1RK0B

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rk0B00
4HEME 4ZAKA 1YN6B 4XX1G 3V7AG 1KELH 1VA9A 2J6EH 4P5TA 3RHWF 4JFOB 3HRPA 4QY8A 3TWCL 4OUUB 4P2YA 2Q6WB 2CIIB 5SX4H 3C8DA 1ZVSB 4AY0A 1EFXA 2HAZA 3T0VA 1AXTL 3QRGL 1Z3GH 1S5IL 1JGDB 5E2WH 4OLWH 2V7NB 1CFTB 5EBMB 2ZPKL 3ULUL 3BRGC 3EZJB 5EOQL 4X6CF 2YPVH 1XCQA 5KSAC 1J8HE 2QL1A 4GAJL 1M7XA 3OJDB 3O0RH 4FQIL 2YMXH 2VDOH 1ACYL 1OOAA 2FEEI 1UM5H 3LPFA 4EN3A 5FGBC 1UWXK 3WS6A 4LU5L 3CH8A 2HFEA 1M7IA 3PWNB 5IVXF 3GK8H 5C0RH 3QULB 3WIFB 5JORB 4M3JA 4YPJA 1CFVL 2DTSA 5HI3D 2BHYA 1QR1B 2YWZA 5I9QC 5E9DB 2ZSWB 5DWUL 3BEVA 1UFUA 4ERSL 4TNWF 3RWCA 5CEXA 4Q9QL 3CXDL 3BRDA 2NY4B 4LMQE 5F97E 4KKCD 5D7LE 2JJTA 1C5DB 3TZVC 1WFNA 5J8OA 5EORH 2NNAA 2XKUA 3KXFD 1X9QA 1EZVX 2NY7H 3VCLB 3KPNA 5CJXA 4XP6L 1ZA3B 1N2RA 1CFTA 5D7KD 1YNLH 3MRFA 1WFOA 4HJJH 2X6MA 1Q72H 3MRPB 2IFGA 3HI6L 5JW4Q 3VFPA 4M6ML 5HGDB 2CKNA 4RGND 4JG1H 5FYKD 1KCKA 3TPUA 4M5YL 3WFHA 4FS0A 1CZ8H 1IGIL 1X7QB 3K8KA 4RFNB 1JMXA 25C8L 3GDBA 5ENWB 3K0WA 2IC2A 1BFTA 2OLDA 4WUUE 2UVEA 1AGDB 2YC1A 4HJGB 2FIRT 1ZLUK 4YQXL 5IW1B 1TZHB 3L6FA 3QRGH 4NKDA 1OM3H 1AO7A 3RAJH 1YN7A 4L8BA 4UINH 3BRFA 5CGMA 2WLZA 4Z0XB 1JMZA 5HI4C 5IB2A 2D31B 3ZLQC 2F58L 4N8VB 4GRMB 1NANI 2E8ZA 1J86A 1IKFL 4IDJH 1BD2D 2H2SC 4BSVB 2R0KL 4F7CB 5CMAA 3HUJF 3GSOA 3CFJA 5K33A 4DCQA 4Y1AD 2VIRA 5ESQA 5EN2A 4F8QA 4LCYA 3BUTA 1QBMH 1TJHL 3DX7A 4Y5VC 4YO0A 3IKKA 3VFVA 2R23B 1A8JH 5D4QA 1A4JA 5EO0A 1I8MB 4XPFL 3O3EB 2DS4A 4HWZB 3VWJB 5HGHA 4ISVA 2W9DH 2GFBB 1K4CB 1T0MA 4PY8I 2NY6D 3GSNL 4ELKA 2QBWA 4N8CL 4P4KA 4XPGL 3MV7E 2XACC 2YRPA 1KCRL 4KI1A 2EIZA 3RVWC 2JELH 1MLBB 5GGTA 2QEJA 1CLZL 1OGAA 1J1XH 4AL8H 5I1LB 4PJXB 1TIUA 4LLMA 3TJHD 1R5VB 2NTFA 5B8CC 5JA9A 1AJ7L 4X9BA 5CJQH 5EZIL 1I3VA 5TE6H 4U1KB 3P30L 2OK0H 5DJYA 3JWDH 3X13A 1BFOA 2ZSWA 5AZEH 3MLSL 1RFDL 5T3XH 4A2MA 3THML 5TFSH 1LO5B 4QRRD 5CHNA 1NCCL 1U92A 4P2QD 1VDGA 2LFGA 3GMOA 4NUJA 4YEFA 2MFNA 5E6IA 4RBPK 3C60D 5JTWA 5KN5A 1UXWB 2BSRB 3QG6B 1MCEA 2XWTB 3LIZL 3W5MA 3CLFH 2CXGA 4ODSL 4GW5B 3FQXA 2EDFA 4XPGH 1F90H 3OF6D 2HVKB 4RAVA 2V2WB 3O4LD 3I3BA 2BJMH 2XPGA 1AQDA 5L2KB 1IQDB 3O4OC 4AENA 3KPSE 4EBQH 4NCDA 5EU7E 1B0RA 4LIQH 4ONHA 2P4AB 3FO1B 1T7ZA 4TUKL 2R29H 4XNYL 4R4FL 3IDGA 5LKNA 4GRLB 2VDNL 4G9FE 2GJJA 4G6FD 3ARBD 4FQ1L 4U1GB 3EOTL 4XVJL 5C7XH 1IAIM 1J9CT 4XRCA 4WNQA 1KGCD 3ARBA 1P6AB 4OBSA 4LCUA 2BRRL 4PBWD 3T0EE 1ZT1B 4B50A 1MCHA 3PIQB 4PJBA 1WBZB 4FFYL 5C08A 3KJ6H 3JV0A 2BCKA 4S2SB 4KHXL 3TBYA 1P4BL 4S0TD 2A1WL 1DSFL 2Y5TA 2Z91A 5KVEH 3HFML 1QPPA 4LDOB 1VENA 5D1ZC 1HHHA 1T4KA 2LAAA 1KEML 3VFTB 4XP6H 2DJ4A 1TQBC 3O8XB 3WL9A 3TN0D 4U05A 4PV9A 3IDJB 4NO5B 8FABA 4PLKC 3DI2B 4YAQB 5CP3H 1XGUB 3HS0A 3IFNL 5IV2A 3M07A 4OT1H 4QHNA 5K9OA 1S5HA 1R24B 3IJSA 4PB0L 4JPKH 5J6HB 4OV5A 3CFKB 5E08H 1KIRB 1MJ8H 5DYOA 4YXLH 4X4XB 3CUPB 3KXFE 1KC5H 5CD3B 4ZMAT 4JPWH 1GRWA 3P0YH 4Y4FA 5KTEL 4HIIB 1LE9B 4P57B 1EJ6A 1G7PB 2ZKHH 1K5NB 5T33H 5F88B 1P4IH 2X4RB 3SCMC 4G6JL 5E8PB 1NGPL 3TYGH 4H20H 3K3QA 1E4KC 3U83A 1NCDL 1B90A 4G6AD 1FFPA 3WHE1 3VD9A 1HQ4A 4X80L 4PRDB 4U6XA 3UC0L 4Y4KD 5INCB 4K94H 2BJML 3ARDC 5DVNA 4IBLT 2HTKC 3SKOB 3OPZL 1ETZB 3DMMC 4XP1H 4CN1A 2XWBB 3U4BH 3PDOA 5F7KC 3V8OA 2JJVA 3W2DH 1SBBA 4UTBL 4ZSOE 4QNPE 4LNRB 4HQQH 2EH7L 3KPPA 2Q8AH 2BX5A 1ORSA 5EZJA 4IS6B 1OF2B 1NCAH 1AQDB 5SWSE 3UDWC 2B2XL 2HT4C 3G5YA 3QXVA 3OR7A 4GRWE 3SKMB 1FYTD 3O3EA 4OLYL 2HTKD 3X17A 5IESH 3QUKB 4PJDB 3TT1H 3HAEH 4KRMB 1SQ2N 2VZ3A 3BN9C 3RTQA 4PJXA 3I6KA 4LSUH 2Q87A 4LCYB 2CLZA 2BRRH 5FUCC 3OZ9H 4FFVD 1NQBA 3QFDB 1NBZA 4X5WA 3WMSA 3ARWA 1QVOB 1A0QL 3P30H 4M48L 3TZVA 4JM4H 4MA8H 3SCMD 1J0IA 2XN9A 1MFCH 2R4SH 5C0CD 1PY9A 4ONOA 2DQUL 4O2EB 3SDXA 2DICA 3D9AL 3PP3H 1HE7A 5L8JB 2UVFA 1WZMA 2IFFH 1EERB 3DO7B 1KLUB 2F53B 1OARL 2I24N 5IG7A 3HN3A 3CK0H 1OGAB 1RZJH 5T5FH 3GGWB 1KPVA 2XTJC 1HHKB 4NBZB 4GAYB 4CL7A 4PGJA 2GJ6A 4LP5A 5C0DB 5GS2H 2LU4A 4YUEL 5GRVL 4TOYH 4TVPL 3KYAA 2AVGA 4C4KT 2CUHA 4JO3H 1NGZA 5CIPB 2GI7A 3NGBB 2NW2B 3FB6B 3D3VA 4OFYA 5I1EL 2RIKA 1XR9B 3KDMA 3TJEH 1YEKL 2H2PD 5D7IF 4RAVB 3QUMA 1S7UB 1LNUB 2B4CC 3OJVC 2WBJD 1MNUL 5LVEA 3HR5A 5DMIL 4Q9RL 3EUUA 1LO2L 2F54A 4M62L 4Z7UA 1UXWA 4NWUH 4MDJB 2I9TB 1BFVL 3K8MA 2Q8BL 3C8KA 1C7TA 1G0DA 3MRLA 1N6QL 2GHWB 5E8OB 3WJLA 1VGKB 4XXDA 5C0BE 2A73B 3MLTB 4K23H 3QQ9C 2NY0C 3WXVL 3FMGH 2R23A 1QFWI 2W0LA 4JRXA 1GGCH 4PJIF 4KY1L 1P7QB 5EU6A 1XGTB 3G6AB 1M71A 4FXLA 5C0AA 4Y88A 1CD1A 4MQSB 1KPUB 3BO8B 4TPRH 4U1KA 4YHYB 4TUJB 2UZIH 4R26H 3FQUA 4JG1L 3TGXA 3JTTA 1DVFB 1CXIA 1I3GH 2XT1B 3BDXA 1R3HA 3VXPB 5DRXA 4PJ5E 4WW2B 2VXSH 3E6HA 1YY8B 4LPVA 4LSRL 3D25B 1KTDA 3MA9H 4K7FB 5DJ8B 4HFWB 1XR8A 12E8L 1MFBL 4I2XA 2RAMA 1K85A 1A5FH 4MJIE 4OLUL 3SDCA 1BBDL 5K9JL 5E2UH 3ILQD 1C5CL 3HUJB 3AROA 4OUOA 2ZUTA 4C59B 2BSTA 5DUPH 3IDUA 3RZCD 4HUNB 3F65A 1GVIA 4ODTL 1X6LA 4BK5A 2C7UA 2RFXB 5CWSB 3HAEG 2ITDA 5DFVC 1RUQH 3F7VB 3MRRA 2P5WA 4PJ7A 4W4OA 3MUHL 4D0CA 2LVCA 4F3FB 4QHKJ 3VWKA 5F72S 4HW6A 4GRWB 1I1AD 3DV6A 4RQQA 1JPTH 1PGRB 4C55A 4X5LA 1KEGH 5I1GH 1RZKL 1XGTA 4F7TB 4HMCA 1T04B 3ARFA 4RDQG 1I8LC 2DN7A 1OL0A 4WO4B 1GGIH 1EGJL 2DJSA 3AVEA 3FN0H 4F9LC 1MCRA 2A74B 2J8UB 1T2JA 4AK1A 3QDME 4NQVB 1JGEB 4ZOCA 1Y18A 4XB8A 4CDHA 4DUVA 3GJEB 4PS4H 3RVVC 4JRXD 1GAFL 2IPUG 2FSEA 4ODVL 5AD0A 5I76B 4TN9A 1TVBA 3ES6A 4YHLL 4JQXC 4I2XB 4XI5C 3KS0H 3I84A 3ZL4L 3KWWA 1JZ7A 2EC9T 1CIUA 2XQYG 5TDPA 4ZNEE 4A6YL 4RAUB 3EO0B 1GOFA 4CAGA 5CP7A 1Q9OA 3DVIA 1TTGA 5BVJB 3PHOA 1JNLH 3V5KA 2MQ0A 1IGMH 5GS1A 2HLFC 4UBDC 1DQLL 5T3XE 5HI4D 1CFQB 2XWJA 4JLRB 5ETUB 3CDFA 2VLRD 1EAJA 2JLLA 1FE8H 1CYGA 3UTSD 3TT3L 2OTWA 2Q3AA 5E6ID 1UZ6E 1V7NH 2C1OB 5KANG 3MUZ1 2X70B 4K8RC 1A3LL 4PRHB 3FZUD 4U0QB 4WFFD 3EYOB 4MCYB 2W65A 1ROWA 4G9DB 3HE7A 3OKLB 4Z0XA 2R29L 4JDVA 5T33L 1P2CB 3VRJB 3H42H 1MWAB 3SDYH 3NA9H 4PB9H 5EWIH 2EDLA 1X4YA 3IF1B 2EEAA 3V0WH 3JTTB 1NC4B 3KNBA 1PX4A 1IM3A 4PJ7F 1JHKH 2V7NA 2CUIA 2J88H 5HHNB 1X5IA 3D25A 5C1MB 4F7EA 2F53A 3AU1A 3B6SA 3FB5B 4X6DB 4L4TE 5FA3A 4GO6B 1WIUA 2FX8L 5ANMB 6FABL 4GQ9H 1CXHA 1WZ1L 4R7NA 4HF5H 2APBA 2YKLL 5GS1B 4GW4A 2HJLA 1OY3B 4HFUH 1G6RH 1I85A 5DMJB 2ZSVA 2C26A 2WIIA 2X1WL 5FKAA 4U2ZA 4Q7DA 3GZKA 3RPIA 3M1BB 4JFPA 3RZCB 3RZWA 4HCRH 1AFVL 3QWOA 4LLVB 4ZSOB 1X5AA 1D5XA 3UO1H 1DJSA 1IBGH 5LAXA 3NACH 3BVNA 4WWKA 2BVPA 5C6TH 5E2VL 5FYJU 2IANA 3O9WB 3D6GA 3D69B 3JUZA 3SDYL 1MREL 4LVOB 1CWVA 4NO2B 2F54B 3H9ZA 5JIIA 4XCCL 3QP3A 5I75B 3MXWH 4MD5A 3SE8L 5I1AB 5GGTL 3TO4B 4F7MB 4UZGA 2AQ3A 4M8QB 3MREB 1E27A 3DETD 3CC5B 2X4SA 1QRND 5CEZE 1N4XL 4RZCB 1BEYL 4WUUA 3RY6A 4OCSL 5J1TC 1WCBB 4KJPC 3PV6B 4PJ7E 3HC0B 4UQ3B 1EZVY 1FORL 2J1KA 1M7DA 3SDXB 3I6LD 4FQ2L 2HN7A 1WFUA 3TF7C 4K7PY 1ULVA 4L5FH 5DURB 5F9AC 3OL2A 4MJ5B 1XEDA 1YYLL 5I1IH 4JCMA 2AJ3A 3RP1A 3VH8A 1KB5L 4IMKA 5GGVY 5F44A 1MQKH 1KTDB 4XCYA 2AEIT 1HILB 3B9EA 2L4OA 2APTA 3WE6A 2HT3C 1LP9B 2Q76A 4R90H 3K81A 3HG1B 1MFDH 1JGUL 3MRRB 4X7SL 2ORBH 3O6LL 4Z0BL 4KKAC 4YHKL 3PWUA 3JSSA 4HIJB 4JAMA 3GRWL 4YDLC 5KBNC 1JUFA 3CVIH 4MA3B 1B0GB 4UT6L 4IOFD 3SOBL 4JN1H 4GW1B 4Y19B 3NA4A 1F02I 3P77A 4FQHA 3QUMB 3GMPA 1YC8A 4Y1AA 2WUBH 5SWZB 3FTGB 4HFWA 3FQTA 2OP4H 3NOIA 3WO3B 3QDJD 3P4MB 1G9MC 4LSUL 3PWPA 4P23B 4KZEH 3WXWL 2IMMA 5F96L 3CFEB 4FRWA 3NCEB 4UU9A 3B9KC 4PRPD 3WSQL 3ZHDA 4YC2C 3WHXB 4HEPG 2EKSA 1NGYB 4HUUA 3PWPD 4LSTL 2FEDC 1NSNL 3OV6A 4MAYB 3MLUH 4WJ5A 1T3FA 1BJMA 4QLRA 5T3XD 4D9LL 4JFEB 5FUOL 1WCQA 3IU4H 2VLLA 1S5HB 4DGVL 1H8NA 4N8VG 1NCNA 1HXYB 2FGZA 5D72H 5L7XH 1KNOA 4Z76B 4RFOL 2CDEB 1MCCA 1U8IB 3FT4A 1S7WA 1CBVL 3IDMB 3CDGB 4WI9A 3VRIA 1T21A 1G7PA 2PTUA 2VDQH 4X6DE 1J0HA 4PJFF 2QSCL 4KJYB 2AV1A 2XIDA 2DQIL 4XCNA 1UM4L 4FZ8L 5HXMA 1JYWA 2CK0H 4L8SC 4KI5C 4QHMB 3B9VA 4YNYA 2CUMA 3MACL 2DQFB 5D2LA 3O2WH 3TA3B 1RUQL 1R3JA 3MLYH 1P9MC 2YUXA 3TN0B 2V2WA 3LVEA 5DUML 3HKFA 3KPLB 4GAJH 1MNUH 4OCRL 4JHZA 2O61B 1BWMA 4D9QD 3QNZA 3H2WA 4XWOC 1SEBB 2VDRH 2ZUWA 2OL3H 3E6FA 4ZXBD 1I8IA 2R2HB 4KDTA 5B4MD 2VZ1A 3G5VA 1L9NA 4NUGH 5DZLA 1WCBA 4MHHI 4MAUL 5DC4B 1DBKH 4PRNB 2Z31C 1NBYA 4F33A 4O02L 5CLWA 1G7JA 4DZ8A 4PJGA 1WICA 4U7MA 4S1RL 3REWA 3SKMA 3O6KL 2GKIA 5HY9A 5F9WB 1SJVA 2HT2D 5DI8B 3V5DB 2IADA 5CJ8A 4M7KH 3C60A 5IGXH 4HIJA 4JAMB 3LN5A 1XGRB 1Q0YH 2YD1A 5HYJB 3W9EA 1P53A 2R2BA 4TQEL 3L3HB 3ARTA 4H88H 3HG1A 1UCTA 2NXYD 4U1LB 4CMHC 2YD3A 1W8NA 3S3JA 5CHNB 3DUSA 4Y5YB 3AREB 4JFDA 2AI0L 1TZIB 4M6NH 4Q97A 2IMNA 5EULV 3RA7L 4OIAA 1CFQA 4MD5B 1RHFA 2PW1A 4N68A 4KZDH 4MDIB 2AP2A 3ALWA 4GBXB 3HZKB 4OFIA 5F9OL 1G1YA 5CGYC 2UWEE 3PWPB 4P23A 5C70A 5KN5B 3AY4C 3CPLA 4QHKI 4GUPA 4EI5A 2WM0A 2XPGB 5IT2L 4XGZB 3IFOB 5L2KA 3CSGA 2VDLL 4TUOA 3U0TB 5JLZA 2BNRA 4PGZA 4IRSB 5EOCL 1CDUA 5DVLA 3CC5A 1JN6A 5HHXL 1D7FA 4Z5RB 3BUYB 4PY8J 2X7LA 1A1OA 1EEQA 3MR9A 4RNRA 1P4LB 1M6OB 2A9NL 4O2CB 4Y16A 5INDB 3VFGL 2YXFA 1DQDH 4N0FA 1NGXA 2HA1A 4ZFGH 5J11C 3QEGH 4PTUA 4EI6A 5A1AA 5F7FA 1KB5H 3RDTB 1UA6L 2CDEA 4AQ1B 2P5ED 2AXGA 1HILA 4J3WA 1D5BB 1FAKT 3L7FA 5HHME 3HCVB 3L3OB 5TDNA 3T65A 3MREA 4X0KB 1JK8B 4LVNC 1KXQE 2OZ4L 4XH2B 2NY5C 4JQVA 2V7HA 1R3IL 2CMRH 2XTJE 2XTLA 1IM3B 4H25A 2Z91B 3LN4B 4MD0B 1IQWL 3FMGL 3RWHA 4R7DA 4L3AA 3SQOH 4Y4FC 3IDIA 1R3KB 2AJYL 1VGEH 4PRPB 1AGEB 1NCWH 1XF5B 5I18L 1HYSC 3I3DA 4F37F 5KS9F 2YN3A 4FA8A 1OAZL 3AXLA 5DD6A 3DNKA 3Q6FA 5IVNA 4HWNA 2G60L 3G04A 1DUYB 1CLZH 4Y1AB 4HS6A 3FKUS 4AMKH 3LRHA 4ENEC 1NC2D 1RULH 2EEDA 2OZ4A 5C0IB 4JHWL 5ICYA 3ARQA 3FB7B 3ZSSA 5FCUL 1U8NA 1JNLL 3HNVH 2HWZL 4DW2H 2HH0L 2VQUA 2WWMD 1UA6H 4LLWB 3AC0A 3MJ9A 3VGGA 3V5KB 5DUBA 3ZTJG 3OXSA 4LNVA 5D72L 1DANT 5GRVK 3VXUD 1NUGA 3KPSA 4XBEH 5IR1B 5CEZD 3RWFB 4G5ZH 5SWZA 3QO0B 4MXQD 2Z93A 1JI2A 3ZKSD 4BH8A 1JPSH 3EOBB 3IVKA 4ZS6D 3EOYG 1S3KL 3DXAB 4HPYH 2XQBL 4OM0H 4MNQD 1WEJH 3VJ6B 2C3HA 3F7YB 2I26N 3MRMB 3ZT6A 4M1DH 2QKIB 4KV5F 3QAZB 5GGSY 1JYVA 3KPOA 5EWIL 5A16B 2JCCB 1NDGB 4WY7H 3VFVB 5CJ5A 4MNHA 3UTPD 3A67L 1II4E 1L9MA 2X9XA 1CFVH 2H8PA 2YK1L 5IBLD 4G6JH 3C2AH 1P5UA 4I13B 2IH1A 3LS4L 3TPKA 2V9TA 4P4KB 2EXYD 4R4FH 4JN1L 4Y4HA 3MTRA 5MENB 1RJYB 4X83A 1OT1A 5TF0A 4HKZB 4CBPA 2ZUVA 2PYFA 4JQIL 1U3HD 1RZFH 5EZOL 4ZUVB 5INDA 4IOIB 4UV4L 1LHZA 1ZTXH 4KUZH 4XXCA 4YBLC 4KJWC 2CMRL 1WIOA 3B5TA 5C09E 2X7LB 4NBXB 5L2JB 4E42A 2A6IB 1HHIB 2VLKB 3U9UA 2F8XC 1OTUD 1YQVL 3GKWH 4OLEA 4D9QE 35C8L 3MV7A 4UUJA 3VXUE 3AS3A 4KDTC 1KCLA 5DZNA 1BEYH 5FM4A 1Y6KR 4EZMA 4L8BB 1FORH 2YOCA 1N59B 4LVEA 5TE7H 3C5ZB 4JGMA 4HJ0C 4YPGA 4QYOA 3OAYH 1CE1H 2DMBA 1BOYA 3E2HC 3RY6C 2Z8WC 2P7TA 4JKPH 2IH3B 3HC3L 1KPVB 1TPXB 3P73B 1PLGL 1ONQA 1XIWA 1FYTE 4RIRB 1AXIB 1JHTA 1ITBB 5DFWH 15C8H 3LEVH 1F4XL 4EN3B 2HLAA 4TSCH 3RL1B 2QQLH 1LGVA 4CADB 4HKZA 3SKNB 2VDOL 4JFEE 1WBYB 2DWEA 5DMKA 2VE6B 4Z8FH 4YX2L 3ARUA 3MGTA 4OIIH 1B2WL 2AW2A 3QDGE 5GRUL 3SDAC 2F74A 1U3HB 3G5YB 3QEUA 3N85L 3S35X 4TULH 4Y7MA 4MQXD 35C8H 1LNUA 4KQ3L 1KCUL 5F6IC 1VFBA 1SYVA 3ARYA 2GK0A 3WIHL 2ERJB 3RX7A 3HRZB 4WFGE 2DBLL 1IAII 3NFNA 1MVFA 5EBWA 4N0UB 1BIIB 3EHBD 3GIVA 3GSUA 2AKRA 3P0GB 3L5JA 4OQTL 1LO4L 5FM5M 4MA8L 1DUZB 2DQJL 2E9JA 1C16B 3L3GB 4HCRA 3BSZH 1EUUA 2X5PA 5T1LD 1T0PB 5JDJA 2Y36H 2FZ3A 3TWCH 3SY0B 1U8OA 1Y0LB 2X4NB 5CSGA 4ALAH 4CVXA 4LSQL 3LKQB 3O2DA 1XGRA 3EYUH 5D7LA 3S5LG 3ZZ1A 4XZUB 3UJTH 1BREA 4Z7VA 1LE5B 3HE6C 25C8H 4AM0B 2HRLA 2AK4D 4B7LA 1FO0L 2ILLA 2MPAL 4DZBB 4PJGB 1DQQB 1FPTH 1KTLA 5BV7H 1MY7A 1N0LA 1U9KA 5E8EA 1XF4A 4HKJB 1QEWA 1S9VB 2IPTH 4ZO8A 1PDKA 4HWUA 3TJEL 3HTLX 2NY1D 4BFGA 1P7QD 3PGFH 5I1JL 2IQ9H 1Z0NA 5T1MA 4QOKA 2R2BB 4HAFA 2AGJL 4JFZH 3HC3H 4J7RA 4O2EA 4OF5A 5IVXB 2UUDK 4OCNC 3AS0A 2NY5L 3FFCE 5FECA 1KJMA 2R0LL 5EC2A 4PUBH 5INCA 2DLHA 3BH8A 3EOAA 4C83A 3HMWL 5DK0B 5SX5K 1ADQL 1BZ7B 5E5MA 4ZFOL 5M94B 4PJCF 3CK0L 5D96B 2ADGA 2BNUA 3O2WL 3OKEA 1UB6A 1IVLA 1YMHA 5MEPA 3GMNB 2Q6WA 5IJVA 1DBAH 1I1AC 5ESVA 1DBBL 3TH4T 4OJFL 4JDZA 2ICES 4H1LA 3RGVA 4ZFZA 4KKLC 5DFVD 4DK6A 1S7RA 4I3GA 3QYCA 4XC3L 3NIDF 1S7SA 2GSIB 1LILA 1D5MB 3QUKA 3H3PL 3U2SB 5DRXB 1AIFB 2WZPD 2X4UA 2YMXL 4J3SA 3C8KB 1S7QA 3KLAB 1Q9LA 3RUGB 1QKZL 4M00A 4HH9A 3IT8D 4P46B 4MMXC 2HG5B 4NWTH 5J0BA 2H1PH 3UBXB 5JA8B 1H3GA 3LPWA 5JNYA 1VEPA 4I0PA 1J87A 1UJTA 4JZJB 2DLGA 1UM6H 4Z76A 2ADGB 3ECBB 4N0YH 5F7WC 4R96B 5IHLB 3IGAB 3SPVB 1O0VA 1R5WA 2PR4H 4XTRC 1BWWA 5LGKA 3RY4A 2VXUL 2QSTA 3X12B 2VOTA 5GHWL 2OR7A 3ZYIA 5DEGA 4CW1B 4NSKA 3DWTA 2FWOA 4HDIA 5IROA 4AIXA 5FB8A 3GJFB 3CAFA 3O4LA 5C08B 3C6LB 3QDJA 1A1MB 3OF6A 5DK2B 2DM7A 2W9LA 5IBTL 4EI5B 4IRZL 4M5ZL 3D3VB 5J1SC 5KOMC 1WGOA 5DK3A 5I30L 5JQ6L 4Y5XA 1YEHL 3SO3C 5HPMB 2R1XA 5K59F 1KN4L 4M7ZB 4WFGD 1MFAH 5AYQA 3PGDB 2B1AH 3F7QA 4K8RL 1XF2B 4R0LC 4XCEA 5K9OB 4P3CH 1H3VA 2AJYH 4Z7UE 2ARJB 4NQED 5GISH 2DIJA 1IEAA 2RJMA 4KHTH 3BQUA 4L4VD 5D71L 3KHOA 3J7HA 5MEOA 4ZD3L 3VFTA 3D18B 3FFDB 1NKOA 1PZUB 1NLBL 1G6RB 1RFDH 3BH8B 5DI8A 3BHBB 4G8IB 4LF3A 2JJSA 1AD9B 2DWEB 3RKPA 5GSRA 5I8OL 2Q7NA 3IU3A 2MJWA 3RJQB 3HI5H 2BOBA 4XBPB 2GJ6E 1MCFA 1SVZA 3R8QA 4NQEA 4KTDH 2VL5A 4JPVL 2D3VA 3EJYC 4GMSL 4L3CA 4UQ2A 1OM3L 4QHUB 4AENB 2CK0L 2X4RA 4HXBL 2C1PB 1S7RB 2WMPA 1UXSA 4HPYL 3QI9D 1LK2B 4N8CH 1ZHNB 3RFZC 3GSUB 4ETYA 3V6FA 3BYTA 2VDNH 3C5JB 5HGDA 4ONHB 1SMOA 4WFED 2P49B 4S0SD 3VXUB 4JG0L 2E9IA 4AYFA 4PRIB 2ADIB 5D93B 3EDEA 4LFHG 4WRLA 1RZ7H 5GRJH 3OSKA 5KJRL 2R1YA 4NJ9L 4P2QA 5ENWA 1VFAA 2ESVD 4NT6B 3RPIB 4Z7UF 4TULL 3SE3A 2FBJH 3BW9B 4UDUA 4MA1C 1H3WM 1K6QL 4X9HA 2VLRE 3TVMB 3VGAC 3G6JB 3HE6A 3TCLB 1WBZA 3RVUD 2VXTL 3A0OA 3LSOA 5E9DE 3RL1A 4Y4KC 4GRLD 1XZ0B 3C09C 3F12A 5ADPL 2PN5A 1R0AH 1IQWH 4PJ9C 4ZUTA 4BZ2H 4KK5C 3G5XB 3OKOA 5ALBH 3ARFD 4KVNH 1CGTA 4GW5A 4WDIA 5CCKH 3SQBA 1NCBL 3BD4A 4XHJC 1MCQA 3FFCB 1CF8L 1XCTA 4M61A 5ESVB 3PP4L 2CLVB 3CX2A 1OT2A 4OV5B 2J8OA 1SJEA 3SY0A 1TZHA 3L6FB 5IFJB 5I16B 1LDPL 3DURB 1RUAH 2ZOLB 1OP9A 4WVRA 3ZKXB 3PQYB 4G43A 3TBWA 3V79C 1D6VL 2GCYA 4HAGA 1HSBA 5ID1B 2GW5A 3AM8C 1X4ZA 5DS8A 4LLWA 5GRXG 3TBSA 5EOCH 1KC5L 1TCRA 5HHVH 1U91B 1NC2B 2FECI 2VXSL 3MBEA 3S34L 4G8EB 3IAQA 1P84J 5GJSH 1LDSA 4OD1L 1JRHL 1FBIH 5F1KC 1PJ9A 4KVCH 4F7TA 4KK6C 5C0FA 3QFJA 3QUYA 1UADC 3BDYL 5F9DC 5KSBE 1LE5A 2X41A 2DBLH 1FH5L 1D6EB 2QV2A 1J10A 3O2VL 1Y18B 2DLEA 5DMGD 3IDNA 1IAMA 2R9HD 5DLML 1MJUH 5DJZB 1IKFH 3LKPB 1CD1B 4X6DF 5T3ZL 1G6VK 1FGVL 4PJFE 1S9XB 4WI8A 1Q94A 3CVHH 1JZ5A 5FKAB 3QQ4B 4ODUA 2BNQB 5KTEH 3UZEA 2Y9RT 4LSPH 1QBLH 4AJ0A 2A73A 3MLTA 2FIKA 4JRWA 5FYJH 4U33A 3RDTA 3BKML 3PWVA 1JGLH 4KXZI 3F5WB 4M43H 2X1QA 3OTTA 2FX9L 2IG2L 4J1UB 3NBNA 1KLGB 1G9NC 3B2VL 2Y4SA 4XNUH 5CEYB 1MCPH 2OL3L 5ESAA 4X5XA 3GJFK 5FF6B 4LPYA 4HS3A 4ZTOH 2FD6H 4LEXL 5IG7B 5I0DA 2AK1H 2P42B 1A9EB 3EJZD 5C86A 4UV7H 1EFQA 2X4QB 4M7JH 4J3TA 1N59A 3GSVB 4MA7H 4O2FB 1J7VR 1P2CA 3H7BA 4IMLA 1YNTA 4UIKH 1VFMA 3FFCA 2XNAA 1INEH 5JMOC 1M05B 1F45A 4GKZA 2GJ6B 5C0DA 15C8L 3QDJE 3ZT7A 5C0CA 5KSBF 4I0CC 4G6KH 1ND0A 4I9WD 4ZPTA 4FFWD 1K9TA 5HHNA 2P5EA 4S11A 1CL7H 4LVHC 4M7LH 5D1XB 3MBEC 4W68A 4X80H 1T1XA 4OD2A 3GSXA 4YDKL 1MI5B 1T20A 4IHOB 1FNLA 5EIIA 1MEXH 3QEHA 4JY6A 4WWID 4MD4A 3QT2A 1NBVH 3O45B 1L0YA 5D1QD 5JUEL 2DQIH 3GMMB 4P5TB 5DGQA 3LH2H 4XPTL 3TNNB 3V6BR 4MB3A 4P2OD 2YC1B 4M7KL 5FF6A 2FD6L 3MCG1 4WO4D 1MJ7L 4NQEB 5D6DC 4OZIE 5T1DL 4BSVA 3ILPB 3L3OA 5A16A 3C5SA 3S96A 2DF3A 4N90D 1KJ2H 3L5XH 1GGYA 3H7BB 3QXAA 3LKOA 4HF5L 2VO5A 1UWXH 2ZP0T 5SV3A 4I0KA 3U4EB 1FDLL 3FAWA 4U1NA 1WWWX 2VAAA 1A7PL 4G3YH 4ZUUA 3QCTH 1DE4A 4XBEL 3O41B 2YHGA 3DYOA 1OAQL 2O5YL 2YWYA 1CI5A 2WBJA 4EVNB 5L88H 5E56A 4OD3H 2W59A 5KVMC 4GUPB 1YEGL 1CFNA 5BZDA 5GGVL 5DQ9A 3LN5B 1FL5A 3O6MH 2E8YA 5AAMA 5DUPL 4YHPB 3TIDA 1U2CA 4DAGL 4HBQA 4KK8C 4P99A 1WJ3A 2BNQA 3EOTH 1DN0B 2D2OA 4NC2B 5JR1L 1DLFL 1NMAH 1CL7I 1AO7E 4XPBH 4AZ8A 2OJZL 2V5RA 1XZ0A 1TZIA 1EHAA 3DURA 2AXFA 4KMTL 1KB5B 3OXSB 4LQFL 4NN7C 4MAYD 1MCDA 3ZTNH 2D9QB 4OCSH 4FQXD 4OF3A 1NPUA 1EA9C 4UTBH 5BS0B 4UV7L 4K7PH 4Y4KA 3MLZH 5E99L 1C1EL 5TH2A 4C57C 5IF0B 3PABB 1A9BA 4OZIF 1RUPH 4M93B 1HXMB 1XGPB 4XPBL 4NRZA 3WFZA 5J1AA 3QUYB 5C08D 4URTB 5F7EL 3IJSB 4IDJL 4QRTB 1MCBA 5MI0B 2NYYD 1AKJA 3AB0C 1BQSA 4YBHA 5E4EB 2DLTA 2I27N 5IFAH 3DPBA 4KGLA 3QIUC 4WW2F 1C08A 1OB1A 4PJ5A 4JFDD 4M1GL 3V6FB 2JJSC 3MA7A 2V9RA 1LEKB 3QHTC 4FP8H 3WDHA 3FN0L 4C56A 5DHVB 4L4VA 3V4UH 2MKWA 4ORGA 1MHEA 4CNIB 5TQ0H 4RMTA 2X42A 4NQTA 4OFPA 4ZFOA 4KV5E 5FO9A 1HINH 4RGMB 3ZDYF 1LK3H 5LWYL 1ZS8A 5A3ID 4BM7A 1KB5A 1NFIB 5L8LB 1CQKA 1MY5A 3H3BC 3ESUF 4YWGL 3MCLL 1MUJB 5D5ME 1PQZB 4OZFG 2Z31A 3TCLA 3VFRB 3WUWA 4PIRF 4LMQI 1FFRA 3NFPA 3LHPL 5IF0A 1NSNH 1JPTL 4NHCH 5EU3A 1FVEB 1QRKA 5HDQH 3UYRH 2J12B 2R0ZL 2BXZA 3W5NA 2G9HA 3N85H 1YNKH 1N5AA 3QG7H 4HXAH 3T3ME 3ABZA 1LQSR 1P9MA 1MRDH 1DQQA 3ULVE 3KPMB 8FABB 2ADFH 2BHZA 1F2QA 1TDQA 3VA6A 1B88A 4XNMB 4W4NA 2ZNWA 2VDPL 5C0GB 1Q9WB 2KBGA 1PD6A 5F7YC 2G5RA 3KG5A 5MEQA 5E6IB 3ZTNL 4ZAKC 3OBAA 3HC4L 4YGVB 1A3QA 2OR8A 3ALXA 5JZ7D 4YDKH 4PJ9A 3VW3H 1FIGH 4ODXA 2NY3C 2LV4A 3U46A 3WDIA 1IC4H 5HHQB 3VDBA 5E5MB 4HZLB 3FB8A 3R1GH 1LE9A 1I1YA 2EYTA 1WFTA 1IBGL 2XZCH 5IFAL 5H35A 1YPZB 4BKLA 5HY9B 3VXTB 1PYWB 2JJUA 3PL6C 5CBAB 4HK0B 5C0ND 5IW6A 2DRUA 3GKZA 3KPRE 2LABA 4NHUA 1BIIA 4QXUL 3IDGB 2VXQH 3BQUB 1J1XL 4AL8L 5DJXA 7FABH 2BY1A 1RIUL 3DGGA 1YMHB 2Z0BA 5FXCH 3DX7B 3GSNA 4KGJA 1DBKL 1AFVH 3E3QE 4HGWB 2YUZA 1YEFL 3LRSB 1FNGB 1KELL 2X2YA 2PCPA 1T5WA 5J1AB 3HA0A 1K8DA 5C0GA 1GZQB 1K4CA 1BZ9A 5GS3A 3CU7A 2F19H 1FSKB 2HN7B 4BSWA 1AKJD 2DWDB 1U8IA 3FT4B 1MFEH 3ULVF 4DWHA 3WLBB 4M9PA 4DGVH 4N90E 4EVNA 4OFDA 3BAEH 5C2UB 3PDDA 3GSRB 4S1QH 3PJSA 3M17A 3IFLH 1P69B 1YEGH 2B0SH 3O8XA 3UYRL 2I9LA 4XCNB 1DL7H 5GRZA 5B39A 5HVGB 4ZXBB 4OB5H 5GXBB 1PYWA 3Q48A 4ZS7H 4UI2A 4XNXH 1MPAH 5DYOB 1QSEE 1LP9A 2Q76B 3EAKA 4UNTA 4KU1A 5KSVA 3BMVA 4G8GE 3NFNB 1OPGH 1NMBL 3KYOA 3UTQA 5AG9A 3BP5B 4BFIA 3ZE2F 3KJ4C 3KS0J 4UB0L 3FT2A 5J7CC 4O58H 3UTZB 3C6LD 2WANA 5FIEA 5IHUL 5CMAB 1JWMA 1MRDL 1M05A 4HS8H 5D7JC 1C5DA 4HKBB 3KXFA 1T83A 4PRDA 1B2WH 4I5BA 5GRUH 3HLAB 5IJKC 1BGXL 3PWLA 5TE4L 3IXAB 2GSIA 1J05A 4RGOH 4R2GB 2B5IB 3H9SE 3BKJH 3S3SA 1ZEAL 3VFUA 3S35L 1CK0L 4WWKC 2NR6C 3QEQA 4ZDHB 1K8IA 4S1RH 5FYKL 5GS0L 4YXKL 4L4VB 1U8QB 1LO3H 1YEIL 3O11B 4OM1H 1N8ZA 1DQMH 1CZ8L 1HINL 1RV6X 2AJVL 1MCOL 4DFIA 3R06A 4Q58C 3D39D 4G9DA 5I74C 2Z8SA 3WNMA 3MV9E 5IW3A 2OL3B 4RWHA 3MV01 2APVA 1N26A 1AGDA 5SWZD 4X6FA 1BFOB 1EH9A 4MYWB 2VQ1A 3L3JB 3JWOC 3S4SA 4XZUA 1OQOA 4JZOA 3BAEL 4DN4H 1OD9A 4YHIA 1MAKA 2AXJA 2BY2A 4ZUWB 5KJRH 5DXWA 3QHZL 3ZE2E 1V7MH 3F58H 1L6ZA 2IANB 1BP3B 1A6UH 5MEPB 4X6DA 5FA3B 1EO5A 2D7TH 2QSCH 4HWEL 3QXUA 5F89A 1S9VA 4LQFH 4B53A 3P0VH 3D85D 2ZUSA 3OG6B 3O9WD 4Z7WB 4PRHE 2NY0B 4N9GA 2IH1B 1ACZA 1LP9E 2IALB 4IIQA 2GITB 4UILH 5CILL 4ZPVA 4GG6E 3KLHC 5IMOA 1A9BB 5DD5H 4MNQB 1HSAA 1BQHA 3RWEB 1KJ2L 4JFHD 4AIOA 4X6CB 4NOBA 4WY7L 4LCCC 4ZUVA 3S7GA 2AQ2A 4UDUB 1HHGA 5H37H 3WIHH 5C6TL 3BD3A 5ACZB 3GMQB 4U1IB 3B8SA 4NP4L 4ZG1A 2FYYA 2FDBP 1T03H 1ZHBB 5JIKA 4UAOB 3BPLC 4I48A 4Q9RH 3RDTD 2O93L 5B22A 5L88L 4CN6A 3V4PL 3TVMD 4D0CB 1VPOH 3OKLA 3DBXB 4RBPH 4M62H 3VGHA 1A4JB 2RB8A 3N06B 4MB5A 2P47B 4U6HA 5DRNA 4AH2B 3L95A 1FVCB 3NCBB 3OR6B 3QUZD 4LLUA 4RWYL 1OGAE 1F11A 5LBSL 1C12B 2OCFD 5E6ZA 2IALA 5J9PB 4NC1C 3VG9B 4TUOB 5JLZB 3V6OE 5AEAA 4HG4K 4AMKL 4ZODA 2BOBB 2W38A 3HMXL 3CFDA 1EEZA 5C6WH 1YNTB 5DHXB 2MNUA 3TPUB 3DOSA 5EBLB 1ZLWH 5IFHH 5EUKA 4XB7A 1KPRA 5BZWB 4QWWC 4RAUA 4NZTL 1IM9A 3EDJA 4N0CD 1K3IA 4NRYB 4FN0A 1T7VA 2CKBB 4GG6F 4PJ8D 1NUDA 2K3TA 3MRCB 2W0FB 4JANA 3O6FB 2FYYB 3VDAA 2AGJH 4JFZL 5BS0D 4RISL 2CR6A 2XKNB 2BOCB 4JKPL 5FA4B 2B1HH 2OL3A 1IGCL 2HFFA 5ALBL 3G5ZB 1N4XH 3BYYA 3IS1X 5FYKE 3QB7C 2FO4B 4FHBD 4HUMB 1A4KA 1MHPH 3GHEL 4LQ1A 4NQDD 3V4UL 3BW9A 5LGHL 3FO2A 3NAAL 3C2AL 4M6NL 1GCFA 4JFXA 5EN2B 1KT2A 4ZAKD 1YA5A 3BQUD 1YY8A 3KGRA 5DJZA 5B3JF 4R4NC 4N5UA 2W9EH 3PHQB 4MXVE 3KJ6L 1H9VA 5DJCB 5CIPA 4DKFL 2BSTB 4CU6A 5IOPA 1I7UA 2NZ9C 2FIKB 3LHPH 4GXUN 1FLRH 2GY5A 3HAEA 5IK3B 1V3MA 3P9MA 1U36A 5TJWK 4MJIB 4OCYL 4KHTL 4X4ME 4RQQB 4M9OA 2YPLA 1A02N 3L1OL 4G6FB 3QIWA 1RU9L 3S36L 5CJOL 3ARGC 4Q6IA 2DWDA 4FZEH 5C2BL 4O9HH 3OGCA 1HSBB 3BXNB 5FCSH 1X5YA 3RGHA 3D0VA 3QUXD 3KPLA 4RX4A 2FJGA 3MJ9L 1ODAA 2WNGA 4HGKC 3FOLA 1H15A 1QLFA 4NKMB 1Z5LB 4JQVC 2QQLL 3ULSA 4G8GD 5KVDH 2P5EE 3UJIH 1R3KA 2CO6B 3RWIB 4JRYE 1DVFA 1F4WH 1GSMA 1U3JA 2YA2A 5C0CE 4I18B 1U95A 4D8PA 2R69L 2FCBA 3RGVB 5ISZE 4XP9H 4KVNL 1H8SA 5C09B 1RZJC 4ZO6A 1J8HA 4BUGA 2UY6A 3WN5A 1AE6H 3G5XA 3OKOB 3OQ3B 2R1XB 5BVPH 4MXVF 2CK2A 5SWSD 5SX4I 3BE1H 2B4CH 1AY1L 3VFWA 3BP4A 4WV1B 5M7QA 1EV2E 4HWBL 4R97C 5F6HJ 1KEMH 4LKXA 5L9DH 3AMKA 4KRLB 2E6JA 3GKWL 2IANE 1I1FB 4D0BB 1ETZA 3MBXL 4P46A 1GAFH 2GCYB 3QDMA 1GL4B 4UV4H 3JWOH 2C3WA 3OKKB 4LHUA 4M1CC 4XNQA 4P9ML 1NH6A 3TN0A 3ZE1F 2X4TA 4OM1L 1ZT1A 4YDJB 4NYLB 1CICC 1TITA 1D5BA 3MRJB 4PP1D 2DKSA 1VGKA 2DIAA 3QIBC 5E2TH 5F7MC 1MRFH 5DC0A 3ROOB 1GJIA 4A2LA 4DOHB 4OAWA 1T5WB 2F19L 1FCGA 3D39E 3P11H 3FN9A 1UXSB 4QF1B 2L0DA 4JO4L 4GMSH 4UOJA 3NZHL 5T5NF 4V2BA 4X4XA 4XMPL 3GMNA 4APQA 5J6GA 2HJFB 1KIPA 2I07B 1BQLH 3BP4B 4WV1A 1LVEA 2GUOB 3F58L 4O51B 5F3BA 4PJDA 3UEZA 2RHEA 3HPLB 3FO0H 1ORQB 4KROC 5HDBF 1MH5B 2IADB 4JO2L 3SGDH 2PTVA 1G9NL 1C7SA 4WJ5B 1S5IH 3DIFB 5B39B 4GXVH 2YSSA 5TGBB 1RMFL 1JZ2A 5H8DA 4UQ3A 5FK9A 1OAKL 1JGLL 4Y5YA 1KN2L 1Z0MA 2X4UB 1AGCA 4Q9BA 3D1MC 1VHPA 3WJJC 3E1F1 4IJ3B 5D7SH 4X4MA 5FYLD 2FZ3B 3PGCB 3QJFA 1MQKL 1UJ3C 3QJHA 3GMRB 3WKMH 4OZGA 2WWKO 4LDEB 4U7SA 2Z35B 5HHOD 2Q3ZA 5IB1B 1OTTC 1E4XH 1UWGH 5HYSG 5DLMH 2EDNA 3CXHJ 3MJ8B 4LOUD 5H37G 1PKQA 1NMCC 4U4BA 3T08A 2HTLC 5D71H 4F7EB 3RTQD 1Z9SA 1XF4B 4HKJA 1NUNB 4P2OB 1KT2B 3DYMA 2EDQA 3GO1L 1NCUA 3NCMA 1WWCA 3P0YL 1G1CA 4HUXA 5CLTA 3TFKC 3DIFA 5BXFB 1C1EH 3R0MA 2DIBA 1T5XA 1WC7A 2IPKA 3V5HB 2J5LB 4YHML 5GGTH 3VFRA 4RWYH 4MS8D 1AXSA 5JPNA 1LMKA 2MMXA 3ARZA 1CIDA 1ZLUH 1VSCA 1NBYB 1UM6L 3IU4L 3BKYH 1TENA 5LAXB 2JB6A 4YUEH 5HGAA 1OSZA 4ZS7L 2P5WE 2A6IA 3OAYK 2FHBA 1CR9H 4U6TA 3A67H 1YDPB 1J0KA 4GRMA 3UXFA 1S9KC 1JIBA 4MJ6A 3RGVD 3ET9F 4RGNB 3IJYA 5E1AA 4F7PB 1DQJA 5AWNH 2IPUK 3L3DA 4UNVA 3RVXC 4PG9A 1AHWB 1VCAA 3UAJC 3PHSA 1A6ZB 1KUMA 4JKLA 3GSXB 1JTPA 4OSUL 1HWGB 4F58L 1TZGL 3B83A 1NC4D 1MF2L 3SDDB 1NAKH 3GSQA 4FXKB 2P7TB 4JDTH 5FGBA 3LKPA 4QF1A 4KI5F 5CILH 5C09A 2VAAB 5E8DL 3UTTE 1CDIA 3DTXA 5E6YA 1BGXH 4GSDL 1D9KA 1CLOH 1OQXA 3NAAH 3NVQA 3MLZL 1OAYH 2W9EL 4UT7H 2ZUQB 5E9DD 4DVRH 1H3PL 3SKUD 4TTDC 4PJ8B 4Q6IC 5DT1L 5IKCB 1JCKA 1FL3A 2VH5H 3QBTB 1F90L 2A0LC 3RWFA 4DGYH 1X6NA 2R2EB 4XVUC 4APQC 2NY5H 2W92A 5ALCH 5FECB 3K1KC 5BV7B 3H3PH 3RIFF 1RSFA 2D03L 1G7LA 5DMYA 4M4RA 1U95B 4D8PB 5JHLL 4RMSA 3STBA 4S10A 2XA3A 3EO9L 3DVFA 4MQTB 3WUWB 1JL8A 5LJYH 4BQ8A 1YN7B 1L0XA 4NZTH 3DXAD 3S36H 1W2KT 5D2NA 2R4RL 1KBGL 4HIHA 5E9DA 2X4PB 4PGBA 3T0EC 1C16A 3L3GA 1D3CA 4PRHA 2VLMD 4P5KA 5F1IA 4LKCA 5KAQF 4CJ1A 2V2TA 5DD6B 1HXMA 2E3VA 1F3JA 3IJHA 1ND0B 4WEBH 3SKJL 2YBRB 3OGCB 5BOPA 4XHJD 4QXGL 3K4DA 3MRBB 2BNQD 2J3SA 5F9JA 4Y0GA 1KCSH 3S8WA 5B21A 4KK5D 4GG8B 4NC0B 4P2QE 1MI5A 3VFSA 5ICYB 2YPLB 3ISWA 1KG0A 1YEEL 3HUJA 1MLCA 2R0ZH 2VH5L 2IBZY 5DHVH 3CFJB 1F5WA 5FO7A 2E27H 1CGXA 2DAVA 2VDLH 3FONB 4JFQB 4P4RB 3W11D 1INQB 2F5AL 4FABL 3MJ6A 3PABA 1JYXA 1I3GL 3WN5C 3REVB 3T8XB 3OMZA 2ITDB 4NP4H 1RURL 1E4XI 1FHGA 2YZ1A 1KCVL 5FDYA 1DVFC 2GK2A 1QO3B 4JQXA 4RNRB 3TV3L 1ONQB 1XIWB 4WI3A 2DMKA 1B6DA 2G2RA 1N5YH 4NN6B 4NC1E 2CSPA 1TXKA 1U8LA 2WW8A 3B4NA 3FO2B 4CVWA 3IFOA 1FIGL 3I50L 4K71C 4BZ1L 1ZA6B 5CJXC 4Y4HD 1MVUB 4OZGF 2WINA 5DJCA 4QXTA 2A6KA 1I3UA 4KUCD 3AS2A 1KGCE 5FAAA 1P84K 2UZXB 4ZFFB 1SYVB 3QIWC 1H5BA 1ZGLP 5E5RB 1TVBB 3U4BL 1GC1C 4PJBF 3MO1B 5IKCA 1R5IB 5L2KE 5ETUA 1VESA 2DTMH 2XY1A 3RL2A 5IB2B 1U6AL 2UWEA 5HHOA 3R06B 1QFPA 2AABH 2DL9A 3QI9B 3QUYD 2AV7A 4LLYB 3G08B 2NY4C 5BXFA 5C0EB 1K3ZA 4H20L 2XZCL 2EDOA 4ZYKA 2YZ8A 2V5TA 2XKNA 4QOKE 3HI1B 3MJ9H 5D7KE 2MQCA 4PRBB 2NXYB 3MOBH 3DX6A 1KSRA 2VDKH 2F15A 4FTVA 4GKSA 3BI9X 3IDNB 3WFCL 3BP5A 5DJDA 5F6HI 1OAKH 3EGSA 4RGNE 1T2QH 4E41B 1GGBL 1RMFH 1PLGH 1X44A 2Y5EA 4V1DB 4JM2A 3RI5F 3KXFB 2A74A 2NW3A 2IPKB 5IHBA 3QPQD 4M61B 1UZ8B 3TT3H 4LKCB 3KR3H 3UZQA 1I75A 2QQNL 3PE9A 2ZCKH 2C1PA 2YK1H 4RFNC 2YEZA 1ZLSH 5I1HL 1MSPA 1RURH 2DM4A 3OAUH 3R0NA 4DTGL 4GRWH 2DM3A 1NLDL 1JFQL 3IXAA 1MCNA 2QQKH 2XNAB 2ARJQ 3MGOB 5D7IA 5J06A 4NGHH 4NKOB 1ZXQA 3P4LA 3TFKD 5IW6B 2P8PA 4G9FD 4LSTH 4PTUB 5CZXC 5BVJA 5T1KB 3QHZH 3F7YA 4PJBE 3B2UD 2AJXL 2XV6B 5IMLB 4MMZC 2ATKB 4JFQA 4P4RA 1JP5A 3QJHB 3OAUL 4QRQA 3DXAE 4O5LL 3OZ9L 3VFOB 4PV8B 1OPGL 3SDXF 1D9KC 2IF7A 5IVOA 4Q9CA 2QADC 1A7BA 5FB8B 3K4AA 3U0WL 2XWBA 3DTXB 3OKNB 4YK4C 1IGJB 2QR0A 3QDGA 1IGCH 1FZMB 2VWEC 2DYPD 3OGOE 4NKQB 4LF3B 1MFEL 5DJ0B 3NFSH 4BJLA 2VN7A 3ZHLA 2FEEL 4JCLA 3U2SA 4CKVX 4F2MB 1U42A 4JREC 1JWUB 43C9A 1FN4B 2PXYB 1CFSB 3IDYB 3QNYB 4I5BB 4KKLD 4P3DA 4EN3D 1FZKB 2EIDA 2XICA 3DHJA 5AAWA 4J4PC 4JEGB 1A5FL 2VXVL 3QUML 2DQCL 2AQ1A 1SEBA 3ZKMC 1QQDA 3BUYA 3U0PB 43CAB 2LTQC 4M7LT 3EYVB 2EYTB 4L3EE 2VABA 1EHLH 4RRPG 3QZWB 2IAMA 4F37K 2XZQH 4L8CB 3VGBA 3VXUA 5EZJB 3KPTA 4DVBA 3L3DB 3MRLB 2WP3O 1NC2A 4LSPL 1ZT7A 1LP9F 2VSDA 2VLKD 1JUFB 1QVOA 1FCCA 4OFVA 1AP2A 1NEZA 1WUNT 3GBNL 4OCWL 4UIMA 1WWBX 3BPNC 5DEGB 4H26A 3H9HA 3SEPA 3VFUB 2DKMA 4RMQA 3EJJX 4NNPH 3RTQB 4B5EA 3DROB 4NWUL 3P4MA 1A7NL 5MEND 5J13B 1XGUA 1A1MA 1CGUA 3K46A 4XP4H 4YXKH 4OZ4B 3ARDA 3CMGA 4LIQE 1KB9J 3A6CL 1CE1L 4P23D 5HPMA 2BVYA 4YHMH 5C0BD 3CSBA 3RKDD 4Z7VF 3T2OA 4GRLA 4HD9A 4CVXB 2HKHH 4P2QB 4HH8A 2Y7QB 4IS6A 4JR9L 4CDGC 1S78D 2A6DA 3HNTL 4HBCL 2PF6A 1RIVL 1CFBA 2VB5A 3SDAA 5KSVB 3ARBB 4JZJA 5I19H 3PXJA 3D5OF 4PBVC 5IBUB 3LKNA 3VGDA 2BNQE 4LGSB 1DDHA 3D85B 1IAIL 3UBXA 4G7VH 4Y16B 4JJ5B 1UZ6F 4CGTA 1NDMA 4FNLL 3I6GB 3S3PA 4LFHD 1FYTA 2RR3A 4DQOL 4QOKB 4Z95H 2G75A 1X5KA 2IAND 2H45A 1XAUA 1P5VA 2OI9C 1HNFA 3WKML 4PGCB 4FQ1H 4ODHH 3U0TA 1U58B 4HK3J 5JQHC 4L9DA 1FNEA 3O41A 1I7RB 2VERN 3FQTB 1CLYH 3CPLB 1T1YB 1UENA 4I8DA 3BD5A 5D6CB 1FVEA 4NSKB 5IQ7H 1N5YL 5DD3L 2VE6A 2ZJSH 4FNLH 1U3YA 1I7UB 4N5EC 4X6BA 3ARGD 1DBBH 2CGRL 5EZIH 2HJLB 3NH7H 2E9WA 3G6DL 1OW0A 1QACA 2EO9A 2DQDH 5E94B 1TLKA 2ZUYA 3QUZA 5MP6H 2BY0A 2GK0B 5DT1H 4I3RL 1OWRM 3EFDH 3IFPA 3RWGB 2YEZB 4HCRL 4HJ0D 3CH1B 2A9MH 1A21A 2NZ9D 3LMJH 3MNVA 5BO1L 5HD8C 2CKBA 1NCCH 5F7HA 2YPKA 4U7KA 5JO5B 1A3RL 1FC2D 1PBYA 5IVZB 5HYSB 5EA0H 2WQ8A 1AQKH 3KPMA 3BIAX 4X7DC 2IFFL 5HHMB 1F42A 1H3TA 3ILPA 4LCWE 1KFAL 1TQCB 4FMKA 2Z4QA 1G7IA 1S9YA 3SGJA 1RVFH 5MEQB 3VWJD 2CLRA 5GQBA 3WNKA 5IVXE 1IC7L 3NTCL 3KNBB 4WEUD 2Y5TB 1INDH 4POUB 1T0MB 5ILTL 1LEKA 2D4DA 3MBXH 2HMIC 4P49A 3L5WB 5E2WL 3EDFA 4FMFA 4KRPC 2J8UA 4XVSH 3CNKA 3D0LA 4O2FA 5HHOE 1UKTA 3TH2T 2PXYA 4O51A 5F3BB 2UUDH 5IBLC 2X40A 5IV2B 1QSFA 2HFFB 4W70A 3IXTB 1VACA 1HZHL 3DRQA 4I0PB 4OGAC 4ZPTB 4E5XA 3AREC 4UT9H 2ZCKL 4XHQA 3T0DA 2DJUA 2VZOA 4NPYB 3KR3L 5HPOA 1H3PH 2NY4D 5EIVA 1JGUH 1P4BH 1JGEA 3OKYA 4QHLA 4GLRH 5HYJD 1A6VH 1PQZA 3OX8A 1XGQA 3VXRD 1RAMA 1G9EA 2LE9A 1KXTB 7FABL 4N0UA 3NN8B 4MXQC 3L3KA 4POZD 4LAQL 5DJDB 4ODBD 3T2QA 2QSQA 4QRPB 1BFSA 1S7TB 2XFXA 3TP4A 4FQQA 2IAMB 3QNXB 3T77A 4OZFB 5I1KH 4KY1H 4P48A 4FQJH 2AJXH 1HKFA 1WBXB 2VSCA 4QTIL 1IC7H 3OKMA 3Q3GB 3TESA 3I9GH 2NNAB 4XVJH 4GKZB 2GTWB 3CMOL 1IFHL 3VD5A 1RK0A 1ZK9A 2G5BA 2IJ0C 3UTPE 3EKCA 2EO1A 4G9FB 3HR6A 2R4RH 3FQUB 1QBAA 4X7SH 1MVUA 4DN3L 4KJQD 5F3HB 3VGEA 2VC2L 3HI6H 4ODUB 2ZUUA 4L9LB 4X99A 4DKAA 3VI3F 1QNZL 6CGTA 2X70A 4YHNA 5D2LE 2IEPA 5HJ3A 4E42B 5CINL 1YPZE 3FRPA 3HUJE 4F3FA 2ADFL 1AH1A 1XGYH 5F7LB 3KLHD 4KUCF 1CTNA 1SJXA 4KPHL 4E41D 1T1WB 3RBGA 4HKXA 3GRWA 1QLFB 2VL4A 4NKMA 1EHXA 3W11C 3QIBA 5FO8A 1W0WB 4IM8A 3RVTC 3MYJA 3IVKB 1ZHBA 4XMPH 3RUGF 2B39A 5B8CB 4QYOB 2D4FA 3C08L 2C4FT 4X8XA 4Y5VA 3U4EA 5JW3L 3GK8L 1EUTA 4KUZL 4YFDB 1SYSB 2UYLB 3TV3H 1B9ZA 1WZ1H 1NKRA 3EGSB 3DJ9A 4XXCC 3VFNA 4ODHL 2F54E 1FQ9C 2ZUXA 4UT9L 4XC1H 2WBJB 3UCRA 1G84A 2FB4H 1MAML 2P8MB 1T1XB 2VLJA 1H0DA 3QUXA 4NIKB 3GEWB 3MCKA 3NGBC 4FXKA 4DCQB 3C08H 3LQZA 4EUPH 3CVIL 2EDDA 3G04B 5CGYD 1U3HA 4OM0L 2DI9A 5D70H 4ALAL 4PJ8A 4K23L 4YLQT 4PJIB 3BGMB 3GSNH 2HFEB 3MACH 4YFLF 2ZOKA 3IF1A 2D0HA 5J12B 2YUWA 4S1QL 5D7LB 1Q9OB 2APWA 2JELL 3BZFB 1T7WA 1RQ5A 1Z9OA 3ZDZE 3ULVD 5DO2C 4WWKD 3MLPA 5I1LA 4J12A 1FLTX 3HHRB 3RVTD 1OGAD 4CUCA 4MZ2A 1BLNA 1N64H 1OSZB 2A0LD 1S7UA 4U6VH 4FQQB 4J1UA 2Z93B 1ZT4B 4PLJD 1XIWD 1D6VH 5D2NB 4TTDD 5I16A 3BP6B 5IEHB 3TYFA 1X5ZA 2H26A 3G6JE 3QUMH 5EUOA 1ZGLA 1E6JH 4WO4A 3NIFF 4QY8B 4TOYL 1D5IL 3MRPA 4QRSA 2E7HA 2HLAB 3W81A 5AUMA 1JWMB 3RNQA 1NMAL 5I8EB 5F1NB 2VQTA 5J3HD 5BW7A 5DJAB 2XZAL 4Q74A 3MV8E 3B5HA 1SM3H 5B4MC 4L1HA 3T2NL 4G6MH 5TPWL 4HLZH 3HLAA 1I8IB 2UWEF 2DQUH 4KTYA 4JHBA 4TSAH 3WS6C 5C8JB 3PXHA 1AY1H 2DLIA 5DD1H 4YXHH 1UKQA 1U8KA 1AR1D 4J3XA 1R0AL 4K3JL 5C3LD 4GKOA 4KKNA 4X9IA 2H32A 1I1CA 4E5XB 5L9DL 4ZTPH 1HHIA 2KDGA 2VLKA 4KH2A 3R8BB 3U9UB 1JNHA 3KPSD 3ZHKA 3T0WA 2Y6SD 4H0GA 4U6HB 5C92A 2R0WL 3MLRH 4FG6D 3WFDH 5GJTH 2RCSL 5FUZH 1QA9A 3ARED 3LD8B 4J2XA 2VQ1B 3L3JA 4NM8H 2X10A 1YJDH 3T77B 1U8JA 3TA3D 4CVZB 2X4PA 4PGBB 1A6UL 4I3SL 2EZ0C 5EZOH 3BIBX 4DVRL 1V7ML 4HBCH 5A2JH 1MHCA 1T83C 3MOAL 4N9OB 1QG3A 4YFEA 4OZIB 1EEYA 4YNYB 3P4OA 3DGGB 5C0NC 5FGCB 4C56E 4HKBA 4JO4H 2HMID 1BVLB 3PL6D 2A6KB 4XNXL 1XCTB 3B9KD 4LOUC 2HG5A 1BQHB 3RWEA 3CFBA 5I6XB 2EECA 3LQAC 1S8DA 3VWJC 2O61A 1FFOA 3QEQB 5D8JH 4I1NB 3OKDA 5ICXA 1KIRA 1ACYH 5FYKH 1MUJA 2M26A 4IMKC 1G7JB 2XFXB 4DZ8B 4OLZH 3BKCH 4UMGA 3JV4A 1LK3L 5LWYH 4RA3A 2AEWA 2OJEA 1B4RA 2NLJA 3W82A 5J56B 1P4IL 2I5YH 5E8PA 1DQJB 3MODH 5D1XD 1TCRB 3SN6N 2DD8H 3F7PC 2QJDA 4GAGH 1UWEL 3PWUB 3GIZH 4ELMF 1KPUA 2CGRH 2VLRB 3D85A 4PD4K 4DKEL 2E5EA 1G7IB 1S9YB 5C08E 1FNGA 3TCXA 4QCIB 1KLUA 1KNOB 4L9LA 4X99B 5EUOF 2X9YA 4NYLA 3FTGA 4PRNA 3IRZA 2HRPH 5I8CB 4ODWA 4X6EA 4N1CA 4GAGL 1MRCL 5DRZB 2Q20A 2C3VA 1UEMA 4GAYA 1ZWIB 4KHXH 1D5ZB 3VXQA 3LS5L 2I9LB 5KW9H 3ROLA 2DQGL 5DTFA 2AJSL 4XAWL 4OZFA 5EZLB 3VG0L 1GIGH 5FDWB 1C08B 5JOFB 2JIXA 3BKCL 3JV4B 2R39A 3LV3B 4NQCA 1EMTH 1CBVH 2BY3A 3FB6A 5CJOH 3VH8B 4OD3L 4RFOH 2J8UE 4RISH 4N0RA 1NGXB 4FTVD 1NCTA 2W07A 3SO5A 4L1DA 2LU3A 4LDLB 5JXED 3O6ML 3NABL 1I1RA 5IVXA 2E9BA 4LVOC 5EPMB 1P7KB 3I6LE 3DRTB 2BCKB 1JHKL 4FQIH 5J4MA 1TJGH 2FH6A 4R96A 3L7FB 5GJSL 3TO4C 4LRIA 4L29B 4HC1A 3BPOB 2R0KH 3D9AH 4P5MA 4JJ5A 4BQCA 3LKSB 3D87B 2PO6C 1AGFA 1JTTA 2XWTA 2X89A 3S97C 1P6FA 2IWGA 5JXEC 2CRIA 4KKBC 3SE3C 5L2KD 2QSVA 5BS0A 1UYWL 2WLYA 5ACLA 5EU7C 2WBWB 1LO0L 4F33B 2X4OB 1TJIL 2X09A 4YX2H 2EE3A 3MV8B 1QFWH 4MAUH 5C07B 5DURD 4S1DC 1HI6A 1UH4A 1IQDA 3W2DL 4PTTB 5F88A 4L8CA 1FZJA 3O4OB 4ZUSA 1NCBH 4WCYH 1QSFD 3C60B 1ZANL 4PJIE 43CAA 1MJJA 1MELA 5E8NA 1DBMH 5I17A 3CGTA 2EIBA 4ZNEA 4WTZG 4ZXBA 4H8WH 3IDMA 1GGBH 4HZLA 4QRRB 1TETH 5DFTA 4CU7A 5KS9A 1CT8B 3STZB 1NGWA 3QCVL 2XRAL 1NJ9B 3S37L 4ODXB 1BECA 5F7DB 4K9EH 2OXHA 2H6PA 5MHSD 4RGOL 3UTOA 4U1LA 5L8KB 1VFUA 5JW5B 9CGTA 5SWQA 2VNCA 5TGBA 1I9RL 3LKRA 2NY3B 5CBAA 2DKUA 3QQ3B 4H8WL 1NC4A 5IB3A 4UOW1 3SO3B 3DI3B 1W72A 4FQLL 4HS8L 3X12A 3BZEB 1WISA 3ARDB 5HTSA 3ZTJH 2IGFL 1RZ7L 5GRJL 5C2BH 4R7NB 2ADJA 4XI5D 4IIQC 1YNKL 4PJFA 5IHZB 1AGBB 3PHQA 1XF1A 2XZQL 3GMOB 3AU1B 3B6SB 3FB5A 1NCDH 4YAQA 2Q86B 3BQUC 4MX7A 5BVPL 3MQIA 1QLRB 2XKSA 2N1KA 2AEPH 1UCBH 1F11B 4HPOL 1RHHB 1JPGA 4O5LH 4R9HA 5I30H 5JQ6H 3M1BA 4JFPB 4MWFA 2HFGH 5GS0H 1BIHA 5A40E 3TIDB 2EC9U 3SDXE 4YHKH 1D9KD 2MSPA 3GMRA 4J3VA 1DQML 1T1ZA 4IHOA 3I75B 2ESVA 1PX3A 3T4AA 4UUJB 1PG7H 2FR4B 3BH9A 5GGUB 3SJVB 1KB9K 4BFEA 3K4ZA 1TJGL 1N5AB 4OI7A 2VABB 2JE8A 5H2BA 4FP8L 1CXEA 1NAML 3JBG7 3O6FA 4HK3N 3SGDI 4JM2C 5EPMA 3TA3C 1VKXA 5DRNB 2K9UA 4EIGB 4K3JH 3TLRA 5F21B 1U8KB 4O58L 2PYFB 4LPXA 1A7QL 1I85C 1IEBA 4HWZA 3EJZC 1MCSA 4JVWA 3VWJA 1FNSH 5BO1H 1QYGL 1Y0LA 1KENL 1PZ5B 1Z5LA 3S96B 4WHYG 3MLUL 3UTSB 1F58H 3LQAL 4LRIC 5D9SA 4Z78A 4L3EA 2IH3A 1J88A 1RULL 3NCJL 4JFHE 3WJLC 4Z7VB 3WFEH 4XX1E 5T1KA 1AR1C 3EFFB 3V4VL 1X7QA 3OAZK 2JCCA 3F7VA 5DA4A 1S7VB 1EXUB 1BAFH 3S98A 4KQ4H 5F9JB 4WIQA 1SEQL 1U8NB 2VWEE 5D7JB 1NEUA 3TVMC 4P3DB 4PJBB 3NTCH 1TETL 1H5BC 1MHCB 3MMEA 1F6FB 4LPTA 3U30C 4LLVA 1X5XA 3DSFL 2DL2A 3N1MC 2MCPL 2VLME 1EPFA 1F6AB 5J3HC 1U8MA 1ADQA 1BBJB 1UVQA 4BK4A 3PWNA 2R56H 1Q72L 3DARA 3JTSA 4PPTA 1KJMB 2CPCA 4G8EA 3VMNA 1FZMA 4M6OH 2PR4L 3LDBB 4XVTH 4HT1L 1U91A 3CDYA 3RNKA 1GZPB 1MCJA 3HMWH 5ISZB 1EEYB 4KK6D 1UB6B 2DQDL 3KYMA 1SHMA 1FN4A 1E27B 3H3KA 2VITB 3DX8A 5LBSH 1Z2KA 3O9WC 4HHAA 4TRPL 5LGJA 4Z6AT 5IHUH 4Z7WF 3E6HB 4JG0H 4ISVB 1JJUA 1BHGA 4JJHA 4HQQL 2FB4L 1A7RH 4Y4HC 3VFNB 2ITCA 5F70A 4JFED 2XTJD 3RWIA 2L7JA 4LU5H 2GT9B 4EDXA 2ZCHL 2GAZB 2PNDA 5C07E 1ZOXA 3DSFH 4I4WB 4YIQB 3VU2A 4EKXA 3AFLA 4IRSA 4TRPH 5CJQL 4G7YH 4OGZA 4DZBA 5GGUA 1O7VA 5EOQH 3BEWB 4XPHH 4YFLI 3F5WA 1CCZA 4CRPA 3RIAK 5I1DA 1PG7W 2AI0H 2ZCLL 5KSUA 2JTDA 5TE7L 4HV8A 5SWSA 5CSZA 1A7OL 1CR9L 1VADB 4FTVE 4RIRA 4DJMA 5CJBA 3CD4A 5DQJB 1FBIL 4LSVH 4ZSOA 2NR6D 1J5OH 3EW3B 1KIUA 4AH2A 3BPCA 5JPMA 1WT5C 5HGBA 4XMKL 1YECL 4UAOC 4M5YH 4NZRL 4OZFH 3UYPA 4TVPE 4V1DA 4OFKA 1UH3A 3IDIB 4DN4L 5I17B 2QLVB 3U7WH 1A3RH 1EXUA 5DA0B 4BUHA 4FFZL 2H41A 4X7FC 1BQHG 2AJZA 1RHHA 3NPSB 4WHTB 4JFDE 2P5EB 3MOBL 4K3DL 4QRPD 5I1KL 1ZMYA 1E4JA 1FRGL 4NQSB 1QO3A 4LPCA 1RK1A 5HVWA 4QXWA 4PG2C 5FYJL 2OZ4H 3U7YL 2HRPL 3MYZA 5KSUB 4K3EL 3O45A 5HYEA 1AO7D 4GKNA 3BZEA 3KHQA 1F3RB 4ZPVB 1UACH 5DWUH 3M45A 3VXME 5HVHB 1UM4H 4FZ8H 3FB8B 1R5IA 1FZOA 5B8CA 1CK0H 4PJGE 1B3JA 2DQJH 1HQRA 4MQ7B 4AEHH 3UTZA 3HZMB 1G6RL 4HFUL 4JRYD 1I8KB 4MX7B 3ZE0E 4NO3A 2P8MA 1CQYA 2VLJB 1WK0A 2JJWA 3L7EB 4L4TB 3NCYS 4XMKH 4LASH 2AJUH 4P4KC 5B39G 1QOKA 1M4KA 5TQ2H 3BWAA 4EXKA 3PWJB 3S37H 1WITA 3VFPB 3OKMB 3Q3GA 2NX5D 3QDGD 3UJJH 3CLFL 4AEFA 2PCPB 4PGEB 4Z78B 2YD4A 3JV5A 1A2YB 2YRLA 5EC1B 1R24A 4PLKD 5DVOA 1TTUA 3TN0C 2EDBA 3MJGX 1KCSL 3RX8A 5ACZA 4KRNA 1U8HA 3WD5L 2YA0A 2IPTL 1CLOL 2XA8L 4WENB 4N0FB 3DMMB 1K5NA 2M2DA 1KLFA 1AQKL 3DVNA 2CRMA 1A14H 4WU7B 3ULVH 5I73C 1IGTB 3QCTL 1INQA 4HXBH 2P44B 3MLVH 3C5ZC 5C7XL 1IM9D 1IGFL 3O3AA 3UTTD 4HPOH 4DN3H 1D5MA 2KQMA 3WD5H 3QO1B 4P9MH 4PRID 5DK2A 4LBEA 1IEAB 1YEKH 2EICA 3O3DA 4MS8C 5ITBL 5IMMB 1U93B 4PJ7B 4PLNC 3ARXA 1G7HB 1INDL 5IIEA 3PDOB 2Q8AL 5EO1B 4XNZC 1UJ3A 5C71A 1PSKH 4JDZB 4JM2D 5LGHH 3GI8H 1VACB 4HS6B 5HD8D 4Y5YC 5D5MA 4N9GB 1LEIA 1YQVH 3DGCR 4RFEB 4F15B 3GUTA 5JHDA 2HTLD 3KDMB 4WFHD 5D2LB 2BMKA 1DLHB 4JHWH 5T5NG 2VC2H 1X5HA 4E41E 3BDBA 3IDJA 1AXSB 4NO5A 5F8QC 5JPNB 1I4FB 2ERJC 3G5VB 3ALPA 3EO9H 1SY6L 4HX1A 3RUGE 4MXWL 4G8IA 4KJYA 3WIHA 3B3IA 1YEJL 2DQTL 4NQXA 2D9CA 1PW3A 3MJ7A 1HK6A 1FZKA 1OARH 1Q1JL 3QNXA 2NXZC 4OGYH 3ULUE 4RCAA 3GSNB 5DEZA 4KMTH 2B0SL 4XBPA 2V2XB 2WAHA 3RPKA 3IFLL 4ZOEA 2L7UA 3VFMB 1E4KA 4NRXB 3EYVA 4TQEH 1BZ9B 3EYQD 4ORZC 1SBSL 1LK2A 1QP1A 5GHWH 2Z35A 2N7AA 4FZEL 3K8LA 1G7MA 4CW1A 2BC4A 3QWRA 3CXHK 1ZHLB 3GGWA 4RMUA 1AD0A 2PETA 4MVBD 4WTWA 4LVNB 4PJEA 3T0XA 5JXAH 2ADIA 1PG7L 5ADOL 2LU7A 2W60B 4J3UA 1T2XA 4U6YB 4JFEA 3KLDA 5DEFB 4BQ9A 1ZKAA 3HG1D 3PG2A 2PW1B 4K8RH 3RKDC 2GSGA 1JWSA 5D1ZA 5ITBH 2QQKL 2XG5A 4QKXB 5K93A 3ZMRA 2F5BH 1JRHI 4MAYC 1JF1B 3EO1A 3BZDA 3BGFC 1EK3A 5JOEA 3MXVL 3X3FH 3S36X 2EE9A 4N1HB 1OGTA 4CU8A 3VFOA 2VZTA 4KKBD 5KS9E 4QCIA 3PNWA 3VGFA 5D96C 2NZIA 3VXOA 2NY6B 2CJUL 2EYRA 3U1SH 3X14B 4KK8D 3PF2A 3WFEL 3GRWH 3DUHA 4PRAA 2PO6D 2XG4A 1KBGH 1U0QA 3WV0A 3EYSL 1MJUL 4S2SA 3BZ4B 2D7MA 4J6RL 5EO1A 1QRNB 4X5WB 4QRUB 5H94A 4I18A 1FGNH 4HGWA 3MRKA 3CSYB 3O3UN 2X1PA 5IEHA 4NOFA 3TO4D 2EDRA 5I1EH 3IKCB 1JHTB 2VR5A 3JWOL 4OZIA 5L7XL 5E2UL 5DTFB 3QDMB 5TQ0L 4M7JL 3WFBH 2CDFA 2R2HA 4U0RC 4PYHA 4CVZA 1JPST 3QAZC 3DHMA 1QTYT 5ANME 5EB9A 2R8SL 3MLWH 2WV3A 5CSZB 4J4PA 3FQXB 2P8LB 1S8DB 3U7AA 1DTUA 4GKNB 1WTLA 3MLSH 4IRJD 4HT1H 4Y5XB 1DSFH 3QCUH 3FO1A 4PGDB 3V6ZA 1R3LB 5IWLC 3EYQC 3CVHB 5TDPB 4J4PD 3MRDB 1BPVA 1Y6MR 3CZFA 4MQXC 4H1LH 3H6JA 5DDHA 5ACMA 1BQUA 3N1PC 3GFUA 2ED9A 4XRCB 1BJ8A 3U0PA 3GSOB 4NQXB 2E6PA 4JM4L 2YD7A 4P2OC 3N1GC 2NXZD 5KVGL 2CXKA 3TNNA 2ATKA 4OQ1A 5SX5H 4U1JA 1QR4A 1KEGL 4XMLH 3S5LB 2Y07L 3WO4B 1MWAA 5JHLH 4FQXB 1RI8A 1MH5A 3QFJD 4U31A 1IEHA 4EUPB 4QEGA 1MFDL 4LIQL 1PEWA 2IQAA 1JFQH 3O3AB 1HCFX 4BA8A 5JR1H 3MBED 2CD0A 1DL7L 2KQNA 3FHQA 4X5XB 3X13B 3EDKA 4LHJB 2EIZB 1N3NA 1H0DB 2F8VA 2VISB 2HFTA 3QUXB 3UPAA 1BBDH 5AG8A 5K9JH 4MNQE 1QYGH 4XPTH 3NABH 1XMWA 3DVGB 1R5VA 2NTFB 5CAYB 2YR3A 4PRHD 1RIHL 4Q0XH 4F57L 1I8KA 1DLHA 4JB9H 1QEWB 4FQLH 3FRUA 5F1SA 5D5MB 1VFBB 1IC5L 4R8WH 4MCZA 2DQCH 1FFOB 3KJ4B 4XPHL 3GMQA 4U1IA 4YHPA 5F93C 1RUML 4YE4L 1YEJH 3EYFA 3JWDL 1N6UA 3FL7A 5HHVL 3VMPA 1GC1L 4H1LG 4WU5B 2EDTA 2Y07H 3D69A 4WGWB 3ZDYE 4HX1B 2BVUA 3VD3A 3WXVH 1VB9A 2OJZH 1HHJA 2VIRB 1MCKA 3EYOA 4MCYA 3QFJE 4RFEA 5HYQA 5DD5L 3TO4A 4F7MA 1B4JL 4JZNB 5IM7B 4K3DH 3SBWA 3C09B 1RUMH 4YE4H 5GS1C 4GXVL 3OX8B 2X9WA 5L6YL 3LN9A 3Q5YA 4OIBA 3QDMD 1CG9A 3AGVA 2NPLX 1EO8L 2VKWA 4M03A 2FECL 2LVEA 4NO0D 4JGJA 1U8PA 4KPHH 4RZCA 4GQ9L 4BZYA 3BN3B 1A6WH 2OSLB 2DQHL 5F1IB 5E8EB 4HHAB 1KCRH 3U79A 1MFNA 4YJZL 5E0QA 4ZUUB 1RZ8A 3I02B 1F00I 1S9XA 4TYUA 4ZD3H 4PJAE 2Y72A 5I76A 2Q7YA 2AV7B 1CXKA 1A6AB 5TDOB 3MRNA 3U82B 2GT9A 4EDXB 3GI9H 5DQDH 1H8OA 1QPXA 4JR9H 4WI4A 3NA9L 4U1JB 2D0GA 3NCYP 3O8XD 4KQ3H 2ZJSL 2MTPA 1QFHA 2AK4A 3JV6B 1IZKA 3B2VH 4XNUL 5CEYA 1DE4B 4OCYH 1F3DH 2DB8A 2CJUH 4X0KA 4OF7A 3DSNA 1C5CH 4JRXB 8CGTA 3RI5K 3E8UL 1MRCH 3B8YA 3IB4A 4DGYL 4NM8L 3TBTB 4HV8B 4HKXB 1WBYA 4RX4D 5L0QB 2H26B 3GIVB 3PDGA 4AG4H 2AJSH 4XAWH 2YPVL 1L6XA 4DEPC 3JVGA 4HUVA 4PLJC 1OP3H 5BMFH 4PJHE 2CDFB 3WIFA 1FAIL 4YXLL 3M17B 4GAFB 2VZUA 4NN5C 4WHYH 5DO2D 3GB7B 3LEXA 1E6OH 3L3HA 1HZHH 2ICWJ 1JI1A 2R69H 4PJCE 5B38B 4LEOB 5J57B 1ZV5A 3Q1SH 2E7LC 2DDQH 2FO1A 5I1CH 4Q9QH 4RDQF 4X6CE 4JFYB 2IAMD 4PJ5D 2XYCA 4GS7B 2C4FU 4K3EH 4K94L 3GBMH 2M8XA 3QXDA 1FFNB 1ERNA 5HYIA 3L3KB 3ZDXF 4LLYA 3NIDE 3HNSL 1JHLH 4UT7L 5KSAB 1IEBB 4LSSH 4KQ4L 3ZSTA 2YBRA 5EBGA 2X4QA 1HH6A 4K7PX 3OR7B 1FE8L 4BH7A 5IMKA 5E7BA 3ETBF 3K1DA 1T22B 3SDCD 4FQCL 1P7QA 4XVUD 4APQD 4I0PD 4QHUA 1EJOH 3UBXG 1I7ZB 3FO9A 3EZ8A 3O6FC 4JY4B 1PZ5A 5C0CB 1F4AA 4G80A 4PGCA 5JIHA 3W0WD 4HIXH 5I15H 1IE5A 2BVQB 4JPKL 4BSJA 5I71C 4W6XB 1RJZB 1S7VA 3T04D 4PJHF 3VWKD 3I3EA 1VEOA 4OZHA 2P24A 4P3WA 5HJ3B 3TZVB 3C6LC 4OKVB 5KVDL 3VXOB 1CVRA 2DI8A 2YD5A 4KXZH 4AG4L 5FO8B 4B0MM 2HH0H 4H0HB 1HKLH 1AGEA 2NX5A 5A2LH 1EHNA 5GGRB 2C7UB 4DGIH 5E7FA 1ZLVH 4XVSL 1R3LA 3EBAA 3GSWA 3EYFB 2OYPA 5GSRB 5FKPA 4MDIA 1YPZA 4BKLB 1ZSDB 3ROOA 5MHSE 1VEMA 1EX0A 4MB4A 1I8LA 1IZJA 5K59E 2O26U 2ZG1A 3MV9A 2AEPL 3AY4A 3FRUB 1ED3B 4KI5D 3X3GH 2F53D 3MRIB 2WUBL 3P0VL 4ZQKB 5IB5A 3U48A 1I3RA 4R3SA 1WZKA 5J6GB 4EIZC 2CIIA 1O7SA 1NDGA 2I25N 1QFUL 2X89D 1Q9KB 2PW2A 1ZHNA 3E6FB 4Q2ZA 4ONGL 1M6OA 4NM4H 4TSBH 4Y2DC 4JFFA 1EIBA 4OGAD 3OB0K 1B6UA 2AJUL 4DKDC 1K8IB 4YHNB 3HE7D 4R4BB 3JWDC 1EVUA 4XTRD 1RY7B 2VZVA 1OAYL 2BK8A 1C5BH 3P4NB 1MHPL 3HCVA 4N8PA 1LEGB 3LV3A 5I1HH 1CT8A 1QFWM 5EA0L 3QZWA 2R15A 1AGCB 3MCLH 5EU4B 3QHFH 2AK1L 4NN7B 3BOVA 3V5DA 4D3CH 4YZFE 4Y19A 3W39B 1FYTB 4ERSH 1N64L 4WFEE 2EYRB 3EYSH 5K9KB 4I18C 3BO8A 2F58H 5D93C 5GIRA 5IT2H 3OG4B 2V7HB 4K9EC 5I8KH 3H9SD 4U6XB 1YY9C 3D2UB 3F12B 5JZ7C 3X11A 5I66A 2AERT 3UTQB 2XXCB 5IQ9B 2ADJB 4M8QA 3LSOB 1A2YA 4X7EC 1DLFH 4MA1B 2HVKA 3PV7A 3HZKA 1NL0L 4GH7B 1PG7X 4LL9A 3UJTL 3A6OA 5IEKB 3LRGA 1W0VB 1JGVH 3UMTA 1DR9A 3KPRB 3DMMA 4Z7OE 5KG9A 1RU9H 1OHQA 1FG2B 1VFOA 3D3VD 3IFPB 4LLMB 4OFYD 5DJ2B 3DX9B 4L8SA 4XWGL 4TTGA 5MERB 1E6OL 4YH6A 3MRDA 4HLJA 4LSVL 1T1ZB 3W0WA 2V17L 5FGRA 5HI5D 1CXLA 3C5JA 4PJCB 5J13C 4PJAB 3STLA 2YA1A 4AIZB 1IGTA 3IJYB 3GMLB 4XP5H 5ILTH 5JO5A 2EDHA 2Z92B 2J88L 4D0BA 3Q6GH 4PG2A 3WLWC 4M3KB 4TNVF 5IIEB 1R3JB 1RZFL 4H0IA 1NFDF 4NUJB 2VXQL 3DETC 1KCVH 2FH8A 2YPLE 3QIBD 3MLYL 4NO3B 5GS2D 5DJXB 1LO5A 2G75B 4S1DD 4F2MA 4PLOB 2O5YH 3BE1L 1RVFL 1FRGH 4DUXA 1HIMH 5IWLA 5IEKA 3AS1A 3O6LH 4WW2C 1I4FA 5ERWA 5E2JA 3CFKA 5CFHA 5EIIB 4PYGA 3QIUD 4BZ2L 1PFCA 2BMKB 3RIFK 1NFDA 1FNEB 4JB9L 2O5ZH 2X4NA 3OJMB 1J1OH 4OD2B 5FYLE 1U8HB 4LNRA 1YNLL 2PYED 3HNVL 3OHXA 5E94A 5BJTA 1P7KA 4XCEB 5EC1A 2K7PA 4EI5C 4Z7OF 3QCUL 4ZFFA 3H8NA 3OKDB 1DUZA 5ICXB 2MPAH 5FYJD 4P23C 1M1SA 3GMLA 1AXTH 2HJKB 4K94C 2A83B 3B9KB 2IQ9L 3K2MC 1HQ4B 4I77H 3PIQA 4PTTA 5FOBB 3S88H 2BRQA 3QO1A 1TQBB 4LCUB 4M6OL 1QNZH 1ZA3A 2DI7A 3F7RA 3HC4H 4WUKL 4Y89A 5CZKA 1B0WA 1KLGA 1T4KB 1FZOB 1A64A 4HUVB 1R3IH 1NFDE 2OR9L 3T1FB 5CGTA 3T4YB 5LXGH 3N9GL 5TF1L 3WLWD 2P24B 1NBQA 4I2XE 4HLZG 4JPIB 5TE4H 3SQOL 2NY1B 1WTGT 3O9WA 2BDNH 4K8RD 4PJIA 2E7MA 5JHDB 2CO7B 4X8JA 1FFNA 5E00A 5E6IC 3W9DB 1LO2H 5FDWA 5JOFA