPB 4YO0A 4Z7OF 3QFDA 4Y4FA 2OL3B 1UJTA 1U58A 2FO4A 4M6AA 5D1XB 3S35X 3OKKA 4Z7WA 4LU5H 1N59A 1AQDA 1XGQB 4NN6B 1LEKA 3MXVH 2ADFL 4FFEX 1LE9A 3QI9C 4ZYKA 4IMKA 1EEZB 1FZKB 4U0QB 3T0BA 1J5OH 3SDCC 4UZGA 1KJ2A 4OFKA 3LEVL 4Q9CA 1MCLA 2EYRA 4RFOH 1DVFB 1FGNH 1JNLL 4KTDL 4ZXBC 4P3DA 5E03A 3RY6A 1JFQL 4MD4B 1C16B 1UQSB 2VRAA 4KKCD 3SKOB 3VXPA 4OV6F 3QXVA 4XAWL 3ULSB 5DUPH 4UT9H 5E8EB 3Q6FB 5A2LH 4BQ8A 3GMOA 4IOFC 3U4AA 4X5LA 3MFGB 4F57L 4JJ5B 1IGTB 1JPGA 1N5AB 3BZDA 1W72H 4PFEA 5DVKA 3ARPA 1HK6A 1FHGA 5ISZE 3HC0A 3ZL4H 3VFTB 1MCWW 3IYLW 2ZUYA 5I76B 4P23B 2VDQL 4PV9B 1I9JL 5GISH 3A67L 5HGBB 43CAA 4ZTOL 1ERNA 4MQSB 4LLYB 2P45B 3OKLA 3PWPE 3BD5A 3WD5H 1N3NB 5I30L 5HDQL 1SJVA 1YY9C 4U6XA 1CDBA 4JGMA 4WI8A 4LQFL 3KJ4C 3OX8B 5F1OB 4M6NH 1MF2H 3STLB 3GSRA 3UAJD 4MJID 3ARUA 1G9ML 4JDVB 5FHBL 2CLRB 5DI8A 5IF0B 4QXTB 2X89A 4FFWD 2IH3B 1A7QH 3MRRA 2RFXB 4K8RD 1YEHH 3PWJA 2H8PA 2LABA 3QNZB 4Z18A 4NDMA 2QJDA 1IAKA 4AEHH 1RZKC 3O8XC 1WGOA 5CP3H 5FM8A 1JUFB 3T0EC 3DGGB 1NANI 4HKZB 4XP4H 1NGXB 2ZCLH 4HPYL 1IM3A 1QUNA 4P2OB 4P2RD 4FNLL 4OFPA 1ZLWK 2QADD 1YJDC 1OCWH 32C2A 3DVFA 3QRGL 1FYTB 5I2IA 4S0UC 3O6FD 3THMH 3Q1SH 5JPNA 4KGJA 2H2PC 5ANMB 4J3XA 4Z7WE 5D7SL 1E6OH 2EICA 3QQ3B 3LSOB 3B9KB 3WIFB 4MWFB 1FGVH 3GSWB 4PY7A 1J9CT 4FABH 4TVSa 2P8MA 4RGOL 1MJJA 3AMLA 1N6UA 1KJVA 1MRDL 5I1JH 3K4AA 2AV1A 2ARJA 5JW5A 3VFVB 3DETD 3N85H 5GSVB 3QUYC 1ZT4B 5DJ2B 4LPWA 4HGWB 1T1XA 2WNGA 1KPRB 2BP3A 4CU8A 1A0QH 3TO4A 1RZJL 4MXVF 5C2BL 3ALPA 5JZ7C 4OQTL 4NKOB 4BK5A 4QRPD 4GLRH 3WHXA 5IEKA 1QEWB 2WIMA 4G6FD 3SKUD 5FK9A 3EO9H 1NQBA 1X7QB 4X6DB 4NKIL 4Q74A 2Q8BH 1P4IL 2HH0H 3P0VL 3P30L 5DF0A 2VZSA 1NUFA 4PR5B 5DK2A 4PJIB 1FAIH 3BVNA 4LHJB 2AGJL 15C8L 4MHHI 4LLDB 4MD5B 1JGDB 3S3PA 3PHOA 2AJSH 4IMLB 1EHLL 3TJEL 1KIPA 1CXKA 1T5XB 2R1WB 2VIRB 1P4LB 4PS4H 4RGNC 1WUNT 5CHNB 4DAGH 3ESVF 1TITA 2FEEI 1OF2A 5EO0A 3RWEA 1YQVL 1KFAL 1KCRH 1A4KA 5EBWB 3MODH 4R4FL 5B39G 5TF1L 1KCUH 1A2YA 4JZNB 3I6LD 1FIGH 3BRDA 5SWSD 1NCDL 1WQVT 5IV2A 1KPVA 1QFWM 4PRDB 1NAML 4EI5D 1FL6B 4J12A 5CJQH 1JGVH 5E2JA 4HIIA 4O58L 4PJCA 3RWDB 4FQQA 4M7KL 2X4NB 3T3MF 5HYJA 1K3IA 4KMQA 1N4XH 5JPMA 4ZUWA 3VFGH 3GJEB 3BEVA 3U46A 3MV7A 2GJ6B 5DS8B 7FABL 1CGSL 2X9WA 3CX2A 5EDXA 2VN7A 2O61A 1F90L 3HE6D 4PGBA 1VKXA 5E70A 1EVTC 4BZ2H 3K8LA 5GHWL 3MLSH 2V2WA 3U82B 1JWMA 4NQUA 5F72S 5D1ZA 4QXWA 4GW5A 3ARGC 3PIQA 3E3QA 3W2DL 3H3PL 1QLFB 2VTFA 3QIBD 3VH8G 3AREC 2DM3A 3JV4B 3WMSA 4RA0C 4WNQA 2R69H 2R0LL 5E2VH 4PJAF 1MY7A 2HVKB 4NQSA 3T65B 1F4WL 4OD1H 5CAYB 3SDAA 4JRXA 3AXLA 4FQXA 1OSZB 1AIFA 2CLZA 4JREB 4WU5A 4P2QD 1P2CA 4OZ4A 4R0LA 5FYLD 1KCSH 3QCTL 4O5LL 1TLKA 4JO2H 3WUZA 3B3IB 1P84K 2JJVA 2DQCH 2GCYB 3ZTNL 4DN3L 4HH9A 3DIFA 5GRUL 4Z7VF 5T3ZH 5I8KH 2Z93A 4WW2F 1KELH 4LVHC 5ITFA 3BH9B 1L0QA 4K7PX 5ESQB 2F8XC 1I1AA 3JXAA 4P3WA 5HVHB 1MFCL 3FRUB 3R06B 3FB8A 3REVB 2X4PB 1DN0A 2PO6D 1IGMH 3DV4B 3QNYA 4UDTB 1S7RB 1EAPB 4M1GH 3VGHA 2G2RB 1QKZL 2AQ2A 4I4WB 3FHQA 1KXTB 4M93C 2YPLD 5L2KB 1I8KA 2V7NB 3S4SB 4WFEE 4M6OL 4PGDB 5I18H 3F5WA 4XCFH 4ZO7A 5FO7A 4TNWF 4XPHL 3BD3A 3P9LB 4RQQA 2NY0C 4FQJL 1GGBL 3CFDA 3QUXC 5DMJB 2XZQH 4PJCE 2WBKA 1KEGL 4HV8B 2BC4A 5HYJE 4G6MH 4HUNB 4Z7UF 1J87A 4GAJL 4V2BA 3ULVF 3MV7E 1N8ZA 2IGFH 2AERT 2AV7A 1J1OH 2R56H 3DV6B 5DFVD 4HGKC 4OCNC 4OGYL 1RFDH 5J6HB 3V79C 1JF1A 1Z3GL 1NPUA 1QNZL 1HILB 2R9HC 4CN4A 1WZLA 4LLQA 4PLKD 1WFUA 5D5MB 2IMMA 2CDFA 1UH4A 4F9PC 3B2UD 3GSVB 5DRWA 2CIKA 3MRIA 3D3VA 2Z92B 4PP1D 2AQ1A 3E3QE 4AENA 2AJVL 1OLZA 3F7YA 3ZDZF 5L7XH 3WIHH 3EDJA 3X3FL 4V3EB 1O7VA 2ICCA 3N1PC 1YEEL 4YAQA 3BISA 3LKOA 4LEOA 4PJ9D 1WEJH 4JRXE 3VRLF 4G8FB 1P1ZB 2X4SB 4G6AD 1RJCA 4QXUL 1IAOB 1EEUA 3I75A 3SE9H 2YR3A 3S5LA 2RJMA 4MS8C 5LQBH 2IAMC 3I02A 3MA9L 5TFSL 4QGTA 5BVPL 3WYRA 1YYML 2W0LA 4ZSOB 5AD0A 2P42B 3LPFA 1DBAH 3PJSB 5HGDB 3AAZA 3QO1B 4R2GB 1FZMB 3T2PA 3DX7A 1FVEB 2GTZA 3KPRB 4HD9A 8FABA 3WS6C 1I9RH 5L88L 1NCCH 2Z8WC 5I75C 3BMWA 1SY6H 4PJ7F 4RAHA 5JDSB 4XMKH 5EBLB 1BZ9B 3P0YH 3T2NL 1S7QB 5BOPA 4HIXH 5FCUL 3CAFA 1ZVHA 1G6RL 1LO3H 4U1MA 3SBWC 2AXHA 1ZLVK 4YHIB 2XA3A 3D9AL 5FUZL 2NY3D 1YPZA 2PTTB 1KBGL 3MCKB 4PTTB 1FL5B 2M1KA 5HYSG 3DSFL 4LDLB 4AM0A 2VLME 4Y2DC 4CMHC 2YD1A 4K9EL 2YRLA 3RVWC 2JELL 5DEGB 1X5AA 1AXSA 1CGUA 4PY8J 5DDHA 4NO2B 2ADFH 4YXKL 1VCAA 1S9VB 4F15B 1JF6A 3BKCL 3SDXB 1KB9J 2YUXA 3LEVH 4RAVA 1XZ0A 2A6IB 4KTDH 1JNLH 4YR6A 1JFQH 4LP4A 3PNWA 3VFWA 3EZJB 4K23L 1MFDL 1LEIB 1L7IL 4OLYL 2ICEB 1RZGB 4XAWH 4J6RL 4U1NB 2YD3A 4ACPA 2CIIB 1LEGA 5FDWB 4F57H 5IOPB 2DBLL 1RI8A 4L9LB 3D3VE 2M26A 4DUWA 3GIZL 2DM2A 3MX0A 4UIMB 4QRTB 4O00A 5FHAL 4HCRL 2XZCL 5GJSL 4BJLA 1SEBA 2DQEL 2VDQH 1I9JH 4K3HA 3A67H 4ZTOH 4I1NB 1FN4A 3E6HB 5C0CD 5FOBA 3T1FA 5GGVY 5I30H 5HDQH 5C0DB 1RZ8B 3C6SA 4LQFH 2AXJA 1F8TL 2OQJB 3QUMB 3BDXA 2XT1B 3HCVB 2NXZC 4DKEL 4UNUA 5IM7B 1YEGL 2O5YL 2HLFD 3TVMB 4D9RE 3FQXA 1G9MH 4XP9L 3SPVB 2R8SL 2B4CL 4QLRA 5FHBH 1CFVL 4RMQA 4G8IB 5C0AB 2W60A 4MMXC 1ZA3A 5GS2D 3PL6C 1D9KC 4KK6D 5DJCA 2R39A 3A6BL 2ZNXA 2I9LB 3RVTD 3Q48A 4FXKB 2FL5B 4F7MA 4XBEL 4YHML 3VD5A 3UJIL 1X9QA 4HPYH 4ZOCA 2FECL 1CE6A 4L8SA 1MVUA 3VWKC 5BV7L 2EXYD 4FNLH 4QWWC 3MRBB 3QRGH 4QHUA 4YXHL 3OKNA 4X6CB 5FGBC 1CYGA 3PGFL 4WJ5B 5D7SH 3VFSA 3RKDD 3AS2A 3OKMA 5FGCB 4U1GC 3ROLA 1INQA 3O4LD 1M7IB 4R4BA 1E4KC 5JA9A 4BQ6A 4HIEB 1P7QD 1W2KT 2A73B 4RGOH 1MRDH 3BT2L 2DIBA 4YFLF 4HFWA 4PRBB 3RL1B 5HDBF 1OTUC 2NZIA 5E2WL 3R0MA 4P4KD 5FO8B 3FT2A 2EDQA 2W9EL 2Q7YA 2V5SA 1FL3A 2Q76B 4YWGL 2PXYB 1RZJH 3NPSB 5C2BH 3VU2A 4DZ8B 4OQTH 4AEIL 2EC9T 5E95B 3LQAL 2XKNA 4HUUA 4NKIH 4ZFOB 3SGDH 1P4IH 2DTSA 3P0VH 2NLJB 1I7ZB 3P30H 5F9JA 5EOTA 3VD4A 5CGYC 1NAMB 4U1IA 3X12A 3ZKXC 1HEZA 4YFDB 3RVUD 4UNVA 4CJ1A 5ESAA 4C56D 4LRNL 2AGJH 3ARRA 2Z8VC 15C8H 3PWUB 3OTTA 5C09D 5CEZD 4FS0A 1KJMA 1QR4A 5FECA 4AT6A 3KLSA 1ZKAA 2X6MA 4IRZL 4JCLA 1AGCA 3SDDC 1EHLH 3TJEH 5IW1A 5HHMA 1ITCA 3ECBB 5FYJE 4FXGA 1EGJL 43C9A 4K55A 4AMKL 5JW4R 1WBZB 1AQKL 4D9QD 1YQVH 4JFYB 1KFAH 2AEPL 1PBYA 4PTUA 4HG4K 4R4FH 5TF1H 1UKTA 2FJFA 2NCMA 4EZMA 3TT3L 2X4OA 4DK6A 3ORJA 4PJGF 4G9FA 3T77A 4LASL 4JN2B 1NCDH 2DYPB 4ZUSA 1BBJB 1NAMH 3I6GA 3WNPA 3RHWK 1U9KA 4O58H 5DFWH 4WEBL 4M7KH 4HWNA 3D2UD 1LWRA 3G5ZB 2UVFA 1QYGL 1MRFL 5IBLD 1K2DA 4QO1A 3MRFB 5K33A 3S9DB 2ED9A 7FABH 2NY5L 1KNOA 2AAVA 1CGSH 5E8NA 2I27N 1KLGB 2QV2A 1IAIL 1F90H 3U30C 3ARDD 1W0WA 4ZFFB 2NNAA 4WWID 1E27B 5EU7E 1YY8B 1K5NA 5GHWH 1CE1L 1J0IA 3P3YA 3UPAA 2HLAA 4UOW1 2I25N 1EJ6A 5KS9A 5BCAA 1I9EA 2J3SA 5I1DB 1IKFL 3GSQB 1LGVA 3CDFA 5HXMA 3H0TA 5I73B 3PGDA 1CN4A 3W2DH 3L6FA 3H3PH 4PRPD 5BZDB 1J0JA 1QP1A 1HXYA 3DHMA 3MJ7B 1MSPA 4R7DB 4D0DA 2R0LH 1ED3A 4JRYB 3HZVA 1F4WH 3VDBA 3NAAL 2BERA 1J8KA 1WIOA 2R2HA 4KV5E 3CH8A 1TVHB 4P3CL 1HQ4B 1RUPL 3RVVD 5ADPL 2GITA 3MV8D 3QCTH 4O5LH 4ZNEA 3B8SA 1I75A 4PV8A 3ZTNH 1HHJB 5B38B 4DN3H 1K8IB 2DJSA 3G6DL 5DGRA 5GRUH 5C07B 4Q97A 3ARQA 3ZKMC 2K9UA 2YHGA 3QEUA 3LKNB 5I17B 4QNPF 4LDEB 5D2LF 1VFAA 3VRIB 2DQTL 4WV1C 4GXUM 2YRPA 4MNGB 2G75B 1EEYB 3KYOB 1NDMB 5ETUA 2PN5A 1NEZG 2H2SC 1U3HD 5C71A 3CUPB 5A2IH 4OGXL 3EJZD 4I48B 1MFCH 5KJRL 2WQ8A 2R2EA 2VLRA 3L3OA 5HHME 1NLBL 1PAMA 1ZEAL 3DXAB 2P5WB 3SKMB 3MLXL 1QKZH 3NH7H 1JPTL 5LG1A 4KI5D 1OQOA 1FZJA 5FYJL 5MEPA 5T33L 4PJXB 4M6OH 2NY6D 4MJIA 4OV5A 4G9FE 5BXFA 3TPKA 1XCTB 1QFUL 4G80B 4XPHH 2XN9B 5B8CA 4FQJH 1GGBH 3QA3B 3CZFB 4CVXB 1KEGH 3RVXD 4JKKA 3QQ4A 4GAJH 1G7QA 2UWEB 1P7KA 1TVDA 2OP4L 3G6JA 4IIQC 1J86A 1E4XI 4OGYH 3DMMB 5I9QB 1NEUA 3ZKND 4L3ED 3MZTA 2E7LA 1Z3GH 3HAEA 1QNZH 4LCCB 2GAZA 4Z7QE 4MNQB 4P2RA 5BMFL 1WV7T 3LDBC 4K3GA 4GRLB 3LS5L 5GS0H 4OLVL 4EIGB 5C86A 1AGBA 3O6FA 2PYFA 4HZLB 5IBUG 5C0IA 2H1PL 1F58L 4ZAKD 4B53A 3KPNA 5CLWA 2AJVH 5IMLA 1T0MB 4LHUD 1G7MB 3RU8L 4W4NA 3X3FH 3BPNC 4OBSA 5CGMA 4U2ZA 4C83B 2Z9TA 4NT6A 1YYLH 3F7PC 1G6RB 4QXUH 4TPRL 5CUSL 4MA3B 4TULL 5D7KD 2Y5TB 1VGEL 4ZNEE 1JF5A 3WFBL 3MA9H 5TFSH 4JRWA 5BVPH 4RMSA 1OP9A 4GS7C 1YYMH 1MHHA 3VXRD 4O4YL 4TUOB 3HFML 5ICXB 1G7IA 5DHYA 1UKQA 2Q6WA 3IVKA 1BWWA 1J88A 1JZ4A 4QRPA 2H32B 2VDOL 1B2WL 1T1YB 4QCIB 4LGRB 1RURL 1SJHB 1OTSC 1XGYL 5L88H 2VC2L 2MCG1 1OQXA 1WIUA 5D7JB 1ZA6B 3EYOB 4U1SB 1S7SB 4MD0B 3OKEA 1I7RB 2FLRT 3T2NH 3WHE0 1DBBL 4JQXC 1MCOL 3B5HA 4M4PA 3TPUB 2ITCA 3D1MC 5FCUH 2Z0BA 1RUAH 1P5VA 2P8PA 4XNMA 1G6RH 1I8LC 5GJTL 3EOYG 3RIFK 3D9AH 5FUZH 4ENEC 5IB4B 1KBGH 2XRAL 2IPKB 1QFWI 1A9EB 1H8SA 4QOKD 1TZHB 3DSFH 3IFOB 4MJIE 1DQQB 3SN6N 2JELH 5EIVA 4JG0L 4OSUL 4OZFB 1B0GA 1A1NB 3MCLL 3TEUA 4YXKH 1DEEA 3Q6GL 3OKOA 1A22B 4L4TD 2XA8L 3BKCH 3DX6B 2P47B 4AEFA 3EOBB 5SWSA 5D6DC 3ZKQD 3ZE1E 4EI5A 3IAGC 1A1MA 3PQYD 3WFHB 3IDXL 2VITA 2DM4A 2E7LE 1NDGA 4K23H 1MFDH 4I0PD 5KSUA 1L7IH 2HRPL 4OLYH 4H1LB 4P2RE 4J6RH 1FJ1B 4HX1B 1Q72L 2QL1A 3LD8C 2FYYA 2DBLH 5B21A 1U6AL 1RIVL 3GIZH 4OLXL 1GPOL 1IE5A 5FHAH 4HCRH 1WK0A 2XZCH 3HE6A 5E6IC 5GJSH 4Q2ZB 2DQEH 4OQ1A 2HRLA 3QP3A 4O9HL 3SGJC 3Q3GB 4U1KA 2BFVL 3FQWB 4JFPB 3SKNA 1S9XB 1CIDA 2GEEA 4CU6A 5GRXG 3AB0B 3GIVA 3MA7A 1F8TH 3OAUL 2PCPA 4BSVB 2VWEE 1BOGA 1QLRA 1PFCA 3QIBA 2VZOA 4CNIB 2FHCA 4M8VA 4DKEH 2BSSB 1WWAX 1YEGH 4JZJA 1UM5L 3QNXA 4XP9H 5KVEL 2R8SH 4GKNB 2MKLC 2B4CH 4H1LH 5M94B 1CFVH 4K71C 3IGAB 4NQVA 3MGOA 5GZND 5DWUL 1JYNA 4P2QA 3UZQA 5I66B 5KSAD 3MFFB 1FC1A 3PP4L 4QRPE 3RGVA 2DLTA 4QYOA 4POZD 1PZ5A 2FO1A 3B6SB 3A6BH 4G43B 4H25B 5IUSA 3FQRA 1G9MC 1KUMA 4AG4L 2YK1L 5HPMB 4JHBA 4LCYB 1SYSB 4KMLB 4Z7NE 4XBEH 2DIAA 4YHMH 5F8RC 3UJIH 1CFNB 4GG8B 5C0EB 4LMQE 2NW3B 2JB5L 3O3AA 1QTYT 3FFDA 5FGRA 5BV7H 2PYEB 4Y2OA 5DJZB 1XIWB 2AK4D 3J8F7 4J4PD 2HTLD 5DRZB 3UBXB 1C7TA 3AS0A 1CL7I 1J12A 3QQNA 3DVIA 4YXHH 2Z91B 1AHWA 2YPVL 5E5MA 1TFHA 2W65A 3QDJA 3WNMA 2PO6A 4X7FC 2HJFA 2VXVL 5BO1L 3BAEL 3DOSA 2AXGB 3PGFH 2P46B 4GAGL 4YHNB 1S7VB 4P5TD 4BH8B 4IEFB 2YPLA 2IALB 4XWOC 3ARBB 3WO4B 1HYRC 3I6LE 3PE9A 4OF6A 5EBGA 5SWSE 4K8RL 3P73B 4Y16A 3BT2H 4N8CL 3MRPA 3C5SA 4PRAB 1WCQA 1ZANL 4KWUA 4YUEL 4X9FA 1V3JA 5E2WH 3ULUD 1A47A 2WK2A 4YWGH 4RCAA 5JOFA 4AEIH 4CL7A 5ID1A 1A6AB 3LQAH 1XT5A 1EHNA 5D70L 3W0WA 2QSCL 2X05A 3G5XB 3ETBF 5IW6A 1U8IA 5F89B 4FQCL 2EDWA 5HSFA 4KTYA 3QAZC 4CVZA 2H9GB 5D96B 1AD9B 5I0ZA 2V2XA 3B9VA 4LRNH 4H20L 2QSQA 1EVUA 1UJ3B 3V5HA 3LAFA 4UBDD 5E0QA 4EXKA 4LSDA 4YHOH 4IRZH 1C7SA 4F9LA 2Z4QA 1HH9B 1ACZA 1MCPL 1WWWX 2VE6B 4D8PA 1DBJL 4X0KB 2A6JB 1EGJH 4PJ9A 1XEDA 3CMOL 1WBYB 5T3XD 1EBAA 4NYLA 4AMKH 3RDTA 3VA2C 4BQ9A 5H37H 1AQKH 3SJVD 4M7JL 4L8CB 3P4OA 4P2QE 2AEPH 4WI4A 4XCYB 1P4BL 5FYLE 3O9WD 1RZIB 3TT3H 4BSWB 2Y07L 1IM9B 5K9KA 2Q3ZA 2NXZB 3QG6B 4S0TD 1G7HB 1T7YA 4LASH 3PDDA 5CIPB 4IS6A 2VISB 5MERA 5BOZG 3RWHB 2AABL 3TWCL 1WBXB 2AVGA 4WEBH 2NXYC 1ZE3C 1QYGH 1MRFH 2FNBA 2CQVA 4AIZA 2EYSA 1UB5B 4FQLL 2NY5H 3MJGX 2BY1A 1EDQA 1WF5A 3HRZA 1IAIH 1MCQA 4PBWD 3QDJE 2YA2A 1Q8MA 4IRJD 4WI2A 4PJAB 5E08L 1GAFL 1CE1H 4OZIB 3BXNA 2CDGA 1PKQA 4F7EB 2YPLE 4AQ1B 2UUDH 1IKFH 4FQ2L 3IJYB 5ENWA 5MI0B 1IL1B 4MDJA 5CZXC 5HYQA 3C5ZA 4HS6A 3CD4A 1U92A 3T2OA 3VRJB 4C54A 5EC1B 1I1RA 1XR9B 4JKMA 1CDHA 2BMKB 3ARTA 2QSVA 3NAAH 4Y4FC 4WW2B 1R3LA 1T6WA 5J1SC 4P3CH 5ADPH 1RUPH 4OZHB 3FO1B 3KPQA 4YHKL 3QFJA 4IMKC 4N5EA 3W0WE 3QULA 5EU6D 4OLWL 2DB8A 3R4DA 1OP3K 3G6DH 4RZCA 1CICD 3L7FB 1IC7L 3QRFM 5D71L 1J0HA 1FP5A 4JKWA 3UTSD 2HMIC 4E41D 3RY6C 4XX1E 2DQTH 4GG6B 2WIIB 5C9KA 1RVFL 4BZ1L 4HWZB 4G42A 3IKCA 4OGXH 2KH2B 3HR5B 4FTVB 5MP6L 3RJDA 2NY2C 5C0CA 5KJRH 2BOBB 4HJJL 1KPUB 1NLBH 1HHHA 5JOPD 1ZEAH 3D18B 1F11A 4NSKA 3MMEA 1HCVA 3JTTB 5JR1L 1JZ3A 1BF8A 5HVFB 1IGJA 3MLXH 3ISWA 1JPTH 3LZFL 4A6YA 2G5BB 3FO2B 4Z7UB 2PTVA 1UZ8A 5IB5A 5FYJH 1ZS8A 2B0SL 2C3WA 4X99B 3PV6B 5T33H 1JL8A 3VXTB 3MRDA 1GC1L 1ONQA 5F7NC 2DWDB 3GBML 4CN6A 4Y4HB 1QFUH 4M1CC 2O5XL 1CDYA 1VHPA 4AH2A 1ND0B 4X98A 3C5JA 4GRMA 5GS1B 4W6YB 3IDNA 1JP5A 3WEXA 2IG2L 2XY1A 5MEQB 3BP6B 2I07B 4Y5YB 4PREA 1VFOA 2OP4H 4IHOA 1U0QA 2N7BA 4NKDA 4LLVA 4WIQA 4H26B 1RJLA 1R24B 4LLAA 3V6FB 3U48A 1DQTA 5BMFH 3LS5H 4QHNA 4OLVH 3VXSB 2NY1D 2VOTA 5CD5C 1WITA 1H3VA 1PKQE 4AK1A 4X6EB 2RR3A 4JG1L 3DRQB 4LSVL 1T7XA 2H1PH 1F58H 4X9BA 4WO4D 1JV5B 4XNXL 5GGRY 3CC5B 3RU8H 5HD8D 1RK0A 4XXDB 5C3LD 5CILL 3ES6A 2WWMC 4EXPX 3D85B 3O4LA 4TPRH 4KU1A 5CUSH 3BWUC 2DLFL 4LDOB 4TULH 1DEDA 3MREA 4TNVK 3TBWB 4P5KA 3VD3A 1CFTB 3OKDA 1X5KA 4FZEL 1VGEH 3OGCA 3V6BR 3N1GC 2R1XA 3WFBH 5IMOB 3K8MA 4P4KA 5A3ID 2V5TA 1DE4A 3DYMA 5J9PB 4O4YH 2EDHA 3HFMH 1IEAB 5FFLA 1UVQB 2EZ0D 3C87A 1WISA 2VDOH 3OHXB 3QUKB 1B2WH 4HKBB 1RURH 1XGYH 3V8OA 2VC2H 2IEPA 3TN0A 1UCBL 3I50L 1HSAA 2HT2D 4XHQA 3TO4C 4HJGA 5C0CE 3QIUB 1YPZF 1DBBH 5C0FB 1MCOH 2ZUWA 3T2QA 4C56A 2FBOJ 1A4JA 1WFNA 2NY7L 1A14L 3W11C 4YGAB 5GJTH 5C09A 3LB6D 3ARVA 3QXAA 5J3HC 5EU5B 5FO9B 2DD8L 4NJ9L 2WP3T 2XRAH 4ZO6A 1RHHA 1IFHL 1U8KA 4J3TA 4X9IA 2VL5A 1FFNB 1BJ1H 3T0AA 3CFKA 4JHZA 4JG0H 4OSUH 3MCLH 4R3SA 5ERWA 3VFUB 1XGPA 1LNUA 3DJ9A 5DRNB 5F3HB 3NFSL 3Q6GH 4NRXA 2XA8H 2F19L 2ITDB 4HZAA 3U36A 1X5GA 4F2MB 4K9EC 1JGEB 4XBPA 5JMRA 1RUML 2YXMA 5ADOL 2XTJB 3IDXH 5F1IB 5HHPB 3RI5F 1MCEA 1C08A 3P77B 1OY3B 4JM2D 3HUJA 2HRPH 1XR8A 3D2UA 1IGCL 4PJ5D 1EUUA 2H6PA 4UB0L 3RX8A 1UXSB 2E9JA 4HUXA 1JNHB 1Q72H 1PYWA 1U93B 4I2XA 5F7DB 1HNGA 1JTTA 1U6AH 1RIVH 4OLXH 1GPOH 5DYOA 3TIEB 2EIDA 3ARDA 5DURB 5IKCB 3G5YB 4QRSB 5IMMB 4GOSA 4N68A 1JHTB 4UTBL 2A6DB 1BIIA 5E1HB 2C7UB 2BFVH 3NZ8B 4FA8A 1Y6KR 3MROB 4OCRL 2A38A 3VFNA 3H3BC 2ZPKL 3RBGA 2HT3D 5JXED 5DJ6B 3O4LE 4EDWL 3OAUH 4PRPA 3M45A 3M17A 5DEZA 3CSYA 2BVEA 3D69B 1FNGB 1WLHA 1XGRB 1UM5H 5BS0D 3WXWL 3C8KB 5KVEH 3BKML 4BFGA 2R1YB 5D1ZC 4WDIB 3FT4A 3E3QC 4IDJL 4AQOA 4S1SL 1U95B 3KNBA 5DWUH 2V5YA 2CXKA 3MV8A 4JFED 3PP4H 4Z5RB 3U7YH 4HKJA 4N0FB 5DZLA 3WKNA 1S9WB 3ET9F 4QRQA 5LGHL 1EXUA 3SDAC 1S5IL 4FZ8L 4FQXC 4AG4H 2B4CC 2YK1H 5CEXB 2DQDL 4R0LC 5D1XD 1A7BA 3DRTA 3OR6A 4KROB 4YC2B 4C56E 1ZOXA 3SO5A 1BVLA 2APVA 3BP7A 2JB5H 5C09E 1VACB 1XF5B 1E28B 1D5MB 1AP2A 1U3HA 4M00A 1UM6L 2YZ8A 5HGAB 1UFUA 3HE7A 1DVFD 2YPVH 5KN5A 2FHFA 4OCWL 5BO1H 3BAEH 1RUQL 1KN2L 1S3KL 4LLUA 3V6OA 4A6YL 3MNZB 4GAGH 4JCMA 5F88A 1I1AC 4D9QE 4AYFA 5BV7C 1V05A 3RTQD 1T7ZA 4TTDD 3HLAA 3L3JB 2M2DA 3FRPA 2Z31B 2A9ML 4X8XA 5K59E 3SQBA 4K8RH 3EFDL 4KV5F 4N8CH 1CFSA 3VFMA 3CXDL 4P23D 1Z2KA 2FEEL 1ZANH 4YUEH 1ZVSB 4RRPG 3HUJE 1TXKA 4XP6L 3GMPB 2VKWA 3SE3A 1R3HA 2MQ0A 4I2XE 3HAEH 1LO4L 1BOYA 5KSBB 1OW0A 4N1HB 4L3EA 5D70H 3TFKD 2QSCH 1ULVA 1J8HB 5D2NA 1F4HA 4FQCH 4YBHA 4KZDL 3FJTA 3AS1A 5HHVL 4XMPL 4ERSL 3K4DA 4CVWA 3JV0A 4H20H 1A7OL 2HKFL 3DTXA 1WSST 3HPJA 5JHDB 3IU3B 2CR3A 5C6TL 3LQAC 4Y4KB 4PRPE 1KT2B 4LHUA 4TOYL 5BQ7A 2OK0L 3ZT7A 3IRPX 1MCPH 1JJUA 4KPHL 4WW1A 1DBJH 4YH6A 5IQ9B 3GGWB 3CMOH 1MH5B 2K1MA 1ZLWH 4M7JH 1D5BB 4P2OD 2WBWB 1P4BH 3MV8E 3BN3B 3MSPA 4DKAA 2I9TA 1FYTD 2OJEA 1MEXL 2Y07H 5LGJA 3CFBB 1H3TA 4M61A 4APQD 1FAKT 3VXRA 2YXFA 2AABH 1YN6A 1JPFA 3TWCH 3FO9B 4U7KA 1NL0L 4P4RB 1BVKA 2JCCF 2OYPA 3MNWB 4ETQB 3B9KD 3BQUB 4XI5C 1G7PB 4R96B 3LKSA 3DX8B 4RMRA 4OAWB 4FQLH 2EH7L 3K74B 5ELIA 4ZQKA 1OVZA 4JHAL 5CEZL 5KS9F 3NGBC 2YOCA 2P48B 5DMGC 3V6OE 5E08H 1R3KB 5LVEA 4ODVL 3MV9B 3DHJA 1GAFH 4NZRL 3HI5L 1CG9A 4KI5E 4OIBA 4FQ2H 1KYOJ 2NR6C 2ZUQC 5IFJB 4IRSB 1RJYB 4TSBL 2D31B 4F7PB 5LAXA 3FB6B 3K46A 4K3EL 1BJ1J 1TNNA 3UC0L 1YNKL 3NN8B 5D2LB 2YD6A 1ZV5A 4WHTA 4L4TA 3FAXA 1I3RA 1QRNA 3WN5B 5DHVB 3I85A 1Y18B 2FHBA 2XPGB 4YHKH 4YHLL 3CSPA 4L3EE 3PQYA 3PWLB 3C09C 4MJ6A 1KXQE 4NKMA 4KQ4L 2EDRA 5TDOB 3IAQA 3QWOB 5D2NE 4OI9A 4OLWH 2ZOLA 3MUZ1 3RL2A 1IC7H 5J12B 1F3DH 5D71H 1FC2D 5DUML 4M5YL 4X7CC 1RVFH 1DLHB 4ZFZB 3ZDXE 4G6KL 1TMCB 4BH7B 4EUPB 3OBAA 2EH8L 5F7MC 4KH2A 4P2CG 5MP6H 3BZFB 3GBNL 4HJJH 1LP9B 5DQJB 1VEMA 2X44D 2FX7L 2YRZA 3TBYA 5E9DB 5JR1H 5E4EB 5DHVH 2VDKL 4XGZB 3BUYB 3KPMB 4PJFF 4UAOB 4OI7A 3LZFH 5D7KE 3WNLA 3L3HB 3O2WL 1A1OA 1T1WB 3LRSA 2B0SH 1BLNB 2GJ6D 3VGAB 3S96A 1GC1H 3CX5J 3GBMH 2FATL 3MRGB 3BGFB 5IEHA 2O5XH 3UZEA 5L9DL 3CDGA 3VXRE 1MLBA 3SGEI 1M6OA 4FHBD 3E6FB 3MRLA 4J3SA 2ARWA 5KSAA 3MJ8A 3FOLB 3G6JF 1U2CA 3BEWA 2IG2H 1GXEA 4P46D 4L4VB 5I71B 4YGVA 2E7CA 5J6GB 1R3JB 1T2JA 3IJSB 3O3DB 2ICWB 4YNYA 3G6AA 4NC1E 2CDEA 4YX2L 1RSFA 5H35A 4M6ML 4M7ZC 3KR3L 3MRQA 4WEUD 5DZNA 4Z76B 1CDUA 4ZUTA 2AK4A 1W0VB 2ZSVB 5BVJB 4J4PA 5CBEB 4JG1H 4LSVH 1EK3A 4JO1L 3TCLA 2JK5A 4L8SC 4XNXH 2Y36L 3HZYB 4GW4B 2MMXA 4ZPVB 3T1WA 4LQ1A 3QZWA 2A2QT 1JBJA 4OTXL 4R4NC 1XF2B 5CILH 4P5TA 2OZ4A 4JO4L 5DJYA 3RNQB 4L4TE 1I8MA 4O2FB 1QRNE 1V7ML 2DLFH 5EU7C 4QTHB 3EO0A 4HGMA 4H0IA 3TBSA 4FZEH 3PQYE 1ZWIA 3EYQD 4RX4D 1FZOA 3O2DA 3QCUL 4V2CB 2A6KB 3O6ML 2WP3O 3NIFF 4DEPB 1XCQA 4PJ8B 1QO3A 1S7UA 1MAJA 5L2KD 1UCBH 3I50H 5F1KC 4I18B 5DO2C 3IDYC 1OOAA 3LKPA 2VAAB 5IT2L 2GK2A 3TH2T 4DVBB 3VW3L 2D4DA 2NY7H 1A14H 1INDL 1SJEA 2CUHA 4LAJH 2J88L 5FKPA 5D7IB 2DD8H 3VXPB 4NJ9H 3S7GA 3JWDL 1G9NL 4LFHD 1OGAB 1QA9B 1TZIA 1IFHH 3DYPA 2BCKA 4CMMB 2IQAB 3O0RL 1J1PL 3W9DB 1S7WB 2J12B 2EDYA 3SJVA 2DJ4A 1B6DA 1KCVL 5DD6B 3NFSH 4S11A 1HXMA 3O9WA 1ZSDA 4JFOA 5FF6A 2F19H 4JY4A 3L5HA 2EC8A 2GI7A 5F3BB 3VXOB 1HI6A 1PQZB 1RUMH 5IHLB 4MA7L 4UQ3B 5ADOH 3C9NB 3FB7B 1MCRA 5HI3C 5H2BA 5CKAA 1U3YA 1IGCH 3MBEB 3VG9C 4E5XA 4UB0H 4QHLB 1C5DA 3PDGA 4ZNCD 2AK4E 4ELMA 1JI2A 1WZ1L 4NIKB 5HGGS 1KJ3L 4N8VB 4IDLA 1OT1A 2XWTA 1NANH 4KK8C 4IRJA 1NBYA 3E0GA 4G8EA 1AI1L 4UTBH 2JB6A 1REIA 3H9SA 1U8HB 2OTUB 2JF1A 1JPST 1T21B 4OCRH 3QEQB 2ZPKH 5HHXL 4HWEL 4U2YA 2OX5A 4R2GD 4EDWH 2VZTA 1XGUA 2DQJL 5T1LB 1U41A 3KPRD 3N06B 3OJMB 4RGMB 2OXHA 1HOCA 5IHZA 4B0MM 4L8BB 4YHPB 3X17A 4PP2A 1CT8B 3WXWH 3X13A 3BKMH 5J1TC 1ZTXL 2DS4A 3ULUE 3TBVA 2D2OA 1U8NA 2X09A 4ZUVA 4IDJH 4S1SH 1ZLVH 2CLVB 5LCVL 3X11A 3QUZB 4HKXA 4U1HB 2VZVA 5LGHH 3P9MA 1BAFL 1S5IH 4FZ8H 5HI4C 3T8XB 2WWKO 1CICA 2G9HB 3U9UA 4N8PA 2DQDH 1S78D 3CVIL 3NOIA 3UTSA 1MWAL 1NUNB 3GI8L 4E41A 3WE6A 4XPFL 1F3DJ 3W9EB 4KKCC 1YECL 5EU4A 1NGZA 3TYFA 4LLWA 2JJSA 1K6QL 3PDOB 1UM6H 2ARJB 5JW5B 3HA0A 1U2HA 2G60L 1AO7B 1CWVA 2F5BL 4OCWH 3U0TB 3QQ9D 1RUQH 1KN2H 1S3KH 5DRXA 4A6YH 1MFEL 3G08B 2FJHB 3SJVE 1A64A 3RUGA 4CW1A 5JHLL 2AJUL 1FV1B 3N9GL 1II4E 2JJTA 1G1CA 4HIHB 4PG9A 5MHSD 4MCYA 3IS1X 3SCMA 3WO3B 2A9MH 3GSOA 3S5LG 4NQEB 5H37G 1SQ2N 1T0NB 2DQIL 3EFDH 4M9OA 4UUJB 1MJUL 3VGBA 1YN7A 2UZYB 4F7TB 3CXDH 4YDJA 3VFOA 5GS2H 4WHCA 3UAJC 2AK1L 3MRNA 2D03L 4HFUL 5T1MA 4F80A 4JAMA 4X6BB 4XP6H 1P7QB 2Y1VA 3HZKB 3N1QC 4MJ4A 2EDEA 2Y25A 4ELME 5B8CC 4FFWC 1CFQA 1LO4H 1T66D 4K8RC 1Q94B 5CD3B 3TVMD 2XACC 3QXDA 4NHUB 5SWZB 5J1AB 4KZDH 3RWFB 4JVPA 4M3KB 3HR6A 1QR1A 1S9YA 2HG5A 1KLUA 5HHVH 4XMPH 2FBJL 4ERSH 3SQOL 2F53B 4YEFA 1A7OH 2HKFH 2IANB 5C0AD 2E7LC 1UXWB 1P9MA 5C6TH 4YQXL 3QIWB 3L7EA 4WO4A 3NFNA 1C5BL 4PJHE 4HIIB 5A16B 1MUJB 3WFCL 1P84J 4TOYH 2OZ4L 5EUKA 2QADC 2N1KA 2OK0H 4KPHH 1AFVL 3MGAA 3O6FC 3MC0A 4P57B 2BSRA 1DQJA 3KYAA 1L6ZA 2UV3A 4U6VL 4OT1L 3ULUL 2XG4A 2X41A 1I1YB 4JFHD 1MEXH 3BPLC 2ICWJ 3GRWA 4NC0B 5EU6E 1TIUA 1X5XA 4Z8FL 2W92A 4HUWB 2VWEC 3TBTB 4X4YA 5TH2B 5C8JA 3UTSE 1NL0H 4E41E 1NEZA 4QY8A 3CMGA 4XB8A 2AJZA 2Q86B 4PRHB 4WWKB 2XFXA 3DETC 5F1NA 1MCWM 3EO1B 4JY5L 5C1MB 3BP5A 5EZIL 3M1BA 2EH7H 1HSBB 4OLEA 3RIAK 1CU4L 1H15B 2HN7A 3LQZA 4JHAH 2M8XA 4NRZB 5CEZH 5TE7L 1X4XA 3WIIL 4ODVH 4NZRH 2DWEB 3RUGE 3FQNA 3HI5H 3KYNA 1NGYA 2PXYD 1BQHB 1CXIA 4PJEF 5T3XL 4M3JA 4WFGD 4TSBH 5TDNA 1TVBB 2FIKA 3TZVB 3IETA 4ZXBD 4NM4L 4H0GA 4K3EH 4ONGL 3UC0H 1YNKH 2AI0L 5I6XC 4JANB 1ZK9A 4WY7L 5F96L 5L0QB 2A77L 4NCDA 3KPPB 4LLMB 3IXTB 2ILLA 1A6TA 4XCNB 4YHLH 3IDMB 3P0GB 4RMUA 3TNNB 1KC5L 1JMZA 2OI9B 4QHMA 4LAQL 1XF3A 4KQ4H 1R5WA 1JN6B 2X70A 4JM2A 1FFOB 5EPMB 4PJ5A 5DJ0A 5GRZA 4LSPL 3WNOA 4DW2L 5AZEL 4MNHA 5FKAB 5DUMH 4M5YH 4EI5C 1YY9D 4G6KH 5E56A 4YIQB 1E4XL 3HMXL 1S7TB 4YDLB 4ODWB 2EH8H 4Z77A 5JIKA 5DVLA 5FUOL 3GBNH 2LU3A 2AQ3A 2R0ZL 3EOTL 2DYPD 5F93C 2GT9A 2LE9A 4KJYA 3KPOB 2FX7H 1MHCA 2E7BA 3HE6C 1QVOA 1J0ZA 5JXEA 1T2QL 2Y23A 3UBXI 2VDKH 3CK0L 1QQDB 4LVNC 1ORQB 3KWWA 3I2CL 4Z0BL 3U0PB 3O2WH 1JZ2A 4NQTA 5JLZB 1A6ZB 3EOAB 3MJ6A 1VFBA 4ODUB 1FNEA 2FATH 2YEZB 4YPJA 1H5BB 2HJKA 1EFQA 2RQ8A 5L9DH 2WINA 2CIKB 1U8MA 3QIBC 1WAAA 2ZUUA 1PGRB 1M05A 4JFEA 1MJ8L 3CDYA 3BWAB 4JZJC 4X9HA 5T5FL 2R4SL 1XF4A 2CK2A 3C60A 4DCQB 5E6YA 3WCYA 5EBMA 3NFPA 3D0LB 1KIRB 4NQCD 2OL3A 4XPTL 2YD4A 5D1XA 3VXNB 4YX2H 3RGVC 3I75B 1XGQA 1DZBA 1HKFA 4M6MH 1A6WL 3KR3H 3AMKA 4JRYD 2NX5B 1EEZA 1FZKA 3GUTB 5GRVK 3H8NA 3HNVL 3K7UA 1DVFA 4EDXB 1RMFL 4JFFB 4JO1H 4GSDL 2Y6SD 1FNAA 5HHNB 1F00I 2Y36H 4MD4A 1C16A 1UQSA 3SKOA 2VLKB 1DDHB 3PP3K 4OTXH 8FABB 1QHOA 5EIIB 5F71A 5C07D 3ULSA 3GBLA 4JO4H 1ZXQA 5E8EA 3Q6FA 3CJJA 1AHWC 1UB6B 3QUYD 5DJDB 5F7HA 2VO5A 2PO6C 4GKZB 4XTRD 3JVGA 1QFWL 1V7MH 3C6LB 4JJ5A 3VWKA 1N5AA 1IGTA 1PEZA 5GRYA 5I1HL 1M71B 3VFTA 2CRYA 5I76A 4P23A 4X8JB 3O4OC 2CKBB 4PV9A 5EFIB 5HGBA 5CP3A 2IADB 2ERJB 4LLYA 1YPZB 4PJ5E 3QCUH 1N3NA 3OJVC 3O6MH 4Y16C 3DXAD 5DK0B 3MGTB 2P5WD 1DUYB 3OX8A 1F4XL 5GS0D 1NJ9B 2J8UB 3TFKA 5DDHB 4U33A 3STLA 3MO1B 4JDVA 5KZCB 5IF0A 2XN9D 4QXTA 5IT2H 3VW3H 2IH3A 4P9HL 4U3XA 2RFXA 4RGND 4WU7B 2DLGA 1INDH 3PG2A 1RPQA 1UEYA 4PUBL 1F6LL 1XAUA 2J88H 3QNZA 1H0DB 4XP5L 4PLKC 3JWDH 3ZSSA 2ZG2A 1G9NH 1JUFA 3B2UC 5BS0E 3O0RH 1EO7A 3DGGA 1J1PH 4HKZA 5K9QG 5EZLB 1UWXK 4PP1C 1NGXA 2WM0A 1BFOB 5K59F 2ZG1A 1KCVH 4P2OA 1DLFL 1WAAE 4MNQD 4F9LC 4JFEE 1GOFA 4QOKB 4HDIB 1SEBB 3RWIA 4Q7DA 3AC0A 1QSVA 1FYTA 5EZJB 2V5RA 1N7ML 4PJ9C 3ARWA 3MNVB 1OL0A 3RDTC 4G6AC 3IB4A 4CDGC 4MCZB 4MA7H 1D5ZB 5ANMA 1IRAY 3QQ3A 1A3LL 4GBXB 3LSOA 3B9KA 3WIFA 4PRNB 3MYJB 3GSWA 5C08B 4LVOC 3MRJB 4PGEB 5K9OB 1WZ1H 1RU9L 2HT4D 3F65A 4BELD 1KJ3H 4I0PB 3JWOL 3B5GA 3RHWF 4PGZA 1AI1H 4MSWA 3VFVA 5GSVA 1ZT4A 5DJ2A 3CIQA 2BSTB 1KPRA 5DLML 1MWAB 1FSKC 5K9JL 4NKOA 5HHXH 2B7DT 4HWEH 2IPUK 1IEBB 1QEWA 4M03A 2DQJH 4P5MB 5M7QA 5TDPB 1CGTA 3G04A 1X7QA 1B0RB 4X6DA 1RV6X 2NY3C 3BZ4B 4FFZL 2BVYA 4MAYB 3TESA 1ZTXH 3U83A 2X4TB 1E0OB 1J1XL 2A0LD 4PR5A 5BJTA 3WFZA 4PJIA 3Q0HA 2VB5A 1QOKA 5LCVH 3C5ZC 4NN5C 1FG2B 4B7IA 4LLDA 1K9TA 4MD5A 5HGHB 1TPXC 1BAFH 4IMLA 4UILL 2YSSB 3B4NA 1D7FA 1T5XA 2R1WA 2VIRA 1P4LA 5CHNA 3CVIH 3HAEG 1MWAH 3GI8H 4XVSL 4PG2A 4XPFH 4ODHL 4N5EC 1CXLA 2ARJQ 1YECH 5EBWA 4Q58C 1YNTB 1K6QH 4ZMAT 2B39A 5CP7B 4JZNA 1I8IB 1A02N 1BP3B 2G60H 4M7LT 4NO5B 1K4DB 4PRDA 2F5BH 1FL6A 3L5WB 2JIXB 1MFEH 4RIRB 1GJIA 5JQ6L 2X4NA 4EOWL 5JHLH 4NN7B 2AJUH 5CEYB 2KL6A 3IT8D 3N9GH 3NACL 3GJEA 4RDQG 4DOHB 2YN3A 3SY0B 2GJ6A 2RAMA 4XNZC 1FYTE 4OFDA 4D0BB 4GXVL 5D7LB 4GMTL 2DQIH 4RNRA 1MJUH 2VR4A 5ANME 5JNYB 2PKDA 2AK1H 3P40A 2YWYA 2HLFC 2D03H 4HFUH 1GGYA 5ICZB 2OL3L 1L9MA 4YDIL 1MCSA 2ZUVA 4PJDF 3AUVA 2X4RB 2O93L 1QLFA 3D39B 4NNYB 3JV4A 1Q9KB 2C3HA 4XNQB 3ZDXF 4MZ3A 2GKIA 2HVKA 3CFEB 4I5BB 4L3CB 3RVTC 3TT1L 3T65A 3QWRD 2FBJH 1OSZA 3SQOH 4FOMA 1BD2B 2LTQB 4YQXH 3L5JA 2ZOKB 2VJXA 3VGEA 3KGRA 3QB7C 1C5BH 3B3IA 3WFCH 3VJ6B 4X6DE 2OZ4H 4G9DB 2GCYA 4UTAL 4M7LL 5F70A 1AFVH 2C4FT 3E2HB 4PJIE 2JCCB 3KPSB 3CLFL 3MUHL 2HAZA 1BHGA 3BH9A 2OXGA 2PYED 4U6VH 4OT1H 5ESQA 3ULUH 1CBVL 2B8OT 3FRUA 5DTFB 4Z8FH 2V5MA 4R26L 2X4PA 3REVA 4RX4A 5KS9B 3DV4A 2XQYK 4UDTA 1S7RA 1EAPA 1S5HB 1CXHA 2G2RA 4I4WA 3FFCB 3B83A 2BNUB 4P59L 2MQCA 4NOBA 4P4KC 5L2KA 4LPCA 2V7NA 3S4SA 3I9GL 3D6GA 4K2UL 4JY5H 4PGDA 5EZIH 3FAWA 5JQHC 4NO3B 4H8WL 1CU4H 3P9LA 1OM3L 3WIHA 5TE7H 4F58L 4FG6D 1QSEB 1Y6MR 1A7PL 3WIIH 3TN0C 1QBBA 2BOCB 4C55A 2GQHA 3D48R 5LGKA 3GKWL 4PJBB 3RVUC 1T03L 2P8LB 2GJ6E 5T3XH 3DV6A 3RQ3A 1MREL 3U9PL 3HMWL 5J6HA 2PETA 1N64L 4Y5XB 2WBJB 1JI1A 4NM4H 4RAUA 1HILA 4ONGH 5I74C 3CCHB 4MX7B 5T1KB 2AI0H 1FVCB 5D5MA 3RIFF 1IEHA 2BDNL 4WY7H 4PBXA 4L8DB 5F96H 5JIPA 3GSVA 1DUZB 1NMCC 2A77H 2VLRB 2Z92A 4X80L 4WHYH 1G84A 1KC5H 4A2MA 4LAQH 5CSGA 4ZPTB 5CJ8A 4HPOL 3EDFA 4GFTB 3T08A 4TUJB 2Y9RT 3B5TA 4M02A 2QR0B 2Y7QB 3T3PE 1QZ1A 4LSPH 4DW2H 3W81A 5AZEH 3F7QA 4Z0XB 2HWZL 1F5WA 4YZFF 4G8FA 1P1ZA 2X4SA 4P48A 1IAOA 4PJFB 1JZ8A 1I3UA 1YDPB 1E4XH 3HMXH 4S2SB 2MFNA 1BECA 1IM9D 5FUOH 1VFUA 2NXZD 2R0ZH 1N6VA 3EOTH 1MHPL 1W8NA 2R0KL 2HVJB 1QSFB 4NP4L 1DANT 3PJSA 5HGDA 5KTEL 3G6JB 3ARDC 3QO1A 1EFXB 1FZMA 1T2QH 2V6HA 3CK0H 1JWUB 1FVEA 3KPRA 3O3BB 3I2CH 4Z0BH 4ORGB 4YFLI 5C2UB 5JDSA 4JFXB 5EBLA 1CI5A 1BZ9A 4RFNB 4NWTL 2P24B 3NZHL 3ME0A 3OF6A 1HINL 2B2XL 4I77L 2D9QB 1MJ8H 4E0RB 4YHIA 4QT5B 3VI3E 2PTTA 3MCKA 4PTTA 3MOAL 1QPXA 5L2KE 1FL5A 2D7TL 2I60L 4W6WB 4WRLA 4XPTH 3RVVC 5DEGA 2DMBA 2B1HL 4NO2A 1A6WH 4WI7A 1S9VA 2R15A 2Y5EA 4XX1G 2J6EA 3SDXA 4YK4C 3FZUD 3HNVH 4R97C 4TNWK 2A6IA 1RMFH 3EHBD 3VFPB 4GSDH 3MBXL 5DT1L 1OP3H 1D5XB 1U3HC 2R2BA 4JEGB 5F7YC 1LEIA 3EJZC 2J5LB 5IJVB 1RZGA 2EYTB 3HE7C 5D5ME 4U1NA 1CD9B 2ED7A 4Q6IB 1T4KB 2CIIA 4DN4L 1QRKA 5FDWA 5IOPA 1BQUA 1QFWH 3V6OC 3ULUF 4L9LA 1KGCE 5GXBB 4POUB 5I1KL 4UIMA 5I1HH 4XNMB 3ZYOA 4KI5C 3ZTJH 4FTVD 5F6IB 5I16B 3E6HA 2UYLB 2NY6C 1OSPL 2LVEA 5DVOA 5C0DA 5EOCL 3TH3T 1RZ8A 4QRUB 3LS4L 4NUJB 3O45B 2OQJA 3QUMA 1F4XH 2RGSA 5F9AC 3RVXC 3HCVA 3ULVD 5JA8B 3DO7B 1NMAL 5SWQB 3TVMA 3SPVA 1LQSR 3WNNA 3SE3C 4Y4HD 2XQBL 2IJ0C 2MCPL 4G8IA 3OB8A 4ZSOE 1OW0C 4LRIA 4P9HH 3ZKNC 3MUY1 1CQKA 5C0AA 2N56A 3LEXB 4PUBH 5D2NC 4LSTL 1IGIL 3W5MA 3KPRE 4XP5H 3OAZK 3T04D 1N6QL 3RX7A 2I9LA 1ZVYA 1YC8A 5DQDL 1C5CL 3UPCA 4FXKA 2FL5A 1A6PA 3X3GL 3W39B 3TP4A 3V6ZB 1Y0LA 4M9PA 1YNLL 3EIFA 1T3FB 4UV7L 3DBXB 1DLFH 3RWJB 3PF2A 4YHYC 3VXSD 3JWDC 3MRBA 1G9NC 1N7MH 2KKQA 2GUOB 3RZCB 3FTGB 3N1FC 2F54B 4F8TA 1PSKL 4X6CA 1U91B 2YUZA 5EIQA 3UTZB 4AIOA 4MJ5B 4U49A 4N8VG 4PIRF 4ELMF 4KJWD 4WJ5A 3AU1B 3TJHD 1A3LH 4BK4A 1UG9A 4YBLB 3TV3L 4F8QA 5KG9B 3FQUB 5ISZA 2ZNWA 4PRIB 3SDXE 3JWNC 2YA0A 1RU9H 5FM5M 1M7IA 4HIEA 3NMEA 2A73A 4U6HB 4N9GB 3EYSL 3JWOH 4LPUA 3ZT5A 4NQDD 4PRBA 3RL1A 2CKNA 1EO5A 1R6VA 5FO8A 3DARA 5F7KC 4U0RB 5DLMH 2Q76A 2PXYA 4NC1C 4M43L 3WBDA 2K3TA 2APBA 4DZ8A 3TA3A 3V5DB 4AEEA 5K9JH 5MHSE 1U8QB 3IDIB 4LL9A 5CKGA 4Y5VB 4MHHG 4FFZH 5HI5D 2VH5L 1NC2B 1V3KA 1I7ZA 2NLJA 3CSGA 1EHXA 1J1XH 3QIUD 2XICA 1NAMA 5B4MC 1ORSB 3ZKMD 4XNUL 1AD0B 2ZG3A 3FCTB 3PWUA 4S10A 5JW3L 4X7TB 3VFRB 1HN1A 3CX5K 1KB5B 2PW2B 4TVPD 4UILH 2VR9A 3LIZL 4XCEB 3ECBA 3LN5B 4WEMB 1OLLA 1WBZA 4WI3A 4XVSH 5TQ0L 4ODHH 5EO9B 4JFYA 5C0AE 4K07A 2BVPB 4R7NB