1RK0B

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Restoration of TCR Recognition of an MHC Allelic Variant by Peptide Secondary Anchor Substitution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rk0B00
3FO1B 4TULH 2G9HA 1TETL 1VB9A 2J1KA 3ALWA 3ARGB 4BELD 5C2BL 4F7EA 3ORJA 1URLA 3ZTJG 4TUKL 2GTZB 4OZHF 2IADA 4WJ5A 2E27L 4BSWA 3MRNB 4JDZA 4LQ1A 4XP5H 1I3RA 2IALB 5IR1B 2P44B 1JNHA 3B9KA 3CUPA 5MEOA 1VENA 4LPCA 5B3JF 1FJ1A 3MLXH 4AG4H 4F7TB 5I1DB 2VZTA 5GGTH 4YWGH 4B53A 3SKOA 1XF3B 4X7CC 1OAZL 1KTRL 2I60L 1MHPH 4QXTA 1MRDL 3AREA 2DL2A 3O2VH 2Z4QB 3SPVB 4MVBC 3QNYA 5JMOC 2NW2A 1LK2B 1JGEA 2YN3A 3ZDZF 5E0QA 3RKDD 4M1GL 3GSXB 4R4FL 4LF3B 2Q8AL 5C86A 3MV8B 5E9DA 3LKQB 3IFOA 3O6KH 3SE9H 5MERB 4OAWA 1MHHA 1E28B 4JRXA 3CFDB 4XNZC 1DDHB 2JJSA 1RJLB 1HYSC 5C07E 3D3VE 3MQIA 3OZ9L 3ZE0F 1IM9A 3UX9B 4N0CD 5C0RL 5IFHL 4RGMB 4WW1A 3TBSA 1K8DA 3IKKA 2K1MA 4XC3H 4AIXA 4JFZH 2PNDA 1LEIA 2EE3A 5JOEA 4YX2L 1SM3L 4P2QB 3RVXC 3U7YL 5HI3C 1P84J 1QLFA 3BQUC 3RI5K 3WFCL 5J3HD 2X89A 3V6BR 2FJGB 3Q1SH 3WXWH 3VDCA 3RWFA 1ZE3C 1U41A 1JHTB 2H32B 4PJIF 4H5SB 5DEZA 4WEUD 1NCAH 3NCYP 3OGCA 2WAHA 5HVGB 1P4LB 4LFHD 1NBYB 4GKZA 3AROA 1JGDB 3BZFA 3QWOA 3ARTA 4YPGA 5T3XE 1RUQH 2OBGA 5BW7C 3ZL4H 3HFML 2LTQC 2MQCA 1MJUL 1FSKB 4OT1H 4MJ4A 1BEYL 1TIUA 1N6QH 3NH7H 4D3CH 1VCAA 3TWCH 5C07B 5DI8B 5GIRB 1EHLH 1XZ0B 2A6JA 3QXUA 2AKRB 2DQCL 2QEJA 3L7EB 3S88H 1YY9C 2DBJA 3K1KC 4ZSOE 1ES0A 1D9KB 1QNZL 3X14A 3CX5J 1HH9A 2FATH 2C1PB 5IBUG 1J1OL 1QRND 4LGRB 2CUIA 3DMMD 4WFED 5GGRB 4CN6A 2VC2L 5CSGA 3DRQB 5DRNB 5J6GB 3PWJB 1DBML 3SBWC 4IJ3C 1KJ3H 43C9A 1C1EH 2FL5B 2XQYK 3GMQB 4V2CB 4WHYG 3Q6GH 3NAAH 4TTDC 3P4MB 3WIHL 5IK3A 3LKQA 4FTVE 1I8LC 1IM9D 2VDML 4HC1A 2QSVA 2H8PB 3NPZB 4KDWA 1G1CA 4NQDD 3GMNA 3UPCA 1JPFB 4D9LH 3MOAL 4X6CA 3RL1B 3H9HB 2JIXB 3BIKB 4QXGL 3WFEL 4GUPA 5GSRB 4Q6IA 4HXAL 4TVPH 4WCYH 5C08E 1JMXA 5C0JA 4UIKL 2EDJA 2MCPH 4G6FD 4M7LT 4P2OB 5DUML 5J1AA 1KPUA 2R2BA 3T3MF 5IJKA 3QIBD 2DMKA 4NRYA 5FYKU 2NLJB 4RGNC 5IROC 1A47A 2VRAA 1IFHL 2E7BA 4ZXBD 1AO7D 4MB4A 1UM5H 4NO2B 5I1HH 4HT1L 1OSPL 4PJCE 4PJEA 4P9HC 1LE9A 3ES6A 2ZUSA 5IVXE 1ZAGA 4MXQC 5HYJA 3GRWL 4LSUH 3QBTB 1IQWL 4YK4B 2MNUA 3RNQA 5GGUB 4TSBH 2W60A 3W9EA 5GRJL 3U79A 4MQXC 4GBXB 1A7OH 2HRPL 4R4NC 2AK1H 2EDRA 3SCMA 3MXVH 4YHYB 1YNTA 4FZEH 3S5LA 4X99B 3ZKNC 4OF0A 2Q6WB 2R0ZH 3RPIA 5J11B 5ACMA 3L5JA 4IRJD 4MQ7A 3ROOA 4PY7A 4QGYA 5J6HA 1MI5D 4K94C 1PJ9A 2X9XA 3CZJA 5HI5D 3SPVA 4EQ3A 3LS5H 4I0PA 1IC5L 4LP4A 1CS6A 2IPTH 3QNYB 1HH9B 4OZFH 5IMKB 3LRSB 3NCJL 2CLVB 5KS9B 1RJYA 4GAFB 1E4XI 4KQ4H 1YQVH 3CSGA 4JM4L 4X8JB 5BZDB 3G6JF 2YK1H 3QUML 2P5EB 2EICA 1H3PH 4M4PA 5C3LD 1LO2H 2VN7A 3ZKMC 4ELMB 1O7SA 3KYKH 5D4QA 5JOPE 2HJFA 3VFOB 4M7KL 3VCLB 3CFCL 4IRZH 1PG7W 3T3PF 1XF4B 5F7WC 1RZ8A 2ORBL 5F72S 3DSNA 4WW1B 4LLYB 5IK3B 3TBSB 1ZS8B 1P7KA 5EO1A 1N0XL 1W0WA 1AQDA 1JWMB 1R0AL 1UB5B 3IDGA 1L9MA 4YR6B 2OR8A 1BOGA 3ET9F 3E1F1 3HE7C 5A1AA 5HVWA 5GJSH 1OTUC 3DROA 5L6YL 3B9KD 1S7TB 3RJDA 3FCTB 5E6ZA 1BFTA 1ZSDA 4LDOB 4JY4B 4MNQE 2YD1A 1MFDH 3IDNB 3ARXA 4GUPB 1L0XA 3MFFA 5E2TL 3SDDC 2EDBA 1EUUA 2JK5B 4MSWA 4K3GA 3AS2A 1JGUL 3ULVL 4CADA 4KC3B 5EOCH 3EIFA 1WBZA 4KI5E 4AENB 5IEKA 1V3LA 4FQXA 3R1GL 4DAGH 2HMIC 4PJ7E 4P5TA 4OZIF 5EPMB 4ONFL 1F00I 4EUPH 3NVQA 3UP1A 2CIIA 3D69A 4O58H 1XFPA 5F1OB 1YDPB 1U3JA 2XKSA 2Z9TA 3QSKB 1NFDA 1EERB 3ILPB 4NQSA 4R8WL 1KELH 1QRNA 1FVCB 4O02H 2ESVB 1BJ1H 1DQML 3VD7A 5F89A 3PXHA 3T8XB 4OIIH 5FCSH 5IEHA 3BWUC 3OG6B 5JDJA 3DSFL 5C8JA 4G7VH 4N0CC 3O2DH 4I1NB 1WFNA 4QRSA 1MCWM 2FJHA 5SWQB 4NRZB 1Z6JT 3S36L 3GMPB 4LCCB 1MWAA 3DIFB 2VLRA 5DMIH 2XTJE 4G9FE 4R9HA 4MJIB 5I8EA 4J8RA 3TPUB 3RIFF 1UC6A 1J0IA 3BH8B 3T4AB 2EDQA 5CGYC 1DANT 4D0BB 3KWWA 1MQ8A 1S7VA 4Z7WA 2ED8A 3IJSB 3QB7C 1N64H 2PW1A 4NQEA 4CMHB 4K8RH 1FL5A 1OAZH 3QUXD 4YHLL 1PW3A 2GFBA 5FB8A 3DTXA 2XWTB 5GGVY 3C6SB 3BUTA 5ACZA 1RZFH 2F53A 1U95A 3O2VL 4JFXA 5D1XB 4X7TB 3HE7B 4PP2B 4Z0BL 2ESVE 1T20A 3I6LD 3OB0K 4HH9A 2AXFB 2E6PA 5KSBB 2FD6H 5HGAB 1Z2KA 4C4KT 3MR9A 3OKYA 4OM0H 5K9KB 1CFSB 3FB6B 1LQSR 1UWXK 2GSIB 4DW2L 2AXGA 5K9JL 2OSLA 4RSVA 4WI5A 5I18L 4F9LA 2I25N 2BRRH 3ARGD 5E7BA 1P7QB 1T5WA 2DQUH 1SVZA 5F97E 4XNXL 4CNIB 5DRWB 3CZFA 1GAFH 3SDXA 4PRBB 3P0VL 4PJEF 5L8JB 2B0SL 4APQA 3V0VA 1T1ZA 3WS6C 1SM3H 1NANH 1MF2L 3BIBX 2YD5A 3FKUS 4P2RB 3QO0B 1J88A 3BH9A 4HEME 2KZWA 5IWLC 4JKPH 4PJXB 3PDDA 1X5KA 3UTOA 3PWUA 3A6BL 3M07A 1Q94A 4ZO9A 1XIWA 5FV2A 4DZBB 3ROLA 2AEPL 4XP1H 5DMGC 3D0LB 4LSRH 2FX7L 1NCAL 4NKOB 5C0GB 3CXDH 1BD2D 1NBZA 5GRZA 2CLRB 5T1KB 5DJXA 3MRFB 1T89A 4K7FB 4U0QB 3PNWB 3U2SA 4UAOC 1A2YB 4YFDB 3WXVH 2VLRB 1X6LA 5HY9B 5KSBF 3O41A 3NH7L 3LS4H 5C9JB 4A2MA 3BUYA 4Z7WF 5EBMB 5EU7E 4OLUL 4U6HA 4L3CA 2VLJE 2NW2B 3MLSL 4Y8DC 1ONQA 5ALBH 4E41A 1UA6H 2EE6A 5K93A 1OY3B 3UEZA 3DYMA 4JO4L 1D9KD 3WNNA 4FXKA 5E6IA 3IJHA 3VFUB 1FN4B 1OQXA 1A3RH 2WUCH 5MERA 4KK5C 2FECL 3IDGB 4YR6A 3QRGH 1S7WA 4TTGA 1D6VL 4X7TA 1BVKA 1WICA 5FAAA 4J3UA 4HUVB 2GCYB 3C5SA 1AXTH 4PP2A 5DO2C 3GBNL 5JA9A 1YMME 4PTUB 5JHDD 1NGPL 4MA8L 4BK4A 1MLBA 5EULV 1L7TL 1XF2B 4HULB 3BPOB 3O9WC 5LGJB 5FKAA 4M8VA 2DM4A 3LKSB 1KEML 4LVHC 2GUOA 5FDWA 4HBCL 3DVGB 3W5MA 1OP5H 1T7XA 4JM2B 3QNZB 2CRMA 3TH4T 1F8TL 1UYWH 3QDME 4U05A 4ZD3L 4I77L 4HXAH 3SDXF 4N0UE 2FSEB 5SX4I 4X4ME 1T5WB 4N0YL 1DLHB 4D8PB 5DGQA 1GL4B 3JVGA 3UO1H 2VWEE 2QSTA 4UOJA 4UDTB 4OZIE 2BVUA 3EFFB 1JGDA 1WEJH 4OD1L 4LU5H 1KLFA 4OB5H 1P1ZB 5IROA 1MCQA 1PBYA 3I75A 3V6OE 4W4OA 1J1XL 5FKPA 2Q86A 4P5MA 4BQ9A 5DJDB 5AAWA 4LEOB 2AP2A 3U0WH 4L9LC 3U7AA 1RUKH 2G9HB 1EO7A 4NZUH 4ZAKA 1WBYA 3HMWH 4JG0H 3WN5A 4ZFOB 1A6ZB 4RBPH 4UIMA 3D87B 3UJIH 1YPZB 2CDGB 1A5FL 4ETYA 5GS0D 3FFDB 1LO3H 4MA3A 1K5NA 2X4NA 3VFRA 3HR5B 5KVGH 2I27N 3NFSL 1X9QA 5D6DC 2ZUVA 1YYLH 3BIAX 3ALPA 1OLZA 4BSWB 3S35L 4Z7VB 3UTSD 2OR9L 4JY6B 1RJZA 5K33A 1DN0A 3IXTA 3QDMB 5DD1L 5DZOA 2WUBL 1WAAA 3QEHA 1JMZA 2FL5A 3OPZL 3ARFA 4DQOL 1ZT7A 5HYSA 3V6OC 5GZND 4HCRA 1G84A 5DJYA 1HOCA 2R9HC 5LKNA 4PRNA 1CF8H 4ELKA 4UTBH 5DK0B 5HGGS 1A6VH 3S37L 3VI3E 5FO9B 4TN9A 1WLHA 1KB9J 3MR9B 5JUEL 1T7YA 4MJ5B 2GCYA 3C5SB 4NZRH 3I02B 3QULB 4UUJB 2AV1B 4GSDL 1A3QA 2KQNA 1ORQB 1G0DA 1D5ZB 4KWUA 4N5EC 1FNSH 3T1FA 3DUSB 4CNIA 2ADIB 3LSOB 2R29L 1F3JB 3C5ZB 2FB4L 1J5OH 4NDMA 1AD9A 3C2AH 2NCMA 3AY4A 3V52H 3F7VB 4HWNA 3MLWL 2XZCH 3KYNB 1INDL 3OG4B 5C7XH 3G6AB 3VG0L 3MV9E 3M45A 4V1DA 1SJVA 3MRHB 2EDEA 1INEH 3T2NH 2VDOL 3O4OC 1NUNB 2CKBH 1K85A 4X6FB 2W60B 3W9EB 1F45A 4PJ9A 1QLFB 3ULUD 2H26A 2Z35B 3S3PA 3SQOL 2CRZA 4KI5C 2X70B 4RGMC 1MRFH 4H1LG 1VADB 1B6DA 3MV11 1OF2B 1MCNA 4LCWA 1BVLA 4CKVX 3VWJC 1KLUA 2FEDD 4MQ7B 4FMKA 1NBYA 3FAXA 4HIEA 3I3EA 4JFPA 4U6YA 3BVNA 4Z7NF 4AEEA 2VZOA 1RMFL 2FECI 2B1AL 5EUOA 5HYFA 3V4PL 3F58H 4LP5A 2P45B 4P23B 1FVDA 2CLVA 3CH8A 1FNEA 4JRXE 1RJYB 2V7HB 1IC1A 1L6ZA 2NXZC 1NL0H 3BSZL 5DMGD 1U6AH 5EZJA 4O5LH 2XXCB 1G6RA 5CZVL 1U0QA 5LGHH 4QTIL 3ARQA 3HCVB 4YDVB 4URTB 4QF1B 3I6KA 3SDCD 5JR1L 3UBXG 3B8SA 3ILQC 1TVBA 4WFEE 2Z91A 3NIGF 1EX0A 4WVRA 2NZ9C 3H2WA 4JB9H 4Z76A 1JPGB 3EOTL 5CEZE 4OLVH 1MWAH 3QULA 2PXYA 1HHIB 3REVA 1HH6B 4N1CA 3FB7B 3BGFC 5IB4A 2OZ4L 3U0TB 3I85A 5GQBA 2HJLA 4BQCA 3G5ZA 5LWYH 1UGNA 3SDCA 4CAGA 2WWMC 1U8NA 1DLHA 5DFTA 5EOQH 5F88B 4BQ6A 4Z6AT 3WHXA 1NMAH 2DTML 3V5HB 2PO6B 1EGJA 5D72H 1KJ2B 2DI9A 1ZT1B 5IQ9B 2W65A 5GJTH 2ZPKH 5T3XD 5GRYA 3UZQA 1VEMA 4Q6IB 1JNLL 1YDPA 1WTLA 5GS1A 5JOPD 1F4AA 5MENB 4M6OH 2WP3O 2AXHA 4HLZH 1KB5H 1F90L 4GG6A 4GAGL 2YUZA 5GGSA 2A74B 5MP6L 2ITDB 1UM4H 5EO9B 5HYEA 5ETUA 4JDZB 4OF3A 3QIWC 3U30C 3NFNA 2BK8A 1VFBA 1YEFH 1FCCA 3MRRA 5DSCA 4NGHH 2H45A 4JKMA 5DF0A 2GT9B 4XMLH 3HTLX 4NNPL 4Y4KA 1YC7A 4JAMB 3TZVB 2VJXA 5TDNB 3UPAA 4YX2H 1MHEB 1T03H 3BH8A 4MHHI 1XCQA 2HLFC 3X3FH 3GZKA 1FZOA 4FTVA 1QFUL 4K8RC 4HZLB 4HUWB 5A2IH 3PQYE 1IGFL 4PJHE 2VR5A 4O2EA 1L6XA 1XCTA 3KR3H 4L5FL 2LQRA 5HYQB 4NUGL 5ANMA 3H3PH 3ARFC 5TE4H 4U2YA 3B9DA 3WJJA 4YK4C 4NC1E 5BCAA 1DQLL 2EYRA 4BFEA 4HSQA 3W0WD 5T1DH 5FYJH 3QEGH 1AD0B 3KJ4B 1TCRA 3ESUF 5EOCJ 3GSRA 3MRQA 1IEHA 2OX5A 4GAYB 3QDHA 5E6YA 2RAMA 3G6JA 5I17B 3VFTA 3LH2H 3QP3A 3EHBD 3PGDB 2PXYB 1UT9A 3VGAC 4NP4L 1AP2A 3LN5B 5EORL 2KBGA 2ZUYA 1EEUA 4KTEH 2E27H 3HC0A 3LV3A 4TNWK 4RMTA 3MA9H 2I5YH 3IDXL 2OCFD 5A43C 4FQIL 3PF2A 1C5DA 3QIWB 1QBLH 3EO1B 4YUEL 4PJBA 1CVRA 4PLKC 2X89D 3RWGA 2A6DA 1F02I 1LNUB 4I77H 3PWUB 5IM7A 3WIHH 1C12B 1IGML 4EN3B 5IB3A 4IJ3B 1F4YH 1N26A 3MXWL 2EDHA 3FQUA 1DVFD 3H7BB 5JXEC 4OF6A 4D9LL 5DMYA 1JK8B 3EYVA 3MOAH 3G6DH 4LVNB 4POZC 1UXSB 1ZEAH 2CIIB 3D69B 5DJXB 4WU5A 3HNSH 2VAAB 3MRJB 8CGTA 4F57L 6FABH 1JRHI 3EZJB 1S7QA 1CD1B 3K8LA 5E4EB 4YC2B 2XRAH 1I3RB 2IALA 4HHAB 5GGRA 1SEBB 5IR1A 4XMKL 3BUYB 1YJDL 3SGJC 3NGBC 4O9HH 5JIIA 3KXFA 2C3XA 4I2XA 3D39E 1CXHA 3GMQA 5DFVD 3WJJC 1B0WA 5E6IB 4J8RB 1BQSA 4XNUL 3V6FA 5D6CB 1A6AA 2E7MA 4X83A 4Z7UB 1UWXH 4EI6B 4FRWA 3H42H 2FEEI 5F7LB 1X7QA 3RDTC 1HH6A 5HVHC 1EEYA 2PYFB 3Q1SL 1FFPA 3JWNC 4F58H 4XCFL 4JN2A 3D48R 1JNJA 4UMGA 1S9VB 3OJDA 1CDBA 2XA3A 1EK3A 1E28A 1KXVC 4GAJH 3FT2A 1T20B 3TBYB 5E99L 1JBJA 1NBQA 1FV1A 1CDUA 3HFMH 3U4EB 3KYMB 1YN7A 3ETBF 1YQVL 3K3QA 3MGOA 2YK1L 3QUMH 2VR9A 5FM4A 2WWKT 4YEEA 4K2UL 4E41D 1QP1A 1ZVSB 3BP4A 1HINL 3IU4H 2WZPD 4F15B 5IVOA 4GG6F 4ODVH 4IRZL 3GSNB 1ZWIA 1R3LB 2EXYC 4KKNA 4FNLH 3ZYIA 4EUPG 2ZCLH 4GBXA 5K59E 2PCPA 4PB9H 1GXEA 1ZLUH 5BRZE 1DBBL 3TC9A 1I9JL 5ICXA 3CLFL 5JXEA 5IB3B 3EOAA 3KPOA 4KVNH 1IRAY 5HHPB 4LRNH 4MS8D 2VDOH 4Y19B 1GIGH 2J6EA 4OSUL 5ID0B 1VFAB 1NGQL 2ZG3A 3QWOB 2X1XR 1ACZA 1ND0A 2YPVL 4HUXB 4P99A 5CMAA 3B2UC 1MPAH 2C1OB 3NAAL 5FYLH 4NHCH 3RVWD 4JHZA 3HUJE 4P59L 4YO0A 3X17A 3TO4C 5AG8A 3VXSA 1ZLVH 1KJMB 1FYTA 5FHBL 5GHWL 2UWEE 1KIQA 3K4DA 4JJ5A 5IW6A 3KXFB 4F3FB 3F58L 3QDGE 2NY4B 1XF5A 1KCUH 3KS0J 4MCYA 2X4UA 4L4TE 1W8OA 4N8VA 4TVPL 4WW2F 3PV7A 4O02L 1CK0H 2V9TA 4Z7OE 5C9JA 1QLRA 2IANA 5H2BA 1S3KH 2EYSA 4L8SB 5I1IH 3O2DL 1CDHA 5JW4N 3BQUB 1LVEA 3FCTA 4R97C 2P7TA 1PZ5B 4UUJA 3SDYL 3VXRA 2ENSA 1NFIB 4D94A 3LEYH 1SEQL 1U58B 1F3RB 4WNQB 4YAQA 1CICC 5LAXB 1DTUA 4HUKB 3GMNB 3QDAA 4EZMA 1UVQA 2P8LA 1K2DB 3JVGC 5A16B 3VXUB 5B4MC 4KK6C 5BQ7B 5IQ7H 4NNXB 4QXUL 1AD9B 3BKYL 4X6EA 2XKUA 1ZLSH 4PJBB 2XACC 5GGVL 5FYKE 4U1JA 1K3IA 4HWBH 1H3XA 2BSTB 5CP7B 5CZXD 2BY3A 2WBJB 3KPPA 4GLRH 4OUOA 4RBPK 4QRQB 1KPUB 4NPYA 4XCCL 1T0MA 3QDJB 5BS0E 5D7JD 4UT6L 1JZ8A 3L1OL 3C09C 1IC5H 2EIZA 1QYGL 1D7FA 5D2NB 2A1WL 3WUZA 4WFHE 2AABL 3BYYA 4XXCC 2GJ6D 3EUUA 2X4PB 1CZ8H 3KNBB 5GXBB 1GPOH 1FE8H 3NIFF 1KSRA 3N1QC 2IJ0C 1HILA 5DD6B 1UM4L 4JFFB 4WEBL 2HVJB 3AXLA 5IMOB 4E41E 5KN5A 3RUGB 4RFEB 4M7ZB 2L7JA 2HLAB 4NGHL 4NQCD 2ORBH 1JNNH 4XH2B 4G8GE 2QL1A 3ZT5A 3O4LB 3WFBH 4F7CA 2E9WA 3TWCL 2ATPB 3ALXA 4WHYH 1T21B 3C9NA 1YPZA 2FGWL 3V95A 4P4KC 1P53A 1M71B 1XF5B 1A0QL 3IFNH 4S0SD 2ZCKL 1BQHB 5KZCB 4POUB 5ITFB 2VQ1A 4P9ML 4JKLA 5DR5H 5DJCB 5BZDA 2DQFA 3QRFM 5TE4L 1RJZB 4LHUG 4WHTB 3VFVB 1P4IH 1YEGL 5FCUL 2VZUA 4N0UA 4Z7VE 5INCB 4PBVC 3WFZA 5FYJL 3VWKA 1RZ8B 2PYEE 3BE1H 3BXNB 4R8WH 4X9HA 4NFBA 4B7LA 3D39D 4LLWB 3Q48A 4ELKB 3UMTA 1XGPA 4WV1A 2VDMH 3EYFB 1MJJB 1IEBA 1S7TA 2GJZA 3DO3A 2A73B 4IRJB 5DJAA 4CN1A 2AV1A 1LEGB 3S36H 1T22B 3SGKC 5ILTH 1MIMH 4L1DA 3RU8L 5E1AA 4PV9B 3N85H 3FMGH 1A3RL 1U8KA 5FHAH 4UV4H 4FOMA 1F3JA 4MQXD 4D0CB 4NDMB 2K7PA 1MREH 4LASH 3OBAA 1WIPA 2CJUL 3S4SB 3DV4A 3IXAA 3ARGA 4Q0XL 3GSOA 3QIUD 4KAQH 1RIVH 5EU4A 5I1EL 3ZE1E 4QHLB 4XPTH 1HWGB 1MEXH 4GKNB 5CIPH 4JHBA 4L4VE 1CGYA 2BSSA 2HRLA 3GK8L 1LO4L 4XPFL 3RGVD 5J89A 4CMMB 4EDXB 5E08L 3OGOE 2FLRT 2UZIL 5MEPA 4QRSB 1C08A 3MUZ1 1G7MB 3DVFA 1HIML 2DIJA 2YWZA 4MD0B 3GMPA 2CIKB 3UPRB 1ZTXL 4R0LC 3PGCB 4NCDA 2VH5L 2VDQH 2X4UB 2JB6A 1MCOH 1T66D 2ATKB 4FZEL 3MBEC 2BP3A 2P24A 3BEWB 4J6RH 1GGCH 1YJDH 4Q9CA 3MRDB 1CE1L 4HBQA 1UQSA 1F2QA 4M3KB 5GS0L 4NRXA 4RISL 4JKKA 3SDDB 5ICZA 4Y4HB 1T1WB 4NM4H 2P5WD 4NJ9H 1FSKC 4XNUH 4WNQA 3OAYK 5I73B 4H26A 2EECA 5F1NA 4QRTA 4OQ1A 3HMWL 4Q9QH 1U8JB 1MJ8L 3FOMB 3OF6D 1SBSL 3O6FA 1IM9B 4TUJA 4JKPL 1ZK9A 2K7QA 2DWDA 5IVNA 4M7LH 1JHLH 1FZMA 4HJGA 2BSTA 3KJ6H 3CFEA 1HZHL 5CJXA 4CJ1A 3RVWC 1GVIA 3HUJF 5FGBC 4Q2ZB 3HNVL 1U2CA 1LO0H 4X6DB 4DKFH 2DJSA 3FB6A 4NOFA 2Y7QA 1C5DB 1DLFL 4HXBH 4ZXBB 2EIZB 1R3KB 5MEQB 4XI5D 2UUDK 4MX7B 3PG2A 1WZMA 1E27A 3HKFA 4DGIH 5JOFA 1R3IL 5EUOE 1R3HB 3AS1A 1A6VL 3G5YB 3V0VB 2OMNA 3FQUB 5F8RC 4JFFA 4U4BA 5KN5B 2W65B 1TXKA 2AAVA 3RUGA 4I18C 3UTSB 2O26U 5DJ0A 3IXAB 1WBXA 1UM6L 4HWEH 5CEZL 3GSUA 2VAAA 1OCWL 4KGLA 3PWVA 3RBGA 2J7LA 2DD8H 4JPVL 4OFKA 3KPNA 4Y5VA 2YPLA 3SE4A 1N5YH 4NO3A 1Q9LA 4Y16A 1NGYA 3IDJB 3QEUA 2AKRA 3AREC 3L7EA 1IKNA 1CE6A 2ILLA 2ENYA 2H9GB 3PIQA 4K7FA 1IGIL 5CZXC 2BXZA 2R9HD 2NY2B 2DM7A 4X80L 1YEJH 1YPZF 4OBSA 3MUGB 3ZSTA 5D7IF 5LG1A 3W39B 3KPRE 4HWZB 1T5XB 3T2NL 4J1UA 2AJZA 4P2QD 5GHWH 3VFVA 4HKBB 1UQSB 5IBLC 1P9MC 2H6PB 1GC1C 1G7PB 3SQOH 5GRUL 5EZOL 1D5ZA 1FN4A 2BNQE 4PRPE 4ZFZA 3OXSB 4Y5YB 3BX7C 5C0NC 4DN3H 1TMCB 1MAML 2MPAH 3VGGA 2ARJA 1T04A 1MFEL 3IS1X 2VXTL 3TIDB 3OAYH 2OJZH 3H9HA 5DTFA 4EI5B 4PJAA 5HVHB 5I15H 1MLBB 1ZKAA 4QHNB 3KYMA 1G7HA 4ODSH 1NC2A 5TF1H 1SEQH 4S1QL 1H3TA 1EH9A 5TDPB 3V4UH 1QA9B 3MMEA 3UROR 3BYTA 1FNGB 2A9NL 3BESR 4NRYB 4IOSD 1QFWH 4JM2A 3MCLH 5D2LE 3S4SA 4I18B 5L8LB 1R3LA 2EXWC 1YJDC 2GSGA 3HUJB 1IARB 2VLKB 4DKEH 3GSOB 3CDGA 1GZPA 2V9QA 1MCIA 5HYJB 3ULUE 1FVEA 3BEVB 2OR9H 3T0EB 1BVLB 4KMTL 1IAMA 3SGDH 2VISB 4HG4K 1I3UA 2R0WL 5ID0A 3QIWA 3K4ZA 4PJHA 1RUMH 2WUBH 3QDGB 2DJ4A 4NBZB 3L1OH 1GYAA 1U8IB 4M5YH 1W0VA 4ZTOH 8FABA 3WNKA 1SJHA 3NCMA 1Y18A 1NMCC 3EHBC 2OZ4H 1T89C 4UBDC 4KUCF 5GRWA 2GIYA 4WEMB 5FYKH 1CIUA 1FVDB 4P5MB 4WFFE 3SO5A 2EEDA 1U36A 1NMAL 3JV6A 4JZNA 4P49A 5ADOL 1YMMA 4MA7H 4F9LC 3B3IB 2R23B 4XBPA 5C09A 3WE6A 4TTDD 4OV5B 4O00A 4YDVA 3MRJA 5IMMA 5I1LB 4R7DA 5IUSA 5F1IA 3VFSB 1DVFA 1RZIB 1UWEH 3LS4L 4JVUA 3GSNH 3W5NA 1DN0B 1TITA 4QRRD 1N6UA 4Z76B 3QDMA 4L8SA 4HJJL 3BP7B 1F11A 4X4MA 1RUPL 1C7SA 2E9JA 3AS0A 5I75B 2W0PA 2CO6B 4XPAL 3VG0H 4LLYA 3U30B 5IBUB 1ZS8A 3KYAA 5C0AD 1QFPA 3QFJE 5C0FA 3TN0D 4GMTH 1TNNA 3R06B 1G9MH 5FGCB 3FT3B 1QEWB 5D7LA 1WISA 5FECA 2AV7A 1HE7A 3TF7C 3BE1L 3MREA 4AEHH 5A3IC 2IQ9H 1MRFL 4IRJC 1KG0A 3GJEA 4JLRB 1JF5A 3TNNA 4JFQA 2B4CH 4DOHB 4LCIH 4C55A 3GMRA 1I7UA 2B1AH 3NFNB 3F7VA 2VLJB 2V2XB 2X4RB 3OKOA 4XXDB 2XKNB 2HT2C 5J13B 1A1MA 5SV3A 2BDNH 5HDQL 2X5PA 4YXHH 3GMMA 5F89B 3T8XA 2YSSB 4K9EC 2X4OA 5IT2L 3QEQA 4B5EA 3OHXA 3V7AE 3MOQA 3HE6B 3QEUB 5MEOB 3VFGL 2X1PA 3BISA 4F7TA 5I1DA 4OZGB 1IGJB 5CJ5A 5ADPL 4O2FB 4Y1AA 4WUUE 1MEXL 1CG9B 4CVZB 4IRSD 5E94B 2D4FA 3TEUA 4LPXA 1T5XA 3VGAB 3RAJL 1YNKL 2P49B 5T1MA 4OFDA 3AUVA 5DO2D 3U36B 4UINL 4FQIH 4R6UA 4NKQB 3UJIL 1LHZA 5FIEA 4WRLA 1AQKH 4K3JH 1Q72H 3VDBA 2WINB 3GSWB 1H0DB 2DAVA 2F15A 5HPMB 2YHGA 3PUCA 5I75C 1UG9A 4PREA 4HIHB 2VITA 4OCMC 5KJRL 3WKMH 5F9AC 4BKLB 3C6SA 1IAOB 1U8HB 2X2YA 5C0BD 2GY7B 3FRUB 5DD1H 4OZIB 1M6OA 3BMWA 2ZPKL 1GJIA 4RISH 5DQJB 2HLFD 4RAVA 4QOKE 3QJHB 3BRDA 4KJYA 2XWJB 5D93C 4P5KA 5D7IB 3HI5H 2ADFL 1F90H 5CWSB 4GAGH 5GS1C 1U8MA 5JNYB 4PR5B 1I1FB 5E00B 3BQUA 2XV6B 4JHAH 4HQQL 3R06A 1NUFA 3UTQB 4ZO7A 3ULUH 4UT9H 4AIZB 3HC3L 4NT6A 1IT9H 3PWPA 2AXGB 4LPTA 2A6DB 5LXGL 4YHNB 1AGBA 1GZPB 3AM8A 3M1BB 4N8VG 3MO1B 3QDJD 1FGNL 3D25B 5EU5B 1HXYB 4GQ9H 2W9EL 5DA4A 5BJTB 5DZNA 3KLHD 4JFDE 4X0KA 5I66A 2FO4A 2F53D 1YEIL 2XPGB 1N6VA 2CK2A 3QO0A 5FF6B 3NMEA 1LE5A 3HE6C 3KGRA 5M7QA 1JYVA 2Z31D 3RFZC 3QUXC 1Y18B 3C60A 2EKSA 1RFDL 4MXVF 2QHRH 3EYOA 2UWEA 4P4RA 2OLDA 4S2SA 1CDCA 3D0LA 3V6ZB 2F5BH 3O9WB 1JN6B 3QUZA 1GC1L 4KGJA 1XEDA 3N0PB 2R0KL 4X6DF 2CDFA 1IMHC 3P9MA 1J18A 1TLKA 3SY0A 4WU7B 1UKQA 1VGEH 1U3HD 1VGKA 1X5LA 1OCWH 2UYLB 3P4NB 4FFWD 3IYLW 2DLFL 1IKFL 2Y23A 2HVJA 3AXLB 3BEWA 5IMOA 4JDTH 1A3LL 2BC4A 5D2LF 3PWJA 1KV3A 2HT3C 4APQD 2W9LA 2HT4D 1NAMH 1KF9B 3Q5YA 2CGRL 5EORH 4X80H 5D1ZD 3WLWD 2COQA 4HIHA 5DHYB 2AXJA 2BSED 5TFSH 4CU6A 1S7WB 4DTGL 4Y8AA 4K7PL 3PP4L 1MI5A 5CZVH 4G43A 3SJVB 1HK6A 4Q6IC 2VDPH 3ARPA 1RK0A 5ITFA 2XN9A 5FO7B 4KJYB 4NHCL 1Z9MA 5E2WL 4RWYL 5GSRA 4ENEC 4O2CB 4GAYA 3CXHJ 2G5BB 3Q0HA 4F9PC 2R1XA 1J11A 4PJCB 4OD2A 4PS4L 4ZUVB 1HSBA 2VXTH 2P5ED 2QQNH 1LILA 4FABH 2NY3D 3FQWA 5L9DL 3DPBA 3SDAB 5BO1L 1ED3A 5TF1L 3SE3C 3VWJD 1RZGA 3HLAB 4S1QH 3KPRD 4CDGC 3GMMB 3I3BA 2HKFL 3WUWB 3MLTA 1LWRA 4M7JL 4XRCB 1N0LA 2BY1A 2D7OA 3WFDL 1NDGA 5KVMC 2D0GA 4DKDC 4PYGA 1T0NB 4DKEL 1JNLH 3ARSA 2CO7B 3KPRB 4H25A 3EYOB 4P4RB 5D8JH 3S5LB 5CKGA 3E6FB 5IWLA 3EOBA 3D2UD 2HFFA 4KMTH 2VSDA 5EWIL 1OM3L 1AFVH 3RZCD 4IDLA 5EFIA 4I0PB 2NY6C 1HHGB 1D9KC 1N59A 2J12B 5GGVH 1DUZB 1A4KA 4LCYA 3H7LA 3ULUC 3IRZA 5DT1H 1X44A 4F58L 3SCMD 4U3CA 5CCKH 3DGCR 1T4KA 1YYMH 3ARBC 4I4WB 3HG1D 2FZ3B 1IAOA 5F7EL 1FO0B 1ADQL 3HAEG 1A21A 3AU1B 2P7TB 3QUXA 3FFCB 2P24B 4XP9H 2HMID 4UQ3A 5E03A 1BP3B 5HHOE 4U7MA 5ACLA 5EU7C 1A02N 4YZFF 1WFUA 3AGVA 1RUPH 4Q74A 5JQHC 4UV7H 4UU9A 5F7DA 4P23C 4C57C 4MSWB 4Y5YC 3QH3B 3KPPB 5A2FA 1QVOB 3OV6A 2IQAB 3QUZD 1H3VA 1GIGL 1A22B 2JKXA 4NM8L 5DZLA 3O6FB 3AM8C 4PD4J 4P5TB 5ICYB 5JPNB 3BPNB 3H9YA 5E5MB 4GBXD 2VLME 3CAFA 3GMLA 1KJ2L 1BQHG 3PQYB 4ZUWA 1ZVYA 2ZNXA 2GKIA 3W9DB 5IW1B 3BKML 5JXED 3O11B 1GSMA 2OM5A 3EAKA 1IQDB 4EUPA 4I2XE 1G9NH 3MLTB 4NKDA 5J4MA 5CBAA 1I1RA 4NN6C 1AE6H 1YEDB 3PL6B 5BMFL 5IIEB 4MD5B 3C87A 3O8XA 2B2XH 4NQDB 3ZLQC 3LN4B 4IOIA 4H25B 4DVRH 5CFHA 2DI7A 1EO8H 1DUYB 1HYSD 3S36X 4JRXD 4M8QB 5JPMA 3UJTL 4FFYL 3V7AG 2C3GA 5ENWB 4YHIB 1D5MA 3WL9A 1XMWA 3QQ4B 5C2BH 1S7VB 4OFYA 5EBLA 2R2EA 2IWGA 2J6EH 3L5WB 3D6GA 4X9BA 3VRJA 6FABL 1QOKA 4JQIH 3VXNB 2ZUQC 1D3CA 1J8HD 5LCVL 3BOVA 5DHYA 1EMTH 2OQJB 4F8QA 1DE4A 2DQEL 4U6XA 4NSKA 3UJJL 1H5BA 4UINH 3HE7A 1KT2A 4O9HL 3QCUL 3ARRA 1JV5B 5H35A 1NDMB 3PHQB 1UB6A 3KPSB 5I1EH 1GHFH 2HWZH 4HWZA 5FUZL 1I8LA 3LCYA 4UQ3B 3UCRA 2QKIB 4HAFA 4PRAA 3O8XC 2YEZB 1KNOA 3F7YA 3EYSL 1HIMH 4IRJA 1IM3B 1E4KA 1HQRB 1QRNE 2OR7A 1ZTXH 1SY6H 3EO0B 3LKRA 3MREB 1MCOL 2OSLB 4OM1H 5E9DB 2A6KA 4FQPA 1FE8L 2CXKA 3VJ6B 3IVKA 3BWAB 4PV8A 4PRDB 3DX7B 1QPXA 1U8KB 3FFCD 4J6RL 3FN0H 4M61A 4B41A 1VA9A 1A7QL 2P8PA 3E0GA 4XAWL 5IFHH 3P4LA 2YPLE 3MRLA 5EDXA 3WLWC 3UBXB 3RVVD 2XYCA 3LB6D 5EU4B 1CFBA 4QHLA 4XC3L 2NX5B 4WO4A 4JN1H 3G9VA 4RZCA 1EZVX 1FNGA 1QBBA 2E3VA 2PTTB 3LDBB 4YHPB 1RZKL 1IZKA 4P2QA 5JZ7D 2VL5A 2BRQA 5T33L 3CVIL 2V7NA 3NPSC 4KZDH 5EZLA 4NQCB 3GFUA 1DBAL 1QSFD 5FEBA 4U7SA 2IC2A 1TZIA 4Y1AB 1I8KB 2YOCA 4WFGE 2F5BL 5KOVC 5DJZA 5TDNA 3HNVH 4RFEA 4ODXA 5FCUH 2OTWB 2YUVA 4G6MH 1DVFC 3VGHA 1SJHB 5HTSA 2E5EA 3AU1A 3CMGA 5BS0D 3OKMB 1VACA 1MJUH 4JZOB 4U1GB 2J8OA 4PJEE 1XCTB 1N6QL 2NY5L 2DLFH 4F7CB 3LB6C 1MVUB 4PJAE 4BKLA 3MLRL 3IKCA 3HRPA 3RVUD 3B3IA 4FP8H 4LNVA 1D9KA 3X14B 4BUGA 3WNPA 3WSQH 4M9OA 1NAML 5SX5H 2AJYL 4N9OB 4LCUB 2ERJC 1CLYH 3GSQA 1QSED 1FLTX 5DJCA 1QBMH 5GRVL 5D7IA 2DD8L 4GO6B 5HDBE 4KKAC 4OI8A 1JYNA 3DVGA 4R4ND 4OBRA 3QPQC 4X6DA 3RVTC 1L0YA 1AGEB 3QHZH 2Q7YA 3OB8A 4NT6B 3Q6GL 3PWPB 1FIGH 1YC8A 3QG6A 4XCEB 4G5ZL 4KK9D 1DSFH 5CBEB 5F3HA 4K71B 1IGTA 2BNUB 2DQGH 4QNPE 4U6TA 3MJ6A 1QEWA 5JHDE 5D7LB 1BM3L 4XZUB 5EZIL 5L2KD 5IB2A 2VH5H 1LNUA 1N5AA 5GRUH 2H2PC 2WLYA 1S7SB 2BMKA 4KI5F 2HN7B 4JRYA 2CR3A 1FFNB 4JANA 2DQTL 3P4OA 4EXKA 4DN3L 2W1NA 4XCCH 1IL1A 1MFEH 1RZJH 2IEPA 3BN9D 2D0HA 1OP9A 4XVTH 1A6ZA 4UIMB 5L2KB 4HT1H 1OSPH 4DOHE 1MH5A 2AABH 4FN0A 2HG5B 4NM4L 4WU7A 2NZIA 4GBXC 2XXMB 5J12B 3GRWH 4U1GC 2AK4E 1E4XL 1X4YA 2FH8A 2IBBA 4XI5C 5SWSE 2W91A 2OYPA 3O6LL 3T0XA 2DB8A 4Z7VA 3RA7L 1WZLA 4HHAA 2Z93B 3BW9A 5IF0A 2ZG2A 3OKDB 2PYEA 5D9SA 1NEZB 2N56A 2D4DA 1JF6A 1D5IL 3B2VL 1MUJB 3OKMA 1ETZA 5D1ZA 1RIUH 4ZS7H 1IC4H 2ERJB 3VH8B 3WMSA 2Q6WA 2R0ZL 1CGVA 4JFZL 4ORGA 1MQKH 5DJ2A 4PLKD 1ADQH 1PY4A 4EN3D 3GBML 3ZKQD 4PRAB 4JHWH 1LK3H 1A8JH 1DEDA 1E6JH 3ZDZE 5EUKA 2ED9A 3MODL 4X4XA 2ZCKH 3TM6A 3U7WL 3VXSD 1Y6MR 5F6IB 1NC2B 1IILE 4ONHB 2FYYA 4OFYD 3B5GA 5FFLA 2KKQA 2ED7A 1BOYA 3BWAA 4ELMA 1JPTL 4PGBB 2ADIA 1BQUA 4MDJA 4U33A 3TN0A 4C4KO 4M7KH 3HZKB 2C9AA 4TUJB 4HJ0D 4FA8A 1NC2D 1NCBL 3MV8D 4XMPH 5CJOH 4ODUB 5EO1B 4CUCA 3T0EA 5JW5A 1EHLL 4UT7L 2VISA 5E6ID 3UTQA 2Y06L 3HZYA 3OJ2C 4P46A 4AM0B 1DCLA 4AIZA 4XB8A 3P11L 4RX4D 1NDGB 5E2TH 2NY0B 3RWCA 1WJ3A 1A64A 1BZQK 5ICXB 3FMGL 1CLCA 2D2OA 4DCQB 4JG1H 5DJZB 2DF3A 1WAAE 2XPGA 5FF6A 4FZ8H 1JWUA 4ONFH 2CJUH 3I3DA 4LVEA 1FNAA 1AE6L 2AJXH 4RAHA 1S7XB 3C08H 1VACB 4JZOA 1CFVL 3UYPA 4M00A 2IADB 4WJ5B 3U48A 4PGDA 1A7NL 5IHZA 2E9BA 3MRKA 4N0RA 1KN2L 3BW9B 4N68A 3DXAD 1KJMA 3ABZA 5TH2A 5C8JB 3PWLB 3LKPA 1XIWD 4NQVB 4GRMA 4RMRA 1NAKH 4JO2H 3BD4A 5I15L 1X5XA 4WWKD 3VFNA 5DD5L 3SKOB 5EU3A 1VGKB 2XQBH 5HI3D 4RNRA 2BDNL 2EEBA 4ERSL 3REWB 4JQIL 5M95B 2XFXA 4J3VA 4GG6E 4L3EB 3V4UL 4J1UB 5BW7A 5L2JB 4KROC 5IVXB 4LEXL 1GGCL 4UI2A 4XVUC 5J13C 5HHNA 3T0EC 4PRHD 5BOPA 4WI2A 1FZKB 3MV9A 4V1DE 5C0CB 5ADPH 1J0KA 5CAYB 3BD5A 2G2RB 5IJVB 2DICA 4LLMA 3BDYH 4CVUA 5KTEH 4OAWB 2UZYB 1QVOA 1TJIL 2YKLL 3E3QE 2QTEA 2PO6A 4KRMB 2HT2D 5GRJH 4KKLD 2ZJSL 4M5YL 4ZTOL 4HKXB 4Z0BH 5CEXA 3QISA 5DD0L 3RWIA 1A14H 5EBWB 1Q0YL 5E9DD 1VESA 2WBKA 2NY0C 4MS8C 1CYGA 3H9ZA 5HGAA 4U3XA 2FD6L 4KVCH 3OKEA 1OT2A 1I8IB 1GGBH 4FXGA 1X4XA 1PSKH 2BJMH 3DI3B 2X05A 4XNQA 5CBAB 1FG9C 2FR4A 5L2KA 5E70A 2HJKA 3SE8H 5K59F 2FIKA 2OXHA 4M4RA 3W81A 5DSCB 3WFHB 3KPLA 3HMXA 4F7PB 1A6UH 4PTTB 1TZHA 4JN1L 3EGSA 4CVZA 4KHXL 1H3PL 4HV8A 3GSNL 1YN6A 1RZKH 3G6JE 3RGVB 1K8IA 4N90D 1J8HB 3U4BH 4NCC2 4OJFL 2CSPA 3DXAA 4OF8A 1IT9L 4XPAH 2C7UB 5LXGH 1H0DA 4Y1AD 4LGSB 1E4KC 4TRPL 1MI5E 4JGMA 3EOBB 2WK2A 3QT2A 2FWOB 3U9UA 4GQ9L 1NFDF 4N9GA 1JZ7A 4PJAF 4OZFA 1KJVA 1NC4A 1T21A 2AJSH 1ZV5A 2R23A 4G6ML 1G9ML 1SYSB 4XBPB 5C09B 5J1TC 1QR4A 3QXWA 1NMBH 4G6FB 2HH0H 1NDMA 2C1PA 4NZJA 4LSPL 1T2QH 5TGBB 4KKBC 4ETQA 2X1OA 1KIPA 3GI9H 3JWDH 3MRQB 3QA3B 5EOCL 3O3DB 1H15B 2B4CL 4Q9BA 4QHUA 1VKXB 2R1YB 4DAGL 1RIHL 3P0YH 2A9ML 2AGJL 1CFNB 2AJYH 4RIRB 4MNGA 1XR8B 5HI4C 3L5IA 5KVEH 1E4WH 4JO4H 5I6XB 5AG9A 5SV4A 4RQQB 1AGBB 3IVKB 2H8PA 4OCWH 3SKUD 4J12A 3U46B 2RHEA 1AR1C 4LVHB 5CILH 2AJUL 3THML 4DJMA 3R8QA 3WDJA 2OL3L 3VA6A 2C4FU 3D39A 1KUMA 4K8RD 5C0JB 3HRZB 5FKAB 2D7MA 4XX1G 1DSFL 5FDWB 5AZEH 5C0CD 1QZ1A 5EH1A 1U8QA 4K3DH 2EC8A 4LAQL 2DQGL 1JN6A 3QUZB 4UDUA 3IFPA 3TLRA 3K2MC 4W4NA 1KCVH 4P2OD 3QUMA 5EZLB 4L3AA 4PJEB 5EZIH 4ZD3H 4L3ED 2X4SA 4XHJC 4BSVB 5ANME 1J0JA 2F9BT 2V17H 3I50H 3MTRA 3LKNB 3TNMB 3R4DA 3BHBA 1YY9D 1BLNA 1DEEA 2VQUA 3OKLA 3WKML 1B88A 2NQCA 2X4OB 1I9RL 5GGUA 2LU3A 5TH2B 2R0WH 1H8NA 1RZJL 3F5WB 3JZ7A 3X12B 1ZLUK 4OB5L 4U1KA 1P84K 4NQUA 1E6OH 5HGDA 2F8OA 5IBTH 3UTPD 1J1XH 3X13A 1MRCH 3S8WA 5SWZA 4F2MA 4ZOEA 1U3HB 3JUZA 3D18B 2GAZA 3RPIB 2MCG1 3U0WL 4NN5C 5I0DA 2AEIT 3LZFL 4HH8A 5KG9B 4EVNB 1BJMA 3LHPH 1EZVY 4TNVF 1LO3L 5CHNA 3PGFL 5D2LB 1IVLA 2AJ3A 4IIQB 3NIFE 4RMUA 5K9JH 1FZKA 1P4BL 1IBGH 4GKOA 4JO3H 4KQ3L 4OCSL 4BQ8A 4KZEH 2VL4A 4X7EC 4ONGL 1FFPB 1WFTA 4XNXH 2HTLD 4LOUC 5D70H 3QCTH 1J05B 4PUBH 2B0SH 3IF1A 2R8SL 5HSFA 3MUJA 5F3BA 3VFOA 5JTWA 6CGTA 1OWRM 2VLLA 1E6JL 3U9PL 4RIRA 1XR8A 1FBIH 3CH1A 3W11C 2C3VB 4E5XA 3NFPA 3U4EA 4OLZL 5CWSA 1PVHA 5JNYA 2BVEA 2RJMA 2LFGA 4Y89A 4GMTL 4NJAL 4AMKL 1ZVSA 3DHMA 1FCGA 1JUFB 3I02A 4ZNEA 3RIAF 3QNXA 2LU7A 3OTTA 3MV7B 4G7YL 1W72B 1VGEL 4Y19E 2OK0L 1CXFA 3SDAD 4NFDA 3W82A 4CADB 4PV8B 4YLQT 4F7PA 4HFWA 5GGQH 1JGVH 5F71A 2BFVH 4RMVA 2HFGH 2EO9A 4C56A 4OLUH 4LNRA 2IPKB 5E8EA 3TFKD 4YBLC 2AERT 3MLSH 3HG1B 5C0BB 3ZKND 3SOBL 2ITCB 5CMAB 1EFXB 4BSVA 2C1OA 2NZ9D 3MLYH 4OD3H 4NUJA 5ITBL 2I24N 1T4KB 2LTQB 1X3DA 4JFOB 2WBJD 1TETH 4N9GB 3OKDA 4G8IB 4MMZC 3P30L 5JW3L 3FZUD 4IS6B 4JJ5B 3K74B 2Z92A 1BBJB 2AJXL 4XCYB 2WANA 5D93B 4TNWF 2B8OT 5L88L 4R2GC 2UYLA 1DR9A 2XA8L 3LPFA 4LSTL 3DRTB 4HWBA 4X5WB 4PJDF 4PIRF 3HR6A 5HHMD 4U6YB 3VD9A 4HD9A 4M5ZL 2DQJL 4XWGL 3CD4A 4QRPB 4XHQA 3VW3L 1LK2A 4KROB 1GGUA 3S96A 5EUKB 5I74B 2JCCA 2PW1B 4NQEB 2D9CA 4GT7A 5T1LA 3RDTB 4QHKJ 2YA1A 4ERSH 4DVRL 3JTSB 3JBG7 4P2RE 3RKPA 1WITA 5J0BA 1MRDH 1U6AL 5H37G 3Q6FB 5I1AB 4FFYH 1U42A 4G6KL 4MDIA 2F19H 3SJVA 3HZKA 3OJVC 3P9LA 2JB5H 2A6IB 2IH1A 2VTFA 1T1YA 2LAAA 4HKZB 5LQBL 1I8MA 4E5XB 4LPYA 2MHAA 3MZGB 5BRZD 4G8GA 4WV1C 1FFQA 3W9DA 4OCXL 2DQIH 4R7NA 1RUKL 4Q9RH 3C5JA 2NPLX 1S8DA 1OW0A 1NKRA 4KKBD 4I18A 2J88H 4GRWE 1P2CA 2VLKA 1L9NA 4IRSC 1ED3B 3LD8B 1LP9E 3MOBH 3QZWB 5C0IB 4HS8H 4HFWB 1XGRB 4LAJH 3EZ8A 3V5HA 2VXSL 3B6SA 4P4KD 2W9EH 3MV8E 5DD6A 4CRPA 4IEFB 3DVIA 2F54A 4JM2D 4MQTB 5GJTL 2RB8A 5T3XH 5JXAH 1IGCL 1AR1D 5FV1L 5MENA 4TYUA 4N0FB 4GG6B 3V4VH 3WLBB 1KB5L 5GGSB 2IANE 4M43L 3KXFD 3HMXL 4L8BB 2HFFB 5DI8A 3FN0L 3WHE1 5DEGB 2XN9E 3SGEI 2R0KH 4ZFGH 4NQVA 5CIPA 1T0PB 3VXMD 2GK0A 4YBHA 1BBJA 5I76B 1M71A 4PJBE 5E8OB 1J0YA 4NNPH 2FO1A 4JQXC 3MRNA 3VGFA 4R26H 3L3KB 3ARDA 5IVXA 2DQCH 3C2AL 1F11B 2Y6SD 1QFUH 3O3EA 3D0VA 1IGFH 3VDAA 1WSST 4OI9A 2ZKHH 4NN7C 4FXKB 1OTSC 1D5XA 1X6NA 5CUSH 2E7LC 1S7RA 3QJFB 5KSUA 3KDMB 4HS3B 1B2WL 4QLRA 5EN2A 1JTOA 4XXCA 2GYSA 4I0KA 4M61B 1JGEB 4X6CB 2B39A 1Z9SA 1JUFA 2A9MH 3MUHL 4HKXA 4X4XB 1I8MB 5KVEL 4BM7A 4ZSOB 1RSFA 2V5RA 4JPIA 3QQ3B 1KG0B 3FONA 1UKTA 3RKDC 3C6LB 2NY5H 1ZHKB 3KPQA 4JKWA 1EO8L 4J4PA 3JXAA 2ZUXA 4OCWL 4JQVA 4WO4B 3UC0H 5I30L 5FYLD 4HCRH 1FPTL 3F7PC 4PS4H 4XPHH 4I0PC 4Q6YA 2QQNL 4FABL 1G0YR 2DQDH 3WFEH 1CDGA 2VZ3A 4KRPD 1K8DB 1P7QD 5BO1H 1FG2B 1FGVH 5IW1A 4AEIL 1JL8A 1MIEL 3O11A 2EIBA 2CKNA 4NUJB 3VG9B 3RHWK 3B6SB 1ACYL 4C56D 3PJSA 4G9DB 3IETA 4JPKL 4U1MA 3RTQB 4AL8H 3O8XB 2FBJH 1FIGL 3CK0L 5I9QC 5C09D 5E94A 4LSUL 4XTRC 2BVTA 4JB9L 2FX9H 3BZFB 3EOTH 4LKCB 4KPHH 1ZEAL 4QRPA 2Q8BH 2GK0B 5C6TL 3SDDA 5CEYB 5D2NE 2Q20A 1MRCL 3L3HA 1MNUL 5EIVA 5CGTA 1FQ9C 4YPJA 2Q1EA 4D0DB 2HFEB 4MWFA 1NFDE 1H15A 1PX4A 5GIRA 2V5SA 3MLZH 2DTMH 3LZFH 1YEEH 4ZUTB 1J86A 1HYRC 4P9HH 1QUNA 3V7MA 2YZ1A 1UB6B 2MQ0A 3KPSA 5D1XC 1WZ1L 2Q7YB 4N1HB 4EXPX 2IGFL 4OCSH 3CX5K 2XNAA 2XFXB 4Z7QF 4QHMB 5DK0A 4G8GB 5IVXF 3QHTC 4N90E 4WO4C 2BNUA 2FEDC 5FM8A 2V2WA 4KZDL 1EV2E 1KC5H 1S8DB 1FBIL 1X5FA 1RIUL 1YA5A 3CMOH 3B2UD 4J23A 4JO1L 4PRDA 4S1DC 2VABB 2FJFB 1B0RB 5CKAA 5L6YH 2NX5D 1FC2D 4IM8A 4Z9KB 3PV6B 1R5VA 3MODH 5K9OB 3OAUL 4TVPE 2N7BA 2EZ0D 2IFGA 4TPRL 3FFCE 4YDIL 5T1LD 1N4XH 2ZUQB 3TPKA 4L5FH 4NUGH 3H3PL 3S3SA 1I8IA 1MELA 2XZQH 3R1GH 3ARGC 1JGVL 3FQXB 5CEZD 3D85A 4Y16B 1PKQE 3ZTNL 2Q76A 4ISVA 2CDFB 4P3CL 4Z95H 3FB8A 4Y5XC 5E95B 3IRPX 1LE9B 4U1KB 5TQ0H 1GGTA 5E56A 5HGDB 1CLYL 1WCBB 5CLWA 3NZ8A 5E2UL 1JTPA 5HHPA 1R5IB 4OZHE 3MBEB 4ZS6D 4OIIL 1BD2A 4LPUA 1KCSH 4I9WD 1LO5B 3B9VA 2D7PA 4QT5A 3SDXE 4D9RE 3P11H 4XC1L 2X42A 1QTYT 2IF7A 4YXLL 2D7QA 4PJ7B 4FQCH 5KSAC 1MLCA 4U1IA 4Y4HC 2J6EL 4UQ2B 4ZDHB 1J8HE 1T2XA 4LSTH 5DLML 1KIRB 4KTEL 4PY7B 5FB8B 5J6HB 1G7LA 3QIBB 3CDCA 1RK1A 3D1MC 4NKIH 1Q9WB 2HP4A 3IF1B 3NCYS 1G6RB 1KIQB 2DQJH 1CWVA 4FZ8L 4P57A 4XWGH 5EUOF 2QLVB 3TT1H 2G5RA 1BVZA 1PX3A 3T65A 4NQDE 5I8KL 1BZ7A 1HI6A 1IGMH 3MCKA 1CK0L 4I13B 2H41A 2DQTH 4CDHA 1AHWA 3PABB 1P6AB 2B1HL 4PJ8B 3MYZA 3GB7A 3ARBB 1U8OA 3T4YA 1T3FB 3W0WB 1CFSA 3T77A 4PJGE 5IB4B 4E9LA 1NQBA 4U1NA 4F7MA 3H9SE 5GZNC 1S9YA 1YQ2A 1XGYL 1FYTE 1UZ6F 2DQIL 5JDSA 3DROB 4APQB 3CVHB 5IQ7L 3OAZK 4Y16C 2Q87A 3ULVD 1F13A 1OARH 3O6MH 4PJHB 3WJLA 5GPRA 5J06A 3JWOL 4OLWL 8FABB 3OR7B 4JZJB 1Q94B 3E8UL 4JRYB 4LHUD 4TSAH 5DC4B 3DUUB 5KSAA 1A1OB 1U8QB 1W8NA 2VXSH 3D85B 2O93L 1REIA 2X4TB 4HDIB 2O5ZH 4I8DA 1J9CT 1ES0B 1A7RH 2H2SC 1IGCH 3MRFA 1A14L 1DBAH 1Q0YH 3ELAT 1QRNB 4A6YH 4PG2C 1F5WA 3UZEA 1GPOL 3L3HB 5D1QC 3ZDXE 3TNMA 3ZKXC 3VFSA 1BD2B 2KZ1B 2ID5A 3QXAB 3QFDB 4GW4A 1EXUB 1RHHB 2O61B 3CXDL 4GAJL 1XGQA 5D6DA 1BAFH 4LBEB 3MNVA 3WEXA 1AR2A 1OAUH 3UTSE 3VXQB 1OB1A 2Y36H 5IKCB 3QG7L 3OR6B 2FHBA 2VYRE 5HGBA 1MLCB 3GHBL 3MJ7A 4XMPL 3WXVL 4EQ2A 3IJHB 1O5DT 1S9XA 4KHXH 5IJVA 4WW2A 1BZ9B 3VFMA 1E0OB 4NN7B 1I3VA 3QEQE 4FQ1L 2Y06H 3PDOA 3TBWB 1ZT4B 1G7QB 2EKJA 2P8MB 3FQRB 4JRYE 1U92A 1ZHNB 3GSXA 1DJSA 2WWMD 1KYOK 2GFBB 4KVNL 1KENH 5I1GL 3T2QA 4KTDL 2R2BB 4YIQB 3L5HA 4KJWD 1U3ZA 3BMVA 1H3UA 2VUYA 4LSPH 4U1NB 4QCIA 4F7MB 4JEGB 2M26A 1XGPB 4WV1B 5F1SA 2VO5A 4G5ZH 5EIIA 3QDMD 1BFVL 2DJUA 4HIJB 4MJ2A 5HD8D 4MCZA 1Q9KA 5DFVC 1B0GA 3QXDB 4PB0H 4N5ED 5I2IA 2MTPA 2F54B 2HAZA 3QQNA 4WO4D 3WJLC 4XP4H 3M17A 4PJCF 1D5BA 1MIML 4YBQD 1NMCB 3OAZH 1FGVL 4LVOC 2Q86B 4FQJL 1CXKA 2CUHA 1F6AA 4RX4A 1GZQB 1YMMD 2VSCA 4LEOA 3BPLC 4PGZA 3UO1L 4LHJB 4KHTH 4PJFF 5T1MB 3RL2B 3DV4B 2BVQB 3TN0C 3EDKA 2AJUH 4Q58C 4YEFA 3FOLA 3QQ4A 4Q0XH 1OLLA 2YC1A 2AI0L 3TVMD 3HR5A 5J11C 1RIVL 5EA0L 4PJ7A 3LEYL 4ZO6A 1WWCA 2X9YA 5EOTB 5JORA 2Y4SA 2HKHL 1HWHB 4NZTL 3ARVA 4KRNA 1KIRA 2DKUA 3BDYL 5EG6C 2VITB 4CMMA 2H1PL 4M7ZC 4JG0L 3LDBC 5JLZB 2FLBT 1BGXL 2EZ0C 4KH2A 4KY1H 1XR9B 3OR6A 2ATKA 4LLQB 2RCSH 3L5XL 4ZS7L 3ZSSA 1IC4L 4L8CA 3UAJC 2XWJA 3QUZC 4JREB 5C6PB 3KVQA 5FO9A 3MLZL 4PJ8A 4FFVD 2VLRE 4P4KB 3GBMH 3T4YB 5MI0C 1S7UA 4P9HL 3BGAA 1IM3A 2VDNH 2X41A 3SE8L 4JY4A 2ICWA 4WI3A 5ICZB 1FO0L 3WBDA 1MCPH 3EO0A 3NCFB 1WFOA 2IGFH 3FHQA 5IHUL 3VFUA 4MNHA 1A6UL 1C5CH 1G7IB 1QSFE 1ZHKA 1S9VA 3KPQB 4AQOA 2APVA 1T66C 1CU4H 4MB3A 4WEBH 1I7TB 3ULSB 1U8JA 4CW1B 5D7SL 3RL1A 1EUTA 2VZSA 4EJ1C 2J2ZA 3PGFH 2BOCA 4OTXL 5E5RB 5EBWA 4J3WA 3SO3C 2DLEA 3DBXB 4WUUA 4Z77A 1IBGL 1P4BH 2QV2A 4JO3L 1KB9K 4KQ3H 2EKSB 1SVCP 2ESVA 1I7RA 3F65A 1DQDH 1LDSA 2UWEB 3QCTL 4RZCB 5IEHB 1NC4D 1BLNB 3OKLB 5BZWB 5GS0C 4DKFL 4Z7OF 2VN4A 3V52L 2CRYA 2DYPD 3GSNA 1ZWIB 4HXBL 5BV7L 4JFYA 3MRGA 2MKLC 3QZWG 4TPRH 1KLGA 5DJ8A 3DIFA 4PTTA 3FRPG 4LCWB 5C2UB 1DQTA 5FA3A 2BVYA 5FOJA 2XZQL 4NC0B 1RUAH 3F7RA 4NJAH 1Q0XH 5F70A 1V5JA 5DQ9A 4DUWA 3EDDA 2APBA 2Z8VC 4P3CH 4Z95L 1X5AA 5GS3A 4WI6A 5I9QB 3L3IA 5TQ0L 2YPKB 1TQCB 2C7UA 4G7YH 4IMKC 5CEYA 5CINH 5JO5B 3QUYD 4DWHA 1CFVH 4L8BA 1A6PA 2F58H 5E1HB 5GRXG 1N3NA 2F53B 3SKMB 1TTGA 4JFXB 5D1XA 1VFMA 4CVXB 1NAKL 4XC1H 3FN3A 1U92B 1ZHNA 4AEFA 3RX7A 2XN9B 4L8CB 1QKZL 1PLGL 2VKWA 1WV7T 3N85L 4X8JA 5KSBA 5I1JH 5ITBH 3EO9H 5DUPL 2ZUWA 2VDLL 1NL0L 1N7ML 2R0LH 5EC2A 4OGZA 4W4OC 1MREL 4YIQA 3STZA 1HSAB 1QFOA 1S7UB 4QTIH 3UTTE 4KXZH 1BBDH 2ICWB 4O4YL 1LMKA 5L7XL 1FH5L 2GW5A 1CI5A 4H0GA 2GSIA 5ESQB 5HDLA 1QSEE 4XPTL 3G08B 1M7XA 4RQQA 3G5ZB 4RA3A 4HIJA 4HK3N 4BFIB 1WZKA 1LO4H 4QYOB 1I7TA 3ULSA 3D2UA 3DGGB 4YE4L 3BZ4A 4LNRB 1TVHB 4WWID 4X98B 2FDBP 5C0BA 1ORQA 2IBZY 2VDKH 2DLGA 1ZA6A 1U91A 2GHWB 1I7RB 1S9WB 4PRIB 3RVUC 3ROLB 4Y2DC 4CMHC 5GS2D 1RHFA 5J56B 1OPGL 3K46A 1P7HL 2EDFA 4G6KH 3FO2A 2BJML 5DVKA 1DL7L 4KXZI 4NNYA 5EFIB 4JFYB 4OLWH 3MJ9L 2D03H 5DRZB 2E7CA 2WV3A 4LVNC 4Z7VF 1A2YA 1T7VA 5SWZD 3QFJD 3U0PA 3U6RB 1DEEB 1RZ7H 1YEKL 4ENED 3QI9C 5GZOC 1LO5A 1HHHA 3IETB 1H8OA 1JRHL 1FO0A 3ZKXB 2F8XC 1JHKH 1YEFL 2IG2H 1NJ9A 1OAKH 2J88L 4OJFH 4M7LL 2BSRA 1JHLL 5JQ6H 1DQQB 4QRRE 32C2A 5DQDL 3RTQD 3RDTA 3TV3L 4O2EB 5I1KH 1OSZA 3O4LA 1KPVA 1FL6B 2QSCL 1EO5A 3AREB 5C71A 2KUTA 1T03L 1NGZA 4PJIA 1H5BC 2GTWA 5B38A 1NMBL 2K3TA 4P23A 2WM0A 3ZL4L 1NCCH 4MQSB 3QXVA 1KTDB 5KW9L 2A77L 5F1IB 4J3TA 3N1GC 4OT1L 3DTXB 3QIBC 3IFOB 2FYYB 4D3CL 2JJWA 1PAMA 5GGQL 4UNUA 2A38A 2OXGA 3G6JB 5I1CL 3ARBA 4BZYA 1NH6A 5HVFB 4JM2F 4LPVA 1RIHH 3P0YL 4CW1A 4ZPTB 4RFNC 2XG5A 3UDWA 5E5MA 2P5WB 3JWOC 4U1SA 1NAMB 5MHSD 3MC0A 3BPCA 1VFUA 4KV5E 4KV5F 3MBED 4R2GB 4KJPC 3SGJA 3D2UB 2LVCA 5C09E 1KCRL 1UXWA 1BREA 2IAMC 3P30H 5JW3H 3BIKA 5CILL 4AM0A 3THMH 1P9MA 3RWGB 5L88H 5E1AB 5B38G 4QXWA 1WF5A 3QUKA 5CUSL 3K8KA 1HKLH 1QLEH 4ODTH 3S34L 5HI5C 1V3MA 1ORSA 3IDXH 2NY1C 5DEGA 4XBEH 4YUEH 4IIQC 2EEAA 4QXGH 3L7FA 5AEAA 4JVPA 5DRZA 5EZOH 3SKNA 1JF1A 1N8ZA 25C8H 3CIQA 1F4YL 1CD1A 4GRWH 3MXWH 5DUMH 3WNOA 2FCBA 4MA1B 5KANG 3KPSE 4DVBB 3QFDA 1EXUA 1RHHA 2W9DH 1F3DH 3ZE2E 2Q76B 3G6DL 4ISVB 3VFGH 3UBXI 2BHUA 4BH8B 1GOGA 4LL9A 1Y6KR 3TO4A 1ZT7B 1OAXL 3G5XB 3WD5H 3DRTA 4PRHB 2HKHH 4ZNEE 5KAQG 5GISL 2YZ8A 3RVXD 5J6GA 2QKIA 2A0LC 5T3ZL 1KFAH 4YHOH 1CFQB 4IMLA 4NQTA 1RJCA 1EPFA 1G9NC 3MRBB 4GG8B 1ONQB 1ZT4A 2NY2D 1X7QB 4KY1L 2C4FT 4Y4HA 2IAMA 1KPRA 3CK0H 2ZOLB 4UQ2A 3ARWA 3L5XH 4ONGH 1OGTA 2P5EA 1UACH 4IBLT 1AO7B 4JFHD 4I0PD 1KXQE 3H0TA 5I1AA 2R8SH 5FK9A 4MDIB 3S7GA 4ZAKD 2VMFA 1DANU 1RUML 3FOMA 2Q8BL 4X9IA 5T3XL 5JXAL 4XPBL 4P5TC 3QJHA 1MCPL 3P73B 3IDIB 5DMKA 1MNUH 3SJVD 4MJIE 4L4TA 2J8UF 4PRIA 4RGNE 1CIDA 1Q9KB 1U8OB 1B0GB 4HUNB 1CU4L 2IAND 1T3FA 5I17A 1JGLH 5CJXC 2D0FA 4LLDA 2CDEB 1OGAA 4IOFD 2VL5B 3X11B 4KDVA 4Z5RB 4LK4A 5C6WH 2NY1B 3HC3H 5ESVB 4PFEA 4WGWB 3MRPA 4KROD 5F7UA 5D2NC 4M62H 1I8KA 1PG7L 4R26L 1DQDL 3SGEH 1FORL 4RWHA 1YN6B 3EO1A 1ZLWK 4WWKC 4HLJA 4R0LA 3CFJA 5T5FL 4X6DE 5BV7H 5I74C 3FOLB 3J7HA 4Z78B 3SOBH 5D7JC 3OR7A 2YC1B 2W59A 3MZTA 1YNTB 4Y2DA 4G80A 1FNEB 4LARH 3IDYC 3MLYL 2OL3A 4KU1A 4OD3L 4D0DA 1TQCC 3VXSB 4G8EA 1FYHB 4LIQE 3TGXA 3IDJA 3MRCA 1UJ3B 2B20A 4HDIA 1FNHA 3TT3L 4WIQA 2GTWB 3W11D 4BH8A 1R24B 3C5ZC 4RCAA 2NW3B 4POZD 4KRLB 3ZDYF 4UTAL 5CINL 5IFJA 3CSBA 4P59H 4KMQA 3EJYD 1HHJB 4MD4A 3D9AL 1ZOXA 5CD5C 4GW4B 4PLNC 2AJZB 3SQBA 5FYKD 5B39B 2XY1A 2R1YA 2YUWA 2VXUH 1S5HA 5E24E 3QEHB 2DQDL 4LKXA 3KPMB 1ZHLB 3FQTA 3DUHA 3VXMA 2OP4L 2D7NA 3MROB 1AXSB 3VU2A 1VEOA 2ZCHH 5DWUH 3MV8A 2AW2A 2GEEA 3QG6B 1OGTB 2AK4A 4ZTPH 4JCLA 5ACZB 1U8NB 3GMOA 5TFSL 4YC2C 3QHFL 5F88A 5AYUL 2FJFA 4MMXC 1B0RA 1K2DA 3EJZD 3VXUA 5HHMB 3MYJB 3EYQC 1HCFX 5D96B 1UXWB 2Q3AA 3NABL 1N64L 3P73A 3JTTB 2IPUG 5GS1B 4Z8FH 3HRZA 3T1FB 2JJVA 1P5VA 3RX5A 4XP5L 1NCDL 1RZFL 4Q9RL 5BZWA 4YE4H 2N1KA 4NC2B 3HC4H 4NWTH 4Z5RA 2NXZB 5GGTL 3B9EA 1FDLH 2EE2A 4HS6B 2VDKL 2X40A 2WMPA 1FG2A 5FYLE 5I8KH 3MOBL 1J1PH 4HUUB 1B90A 3SKNB 1FL3A 3BKJL 1MSPA 3GNML 3HNTH 4X6FA 3OKNB 5TPWH 1DL7H 2RR3A 2NY7H 3E3QC 5C0AE 3DECA 3SBWA 1U9KA 3L3IB 2XTJC 3QFJB 3R8BB 5GGSY 3E6FA 4FQLH 1KLUB 2RIKA 1VFAA 4GMSH 3T0EE 3HS0A 2Z31B 1Y0LB 3OZ9H 3WE6B 3EOYG 1N59B 2BY2A 1DUZA 4LCYB 4Z7WB 1MHCA 4EOWL 5ERWB 1LP9B 3N06B 1YY8A 2HFEA 1JTTA 3WFBL 2DLTA 4LSRL 4OGYH 1NUGA 1AO7A 3K2UH 1CD9B 3F12B 4RAUB 1XF1A 3O3AA 2ICWJ 5T1KD 4MYWB 4MCYB 4LMQE 2NY1D 1RULL 1RZJC 4N8VB 1D6EB 2YBRA 2A77H 4RMQA 3KXFE 4ODUA 4Y5XB 2PUQT 3GMOB 1KGCD 3S98A 2VLRD 2D31B 2VUOA 1PGRB 1EJ6A 3RY4A 3FT3A 3DLQR 4W6XB 1OAUL 3QG7H 3DVNB 5E2UH 4POYA 2AEWA 1BEYH 2H3NB 1IKFH 5KSAB 5A16A 3GEWB 1A3LH 3S88L 1D6VH 3OGCB 4NM8H 1A9EA 1JWUB 2NXYC 4NO2A 1FP5A 4ODHL 3KLAA 7FABH 2J8HA 3TA3B 4MXVE 2CK0H 4X4YA 3RZWA 5A40E 3U0PB 3U6RA 4Y2DB 2OL3B 5HHOA 4I48B 1G9NL 4HBCH 4UDTA 3FJTA 5F8QC 1VFBB 3FQNB 3MNVB 2DDQH 4OCNC 5BMFH 1AGFA 4KAQL 1IGJA 4LFHG 4LRIA 3VFNB 3LQAC 4OLEA 1QFWI 5CJ8A 4GW5B 5FUCE 3REWA 2EDTA 1S9XB 1TJGH 2EYTA 1JFQH 4P2QE 2R4RH 2BVOB 4KPHL 5B38B 1S5HB 5IMKA 4JFFE 3ULUF 1RV6X 1G1YA 1K4CA 2BXYA 3RUGE 1OAXH 3RWDB 3TBTB 5HYQA 3I6GB 1FFOB 2X1WL 1XGYH 2ICES 2AK4B 1B3JA 1N3NB 1U8HA 3F8UB 2DQEH 1KB5A 1H5BB 5ISZD 4HUVA 1JV5A 3FT2B 5F9JB 5A3ID 5GS0H 5HYSB 5HJ3B 3JWOH 1WIOA 1WZ1H 2VQ1B 5EA0H 5DC9B 1GHFL 5JMRA 2YRLA 2LE9A 4U1SB 3JTTA 2PO6D 3K7UA 3B9AA 5KSVB 4TSAL 1UB5A 1CXEA 1Q9OB 5C70A 3QEQD 5E4EC 1NCTA 1OM3H 4Q9QL 3EYSH 2MSPA 3IB4A 3T0AA 5KBNC 3HPJB 1EHXA 1F4XH 2NXYB 1A6TB 1SY6L 1XIWC 4JVWA 2RCSL 4Y4FA 3KJ6L 2HTKD 1CF8L 1R6VA 3DUSA 3GJFK 3LV3B 1BMGA 3LKOB 5JDSB 3BN3B 1MJJA 4AJ0A 4HWUA 5JUEH 2FO4B 3BPNC 3LS5L 4NZRL 3OKNA 1A7QH 1J8HA 2JELL 4HUXA 5BVJA 1AKJD 3GHBH 4WWKB 4Q97A 1G6RH 1HHKA 1AIFA 4JM4H 4XWOC 4X99A 4HF5H 1QQDA 4ZPVB 3ROOB 2R29H 3VFPB 4PJ9B 1ZVHA 4DK6A 1UXSA 5T5FH 3PHOB 4JFDB 4OTXH 3GHEL 5IJKC 3EYQD 5SX4H 3TO4B 2YA2A 3SY0B 4PRPB 5ERWA 3E2HB 1UH3A 1KCKA 3T3ME 1JZ6A 1KIPB 1L0QA 4PJ8C 4XNMA 4MXQD 1I7ZB 4ZYKA 4PJGA 5E2VH 4XGZA 4ZUSB 5H2BB 1BF2A 5J9PB 2Y5TA 3OMZA 3NCBB 4MD0A 4IMLB 4JFHE 1VPOH 4XNYH 5FYJD 1JYWA 1CFNA 1K4CB 2FRGP 1QD0A 4XPGH 5IOPB 4MNGB 4ODBD 1YEJL 2QBWA 5IGXL 1NFIA 4XBGB 1OTTD 4WDIA 3BKMH 4S1DD 3CVHH 4DGYH 1EIBA 1Q8MA 5B4MD 2DLIA 1OW0C 4KUZL 4WW2B 4NBYB 2J8UA 3MLRH 1NGZB 4PJIB 3DNKA 4LIQL 1RMFH 4MJ5A 1OAQH 3LPWA 3TT1L 5F9JA 3RNKB 5B8CA 2YMXH 4QF1A 5DUBA 1R3JA 3DBXA 9CGTA 1G7HB 2VQTA 3NZHH 4ZTPL 5AUMB 2P43B 5JW4Q 4S1SL 3DSFH 1MAMH 1JPGA 4K23L 2YS4A 4O5LL 3KPSD 2F8VA 3UJTH 4OQTL 3OKKB 1AKJA 3N1MC 3BP6B 2DWDB 4XVSH 2P5WA 5IHBA 4QO1A 3QUMB 4Y4FB 3VD5A 4RFOH 4X4ZA 1QKZH 1GGIH 4V1DB 5C0CE 4NZTH 3KNBA 3EO9L 4FMFA 3S35X 3VE0A 3BEVA 3GSVB 4MAUL 4XAKE 2H1PH 1T6VN 3OJMB 3TP4A 1P4LA 3UJJH 1KXTB 3LY6A 4I9WE 3VMOA 1U93A 1JZ2A 1BBDL 5JIKA 2VAJA 5D1QD 1FDLL 3QCVL 2EIEA 2W0LA 1XGUB 2FX8L 4HFUL 3QO1A 2BY0A 4P3DB 1Z0NA 2HWZL 3GJFB 5JO5A 4PJIE 1F6AB 3GBLA 5I8EB 1CL7I 1ORSB 4KK9C 3VA2C 4HIEB 4JFPB 3S9DB 3BVNB 4FFZL 1CICB 1NGWB 4DEPB 1AJ7H 2GJJA 2E6QA 5MHSE 1V8HA 2XICA 3MNZA 4PJBF 4MXWH 3CU7A 4CJ0A 3U82B 1JF1B 1N8ZB 1ODAA 1NSNH 1T6WA 2GTZA 3RWDA 3G9AB 5DYOA 3O41B 4XNMB 4MWFB 3RWJB 4K07A 3HZMB 4KTYA 5BXFA 3LD8C 2P47B 4MA7L 2NX5E 5JLZA 1A7BA 2H9GA 3PIQB 2RQ8A 1MFCL 5D1ZB 2NXYD 1QG3A 2D03L 2IH3A 3MA7B 4PGCB 3VWJA 4R96A 3AS3A 3K0WA 2XNAB 4NQCE 4LLWA 2DQUL 4KKCC 2GITB 2N4IA 3P0VH 3K2UL 1I3GH 5BV7C 1BVKB 3C60C 4QRUB 1CGSL 3N9GL 2X4QA 2V2WB 5DJAB 3QI9A 1JVKA 1AD0A 4YNYB 5GSVA 1K4DA 1T22A 4LVOB 1QO3A 1EEQA 5DQDH 5I8CB 4PG9B 4Y5YA 1VSCA 1MHHB 1ZLWH 2ICEB 2GQHA 3WHXB 2AK4D 1Q0XL 2M1KA 3TN0B 2XTLA 1V7NH 1W72L 2BOCB 2VWEC 5KZCD 5SWZE 4DGVH 3IDIA 5KW9H 5DMKB 3CLEH 1KBGH 2BVPB 2ITCA 5ISZE 4JFEA 4L29B 3HC0B 1BFVH 4QOKA 4QRQA 2YRPA 2EDOA 4M1DH 4NPYB 2F58L 4FQXD 5E8NA 3LH2L 2MKWA 3QEQB 4FP8L 2O5XH 3WSQL 5ESVA 5E5UB 3QYCA 1MY5A 4IS6A 3MRRB 1UA6L 2R2HB 2ADJA 5IESL 1EJOL 4GXVH 4NP4H 3NZ8B 3BZEB 1CBVH 4H88H 1DQQA 1FAKT 1QBML 1TCMA 2DN7A 4F37F 5FA3B 1MHEA 3MA9L 1JI1A 1K6QL 1WBYB 2I5YL 4Y2DD 3WN5B 1CICA 1NGWA 1XCQB 2QQLL 2VOTA 4KHTL 1NGXB 4QT5B 1EAPA 4O51A 3JV4B 4LHUA 1HDMA 4O4YH 1ZGLM 1FH5H 1RURH 4MA8H 5JHDB 3OWEA 4WY7H 4UBDD 4J4PC 3AB0C 3QDGD 5ANMB 1QLEL 3D3VA 4N5UA 3HZMA 5BXFB 3BGMA 1RK1B 4H26B 2G75B 5F1NB 3RP1A 5CJBA 3VCLA 1UEYA 2ARWA 3NTCL 5F7MC 1R24A 4P23D 1NBVL 5EU3B 1FHGA 3O4LD 3AY4C 4GW1A 2IH3B 1TCRB 3DXAE 3GSRB 3VRLE 5DJYB 1FZMB 3WNLA 25C8L 4NKMA 1C16A 5HDBF 3FL7A 5IFAH 3BJ91 2W9DL 2YEZA 4Y88A 4QRUA 4LKXB 2X4QB 4YJZL 3QI9B 4P2YA 3VWKB 1EEYB 1NLBH 1WUNT 2NY5C 3ZYZA 2QADB 5C0DA 3ARDC 35C8H 2ADFH 1HXMB 1TPXC 2DS4A 3N50A 4PJ5E 3RA7H 3VE0B 4WFGD 3MNWA 1TFHA 2CMRL 1CL7L 2VZ1A 3CVHA 4KKAD 3K81A 3TBYA 1INQA 4TQEL 3ULUL 1OAKL 3VRLF 5KVGL 1D5IH 3B2VH 1P1ZA 5FYJU 1F4WL 4NZDA 3H3BC 4RMSA 1S78D 4TNVK 1X5JA 5FGCE 1A1OA 4D0CA 3BP4B 2PTVA 4H8WC 4F80A 3FO2B 4DVBA 2V2XA 2X4RA 3JV5A 2HJKB 5CIPB 2FIKB 3S37X 5HPOA 2R2HA 4WU5B 2XZAL 4HK0B 5DHXB 1JP5A 2KQMA 3O9WD 5C0ND 1XF3A 2QHRL 5LBSH 2FHFA 4PGJA 4KK6D 3TPUA 1JPTH 1RUAL 1JGLL 3RWJA 4TOYL 2OZ4A 3SJVE 4ODXB 1ND0B 4CGTA 1VHPA 1QSEA 3WEXB 4DZ8B 3UPRA 3GHEH 4GG8A 1JYXA 5F1KC 3ZO0A 4YDJB 4OCLC 1CR9H 2IAMB 1AY1L 5I8OL 3QR2A 2LABA 4X6CE 1YMHB 1KEGL 4H8WL 5DMJB 2Z0BA 3D3VB 5D6CA 4QWWD 1XAUA 1S78C 5IB1B 4JDTL 2FB4H 5BS0B 4OSUH 3MRDA 4GS7C 4DN4H 5E8DL 1RJLA 4OZ4B 3GSWA 4YHKH 5HJ3A 1LP9A 3IAQA 5DVOA 2CGRH 5GSVB 3VXOB 1WQVT 3B5TA 3I6KB 4W68A 5FM5O 3AVEA 2Z8RA 3FRUA 4DTGH 2HJFB 3TJEH 4HPOL 1CGTA 1S5IH 5A2JH 4A2LA 1HHIA 3REVB 3BO8B 1I4FB 3VXRB 4EIGB 2VDPL 4OCYL 2AVGA 1KCUL 3FB5A 2R4SH 4HJGB 4OFIA 4OIBA 3O6FC 1UJ3C 1WVZA 1U8MB 5D5MB 4FXLA 3MRHA 5DRWA 2YD4A 4LDEB 4QOKB 3V0WL 2D31A 3MNWB 3ARFD 1KJ2A 5DGRA 3D85D 3E6HA 4BYHA 2VXUL 1XT5A 3WIHA 4LPWA 3CFJB 1BIIA 1V3KA 2EC9U 4PJXA 2JK5A 3D5OF 1S7SA 4RFOL 4AENA 3WD5L 1GGIL 1CLOL 3BZEA 4U1HB 2NR6C 1LEKA 4PJFA 1GZQA 4Y4FD 1T0MB 3QDJA 3BSZH 4K3DL 3FO1A 4M7JH 5CZKA 4TSCL 1LE5B 4EI5D 1J8KA 3WFDH 1NBZB 4LSDA 1NGXA 3GJFH 1EAPB 4MNGE 3KLAB 4O51B 1ZLSL 1NFDB 3ILPA 4NQSB 1NFKA 4HWBL 3I9GH 3BAEL 1JPSL 4WHDA 3SO3B 4J3OC 5IMMB 4Z8FL 3QIUA 3NIDE 2WQRA 5EOTA 2I60H 3UXFA 3NCCB 3TBVA 1FNFA 3O6FD 1HHJA 2YXMA 3BGMB 2X6MA 5D9SB 5EWIH 3TJHD 3X12A 2AJVH 4UILH 4UT6H 2JE8A 4PBWD 4ZUTA 5IW6B 3L3JA 5J1SC 1QYGH 4XPBH 1JZ5A 3LQMA 2A1WH 2BCKB 2G60L 3KPMA 1CN4A 3B4NA 5CJQH 4MXWL 1ZHLA 3QUXB 3FQTB 1A7PH 4AT6A 3DYPA 3P4NA 1U8PA 3IU3A 3ZHLA 3HB3C 1YYML 1QLRB 1CXLA 1IC7H 2NR6D 2ADGA 1OWWA 1JPFA 4P4KA 2E7HA 5D71H 1T80A 2FHCA 5B8CB 3ZE0E 1Z5LB 1NCCL 2HT4C 3FB7A 4TVPD 2GK2A 1HN1A 2KPNA 1PG7H 4YAQB 1I1YA 4RGND 2WIIA 4X6BA 3W2DH 4GMSL 2CQVA 1MI5B 5FK9B 2APFA 1Q1JH 3QQ9D 4PJ9D 5IQ9A 3BO8A 2C3HA 3CH1B 3INUL 2EC9T 3FZUC 2IMNA 2W0FB 4FQQB 3CSPA 2BNRA 4BFBD 4L4JA 3WXWL 2CXGA 5I71C 3BI9X 4MA1C 3BT2L 4CU7A 1P4IL 1BHGA 3DJ9A 1AI1L 1IAIL 3DMMA 4NO0B 1LEGA 3HE6A 4UNVA 3CFBB 3DX8A 5BVPH 4G9FA 1RULH 2HH0L 3QPQD 3SDAA 5FKPB 4YBLB 1P7QA 3QO1B 3GI9L 3JWDL 2FEEL 4U1HA 2DIBA 1LEKB 2XI9A 1DP0A 4ODTL 3CDYA 3MBEA 3ULVE 3MSPA 3RQ3A 2DKMA 2ZWLT 2UY7A 2P1YA 5ID1B 5JPMB 3TH2T 1BWMA 3QUYA 4YHIA 4W70A 3QEGL 4DZ8A 5BVJB 1IEAA 2P5EE 3G04A 4KKLC 3RU8H 4U2ZA 4YHML 3TYFB 3C8KA 5DWUL 1J1OH 4H88L 3IJYB 5E4IA 5B21A 4NQXB 3H9SA 3HI6H 4UV4L 1B6UA 5C07A 4MVBD 3QHFH 5IB1A 5AYUH 3RGHA 3IXTB 3AB0B 2QQLH 3C9NB 2B5IB