1RK0B

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rk0B00
1MCPL 5AWNL 5EC1A 1FAIH 1T7WA 3H0TA 4F58H 3MLRH 3C5ZC 1B0GB 3GJEB 5L9DH 2B2XL 2BSTB 3P4NB 1LO5B 1I8MB 1HINL 4ZOEA 5ESAA 2LABA 5IQ7H 1A7NL 4YDVA 1V3JA 2AS5M 1AR1D 5FYLH 2FX7H 3OPZH 3FOLA 4S2SB 2D4FA 1NCCH 5JXEA 4RFNB 3MCKB 3OB0H 1XF5A 2VAJA 1C08A 1FNGB 3P0YH 5INCB 3C6SA 3EDEA 1E4WH 1E4KC 3VD3A 1UCBL 4IS6B 5C0DB 1A6UL 3V6OA 3RTQC 2Q3AA 1UYWH 3NCEB 1SBSL 1CXIA 1MCDA 4BFIB 1BD2B 1YY8B 1YEJH 3N85L 1R24A 5GSVA 3MA9L 1YNLL 5TE6H 2VE6A 3R8QA 2OJEA 4JY4A 4G5ZL 3KPNA 4LEXH 3FFCE 2CDGB 5I1AA 1RQ5A 3Q3GB 1NL0L 1JPTL 5F6HI 1H5BB 5B22A 5D70H 5K9KA 1O7VA 3K1KC 1PZUB 3RDTD 3RUGB 3MRCB 4IDJH 2PCPB 3K4ZA 4P2RB 4YQXL 1E4XI 4RSVA 4EN3A 3GGWB 3BEVB 4X7EC 3EIFA 4ONHA 3BEWA 1MVUA 4J4PD 4CNIB 3PWJB 1CD1A 2P5EB 1A5FL 4X99B 4YNYA 4ZUVB 3TV3L 4JFOB 4DGIL 5FYKE 4JQVA 3N1MC 4LRNH 3NCYP 1CXEA 4KHTH 1I85A 4LVHC 3RNKB 3C6LB 12E8L 5TE4L 2XIDA 1ZT4A 1FCCA 4P5MB 3AM8C 1F58L 3RVUD 43CAA 4I2XB 1EVUA 3GSQA 4I18A 5E7BA 1D6EB 5D7LB 5F71A 5D7SH 5AZ2H 1FZMB 1ITCA 1OAUH 4QYOA 4X5LA 3KS0H 4KMTL 3DX9B 1G0YR 1I1YA 4XVTH 1LDPH 4TYUA 3NCYS 4BFEA 4F7TA 2HFTA 5FHAH 4OM1H 1NC2B 4AEIH 1YEGL 3WIFB 5D96B 4OM0L 5CD3A 5CP3H 4PJAF 2P1YA 5DGRA 3B5GA 4F2MB 4U0RC 3MR9A 1NMCC 3CFJA 4M6OH 3DUSB 5LCVH 3T2OA 4XNXH 5H2BA 3PJSA 4FG6C 1ETZB 1S9VA 4APQA 1L7IH 3LEYL 5A40E 2ATPA 2EE2A 3TBSB 5E8PB 4HS8H 3VFWA 3K8LA 2EECA 3N9GL 5DMKA 3X13B 4N0YH 4KY1L 1MRFH 3VRJA 1N3NA 4MVBD 4FNLH 4P3DB 4Z8FL 4NWUL 3RX8A 4ODHH 1WEJH 4NKMB 1UZ8A 3QR2A 3QEQA 3MUJA 1WUNT 2O26U 3V0VA 1OW0A 4O9HH 4QCIA 3VMPA 3WFCH 1MI5B 3Q48A 3BZEB 3MRRB 3VMOA 4LF3B 1QFWM 3C60D 1JMZA 2WBWB 4NSKB 3H7BA 1I1AA 5EORL 2RCSL 4GRWB 1NUNB 1IAIL 2P24B 3D5OF 2IEPA 3MRNB 1UACH 3GB7B 1J12A 2G60H 1LILA 2X4UA 1YN7B 4QTIH 2VL5A 4NQEA 4AL8H 1HHKA 1QRNA 3VJ6B 4DZ8A 3G6DH 3NBNA 4YBQC 2J8UE 4XPFH 3P9LB 5LGHL 4ZG1A 4PJEF 1A14L 5E56A 3U7YH 1Y18B 5HHXL 1R0AH 5JOPE 4JDZA 1IT9H 4JFDE 4M7ZC 3N0PB 2AJ3B 5HDBE 2XQYG 4PR5A 4TNVF 4JE4B 1ACYH 3HR5B 2VL4A 2XT1B 2GKIA 3F7QA 3I6KB 1ZGLP 3G04B 4X4XA 1OB1B 1KIPB 3VFOA 5D7KE 3IDYB 1W72L 3VE0A 4ISVB 4DAGH 3WJLA 3IDMB 4ZPTB 2NY4C 2WINA 1T5XA 3KXFA 4OV6F 1MFDL 3CFKA 1WFTA 5J9PB 4P46B 5JXAH 5SWQA 4BUGA 1M71A 3WBDA 2R23A 2YRLA 4JY5L 2XRAL 2R69H 3NFSL 4PRNA 3UTSB 4YHKH 2YBRA 1M7IB 4R8WL 2QTEA 3SPVA 4HUWA 1N64H 4RWHA 4K71C 3NAAH 3MXWH 5EU7C 1TETL 2VIRA 2CRMA 4JFED 3ULUE 1C5BH 1MQKL 4HT1H 2AXGB 3GJFA 3JV6B 1ZLWH 3QB7C 1H15A 4KXZI 1U8NB 4OZIF 4WI9A 4YPJA 3VGFA 1I3VA 1FBIL 3VFTA 5LXGL 1BMGA 4HIHA 1TIUA 3H7LA 4RGND 1IGJB 1OTSC 3PWPA 1I9RL 4L9DA 3BO8A 4N8CH 3FQXB 4JPWH 4QY8A 1HI6B 5BZWB 5F7WC 5ANMA 5FEBA 1JNJA 1ONQA 4HZLB 2VLLB 2Q6WB 3VXTB 1EGJH 2NQCA 3T4YA 2F5AL 5FO9B 2VLKB 3RY6A 2P42B 4L5FH 2R0ZL 1GXEA 3OZ9H 5DHXB 1HZHH 1JGEA 4N0UA 2H6PB 1MCFA 3PWVB 3C5JB 2P47B 2V5TA 1SHMA 4ORGA 3R8BB 3ARGB 4DFHA 5EBMA 3D9AH 3U0PB 1OL0A 2A0LC 4G43A 1MFEL 1A7QH 3LZFH 2VOTA 5HI3D 2NY0D 4DEPC 1HIML 5I9QB 1HXYB 2XZCL 5E8OB 4F57L 2I9TA 4MD5A 4JJ5B 4OIBA 1YN6B 3EYOA 3QXDB 2YN5A 4L4TB 1LO2L 3TZVA 3ECBA 5DHVH 3IDGB 4N8VG 4NQCE 3N50A 3QI9B 3O3AA 4KKCC 3M8OL 2AEPH 4XXDA 1MFBL 4YHMH 3BPNC 4EUPG 1BWMA 35C8H 5I73B 2BSSB 2UWEF 3RAJL 1HKLL 5KN5A 4UT6L 1EERB 2R4SH 5EZIH 1KN4H 1NAMB 4HGMA 1ZKAA 2VDPL 1H8OA 1DP0A 2HG5A 1EVTC 2GJ6D 3WO4C 4NNXB 1V7NL 1A22B 4LAQH 3STZB 1G7MA 2E6JA 1MH5B 3VMNA 3HUJE 5C07E 1BFOB 5IB3B 4PJIA 1EAPA 3BPCA 4CN4A 4KQ4L 3IFPB 2ZG3A 5HGDA 1QUNA 5JTWA 2AVGA 3KPRD 25C8H 2A9NH 4K23L 2VZSA 3LIZL 1RUML 1OWWA 4HMDA 3IJHB 4P3WA 2ZCLH 3QCVH 4JO3L 1B0GA 1OY3B 1B4JL 3ARFC 1NSNH 2OBGA 1BBDH 3GJEA 1JV5B 2BSTA 3P4NA 2VDKH 3V5DB 1LO5A 1NDGB 1I8MA 4FA8A 2E7CA 5IUSA 3DMMD 4JAMB 8CGTA 3MMEB 1RSFA 1K6QL 3LPWA 4PV8B 2YA1A 4KV5F 3ES6B 4M9OA 1XF1A 3MCKA 5GJSH 1A4KA 3BSZH 5INCA 3T0WA 5KVFL 3IU4L 4PJDB 2ADFL 1KN2H 3DETC 4NN7B 3TVMD 3TLRA 4IS6A 5C0DA 1EEYB 2DQJL 3CX5K 2ICWI 3UJJH 2ESVD 3AU1B 4IRJB 5J1AB 1GGUA 3NZ8A 4H20H 4BFIA 1BD2A 1GGBL 3WIIL 2OP4L 4WVRA 3NCCB 3DXAE 3FQNB 1TNNA 4X0KB 1E6OH 3ARQA 2DQTL 2MCPL 1NFDF 5BRZB 2CDGA 3LKNB 3Q3GA 1VKXB 1L9NA 4MAYD 1H5BA 2YD3A 4M43L 3ZE1E 4X4ME 1A21A 3RUGA 5IWLC 3MRCA 1I9IL 2PCPA 4P2RA 3I9GL 4J8RB 3TT1L 2CO7B 3RWIB 1DQTA 3IVKB 3GGWA 5C0AD 2W9EH 3BEVA 3ZKND 5BW7A 3ULVC 4HXBH 3PWJA 2P5EA 4X99A 4ZUVA 3RY4A 2KKQA 4JFOA 2OTWB 1MNUH 4P2OD 4U2YA 2AJYL 5CGMA 2NXYB 4Q6IC 5KS9B 4JFHE 2FHBA 4UI2A 3RNKA 4PRPB 3LAFA 3C6LA 3OB8A 4M1DL 4P5MA 4FQLH 1G7QB 4UDUB 1OPGH 3WO3B 4O00A 4I2XA 4P23D 3GSXB 5HJ3B 5D2LB 1D6EA 2EDOA 5D7LA 2R4RL 3FOMB 5I8KH 4PRBB 2WM0A 4OLWH 1FZMA 1RIUL 3EO1B 3I02B 3DX9A 4LIQH 4AQOA 5HHNB 3CXHK 4MJIB 5D1QB 4AZ8A 3CVIH 2WW8A 4MNHB 4EUPH 1MFAH 4FQ2L 1UB6B 4H1LB 5DDHA 1UC6A 4UV7H 3AXLB 1KYOK 3W11D 3UBXI 4F2MA 5LJYH 5DR5H 3V0WH 2ITDB 1AQKL 3DUSA 3U2SA 1JI2A 4EXPX 4Z0XB 1ETZA 5F7NC 3TBSA 5ITFA 5E8PA 1ZEAL 1NMAL 4QHUA 3WCYA 3X13A 1HN1A 3G6JE 2EH7L 3IDXH 2YK1H 3D2UB 3GNMH 1CXLA 4P3DA 4YH6A 5TDPB 3VG9C 1CBVL 5FGRA 2DN7A 2ZPKH 5DLMH 4NKMA 3T0VA 4KC3B 2XZZA 4X6DB 3DO3A 1J87A 5C1MB 1MI5A 1RZ8A 3BZEA 5JNYB 5C0CB 4H0HB 4LARH 2DKUA 3NH7H 4NSKA 5CIPH 2VWEE 4KJPC 3KPQB 5D1ZC 1HHIB 3AB0C 1URLA 2PYED 2P24A 3MRNA 5MI0C 3GB7A 5CZVH 2EXWD 3MRDA 1QPXA 1MRDL 3LKQB 2XZAL 3MUHL 1VPOL 5L2JB 5IFJB 3O8XD 4YXHH 5DRWB 1A7PL 3IAQA 5DWUH 3UZEA 5E2UH 3QQ9C 1UA6H 4N1CA 1D5ZB 4HZAA 3VJ6A 2LVCA 3MLVH 1JVKA 4KJWD 3P9LA 5HHVL 4FHBD 2OR8A 4YX2L 1Y18A 5CSBA 5J12C 4GQ9H 2AJ3A 2X4RA 4MDIA 5A2KH 4C83B 2BNRD 4JQIL 3HR5A 5F1KC 1E4XL 3CLFH 5FUOH 5DC4B 3T2NL 5CJXA 3I6KA 2ZNXA 4MCZB 5C08B 5DJXB 4JJHA 3G04A 4WHYG 4K7PL 1OB1A 4LPYA 3T0ED 3VFGL 5FYLL 4L8SA 4K8RD 3P9WB 3OPZL 2IBZX 5D1XA 4PB0H 5D93B 3IDMA 5EOCL 4ZPTA 4L8DB 3HAEB 5A43C 4PJGF 3QUKB 3QEQE 4X9BA 4P46A 3BPOC 5FGCB 4OCSL 5DMIH 4LNRB 3LPFA 1E4WL 1DBAH 5KVGH 1EPFA 2XTJB 5TH2B 1M7IA 4UUJB 3OSKA 2XICA 2XV6B 2BY0A 4B0MM 1YEJL 3MTRA 1CXHA 1UWGH 3QIUC 2BVUA 1LP9F 3O6FD 2AXGA 4XXCC 4V1DB 3FMGL 1CF8H 1U8NA 1C1EH 1T7YA 1WJ3A 4QKXB 4WI2A 2NY2C 4LEXL 3OHXB 2ZSWB 3B9VA 3K81A 1IGJA 2QKIA 3O6KL 3FQXA 4IOFD 3DRQB 2IMMA 4IDJL 5B4MC 4PJCE 2G5RA 3WFZA 5BZWA 2FB4H 4HZLA 3DVIA 2VLLA 3RHWK 5FYJD 4Z9KB 3VXTA 1IJ9A 5L2KD 4O02L 5FO9A 5FGBC 5BS0B 4JZJC 5T3ZH 4OLVH 1MHHB 4GUPB 2ORBH 2H6PA 3PWVA 3RWEB 3SKMB 2V6HA 3KXFE 3ARGA 5GS0C 2HKHL 3FN3A 4YEEA 1OAUL 3PQYD 5GGVY 3ESVF 5F7EH 4G6ML 4WFEE 1JL8A 3MJ8B 1T83A 5JQHC 4J1UA 2APTA 1HXYA 5E8OA 3GM0A 1JCKA 2MSPA 1YN6A 3S3SA 4MNQD 5FHAL 2Z91B 3QXDA 5E6IB 5I1HH 1QSED 3PWLB 3IDGA 1CGUA 1G9MH 5E4EC 5HI4C 1QPPA 3MRMB 3QI9A 2MQCA 3DHMA 4LSTL 1VFBB 2IPKB 1MCSA 2WUCL 4LSRL 4XBGB 2Q20A 1RUQH 5CFHA 3VDAA 4X83A 4M6OL 5FB8A 4XNXL 1NAMA 3KPLA 4XMPL 2FH6A 4LVNC 4P48A 4OZHB 1OOAA 5DFTA 4NJAH 2RFXB 4UINL 5ANME 4NNXA 3Q5TA 2CXKA 1P7QB 3WHXB 2W92A 3QDGE 1MRFL 2QV2A 3STZA 3RRQA 4NM4L 1BFOA 1NEZA 1RFDL 4JFFE 1P4BH 3A67H 1HNGA 2NTSP 1PVHA 3IFPA 3IAGC 2ED9A 4ODHL 4HIXL 4WEBH 3RZWA 5ISZD 3QHZH 3GKWH 3QRFM 1U3HC 4HW6A 4L3CB 4RQQA 3E3QC 4ZTOH 4OB5H 5FF6B 3A0OA 5J06A 3IJHA 2VDLL 2IBBA 5IFHL 1NCWH 1FHGA 3H2WA 3BD3A 2FJFB 2C3XA 5DEGB 4WHYH 1JV5A 3V5DA 5IBLC 3SKNB 3H3PH 4GAGH 4XBEL 2W0LA 3DUUB 5ESQB 1UJ3B 3QUYB 3MMEA 4JAMA 1ZLVH 3MRBA 2E8ZA 1I1FB 4QTIL 5D2NC 3EO9H 4NC2B 4PV8A 3EYQD 4K2UH 3ES6A 3QUXD 3BAEL 5JMOC 2ENYA 2I07B 5HHME 4XPTH 3ULVL 1DUZB 3QG7L 1MCHA 1SJXA 4PJDA 3LD8C 3U7YL 5JPMB 4NM8L 5F89B 2X7LB 4TNWF 1R0AL 3D48R 1T0MB 1EEYA 4B5EA 5DTFA 3AU1A 4IRJA 5J1AA 3C8DA 5IIEB 1Z9SA 1BZ7B 2D4DA 1YC8A 4M61B 3BRDA 3FQNA 4X0KA 5C3TA 2OXHA 4ETYA 2CIIB 2AGJH 5BRZA 3BVNB 5F7FA 4G9DB 3HE7C 3ELAT 3LKNA 1VKXA 3IDJB 5IHBA 1GOHA 3EFFA 3BZ4A 2D7TL 1U8IB 2E9IA 4YDJB 3O3DB 4J8RA 1W72B 1LMKA 3RWIA 3IVKA 4YHKL 5DHYB 3QISA 3CFDB 2J8UF 3GSUB 1DQMH 3QH3B 3QWQB 4OIIH 1U93B 3NAAL 1N7ML 4LPVA 3VGGA 4HT1L 4YWGL 3EDFA 2OTWA 1ZHLB 1DN2A 3EHBC 3D69A 1ODAA 3VXSA 1CFSB 5AG9A 4WHCA 4HJ0D 1BIIB 1X5KA 2E7LC 4UDUA 3GSXA 5TJWK 5HJ3A 5D2LA 4PRBA 3NZHH 3QCUH 4JPWL 3EO1A 1IEBA 3I02A 4YHOH 2IC2A 5A3ID 3SDDB 1YNTB 2IPUG 5HHNA 4XHJC 4MJIA 4OLEA 4KFZC 4PRDB 4M4RA 3SGJA 3FT3B 1PG7H 4MNHA 3TYFA 1CICB 4PGBB 1UB6A 4H1LA 1MSPA 3NACH 3O2DH 4JEGB 4N5EC 5EIVA 3AXLA 4R4NC 4YFEA 3ARWA 3QEGL 4JFQB 4KKLC 1TJHL 1NBYB 5DFWH 2ITDA 1Q9LB 4P4RB 4GBXB 4Z0XA 3RUGE 3G5ZB 4J3WA 5JW4N 5DK2B 1FFQA 3TFKC 1FIGH 1S78D 3D2UA 1NUGA 4HAGA 5TDPA 1BVZA 2A73B 3WS6A 1K8DB 2AEPL 2ARJQ 4FP8L 1HH6B 4OZ4A 1MFCH 1QTYT 2XI9A 2D0GA 4MMXC 4I2XE 2R4SL 4KAQH 5D7LE 4YHPB 1KN4L 3W9EA 5JNYA 3GRWH 5C0CA 3C5ZB 4Z95H 3PNWB 3THMH 1XZ0B 3KPQA 1HHIA 2CUIA 4HFWB 4JM2C 3T3PE 1NCBL 1UB5B 5C0RL 5T1LB 4K3EH 3TP4A 4X6CB 3CDGA 3B9KD 2MOVA 3LKQA 3O4OC 2HJLB 4ZUTB 3FT2B 5L2JA 5IFJA 5DRWA 2B7DT 1EIBA 1D5ZA 1TVDA 25C8L 2A9NL 2EYSB 3EAKA 4KRLB 1INDH 2VXQH 3PL6D 4LOUC 4XWGL 1VGKB 3RA7H 1CL7I 1J1OL 4PRIB 1DL7L 1P69B 2ZCLL 1NBZB 2APBA 3FRPG 5F21B 2KQNA 4U1IB 5SV4A 3RTQB 4LSUL 4C83A 4KQ3H 5ID0B 5IBUB 5C08A 1Q72L 5DJXA 2P8MB 3BOVA 3QIWD 3U9PH 4TQEL 4LMQE 4OCMC 4XC1H 4L8DA 3HAEA 4WHTB 2VDNH 1BOYA 3QUKA 5MENB 3HUJF 3K0WA 3OKLB 3BSZL 4RDQG 3QZWG 4XP4H 3OB0K 4LNRA 3G5XB 1ZGLB 3SKUD 5TH2A 5B39G 3UMTA 1P2CA 4UUJA 1NLDL 5CLTA 3SCMC 2NR6C 4OFPA 4GRWE 5GS0L 3MOAL 1CU4H 1U6AH 4V1DA 5AAWA 1LD9A 2AJUH 2PTUA 4XCYB 2R56L 4FMKA 3IGAB 4LVHB 3OHXA 2ZSWA 2K3TA 5JOPD 1OGTB 1T6VN 4JFDD 2AQ1A 5GRVK 3DRQA 4JKPL 1NKOA 1KCUL 2PKDA 1W0YT 4WGWB 4WTZA 2H8PA 3AY4A 2W9EL 3LN9A 2V5MA 1OLZA 3KR3L 1DVFD 1MNUL 5GISH 5BS0A 1U95B 2EKJA 4PTTB 3WFBL 1BJ1J 4R0LC 1MHHA 4GUPA 3VD5A 4HCRH 3RWEA 2A6DB 1RZKC 4JPVL 2PTTB 4XAWL 3SKMA 4JN1H 1OPGL 4BSVB 4U0RB 1NMCB 3JUZA 5I8KL 3OR6B 1UM4H 4LSSH 1EX0A 3QCTH 2BVQB 3ULUD 2AKRB 3MJ8A 3SO3C 1IVLA 3UTSE 2VXUH 3UO1L 1L7TH 1KELH 5IVZB 3QFJB 1FL5B 3TWCH 4BZYA 5AD0B 4S1DD 1MF2L 3OMZA 1DZBA 2Z91A 4LSVH 5E6IA 4JO4L 2PTVA 1YJDC 4M93C 3GIZL 3MRMA 1AY1L 4P59H 4LKXB 4UV7L 1VFBA 2IPKA 3WNLA 2YA2A 2R0LL 4Z7VB 4Z18A 4XBGA 4HG4K 1IC4H 3MQIA 2WUBH 3RWCB 3MLSL 1U42A 2HFEB 3C87A 5EB9A 5IEHA 4NGHL 1U3ZA 3SBWA 3RBSA 2RFXA 1XGYH 4KK9D 4LQFH 5F93C 5TQ0H 5C3LD 4EIZC 1NGPL 1P7QA 3WHXA 1AQDB 5IW6B 1AO7B 3OBAA 3QNZB 1XF3B 4OD3H 5T5NG 3MLXH 3V6FB 3IDXL 2VLKE 3GNML 1GRWA 4X80L 5DLML 4K9EH 1DFBL 3HMXA 5KZCB 3UTTE 3MCLH 3CIQA 2HT3D 5CGYC 4L3CA 5FF6A 4U1LB 3SE4A 1JPSL 3WXVH 1YYML 4HC1L 1ZTXL 4M7ZB 2FJFA 4QRSA 3NH7L 5DEGA 1JRHH 3SKNA 3DURA 2G9HA 3QHTC 3UPCA 4NQCD 3DUUA 4IMKC 5CZVL 5ESQA 1J1PH 3QUYA 1FVDB 4MS8C 1UJTA 1CTNA 4L4TE 4U3XA 5D9SB 3VFRA 1QR1B 1JPST 3NABH 1T0NB 3L1OL 4MSWB 2UZXB 2I07A 1UA6L 1CE1H 4GKSB 1F6LL 2NY4B 2Y4SA 1IGMH 1DUZA 5J0BA 2F19L 4IJ3C 5JPMA 3QXAB 4KUZL 2X7LA 1T0MA 4GQ9L 2FECI 1NLBH 1KTDB 5C07D 2P5WE 2LU7A 4K71B 2G75B 4Z7WE 4M1CC 1BZ7A 1FG2B 4M61A 3DYMA 5ITBH 5FAAA 2CIIA 4XMLH 3O2VL 1WIPA 4WUUA 4XVUC 1RZ7L 2QQNH 3PGCB 4JO1H 1J11A 3MNZB 3GMMB 3IDJA 3R06B 3BQUD 3OKMB 2UY7A 4K07A 2X5PA 3V79C 3I6LD 1U8IA 4L4JA 5KVGL 4YDJA 1W72A 1RIHH 3MJ9H 1ZHNB 5DHYA 3SGEH 4WFHE 3CFDA 3S88H 3GSUA 3QH3A 1C16B 4K3DH 1U93A 4BQBA 1CGSH 2GT9B 1EA9C 4MAUL 2YD6A 3NA9L 3V6ZB 4RBPH 1ZHLA 1CWVA 2QADD 5CS7A 3NCBB 2YKLH 4G80A 1C1EL 2XWBB 1ZLWK 3QP3A 1BIIA 1FO0L 2FEEI 1QZ1A 3CPLB 3F65A 4PGCB 4PJDE 5BJTB 4EQ3A 1NGXB 3GMOB 2C1PB 3SDDA 4DEPB 5LGJB 2VB5A 4FFVD 1YNTA 5GS1C 3DXAD 4NDMA 2W0FB 4OZFG 4PRDA 3FT3A 1C8PA 2W60B 2WK2A 1CICA 4M48L 3U46B 3IKCA 1QBLH 1RK1B 4X5WB 2CR6A 2K9UA 3VXRB 1CZ8L 2BY3A 1JPFB 4L4VB 3HC4H 5BRZE 2O5XH 5ICZB 1BJ1H 3BPNB 4JFQA 2JKXA 2KH2B 5HHQB 1NBYA 3MLWL 3S34H 1Q9LA 5GGUB 4P4RA 4KKBC 4GBXA 5F7EL 5C9KA 5F88B 3G5ZA 3ZHDA 3LS5H 3NCJL 5DT1H 5D5MB 2XA8H 3ARBC 3WO4B 1QBBA 4J6RL 5DK2A 2MFNA 4MQXD 1KACB 43C9B 4JFHD 5CUSL 5I1HL 4U6TA 3F5WB 1G9ML 4X4YA 1AXIB 2A73A 3MROB 5KS9E 1K8DA 1HH6A 2G5BA 4PRPE 2VZ1A 3L5XH 4ALAH 3U4EA 3FHQA 2EICA 4MA1C 5D2LE 2YD8A 4YHPA 1MY7A 1WT5C 1TVBB 3CC5B 3C5ZA 3PNWA 2FL5B 3ARFB 4WDIB 5DJ2B 1XZ0A 4HFWA 2OYPA 4YDKH 2D0HA 1UB5A 1WISA 5GGRY 5T1LA 4MJIE 3PP3H 4NQTA 2APFA 1XGRB 4X6CA 1NGYA 4DTGH 4LBEA 4NO5B 1P4BL 2HJLA 1SJVA 1CDCA 3FT2A 4CGTA 2BHZA 5SWZE 3QHZL 1QYGH 1H3UA 1G0XA 3H9HA 5F7KC 4HPYL 5E8EB 4OB5L 1YQVL 5IOPB 2F74B 5D8JL 4AEHH 4EN3D 4PRIA 4Z0BL 3ZL4H 1U9KA 1I7UA 1E4KA 3D39E 4XC3H 5IHUL 3RTQA 4M6MH 2ZUXA 5ID0A 5GRXG 2GY5A 4GAGL 3VG0L 2JIXB 5CILH 2P8MA 4KUCD 3P9MB 1WFUA 1TJGL 1JE6A 1G9NC 3EO9L 5A2LH 4HUVA 1IGFH 4WHTA 4K94C 3VFPB 1QKZL 4CN6A 5MENA 2HWZH 4HWEH 4Q9RL 3OKLA 2PO6C 1SEBB 5EU6B 2AJXH 4X6DE 1ZGLA 4TTDD 4ZPVB 5C0CE 4K9EC 1FNAA 5AYUH 3BDYH 1RZKL 3PGFH 3QNXA 4G9FE 1YMME 2X4SB 4UILL 4HIIB 4U6VL 3TO4C 4LLWB 5IT2L 1BQUA 4OV5A 4HULB 3DWTA 4FFZH 3DGGB 4K3GA 2HT2D 5GJTH 2AJZA 4Q6IB 4OCLC 4XCYA 3TIEB 3RNQB 4UZGA 1OGTA 3AM8A 3LKPB 1BF8A 2X6MA 3TN0C 3QDJB 4APQD 1S3KL 2AAVA 3SKOB 2AI0L 1YJDL 1AHWC 1MQ8A 4OSUH 5HGHB 3V4VH 4OZFH 2YA0A 4HGWB 3ARPA 5F1NB 3VFVB 1WICA 4Q9QH 1PQZB 5C08E 1MJUH 5DJYB 4PJFB 1CD9B 5ELIA 1JFQL 1U95A 4PTTA 3QEQD 1QA9B 1RJYB 4JZNB 2A6DA 4M1GL 2PTTA 4GLRH 3CSYB 5MHSD 3HG1B 1MREH 4BSVA 4O4YL 5HD8D 4PJIF 3B2VH 4JFPA 1WVZA 3LHPH 5FGCE 1ERNA 3NZHL 1DSFL 2AP2A 2BVQA 1I1AD 3HLAB 2AKRA 1LWRA 1K85A 2XTJE 3BRFA 5IVZA 5AD0A 3ZKMD 1YEKH 4A2LA 2VLJE 1O7SA 5DMGC 4F37F 3MLZH 3DVNB 1GPOH 2BJMH 4NQED 1WZLA 3RGVA 5J8OA 3VG9B 1AI1L 1QRND 3CNKA 4LKXA 3TBYB 3BKMH 3FQRA 1J0YA 2Q8BH 3TESA 5ADOL 4Z7VA 3IXTB 3CLEH 4YUEH 2EDNA 3MLUH 4UTBL 3RWCA 4JVPA 3OJVC 1CL7L 5KANG 3NTCH 5DD3H 5D1ZB 4BELD 3AB0B 3GHEH 1A3LH 1AQDA 5CMAB 2Q87A 5IW6A 5KSUB 4JG0L 1AO7A 4I3RL 1XF3A 5MI0B 5E9DE 1MJ7H 2RBLA 3OJDB 4F8QA 3KXFD 4PP1D 3JWDH 4NC1E 4XNYH 2PW2B 1XF4B 4FXKB 5JOFB 1IFHL 2F54E 2VKWA 1P84J 4NO3B 4C55A 4WFED 2OMNA 4U1LA 1JGVH 2APVA 4KAQL 3MBEC 2YWZA 5J12B 4UV4L 4JM4H 1Q94B 1WFOA 4PREB 1VHPA 5JR1L 2XN9E 4TRPH 3WD5H 1FGVH 2YMXH 3RUGF 4U3CA 3RPIB 4YHZH 5HI5D 3L3DB 1FVDA 3WLWC 2PF6A 5D9SA 1SMAA 5EOTB 1T0NA 4MSWA 4JHZA 4PJHB 3HZVB 4GKSA 5E4IA 3PWPD 1INDL 2ICWB 1IGCH 2AEQH 3BPOB 3QXAA 5F1OB 5BOZG 2BC4B 4I0CC 1KTDA 4OZHE 2FEDC 4JFFD 2G75A 1FNSH 1ORSB 1V7MH 2VJXA 3GK8L 4G8GB 4U3HA 5I0DA 1FG2A 3VFSA 3NVQA 3QIUB 1QD0A 1P4LB 4K3HA 4W6XB 3PGCA 3T3PF 1D6VH 3FFDB 3MNZA 4JGJA 2VDNL 2NY2B 4YHNB 3BMWA 3GMMA 3R06A 4QRPB 3S3JA 3OKMA 1F2QA 3L3GB 4DK6A 1WZ1L 1YEFH 1OGAE 4QRRB 1ZHNA 2VDQL 2FHCA 4RAUB 1YYLH 1C16A 1KCVH 2UYLB 4F33A 4NBYB 3ORJA 3TZVD 2GT9A 4E0RB 5CINL 3SGDI 5DRXB 3QNYA 4C54A 1RZIB 2H2PC 4LU5L 4DKEH 4KJQC 1KC5H 4JZJB 4RGOH 2BNQB 4LCUB 2AJUL 4JDTH 5KJRL 5I19L 3RDTC 1JYXA 4MB4A 2W0PA 3BKCH 2AXJA 4WCYL 4ZSOB 3CPLA 4HMCA 4PGCA 5IBTH 5BJTA 2ATKB 3GMOA 3HFMH 4UIMB 2C1PA 1T0PB 1IC5H 3QDMB 5LGJA 5FM8A 2AJSH 3BISA 2NZIA 2Q1EA 1B88A 1RURH 5GISL 2W60A 5J6GB 1D5BB 4F15C 1JZ5A 4X5WA 5E4EB 3VXRA 3U6RA 2R2EB 4L4VA 5ICZA 1L0QA 3LV3B 3MJGX 2WP3O 2DBJA 2AABL 1BVKB 4NRZA 4XGZA 2NX5B 4YIQA 1ADQH 5GGUA 2HLFD 1MJ8L 4LDLB 4OLZL 5F88A 4X4ZA 2HKFH 4DZBB 4LVNB 4QOKE 5D5MA 1CS6A 3GI8L 3S37X 5J4MA 1TZGH 1I7ZB 4TSBH 1RI8A 3LMJH 5JXEC 4Y8DC 3EFDH 1F4AA 4FFYH 3FB7B 1T4KA 5H8DA 2ZNWA 3S36H 3VI3E 3P4MB 5GRWA 2OMBA 4WO4C 4MJ6B 1MCJA 4PY7B 4N8VB 5DUML 1KLGA 3V6OC 1U3HB 4XMKH 4YXKL 4EUPB 1TVBA 3CC5A 1G9NL 2QJDA 3VXQB 4WDIA 2FL5A 1L4IA 3ARFA 4HUKB 4QF1A 5DJ2A 3I2CH 1UQSB 1XGYL 4LQFL 4XP9L 2BHUA 4DN4L 2JELH 2FECL 1A1MB 2W07A 3MLXL 1XGRA 4LLYB 2B4CC 1VACB 4NO5A 1INQB 1RUKL 3GSNH 3ARDA 5D2NB 4MXQC 1NKRA 1DBMH 1I7RB 3UTPD 5I15L 1RY7B 1KXQE 3HNVL 4K9EL 5KAQF 4DUWA 5CJ8A 1E6JH 2CKBH 2EDDA 3HA0A 5E8EA 4POYA 4F9LA 5HSFA 4P2RD 4FTVB 2F74A 5IOPA 3LD8B 3WXVL 2AXFB 4G7YH 4S1RL 1RJLB 1UKTA 4R26L 5HVWA 2Y1VA 2Y72A 1DEEB 1I85C 4CVWA 3P9MA 5FO8B 2I5YL 1ED3A 3C6LD 3NABL 5DQ9B 3NMEA 1ZLVK 1A9BB 3ARRA 2F8XC 5TQ2H 1DQLH 3LS4H 5CIPB 5D7LD 4OBSA 5CEXB 1KCSH 3HE7B 4PB9H 1FNFA 1SEBA 5EU6A 5ACMA 4JDVB 1BGXH 1TJIH 3LN5B 4NFBA 2EDFA 2FD6H 5JDJA 5IWLA 4ZPVA 4X9IA 3JWDC 1NLBL 3VFMB 4M4PA 2YRPA 1NC2D 3STLA 1MCLA 2X4SA 5I1KH 3V5HB 4U6YB 2F9BT 4LLWA 5E8DH 3C2AH 5C0BB 1MCWW 4X6CE 1WBXB 3DGGA 3I6GB 2E9WA 4JO1L 3ROOB 4Q6IA 3WXWL 3RNQA 2IANE 2VQUA 3LKPA 5LBSH 3PUCA 3QDJA 1U3JA 3F58H 3LKSA 3SKOA 4HD9A 2FHFA 4GG6B 5HGHA 5C6TH 2B5IC 2ZSVB 3MJ9L 3RBGA 4HGWA 2VZVA 5F1NA 4K3DL 4P2QB 3L6FA 1CGSL 3CH1B 4XP6H 1S7XB 1YPZB 2R9HD 2YUWA 3DX6B 4KJYB 5DJYA 4M7LT 1JYWA 4PJFA 1C7SA 1UKQA 4LKCA 2D7NA 5F97E 2KL6A 5ILTH 4YK4C 1F2XK 2FATL 1XT5A 1RJYA 3JWOH 3VA6A 1A1OB 3CSYA 4RWYH 3HG1A 3BXNA 5B3NA 5MENE 2C4FU 1FE8L 4TULH 5HGAB 4PS4H 4B7LA 2E6PA 3HLAA 1JGLL 3P77B 1TITA 4R7DB 2VRAA 3NIGE 4DCQA 1FO0B 3DVNA 4G3YH 1QBLL 4AYFA 5BVPL 2NNAB 3TBYA 4M62L 3HC4L 1RVFL 3P30L 2FGWL 3IXTA 4YBHA 2X9XA 4KHXL 1FVCB 2R2HB 4KI5C 3L3JB 2Y5EA 1QBMH 3LS5L 4H25A 2IQAB 4ZUSB 4PPTA 2XA8L 3GO1H 5D1ZA 5CMAA 4JM2B 3KPSB 1DE4B 1WWAX 5KSUA 3KPPB 4PJDF 5D7IE 2YPLB 4NQXB 4LP4A 5JLZB 3OJDA 2ZKHL 5SWSB 3O4OB 4ZTPL 2IQ9L 2PW2A 4QGTA 4P46D 2J6EL 1XF4A 5TFSH 4FXKA 5JOFA 4Z7QE 5JZ7C 5FUZH 4JKMA 3L5XL 4ALAL 4K8RH 1Q1JL 3U0WH 4YC2C 4NO3A 1ORQB 3UTSD 5DHVA 1A7RL 4YPGA 5I1LA 2X1WL 3GMPB 4XCEB 4AG4L 1TQBC 1Q94A 5BO1L 4PREA 2RR3A 3QFJE 4P2YA 5JW5B 3RPIA 3L3DA 4AEEA 4D0CB 1TPXC 1QLFB 5KOVC 5I71C 4MLSA 1B0RB 2Z9TA 4PJHA 3HZVA 4RZCB 1I3RB 4QWWC 4PLOB 5I8EA 3PXHA 4D9QE 1ZV5A 3ZKXC 2ICWA 4X7FC 4DVRH 3D85D 1O5DT 1B9ZA 4C4KO 3GZKA 2BC4A 2DQUH 2AK1H 2ZUYA 4MMZC 3SCMB 2VLKD 1IAIM 5D2LF 4GRLD 4G8GA 1AO7E 3QIUA 4ELKB 3BKYH 4XXCA 5FYJH 5C0EB 1P4LA 3BT2H 5B38G 4HXAL 3VD7A 5KSAA 4AH2B 3ARGD 4YHNA 1QFWH 1G7JB 4ZS7H 1SMOA 3IRZA 4QRPA 3VRLF 4HWEL 3L3GA 4MX7B 4LCWB 1U8JB 4P57A 2MMXA 2AJXL 4DQOH 2N4IA 5AUMA 4PYHA 1BREA 3N1PC 3U83A 5F7DB 2Z8SA 4OQTH 2QQQA 2GHWB 4FZ8H 4PIRF 4QRRA 4KRPC 4RAUA 5AYUL 1CGXA 3BDYL 4L4TD 2BVOB 4HK0B 2Q7YB 5DRXA 1BJ8A 4R9HA 2WP3T 3QI9D 3IETB 5FGBA 5DYOB 2DM2A 1RZIA 4JZJA 4R0LB 4PTUB 2EDJA 4NZRH 1BZ9B 3EJZC 4Y1AB 2C1OB 7FABH 1KB5L 3V2AR 4GKZA 2J12B 4ODSL 5JA9A 4OSUL 4L9LC 1VFUA 2ATKA 3V4VL 4UIMA 2IPUK 5K59E 3QDMA 2X9WA 3SO3B 2E9JA 3QAZC 2IH1A 1J0KA 4JKKA 4P2OC 2Y25A 2ICES 5DO2C 1UM5H 4TVPE 3MNVA 1T22B 4G6KL 5K9JL 1MUJB 1FL6B 5J6GA 4E42B 4M93B 1D5BA 4RFOL 3WNNA 4M6NH 1OTUD 4FQ1L 4HHAA 3RWJB 3LV3A 1EK3A 4IMLB 2NX5A 4WFHD 4J2XA 2B4CL 1IGIL 4Y16C 4LVEA 3WLBA 1AKJB 4DZBA 3LOWA 1JGDB 3DUHA 1FYTB 1Q0YL 3SEPA 1CDHA 4JREC 1YEKL 4JB9H 5JIKA 1I7ZA 1FZKB 1MIEH 5E2VH 4ZNCD 2EZ0D 1JNLL 5L6YH 4BQCA 3FB7A 2PW1B 3B9AA 3P4MA 3MV8B 2Q8BL 1FGNH 3UZVB 2CO6B 1BFSA 3UROR 4MJ6A 3MUGB 4PY7A 4N8VA 1U3HA 1KGCE 1J7VR 4I0PC 5F1IB 4IRJD 4EUPA 4PGDB 3VXQA 1RHFA 4UTAH 3NTCL 1FSKC 5GS2D 1EJOL 1KPRB 4LPTA 1GYAA 1IQWL 4LLYA 2UZIH 3BN9C 2OK0L 1INQA 1IKNA 5BRZD 1JIBA 4ZNEE 5D2NA 5I76B 4U1HB 3PIQB 3JWDL 1I7RA 4NHUA 4KRNA 3VXRE 3L5HA 2ZCKH 4QRTB 2MPAH 4M8QB 4L4VE 3PV7A 2DKMA 4IJ3B 4FTVA 3ZYOA 3QBTB 3PP4H 1YY9D 2AXFA 1ZLUH 4LSPH 4LL9A 1VCAA 1RJLA 4JM4L 3WFEH 2X70A 4WJ5B 5D5ME 5DZOA 1AP2B 5DVLA 1Q9OB 2QSVA 4M9PA 3WD5L 1DEEA 3MRKA 5H35B 2NXYD 4YHZL 1G1YA 2DKSA 2DYPB 5FO8A 5KVDH 4PRPD 1PX3A 4HC1A 2VQTA 5DQ9A 1A9BA 1CVRA 4HAFA 5JPNB 1K2DA 5CIPA 5D6DC 3OXRB 3MRLB 2DM4A 1REIA 5CEXA 5CJQL 1A2YB 2R29H 1IGCL 2AEQL 4JDVA 3LVEA 1NAKH 2VDRL 1YEDB 3BP5B 3K80A 3VFMA 4MJID 5JIPA 5D1QD 4GXVH 1U8PB 5BV7C 5F7YC 2BOCA 1FNSL 5I1CL 3MOBH 1XMWA 3V5HA 3EYFA 4U6YA 5JUEL 5IFAH 3LH2H 5SWZD 1QHPA 4U6XB 3TF7C 1ZGLM 5DUPH 5EO0A 3BYTA 4HMEA 3I6GA 3WDJA 3ROOA 1CFQA 2E7LA 3D39D 3O41A 4ONGH 3FO1B 4XVJH 1AGFB 3ZKSD 1YEFL 3SKJH 1EO7A 4GG6A 2ZSVA 1SY6L 1KCVL 3F6LA 4MD0A 5IB1B 4P2QA 4WFFD 2EDLA 3IAPA 1WZMA 5GS1B 1D9KB 3D2UD 3CH1A 4ZS6D 1KSRA 3EYSH 1S7XA 1YPZA 3DX6A 4KJYA 4ESKA 5FYKH 1CDJA 1KC5L 5FYJU 4QRQB 4RBPK 3WNOA 1ZSDB 3CVHL 2DQCH 1K9TA 5M94B 3EYUL 5I1IL 1BQLH 1FORL 4NNPH 5CJOH 5HHPB 3UAJC 4O51B 1I8LC 3BKCL 4PGJA 5C0CD 5EU6E 1IM9B 5HGAA 4DJMA 5M95B 2QQKH 3VDBA 4JRYB 3QQ4B 3C5SB 4G9FD 1YMMD 1EEQA 5JIIA 4AQ1B 3UTQB 3P77A 5T1DL 1HH9B 3O9WC 1UH2A 3ARBB 1DBJH 3ULVE 1FO0A 3HB3D 3RIFK 1G7IB 4HUUB 1RURL 1FDLH 2H1PL 4YFLI 2CIKB 5C70A 5BVJB 5FOBB 2NNAA 2CGRH 1WFNA 4LEOB 2L7JA 1UGNA 4D9LL 2P8LB 1G6RL 3U9UB 3VGHA 5DK0B 1A6ZA 1AIFB 4U0QB 2ZG1A 4MA1B 1UXSB 1FVCA 2H32H 2R2HA 3GBML 4D0DB 1BFVL 2HKFL 5DVNA 1XAUA 2IQAA 4ZUSA 5HGBB 5C08D 3U4AA 4POZD 4JM2A 4OCWH 3KPSA 1DE4A 4XNMA 4L1HA 3KPPA 1TZGL 2OZ4L 4L8SC 4IRSC 4TSBL 4L8BB 3CDYA 1L6ZA 3W0WE 5D1XC 1XGPA 2YPLA 4NQXA 5JLZA 3GUTB 1CT8B 3OKOA 5SWSA 3I50L 4FFYL 3SDXB 2YPKB 4C4KT 4Z5RA 1IC1A 4QT5B 3HG1E 4FMFA 1ORQA 2XTJD 4IEFB 2WQ8A 4HEME 5INDB 3GMPA 4XCEA 5ERWB 4MA7H 5CWSB 2YZ1A 4V1DD 1Q0XH 1C7TA 3OTTA 5JW5A 1HHGB 2IAMC 5M7QA 1QO3B 2ADIA 4JHAL 4D0CA 1F90L 3GSNL 3PP3K 1Q8MA 1QLFA 1DBML 5ADPH 4RZCA 4ETQB 1I3RA 1YECH 1E6JL 2YRZA 4RRPA 3V4UH 5IGXH 1HYSD 4LHQB 2PO6B 1RZJH 4OLXH 1KT2A 5CP7B 3KAAA 3BW9B 3MLYL 3KG5A 5D7JD 3EUUA 1QQDB 1UZ6E 3SCMA 2CD0A 2FNBA 2R15A 5BS0D 2BFVH 4Y89A 4BSWB 2ZOKB 3TO4B 1RZGB 2A1WH 4ELKA 1NC4B 5A2JH 5C0EA 1ZK9A 4AH2A 1DQLL 3H42H 2KPNA 4P3CH 1G7JA 2Y6SC 1KCSL 4JCMA 1J0IA 4PB9L 4MX7A 4LCWA 1T83C 1U8JA 4G6AC 4S1SH 4YFDB 3TN0B 1TJIL 2XZQH 5F7DA 1QG3A 3T2PA 1AHWB 1EHXA 2IALB 2XN9D 3QZWB 3EBAA 5E6ID 3ULUH 4KZEH 1RUAL 5C86A 4HK0A 5B39B 2Q7YA 3JSSA 1T5WB 5E8DL 3LRSB 3IETA 4NJ9L 5DYOA 5CBAA 1F4WH 1JYNA 4R0LA 4PTUA 1KF9B 4PJHE 4WEMB 4PGEB 5TGBB 1KENH 1BZ9A 1MCOH 3BP7B 2C1OA 1CGTA 2GJZB 2DDQH 5EN2B 3NFPB 3F58L 4KK6C 1FYHB 4PUBH 4CN1A 4R2GD 2OL3H 1CK0H 3TM6A 5C6TL 1P7QD 3WKMH 4RIRB 1T2QL 4RX4A 1HSBB 4JFEE 1OAZL 4OD2B 4G8GE 4QXGL 1MUJA 1FL6A 5ILTL 4JFZH 1Z9LA 1RMFL 3RWJA 5I1EH 3SGKA 1OGAD 4R90H 2HYMA 4IMLA 4X6CF 4QRPE 3NPSC 4TULL 5A3IC 4U33A 1OSPH 4PS4L 2CSPA 4XPHL 4LPWA 1JGDA 5KW9L 4NUJB 5C7XH 1T66D 4PY8J 3QUYD 1FZKA 3ZSSA 2Z4QB 2QSQA 4G3YL 5J1SC 3MGAA 4G42B 4HKZB 1OAKH 2AQ3A 5FYKU 2BNQE 2PW1A 3HE6C 4PD4K 2KZWA 3MV8A 3MUY1 5F9DC 1ZS8B 1HEZA 3MUGA 4LSQL 1SEQL 4JZOB 4HWZB 4ZSOE 5F1IA 1KTLA 4EBQL 3MBEB 4YHLH 1H3GA 2VR5A 2E7MA 2CRYA 4X7SH 3ZHKA 3FO9A 2WSKA 2Y36L 4CMMB 1SM3L 3B83A 1KPRA 5T3XE 1X5YA 4LGSB 4DKFH 1N6QL 4IMKA 1INEH 2N56A 4QHKJ 1R5WB 1X5GA 5I76A 1F13A 3PIQA 4U1HA 4MA8H 1I8KB 4BZ2H 4PG9B 2X9YA 1T7VA 4O2CB 4PJBB 1V05A 4QRTA 5TFSL 4M8QA 5BV7L 4N9GB 5DVOA 1NANI 4XAKD 1F42A 2AK4B 2YWYA 5I66B 5E2JA 1A0QL 1PKQB 1HHJB 1QFUH 1OTTC 1S9WB 2GJ6E 4WJ5A 4HF5L 1AP2A 1FC1A 1Q9OA 3BHBA 4GXUN 5H35A 2IG2H 4GAFB 2DYPA 4UU9A 3VFNB 4RMUA 2VQ1B 5JPNA 3MRLA 3WL9A 1HK6A 3KPRE 1Z9OA 3SDYL 1LE5B 4IBLT 1A2YA 4Y7MA 5EU3B 2YD2A 3JV4B 3IDNB 3TIDA 3SDDD 1IZKA 5I18L 3SDCC 2DQUL 1YEDA 3BP5A 4K7FB 2AK1L 1U8PA 1XGUB 5F7MC 1Y6MR 1RUPL 3V5KB 3PGDA 1CICD 4PJEE 3MRFB 4PRHB 5TF0A 4U6XA 5EU5B 3RX7A 1EBAA 3CAFA 4U7SA 1JGUL 1QRKA 3BT2L 3IS0X 4N0CD 4KRMB 3P11H 2CMRH 2GQHA 3AC0A 3RDTB 5L88L 3LCYA 2DQGH 5SX5H 5KSBB 3MA7B 4MZ2A 1WBZB 4DQOL 3FO1A 1AGFA 2NY5H 5C92A 1BX2B 4FTVE 2DWEB 4OQTL 3C2SA 4KROC 3QPXH 4Z7VF 5IB1A 1AFVL 3M1BB 1HWHB 5GS1A 4AMKH 1D9KA 1X7QB 5GGQL 3DO7A 1RZJC 3U36B 1UENA 2WAHA 4JN2B 4F15B 3IS1X 1KEMH 1ZSDA 4X9HA 1KCKA 4POUB 1FFRA 3GHBL 4NZRL 5HHPA 3ARYA 1IM9A 4UOW1 4YE4H 3C5ZD 3INUL 3B6SB 4HJJL 4JRYA 3QQ4A 2O93L 3C5SA 5T1LD 1HH9A 3T3ME 2IGFL 3DIFB 5ESAB 5EWIH 3X17A 2O5YH 4NUGH 1KEGH 3F7YB 1GL4B 2O61B 3FOLB 1G7IA 1KB5B 4HUUA 5C0BE 3SE8H 3S5LB 2CIKA 4LHUG 2ZUWA 5C09B 5BVJA 5FOBA 4OZFB 1A1NB 5TDOB 4LEOA 5CZXC 4GXUM 4ODXA 2P8LA 5EH1A 5DK0A 3ULUC 4PRID 4WO4B 1BZQK 1AIFA 1UXSA 3RTQD 2BOBA 5F8RC 3ZYIA 1WAAA 3A6BH 4D0DA 1DQDH 1WT5A 3E0GA 4EJ1C 1AJ7H 1G7LB 5HGBA 1YDPB 4U2ZA 3DOSA 1OHQA 3NGBC 1S9XB 4L8BA 5E2VL 1YPZE 3GUTA 1CT8A 4RISH 4ONOA 4CL7A 2VYRE 2DQEH 1OARH 3NN8B 1PJ9A 3U7WL 3SDXA 1LO4H 5MEND 2YPKA 4JRXB 3V0AC 5KVMC 4QT5A 5FDYA 2O5ZH 4MLIA 5B21A 4XPAL 4TNVK 5TPWL 3HI1B 4G8FB 1IRAY 5DMYA 4FQIL 1IAMA 5HYFA 4NFDA 1QSFB 5INDA 5ERWA 4HBCH 5J13C 4LNVA 4UTAL 1EHNA 4KH2A 4ZAKD 4BSJA 5I1JH 4ODTH 1HHGA 1QO3A 2UZIL 3ETBF 5DXWA 2A6KB 2Q8AH 1KBGL 4TPRH 3SO5A 2R8SL 1F3RB 3O6ML 43CAB 4RMSA 3IDIB 4ETQA 4LCYB 4WTXA 3LKOB 5MP6H 2PO6A 3HC0B 4U1MB 4RGMC 3PP4L 4LSPL 4XH2B 3BW9A 4WY7H 3CSGA 1P84K 3D25A 3QO1B 5I30H 3OAYH 3T0AA 1QOKA 4PFEA 1NGWB 5EBGA 1QQDA 8FABB 2PYEE 3KPSE 4BSWA 5CLWA 2ZOKA 3TO4A 1RZGA 5KVDL 1UM6L 1NC4A 3HS0B 1VSCA 3J7HA 1CLYH 3EOTL 1K3IA 3DSFH 1M7DB 4AY0A 2AXHA 2DMBA 2FWOB 1I1CA 4AK1A 1AXTH 3UXFA 5J3HC 1ZA3B 2HH0H 4LQ1A 3GIVB 3TN0A 1WWWX 4FG6D 4S1QL 1S7TB 2ATPB 3O3EA 4KGJA 1AHWA 5JHDE 2IALA 5DQJB 3QFJD 3WFDH 2B5IB 3QZWA 4GXVL 4HPOL 2RGSA 1R3HA 2JCCB 2Z0BA 5B39A 4M7JH 1T5WA 2VZTA 3LRSA 1A7OL 1WCBB 2C3HA 1ZANH 3T0EE 3BQUC 1XIWC 4Y4HC 4YK4B 4D9QD 5D5MF 3P40A 3NIDF 4HDIB 5TGBA 4PGEA 2VN7A 4OTXH 1MIMH 4OGXH 3U0TB 3V8OA 3SBWC 2GJZA 5EN2A 3NFPA 4XVJL 2GSGB 4RMWA 3CFEB 3SKJL 3N1QC 1NFDE 4ONFH 3KLHD 1LK2B 4RIRA 4DN3L 3B9EA 1AO7D 1OT1A 1HSBA 1KLUA 4OD2A 2D9CA 4FQXD 3MBXL 5FYKL 5DRZA 2FIKB 1OAXH 1PYWA 6CGTA 5KZCD 1GH7A 5TE7L 4QHMB 3MJ9A 3N1GC 4KTEL 1BQLL 4NNPL 2AJVH 1I9JL 3RU8H 4G6FB 5FFLA 2QQKL 3D6GA 2A74B 2EE3A 2VXVH 2B1HH 3OKYA 4QTHB 3T2QA 5FK9A 3CVHB 4KKAC 3O4LB 3BKJL 4N90D 5L2KE 5IR1B 2FX9H 2Z4QA 4NRXA 3GJFH 1T5XB 4G42A 4HKZA 2NY4D 2CGRL 1Z0NA 2LV4A 2V9TA 5T33L 3WHE1 1ZS8A 5J1TC 5B8CC 4CMHC 4UNVA 4YC2B 3ZYZA 4FQJL 4JZOA 4Y1AE 4HWZA 3MBEA 4AEFA 1TTGA 3IRPX 3LKRB 4TVPD 2LTQC 2N7BA 4I3SH 1TQBB 4PJ7B 1ZWIB 1G6RB 2EIBA 3CFCH 3QHFL 3KYAA 4HJGA 2ADGB 2NY7L 1R5WA 4XHQA 4GMSH 3VFTB 3LDBC 5CEZL 1TPXB 1F45A 1I8KA 2YD4A 4I77H 1MJJB 4PG9A 1DBBL 5I71B 1K4CB 3ULVF 3GSRB 3O2WH 4PJBA 1OTSD 4N9GA 2HJFB 2JB6B 4U31A 3ZKXB 1CFVL 5FYLD 3H3BC 3QA3B 5I66A 3RPKA 4N8PA 3HRPA 3PDGA 4CKVX 3A6OA 4Q9CA 3O0RL 4MA7L 4DGYH 1PKQA 1FYTE 2J6EA 2DS4A 1S9WA 3TJEH 2VDML 2X1PA 4BK5A 5IVXA 3OKNB 3I3EA 3VFNA 3CCHB 5DJ0B 4N0UB 2VQ1A 4XTRC 4I13B 3O3UN 1KGCD 1DANT 1M7XA 3MV8E 4OGYH 4S0TD 2A0LD 3LEXB 3OGOE 5IGXL 4PJFF 5EU3A 2JJTC 3JV4A 4OF3A 1RZJL 3WYRA 3IDNA 4TSCH 2M26A 1AGBB 1Y0LB 2YPVH 3GSNB 2I9TB 4KRPB 1XGUA 3EYOB 1SVZA 5DRNB 2ZCHH 3V4PL 3V5KA 4PRHA 3MRFA 4ODVL 5EU5A 3VXRD 1FNLA 4NHCL 4KKCD 4L4VD 5HVHC 2VWEC 3QIBC 2V17H 1LK3H 3RDTA 4GBXC 5KSBA 1KULA 1WBZA 4S1SL 1BX2A 2DWEA 5EULV 1IARB 2B20A 5EC2B 1TTFA 3FN0L 4L9LB 1IC7L 1JZ2A 4NYLB 1G7MB 3QAZB 2WBJC 3M1BA 4PJIB 1EAPB 4P2OB 5CJBA 3V7AE 1X7QA 3ULUL 4XPBL 1YZZA 2C3WA 3BI9X 5IB2B 1NMBH 5T5FH 2XWJB 1GGTA 3U36A 2EC9T 2Q86B 3IFLH 4JN2A 4OCYH 3FZUC 1UZ6F 1H0DA 1FFPB 1KV3A 3WN5A 2NY3C 3S35H 3LEVH 3NOIA 4UT9L 1MCNA 4HWBH 1CLOH 1MCOL 1LP9E 1MELA 3QQ3B 1DBKH 3ARFD 3B6SA 1PG7W 2OXGA 4PUBL 1NFKA 4Q6YA 2HRPH 4Y16B 4AIZB 1MAML 4XWOC 3MPCA 4KI1A 3HI5H 5KTEH 4K3JH 2NXZC 1YC7A 3DIFA 2GK0B 2DQIL 1QLEL 1HXMB 1X4ZA 4GMTL 1BOGB 4JREB 3F7YA 4XP5L 2O61A 2JE8A 4KVNH 4JGUA 1F4YH 2J88H 4M3JA 1KB5A 4XPGH 3TNMB 4NIKB 3S5LA 4JFZL 5C09A 1T1ZB 2VAAA 1J0JA 1A4KB 4OZFA 1A1NA 3BFOA 5TDOA 3DX8B 1KFAH 4R90L 4WO4A 3DETD 3OXSB 2XY1A 1RU9H 2HFGH 1OSZB 4PRAB 4P9HC 4Z7OE 1OSPL 4I0PB 3NZ8B 4PJHF 2ICCA 3CK0L 2JIXD 1G7LA 1YDPA 5FHBH 1FSKB 5EZJB 3GSWB 3AS2A 1S9XA 2BVPB 3REWB 4F7MB 2F5BH 2FCBA 4KVCL 5ACLA 2OSLA 3R0NA 2LVEA 5F9OH 3LB6C 3NN8A 5FKAB 5E2WH 1OAKL 4JRXA 5EU6D 5I75C 1UXWB 2CK0L 3OF6D 1LO0H 3D0VB 4M02A 2Z8VC 3ZT5A 3HI1A 4G8FA 5HDQH 1QSFA 1IL1B 3ULVD 4JRYE 1BBJA 1RAMA 2QQLH 5E5MB 5IB4A 1X4YA 4OFYA 4JANA 2OI9C 4BFGA 4LFHD 1INEL 3T4AB 3DRTB 3BH8A 1VGEH 4UNUA 2YD9A 2A6KA 1A6VL 3EZJB 4OF7A 3SE9L 4ELMB 3IDUA 4R97C 2OR9L 3IDIA 4B41A 2B1AH 3EYVB 4LCYA 1T03H 3LKOA 3QDJD 2E6QA 5GZND 5I1DA 5IJVB 5GHWH 5MEQB 2EKSB 3HC0A 4U1MA 3LN4B 2BNRB 4OCRH 1WBYB 2VXSL 1WAAE 4XH2A 5HYSG 3QO1A 3W0WD 3BESR 1ZLUK 1CLZL 1NGWA 1QFUL 5BV7B 8FABA 3L3IB 2VDOH 1NBQA 2X1QA 3TYGH 2IG2L 1BM3H 5DDHB 1UVQA 2BRRH 3O6LL 5FDWB 3HS0A 2JJWA 2M8XA 4DW2L 3HG1D 3O81A 1M7DA 1RULH 3SDXE 3WEXB 3R1GL 2FWOA 3U2SB 3FO2B 1ZA3A 3GIVA 3V6BR 4X6FB 1PSKH 4FFWC 1S7TA 3HMXL 4U7MA 1IBGH 5ITFB 3FO0H 2A2QT 2OM5A 2VC2L 2X4NB 5DQJA 4QHUB 5IW1B 2Q7NA 4ERSH 2QHRH 4LASL 2JCCA 3RGVC 1F8TH 4GRWH 3MX0A 2X89A 1T2JA 1CDIA 1WCBA 2P46B 3VH8G 2ARJA 2JTDA 3I75A 3P11L 4HDIA 3MV7B 3TBVB 1RZ8B 3U0TA 2XQBH 4HKBB 2JJVA 3G5VB 1KXTB 5GRUL 2GSGA 1R3KB 3CFEA 4KJPD 1HILB 2Y7QB 4KDVA 4U1SB 3QPXL 1LK2A 4MQ7B 4XI5C 5GS3A 4EIGB 3MRDB 3O9WB 3OAZH 4PJ5E 4S10A 3EDKA 3BMVA 2NLJB 5AYQA 2L7UA 1GIGH 3HC3H 2DM3A 4FQPA 3LQAH 9CGTA 2FIKA 2EH8H 3S8WA 3QQ9D 3TCLB 4Z7NE 4QHMA 2MTPA 5DD0H 1SY6A 1ZAGA 1HSAB 2EO9A 3IXAB 1J05B 2PUQT 2X4RB 3WJJC 4MDIB 1MY5A 1MCCA 1U58B 2A74A 3AMLA 4YAQA 5J7CC 3GDBA 4TUKH 4QTHA 5GGRB 1GGIL 3CVHA 4HSQA 1CLCA 1JUFB 2XTLA 5EWIL 1KEGL 3O4LA 4L8SB 4IRSB 5D1XB 5IR1A 1EXUA 5F96L 1FFNA 2W9LA 3G9VA 2DLEA 3QXWA 2FGZA 3NIFF 2HLFC 1FFOB 4MXVF 5F70A 1R5VB 2J4WH 3BD4A 1I7TB 4I48B 4N5UA 5IROC 1GCFA 1LO3H 2XFXB 5K9QG 1LE9B 3LKRA 1A64A 4O5LH 1AJ7L 4G8GD 4YO0B 4PJ7A 1ZWIA 2RQ8A 1G6RA 3QIUD 3F7PC 3P3YA 3UYRL 2RJMA 4G8EB 2FBJL 2IAMB 5ISZB 4RISL 2ADGA 5SX4H 3EGSB 1A3RH 2A9MH 2DQEL 1OARL 2NY2D 1QP1A 3T3MF 5EA0L 5DZLA 1LO4L 4QRPD 1MJJA 1K4CA 2QKIB 3GSRA 2D03H 1X5AA 1F4XH 1S7RB 3A6CH 1NBVH 2HJFA 2JB6A 1S5IL 3EDDA 2OZ4A 3F7VB 4I8DA 5B4MD 3QA3A 4QRRD 2WLZA 1J1XH 4HEPG 5C0NC 3DMMA 5I1JL 2AEWA 4UAOC 3WSQL 3K74B 3OKNA 2BNQD 2QLVB 3CCHA 5DJ0A 2JB5H 4GG6F 3K2MC 15C8H 2Q8AL 4PJ8C 5CBEB 2GITB 4OT1L 5GS0D 1U8QB 2B0SL 3Q6GH 1YPZF 3LEXA 3PHOB 1BF2A 4J1UB 2R0KH 3J8F7 3MLTB 1KG0A 1AGBA 1Y0LA 3WUWG 1E27B 3GSNA 1NAMH 4J23A 5T3XD 4WY7L 5I30L 2WANA 3SE3C 1XGQB 5DRNA 4JG1H 3HCVB 4KK5C 3DYPA 4JLRB 3MFFA 5EIIB 5HI4D 1MHCA 4EDWH 2DD8H 3OX8B 2Y9RT 1L0XA 1BAFH 3DSFL 5GGTL 2DLFL 2NX5D 2EDXA 3E6FB 4QXUL 5FB8B 5B38B 3FJTA 3KPLB 3P0VH 3KLSA 2X10A 2AK4E 5BCAA 3P2TA 5EC2A 4L9LA 3NFNA 2BNUB 4IRZH 4NYLA 1PKQE 1FZJB 5F9AC 1NEZB 2I25N 4P2OA 4FZEH 5IB2A 3OG4B 2XWJA 1ZANL 1P9MC 2NW3B 4P9HL 2Q86A 1EFXB 1II4E 2X4OB 3VFUB 3OWEA 4NWTH 3F62A 2CJUH 1MCKA 1FFPA 2YS4A 4RQQB 4JM2F 1U3HD 1R6VA 5IESL 1Q9WB 5KVEL 1YNKH 3QQ3A 3NPSB 2HT4C 2NZ9C 3I6LE 4AIZA 4Y16A 4HX1A 4R3SB 2YHGA 1D7FA 4XCFH 2GSIB 1X44A 5IBLD 2H2SC 2IBZY 2GK0A 1MCBA 3QUZC 1FNHA 1HXMA 3AVEA 1B2WH 3FFCB 1BOGA 2APWA 3ARDC 3MRBB 2H45A 4PRHE 3TNMA 3RL2A 4CVXB 5GS2H 4U49A 1ZT7A 1OAXL 4I4WB 4Z7UB 1E4JA 1T1ZA 4NCC1 4F9LC 4XT1C 3DX8A 1KCRH 3HE6B 4ZFZA 4CVUA 4JPKH 4FTVD 4O2FB 5D72H 3BYYA 3OXSA 2AJVL 1OSZA 4PRAA 3ZTNH 1RZFH 4I0PA 5DTFB 5JQ6H 3GI9H 1TENA 2B1HL 1AD0B 1PG7X 1GAFL 1R5IB 2AERT 1CN4A 3SOBH 1FG9C 3GSWA 2FX8L 1MEXL 2BVPA 2D7OA 5EZJA 3REWA 4F7MA 4RA3A 4Q97A 3KYNB 2V2XB 5D6CB 1U2CA 1ZMYA 5FKAA 1EMTH 3HE7D 1Z3GH 3EFFB 3BZ4B 1UXWA 1GC1H 3HNSH 3UP1A 1UEMA 5EUOA 3D0VA 2X4TA 2JJUA 1FRGL 2XG5A 4GSDH 1MVFA 2DBLL 1H9VA 1IL1A 5E7FA 3Q1SH 3ZE2E 4I3SL 4TSAL 5E5MA 5C0BD 2ED7A 5DA0B 5I1GH 3BUYB 3D69B 3EHBD 3CFCL 3T4AA 1HHHB 3DRTA 4OF0A 4XRCB 3VXSB 3GBNL 3L5IA 2H32B 4ELMA 3GMLB 4P4KC 5K9QI 5C09E 4R4FH 1P4IH 3EYVA 3O2WL 5D6DA 1MCQA 3QRGH 4HS6B 3RVTC 1GSMA 5IJVA 4PP2B 2BDNL 5MEQA 2EKSA 1IEBB 3LN4A 1X5IA 2BNRA 3X14B 3V6OE 4NO2B 1WBYA 4GKOA 4P2QD 1D5IH 3SDCB 3TA3C 3AREC 3QIWB 3VW3L 2BVTA 3TYFB 5JHLL 1UWXH 3L3IA 4GAJL 1AGCB 2F58L 5FDWA 3UC0L 2DQFB 2EEBA 4R4ND 2IFFL 2EC8A 1I3GL 3WEXA 2X4QB 4KKLD 2V2TB 5IK3B 3F12B 3H3KA 3OJMB 3FO2A 2DTMH 2QR0B 4X6FA 2BSRB 4UBDC 3MRQB 2PXYC 4ZO7A 3BD5A 4GRLC 1OCWH 2X4NA 5MEOB 3CXDL 4WI5A 5IW1A 4KROB 2QBWA 3TFKD 1EHLH 2AV7B 3L5JA 2ZCHL 4OGAC 5CCKH 1OAYL 1CDYA 1AE6H 2Q3ZA 4ZFGH 2CLRB 4OZ4B 4HH9B 1ZVSB 3MV7A 1LK3L 3TBVA 1X3DA 4DFIA 1J0HA 3HMWL 3RVVC 3W9EB 3TNNB 1I8LA 4HKBA 3G5VA 4FABH 4P5TD 5SX5K 1R3KA 1R3IL 1VEPA 2HN7B 3BZDA 1HILA 2VMFA 2Y7QA 4JM2D 3KPSD 4OLYH 4U1SA 4MQ7A 4JO2L 1KJMB 2YPLD 3O9WA 3CDGB 5DUBA 5EZOL 5SWSD 2BERA 5HPOA 1KPVA 2NLJA 1NMBL 1MCPH 1PW3A 1FH5H 1YEIL 3IFLL 3TCLA 2CRIA 4OQTA 1FAIL 4TTGA 4LOUD 4F58L 1HSAA 2B2XH 3HAEH 4HWBL 3L5WB 3IXAA 3MLRL 1J05A 5JHDD 5K33A 1HINH 4W6YB 1DBKL 3V52H 1U58A 3JVGA 5L9DL 1BEYH 3QEUB 1N26A 1A7NH 3HI5L 4MNQA 5GGRA 4YDLC 4ZO9A 1JUFA 1G7HB 5IQ7L 5I8OH 3NGBB 2FX7L 4IRSA 4KVNL 1PY4A 2CQVA 2GEEA 2XG4A 1NCCL 5GZOC 5EBWB 3DROB 4C56B 4GG8B 1A6UH 3P0YL 1FFOA 5ABDE 2IJ0C 5MHSE 5HGGS 4BJLA 1R5VA 1KJ3H 1RU9L 1I7TA 2HFGL 3UDWC 1UYWL 3HHRB 1P2CB 4I48A 4BZ1H 2XFXA 1LE9A 3MA9H 1DR9A 1YNLH 3SCMD 2NR6D 2LU3A 5J13B 5FHBL 4YO0A 2YUVA 1F4HA 5TE6L 4G8EA 4RMVA 1LD9B 5KSAC 1NL0H 2IAMA 5ISZA 3TBTB 4I0KA 1EH9A 4NQEE 5T1MB 1KB9J 1P6AB 3EGSA 2Z31C 1XCTA 4UOJA 5GRVL 1QRNE 4EI5C 4YQXH 4LPXA 4BUHA 4LCWD 5D70L 3FT4B 1S7RA 2GAZB 1LO0L 4FQHB 1NCUA 2D2OA 2CDFB 3F7VA 2EYRB 4RGMB 1A5FH 2H8PB 3FTGB 1R3LB 3VGBA 3WDIA 4HKXA 1NEUA 4JKLA 4NQCB 2OQJB 2QQLL 1S5HA 3BIKB 4LRNL 3WNMA 4Z7OF 1F58H 5E94B 4KHTL 5CBEA 2GITA 5IM7B 1G84A 3I85A 4Y1AD 4YZFF 1U8QA 4KMTH 5AZ2L 5D7SL 5GHWL 4U1NB 3PHOA 2V5RA 4JRWA 3VXOB 4PJGA 3MLTA 4V2CB 1E27A 2VABB 4XVTL 1LDPL 3EKCA 2FR4A 1XCQA 2NY6C 4RX4D 3ZDYF 4OM1L 1XGQA 3TJHC 4AEIL 4PJ7E 2OX5A 3HCVA 3OAYK 4G8IB 4Z78B 2H3NB 3IJSB 4JLRA 3TYGL 4CJ0A 5EIIA 1BM3L 1VESA 3OX8A 2IADB 3BQUB 3TH2T 1XIWB 4Y4HB 4F7CB 4YEFA 3E6FA 3KJ6H 5DEZA 3PWPE 2COQA 5LCVL 1QBAA 2M2DA 5B38A 1AKJD 1FLTX 1HOCB 3N9GH 5IEHB 3BPLC 1L7IL 4KY1H 3MV9B 1FYTD 3RVXC 4HS8L 4Z8FH 4N0YL 2BNUA 4QXTB 5IHLB 4NWUH 4U1KB 3OR7B 3HNTH 1FZJA 4OKDA 1P1ZA 4FNLL 1F8TL 3H9ZA 4JQXC 5LG1A 4KZDH 3RIAK 1WAAF 1WEJL 2NW3A 1EFXA 5FA3B 2X4OA 3MV8D 4N0UE 3VFUA 2GCYB 4FN0A 2UVEA 1JK8B 5CGYD 4O9HL 3CH8A 1J18A 3VI4E 1Q9WA 3WFCL 5EORH 5CD5C 2RCSH 5E8NB 5A16B 2XQBL 3F6IA 1IAIH 2LAGB 3QJFB 4QRSB 1H3WM 1KOAA 4ZS6C 3SDXF 4R3SA 5H94B 3DURB 3MO1B 1VB9A 2GSIA 2G9HB 2NCMA 1EO8H 1UACL 2G60L 1JZ7A 3FFCA 1IKNC 3VFRB 2EDWA 4MS8D 2EO1A 4B7IA 2CXGA 2D3VA 1GIGL 3HC3L 4AL8L 3IFNH 5LGHH 4CVXA 3LQAL 3VDCA 1A14H 4I4WA 4Z7UA 2E5EA 3O45A 4M6AA 3G6DL 5HHXH 4M3KB 5DD0L 3PDOA 5IBUG 4XPFL 3HE6A 5A2IH 2VR4A 4O2FA 5B8CB 4CMHB 1IT9L 1JI1A 3O11B 1ACYL 1JWSB 1IM3B 1Y6NR 4C57C 1AD0A 2FO4B 4TUKL 4PBVC 3GMRB 2DIBA 4O2EB 1R5IA 2LTQB 4M1CD 2DYPD 3RWDB 4PJIE 1A7BA 4WUUB 3MRIB 4XVUD 4DAGL 5BZDB 3KYNA 3DI2B 2V2XA 3DECA 5D6CA 1T1WB 3LDBB 4JY5H 4Y4KC 2XRAH 5JXAL 3GJFK 3NFSH 4R8WH 4BM7A 1C5DB 1KXVC 1MPAH 2R69L 1JYVA 4Z7NF 3MYZA 3TC9A 1WLHA 3BGFC 2JJSC 1N64L 5F44A 1N5YH 3MXWL 4O5LL 4IIQC 1C5BL 3E6HB 1U8HB 4XVSH 1R3JA 1GOGA 4N0RA 3BUYA 4KDTC 5LXGH 1CE6B 4G80B 1HHHA 4XRCA 1LHZA 2H32A 2MJWA 4RDQF 5E00B 3FQWB 3GMLA 4Y2DC 4HS6A 3WS3B 3A6CL 4N8CL 4PP2A 2CH8A 4EOWH 3X14A 4NO2A 2F5AH 2DAVA 4NDMB 4KWUA 5GRJH 3SDCA 1EGJL 3QUMH 1BD2E 3B43A 1EFQA 2BXZA 3QIWA 4GW1B 2R2BB 4J3SA 3B5HA 4L5FL 4A2MA 3OZ9L 4DKDC 1HZHL 3IKCB 2MNUA 1AGCA 4NKIH 15C8L 3B2UD 4I1NB 2DQFA 1HYSC 4HK3J 3LPGA 1G1CA 1MFEH 5DEFB 3X12B 4WUKH 3UTPE 2X4QA 3MYJA 2RHEA 4ZFOA 5IK3A 5HVHB 3D9AL 2V2TA 3F12A 1IM9D 3QIBB 2XZCH 3NCMA 2QR0A 4F57H 2BSRA 1A7QL 1OF2B 3LZFL 4KKBD 3MRQA 4JRYD 4P2RE 2X2YA 2EDTA 2ADJB 5D7JC 1N5AB 5MEOA 3ARBD 5IF0B 1H8NA 4J12A 3OAUH 1AGDB 2DI7A 2P5EE 2AV7A 3QULB 4J3XA 2V2WB 2WBJB 3M8OH 1T1XB 2H9GB 4NKDB 1MFBH 2CRZA 5IB5B 1VENA 4X4YB 3RAJH 1HKLH 4UT6H 4EDWL 2CLRA 2DD8L 1G7PB 2G5BB 4YHML 1BAFL 4ELME 3U4EB 4PV9B 35C8L 2IBGA 4HH9A 2VDPH 1KCLA 1ZVSA 2NY3B 5EZIL 1QEWB 5CJ5A 3TNNA 4HUNB 4A6YH 4GS7C 1V7NH 1TXKA 5KBNC 3G9AB 3PDDA 4AT6B 2HN7A 5FECB 4KQ4H 4LAQL 4NCDA 5FUCE 4F37K 1KJMA 1MRCH 5HYJB 2NXZB 1DVFA 1NGYB 4LBEB 1EEUA 4K23H 1WITA 3LIZH 1L9MA 1RUMH 4PJXB 5F6HJ 3BDXA 3KYMB 4YJZL 2CJUL 1W0VB 3U48A 3H9HB 3P0GB 2EEAA 4JO3H 1B4JH 4R2GC 1FP5A 3L5WA 3QCVL 1J8HB 1I7UB 1G9MC 3EJYC 5CSZB 4HFUH 1FC2D 4KPHH 4LK4A 1NSNL 1BBDL 1PZ5B 3QEUA 2VDKL 1CFNB 5T5NF 1K6QH 3CD4A 1JF1B 1X5LA 4PJBF 2GI7A 3AGVA 1FLRH 4NOFA 1G7HA 1UFUA 1B2WL 4XNUH 1U0QA 4DWHA 5GIRB 3ZT7A 4HUVB 4FXLA 5E1AB 3IU4H 2ADFH 5EBWA 5GJSL 3DROA 3BJLA 3K7UA 2HFFA 1Q9KB 4GG8A 4C56A 1AH1A 3UYPA 3IU3A 1KCRL 3JTTB 4I5BB 3AAZB 2DQJH 2PO6D 5I75B 5D72L 1KN2L 3MV7E 4NO0D 4BH8B 5IVXF 2GTWB 4LHUB 3ARSA 1MI5E 2BX5A 4OUUB 1GGBH 3WIIH 1RZFL 4HIJB 3UJJL 1YEEH 3SJVB 4H20L 3FHAA 2YR3A 4PJ5D 1MOEA 3QNXB 5JDSA 2DQTH 2MCPH 3RWHB 3TO4D 4OV5B 3O3BB 1E6OL 2OI9B 4ZOBA 3TBTA 2AJZB 5EO9B 1TZHB 5T1MA 5JW4M 2D7QA 4M43H 1HQ4B 3OQ3B 4L3EB 4R97B 1RHHB 2WIIB 3I9GH 3TT1H 5HBBA 3PHSA 3FT4A 5E0QA 3TN0D 2GAZA 1RPQA 4UOW0 4FQHA 4PJ9C 2CDFA 2N7AA 2EYRA 5F1SA 4GSDL 2QSCH 3FTGA 1R3LA 5ICXB 5GGSB 1T89C 4HXBL 3KJ4C 4NQCA 5DJAA 2OQJA 3FN9A 5CSGA 5KSBF 3BIKA 5I1GL 4M1DH 2NTFB 3GMQB 5E94A 1N6VA 3KPOB 5DS8A 4CU6A 4NN5C 2R4RH 1FPTH 2MHAB 4FQLL 5IM7A 1RIUH 1T2XA 4JFPB 1HDMB 4OLWL 2VLRB 4U1NA 3QDGB 2P7TB 4OI7A 3Q5OA 3SY0B 3VXOA 2HP4A 3UYOD 4GH7B 4BFBD 3HPLB 4LIQL 2VABA 5E08H 5DMGD 2E7BA 4OBRA 2R0WH 3CVIL 3JBG7 4ZMAT 4WENB 4G8IA 1F6FB 1MFAL 3RGVB 2H3NA 2KDGA 3IJSA 4Z78A 4FOMA 1LEGA 1CVSC 3FQRB 3SGKC 3ZE2F 1AQKH 1U8OB 2IADA 3BQUA 3P4LA 1XIWA 4Y4HA 5DFVD 4F7CA 5DR5L 1MLCB 3V0WL 1WWBX 2EDKA 5TF1H 2Y07H 1FV1B 1UWEH 1ZEAH 1NMAH 4IOSD 1HOCA 4WWKC 3MV9A 2EH7H 5FCSH 4JVUA 3HZYB 4QXTA 1CBVH 4U1KA 3OR7A 2X41A 2YK1L 5HHMB 1DJSA 3TPUB 2XWTA 1J0ZA 5IVNA 2ZPKL 4ZFGL 5FA3A 3QWRD 2Z92A 5BOPA 2GCYA 1UCTA 1JK8A 1EHAA 1J86A 5IEKB 3MBED 2NW2B 5E8NA 5A16A 1IZJA 2BVEA 4LARL 4RAHA 3QJFA 3T1FB 1T3FB 1P7HL 5H94A 4WV1A 3UPRB 1MRDH 3MO1A 4OLYL 2XZAH 4MXWH 1EO5A 4L1DA 1A7PH 3DBXB 2UUDH 3WLWD 4FQQB 4HUXB 3ZDZF 2KUTA 4D94A 4TVPH 1FH5L 3OAZK 4YXHL 4OI8A 4X4MA 5HHVH 5DWUL 5E2UL 3VXMB 4YX2H 3MLVL 3RZCC 1TQCC 1D5XA 5MERB 3JWNC 4KGLA 4H88H 2AK4D 4JQIH 1CGYA 1T7XA 5B8CA 2YUZA 4TUJB 1E4XH 3MCG1 3T2NH 3GSOA 5DURB 3V52L 3O11A 1BEYL 1JWSA 1IM3A 1X6NA 4QEGA 4K7PH 3IKKA 1RK0A 4F9PC 2ERJC 2FEDD 1YUHB 3CLFL 5FUOL 1CDGA 2FO4A 3VFGH 3BGAA 3GMRA 4O2EA 3VFSB 1A8JH 3RWDA 5I8OL 5EOCH 3QWOB 1UKSA 1S7VA 3MRIA 4PB0L 5BZDA 5L8LB 4KK8C 1VFOA 4OCSH 3WDHA 1T1WA 1JWMB 3SQBA 5HYQA 3HZMB 5DMIL 5I2IB 1C5DA 1GVIA 1MCRA 1DBAL 1KJ3L 4LFHG 1JRHI 2B8OT 4BZ1L 3I3BA 3FMGH 4F33B 1UWGL 4PRHD 3E6HA 1U8HA 3OG6B 4UAOB 3LQMA 1CF8L 3G6AB 3QNYB 1CE6A 2H2PD 3S36X 4KJQD 1QVOB 4NP4H 5E00A 3O6KH 3FQWA 3LRGA 4Z7UE 2OTUB 4PJ8B 1BQHB 1SVCP 3VCLB 3WS3A 2JCCF 3VWJC 4W81A 2F53B 1NCDH 3G6JA 4WU7B 2YSSB 2JJTA 4ZAKC 1W8NA 4B53A 1J5OH 2J5LC 1DN0A 5DD1H 2FB4L 4O02H 2NY1D 1D9KC 2FLRT 3IJYB 4PD4J 4GW1A 2BSED 5B3JF 2R2BA 2I26N 3AS0A 5FO7B 4NQDB 5T3ZL 2FDBP 4OLVL 3VXPA 3U6RB 2ORBL 4GJTB 1CCZA 2HKHH 3WHE0 4G6MH 5DEFA 3X12A 4NRZB 4XGZB 4YXLH 4YIQB 3QIBA 3SGEI 1OF2A 2ZZUT 3WNPA 4LCCA 2ADJA 2V9QA 1N5AA 1ZA6B 3CX2A 5A2FA 5IF0A 1AGDA 3QULA 2V2WA 3FCTB 3FKUS 2WBJA 1T1XA 2H9GA 4LSTH 4NKDA 5IB5A 5JXED 1LQSR 2WUCH 4LSRH 5C09D 1T4KB 1S9YB 4KI5F 1KUMA 3VXSE 1G7PA 1KLFA 1TCMA 4PV9A 4WO4D 2HMID 1RUQL 2MQ0A 1KLGB 4XMPH 3KJ6L 2ICWJ 1QEWA 4UINH 3DX7B 1XGTB 4JFXB 3WMSA 2X42A 4QF1B 4Y4FC 2LU4A 3K4DA 4NJAL 4WI6A 4NM4H 4AT6A 1RFDH 5FECA 1PAMA 5GGTA 2QSTA 5CEZE 1XR8B 2R39A 3HNTL 5HYJA 4HIXH 4XX1G 3VRLE 5I6XC 3QUZB 2VSDA 3A67L 3VWKC 4ENEC 2X44D 3ARDB 4KZDL 4PJXA 4WEBL 1BLNB 2HTKC 4MXQD 4JRXD 4D9RD 3GKWL 3KYMA 3L95B 2I9LB 4NCC2 2VDLH 3RKDD 1W0VA 5IFHH 4PJ7F 1KJ2H 4ZTOL 2VKXA 2WWMC 2C7UB 1F02I 4W68A 4XB7A 1J8HA 5JOEA 5CSZA 1QSFD 5I17B 5L8JB 1NCWL 3KLHC 1HWGB 4XBEH 3EOAB 1PZ5A 3QPQC 1CFNA 1E0OB 3H3PL 1JF1A 1K8IB 4OFYD 1EO8L 4FQXC 2GTZB 3W39A 4NBZB 3CZJA 4BQ8A 3BAEH 4KXZH 1DUYB 4WFFE 1ED3B 3LQZB 4ZYKB 3ULVH 5GIRA 4MB3A 2W91A 3QG7H 3IFNL 4K2UL 1OWRM 1U91B 5E1AA 1S7QB 3EW3B 4ZO8A 4NM8H 4XPTL 1M05B 4YLQT 4PJCA 1Q9KA 1EUTA 3JTTA 3HI6H 3AAZA 4I5BA 4LLQB 4PLKC 4BH8A 3ZDXE 2GTWA 4LHUA 4OUUA 4HIJA 4UNTA 3SJVA 1CIDA 4ZXBC 3VI4F 5E99H 2EDBA 3STLB 1A4JB 3RWHA 3O3BA 2NYYC 5EO9A 2AGJL 1TZHA 2GYSA 4N68A 2D7TH 5F8QC 1JHTB 3BWAB 4CDGC 1HQ4A 3GMNB 4L3EA 5DVMA 1RHHA 2WIIA 4P4KB 1P5VA 3D0LB 3QO0B 3LKSB 3CSPA 1MPAL 1N7MH 1HQRB 1Y6KR 1DQML 4OIIL 5ICXA 4YWGH 1N5YL 5GGSA 1KIQA 3L6FB 4WW2C 3TA3B 2X89D 3AREB 1TCRB 4XVSL 1NUDA 4CU7A 4LKCB 4TOYH 5HPMB 1D3CA 4Z77B 2NTFA 3GMQA 1RV6X 3KPOA 3W2DH 2MHAA 3BXNB 4C56E 3D85B 1HDMA 4CADB 4R7NB 2M1KA 2VLRA 3K1DA 1A3QA 3QCUL 3UBXG 5FM4A 3QDGA 2P7TA 4CRPA 5E95B 4EOWL 1T04B 3SY0A 4YHOL 1U2HA 2PXYB 1BJMA 3HPLA 4JFFA 5DK3A 5DD6B 1OD7A 5GRJL 4GRLB 5CKAA 3QUML 4DCQB 1MHEB 5CAYB 5DC0A 1PG7L 3UTTB 4EEEA 4V1DE 3RVWC 3QEGH 5HYSB 1TJHH 3NACL 3O2DL 1UWXK 3NA4A 3D18B 4NKIL 3KNBB 1U8OA 2WMPA 2EXYC 4FXGB 2FRGP 4ZO6A 4WUKL 4TUOB 2HVKB 2Y23A 3W5MA 1MLCA 4G6FD 4XB8A 1F11B 1J8KA 1FV1A 1J88A 3VD4A 5GSRB 4KI5D 4H25B 2XPGB 1DDHB 3HZYA 5FV1L 4RCAA 3ILQC 3SDAC 3OAUL 4GW4B 3O4LD 1GZPB 3C09C 1FIGL 4FP8H 3TPUA 3U30C 4PG2C 5BS0E 4GLRI 5TDNB 4W6WB 3KLAA 2YD5A 1B3JA 1M1SA 1MFCL 1OT2A 5JZ7D 3B3IB 3CGTA 3VH8B 5IEKA 2P5WB 3MV11 4MB5A 2EIEA 4Z7WB 2NW2A 1NCBH 3GRWL 5DHVB 4A6YL 4YPGB 2P49B 4HLJA 4Z95L 3T1FA 5C0RH 5I1LB 1T3FA 3THML 3WJJA 1WIOA 3UPRA 2BXYA 1AC6A 3P4OB 1MRCL 5EUOF 4K3EL 4YDLB 3DBXA 3LN5A 4FQQA 4HUXA 3ZMRA 2BMKB 4XCNB 1CTOA 5DA4A 4IOIB 4M03A 4XWGH 3IB4A 3VXMA 1J1OH 4QWWD 5I8EB 1DL7H 5MERA 2VXQL 3RA7L 4LSUH 2E7HA 4NNYB 1JJUA 3MFGB 4TUJA 3W9DB 4HFUL 4KPHL 1DTUA 4CJ1A 1Q72H 4KQ3L 4ELMF 3MV9E 5IROA 2Y5TB 1T80A 2JLLA 1AR1C 1YUHA 2AV1B 3DGCR 2R1YB 4N1HB 5FGSA 4TQEH 1FLRL 3VRIB 4S2SA 4XNUL 1BECA 3QWOA 4HWBA 4XZUB 1JP5A 3U9PL 1CI5A 4IDLA 5IVOA 2IF7A 2FSEB 1PY9A 2ZJSH 5KSAB 2YXFA 5DVKA 1FNGA 4XC1L 4NT6B 1JWMA 2Z31B 1L0YA 4EI5B 4XP4L 4P57B 3HZMA 5I