1RK4A

Crystal structure of a soluble dimeric form of oxidised clic1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
213
structure length
213
Chain Sequence
GNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Intracellular Chloride Ion Channel Protein CLIC1 Undergoes a Redox-controlled Structural Transition
pubmed doi rcsb
molecule keywords CHLORIDE INTRACELLULAR CHANNEL PROTEIN 1
source organism Homo sapiens
molecule tags Ion transport/membrane protein
total genus 72
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1rk4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1rk4A01
3FRCA 2C0DA 1GSYA 5GAPD 4ACSA 2AJQB 2HRKA 2MMAA 1AQWA 5HFGA 4MK3A 4TR1A 1TOFA 2QSIA 2R3XA 3US3A 3QOUA 2CT6A 3DIEA 3VLNA 4K7IA 5AIVA 4Q5NA 5CAXA 4DSQA 2P0GA 5CNWA 1FB6A 2VCQA 3BBYA 5C04A 1OC9A 4IVFA 2FWFA 4IGJA 3IAM2 2FWGA 1S3AA 4MJEA 2E2GA 2C8UA 1SL1B 3ERWA 1GL8A 2K9FA 3GKXA 3TKPA 4JEDA 2DSAA 2O85A 5KEJA 2LNTA 4LL4B 3A2WA 3HVSA 3SBCA 5HFKA 4HJ2A 4I2TA 1G6WA 1M99A 3EMPA 3HA9A 2H0HA 4MF6A 2ZNMA 2DJ1A 4MH2A 2WB9A 3F8UA 3LJRA 5DQYA 3VPQA 3BD2A 2PGTA 2R5GA 1KNGA 2CX4A 5B8AA 4ECBA 3GV1A 4XRAA 2JACA 3CSJA 5B8BA 4IW9A 3BJ5A 3HXSA 4ULXA 4IJIA 2R37A 1Z9HA 5D8IA 1YF1A 3ZITA 3JCML 4TOPA 2C3QA 5ELGA 3CBUA 3BOAA 4CHSA 2GSRA 4DEJA 5DQSA 5GSSA 4F82A 4G2EA 3P8WA 3TJBA 4NPBA 2LRTA 3IK7A 5DVBA 4AJ6A 3TJGA 2YCDA 3F0IA 3UARA 2WULA 2OJLA 2YZHA 1TRVA 4TR0A 2IN3A 5CRHA 4POMA 2DIYA 2HRNA 2I3YA 3ZMLA 1AQXA 1W89A 3GKNA 4V2NA 1URMA 4MPFA 5JCWA 1EGRA 4OMVA 2QGVA 4TXOB 1YF0A 1KEBA 1V2AA 2LNSA 4IP1A 1F3AA 3WGDA 2L4CA 5HQPA 18GSA 1V9WA 1SK2A 4V2LA 2IMKA 2VIMA 4IN0A 4HU7A 3WGEA 1ZCPA 4KA0A 5IMDA 4GTUA 1Y6EA 3GH9A 4YAPA 1X5DA 5IOXA 4IQAA 2H0GA 3DVXA 4ZB8A 3C1SA 1TI3A 4V1Ap 1XWKA 2YJHA 3H93A 3ZRDA 2GDRA 2O8VB 4L0WA 1M2AA 5CRDA 1SKSB 3VFIA 14GSA 5F0GA 2B5XA 3E0UA 2HRFA 3WD6A 4ECIA 3J7Yk 1A8YA 3RPNA 4TR4A 1A24A 4NWYA 1K3OA 5DCHA 4HDEA 4HQSA 1WP0A 1FB0A 3HHVA 2VL2A 4ISDA 3F9UA 4WF5A 3RBTA 1TU8A 2L5LA 3HDCA 4H86A 2VCXA 4ZBBA 1MDJA 3F4SA 2HZFA 4TXOA 3D22A 1GUHA 1SL2B 6GSVA 4BVXB 2ON5A 2C1YA 2LRNA 1QK8A 1BJXA 3NIVA 3PH9A 2DJ2A 2HZEB 3DGQA 2X8GA 4E8EA 3HY2A 2VD1A 3KP9A 5E4WA 3KM6A 5INYA 1XBSA 4MDCA 1TXXA 1BQ7A 4FIWA 22GSA 2E0QA 3DMLA 1M2BA 2PERA 2VO4A 5H5SA 1MTCA 2WJUA 3DWVA 2AUVA 1TK8B 2LJKA 2LEGA 4X0XA 1T3BA 5IQYA 2DIZA 1O73A 2KUCA 2YWMA 1XOBA 5D96A 1SKRB 4BWSA 2J9HA 1R5PA 2DMMA 5G1LA 1F3BA 1A0FA 4FH8A 2LV3A 3HD5A 1A8LA 1HD2A 5KN1A 2O87A 4J57E 1G6YA 2H1AA 2F9SA 3TRQA 3QAGA 3IPZA 4XTSA 2CVBA 3FEUA 5IM9A 3FZ4A 4KGIA 4BVXA 4KDUA 2RM6A 4IHUA 4E8HA 2HZEA 5HR3A 1XW6A 5IO0A 3GKMA 4ZBAA 1EWXA 3LXTA 2VD0A 3FHKA 2L6DA 2NDOA 2H70A 4TRXA 1ST9A 4WXTA 1GSEA 1VF3A 4IS0A 1HNAA 1GUKA 5HR2A 2ZUPA 2YV7A 5DALA 2H76A 3OR5A 3M0FA 2VL2C 3GKKA 1VRSD 1GTIA 1MEKA 4BVYA 3F3QA 2VAFA 3IOSA 1ERUA 3TRXA 1LBKA 3UJ1A 1J0FA 3L9SA 1PKWA 2ZCTA 4PQ1A 1YQ1A 2VM1A 3Q18A 3KEBA 4ML6A 4ZB6A 4MJAA 1ERVA 3IR4A 3GNJA 4KB3A 1O85A 1K0NA 4Z7XA 1USBA 4D73B 3EU3A 4HJMA 2ALBA 2NPBA 2VCTA 3TKSE 3GN3A 4PNGA 2GLRA 1EGOA 3TKRA 4WBJA 1B48A 4HZ2A 3O3TA 2DC5A 3IC8A 2F3MA 2FA8A 1B4QA 4K2DA 5ECQB 1WWJA 3ZREA 2HXKA 1K0BA 1HQOA 5ECPB 2VOCA 3ZTLA 3GUSA 3HJOA 2F8FA 4ZL8A 2HSYA 4QL7A 1SU9A 3KXOA 3ERGA 4MPGA 1J9BA 2IFQA 5KN2A 5ECKB 2IMEA 3QPMA 4K8MA 4ECJA 1OE7A 1VF1A 4IKHA 5ABRA 4KDYA 4ZB9A 4KE3A 1Z3EA 20GSA 5JWOB 5G1KA 2HSHA 1TP9A 2V1MA 4GWRA 3APOA 5DJLA 4POKA 1QMVA 3KJYA 4D73A 3VI5A 1K3LA 4HUAA 2LQQA 2V41A 3NZNA 3IE3A 1WMJA 1PX7A 5DAKB 3FZ9A 1R26A 1EP8A 5F06A 3AY8A 2OE0A 2LUSA 2H66A 1SKWB 4KH7A 1K0AA 3C71A 4V2MA 5AIXA 6GSYA 1HYUA 1PX6A 1PA3A 4POLA 2RIIA 3P90A 2B1LA 5ENUA 1A2JA 4O7HA 3LFLA 4GSSA 3TB2A 3H1NA 2HI7A 1XIYA 4I8BA 3ISOA 1ZGNA 3IDVA 1N2AA 3MAKA 3LEFA 2HSMA 3QR6A 3HZ4A 4MH3A 2YWIA 2YP6A 4OCEA 4EF0A 3FYGA 1F6MC 2K6VA 3W8JA 2YZUA 2H6YA 5D9VA 4O92A 2X8CA 3KIJA 2HT9A 4OO4A 1PRXA 1SD9A 2KOKA 3TKQA 3TJFA 1GH2A 3H79A 1GTUA 3GRXA 1GNWA 1GSSA 4HQZA 1PGTA 5F07A 3BCKA 4GRFA 5DAKA 2GSTA 5A4WA 1G7EA 5J5NA 3ERFA 3KD0A 1GRXA 2OBIA 2JU5A 1SJIA 1WE0A 4DSRA 3KTBA 4FQUA 4RQRA 3ZIVA 3TGZA 4RI6A 1XPVA 5LCZA 1JZDA 4YAVA 3KZQA 1OKTA 5CO3A 1TK0B 4KUNA 4PUAA 3GSSA 4O32A 4GLTA 1BEDA 8GSSA 5D93A 1SK0A 3F4RA 1T7PB 2H71A 3QFAC 1GLQA 1H4OA 4LL1B 5IPHA 2CV4A 4F0BA 2DLXA 1M0UA 1PMTA 3DYRA 1JZOA 4XS6A 3HCZA 2MBTA 4G0KA 3EU4A 1GLPA 4L0UA 4WETA 4DSSB 2V2GA 5F8BA 3W6GA 3I6AA 4MMMA 4YQVA 2DMLA 4MF7A 3IAS2 4XHMA 1F37A 4OO5A 3VWXA 3Q74A 3LWAA 1YY7A 5ECSA 3L78A 1Q98A 1X0RA 2MYGA 3D4MA 5LD0A 4KDXA 2Z9SA 4G19A 2GSSA 3UVTA 4OFTA 3ED3A 4HI7A 4EL1A 2CZ3A 2HNLA 4WR5A 1X5CA 3GYKA 3L0HA 1TW9A 4Q5QA 4G9HA 5HR1A 1E2YA 1M9AA 2CAIA 1RK4A 3MDKA 2XC2A 3GIXA 2V6KA 4NV5A 4YQMA 4G10A 5COHA 2H75A 2HQTA 2NBSA 1NW2A 2FY6A 3MNGA 4JRRA 2H1DA 2M72A 3HKRA 4N0ZA 3TDGA 3HVVA 3A3TA 2QC7A 1XCCA 4XS4B 4EDYA 5G5FA 3M3MA 4AJ8A 1ACVA 1XXUA 2C0EA 1IYHA 5ECOB 2TIRA 2MMZA 3ZZXA 4PXOA 2JADA 3GX0A 4DSSA 5AISA 2DBCA 5B6NA 2RUEA 1EP7A 1PQNA 2G0FA 3ZIJA 1T4YA 5IIZA 2B1KA 4PQHA 2BJXA 3UIWA 1AQVA 2H8LA 1CQGA 4JBBA 1XWGA 3M1GA 1TTZA 1ZYQB 1WRYA 4TXVA 5J3RA 5IMVA 3W8SA 3IBHA 1DSBA 4RUVA 4G0IA 2HE3A 10GSA 3E3EA 2M46A 3UBLA 2H73A 2GT6A 2YJ7A 3RAZA 4FYUA 4N0VA 2KHPA 17GSA 2X8HA 2HYXA 1ON4A 5HR0A 1S3DA 1R5AA 4OWYA 6GSWA 4EKZA 4KW6A 4LMWA 4XS4A 2H72A 5JWQB 4USSA 5J9CA 4WR4A 2GSQA 4ZL9A 3O76A 1VGLA 2GZYA 2BTOT 1RW1A 2C0GA 4K9ZA 4KF9A 4N30A 1A2LA 3UEMA 3GSTA 2IMIA 1T8EB 1TRUA 1XW9A 16GSA 1TJDA 3KMOA 2GT5A 2WS2A 4K0NA 4J56E 5IMCA 1ERWA 3D4TA 5JCUA 2GQLA 2LSTA 3APSA 3QAWA 4OFMA 3UMAA 2B5YA 2XBIA 2GVPA 3F6DA 1WJKA 1V40A 4JE1A 1SJ6A 3RHBA 5L71A 4Q5FA 2K8SA 3TUEA 2C3NA 3S9FA 4X43A 4AJ7A 3LG6A 5DCGA 5ELAA 3P2AA 3GL3A 4FO5A 3UBKA 4ML1A 5FWGA 3P7XA 2RUFA 4WBRD 2HSNB 1K0CA 5JWRB 5DBQA 4HS1A 5IMZA 13GSA 1MD3A 3M8NA 4LMVA 1OAZA 1ILOA 3U6VA 2GQKA 3NOFA 2VLUA 2FWHA 4WKWA 3D6IA 1FOVA 5HFIA 5A5KA 5DDLA 4MF5A 4EUYA 2P5QA 5CRGA 2N5FA 1M7TA 3PR8A 2M80A 2OADA 3CTGA 2L59A 1XVQA 2H19A 2IMDA 4N11A 2H01A 1FVJA 1QGVA 4K7NA 4X1UA 4CDOA 2B6MA 2WRTA 3F6FA 3QMXA 5IMAA 1AXDA 2LQOA 4KNDA 4BA7A 5D9TA 1XWCA 3FZAA 3TOUA 3L9UA 4V1Ag 4KSOA 4EO3A 1NHYA 1JFUA 1ZYEA 3IK9A 3EINA 3FY7A 4IJ3A 2CZ2A 1IYIA 1THOA 2DJKA 4IELA 1K0DA 1WOUA 2JSZA 5G31A 2FNOA 1GWCA 2EIRA 2B5EA 3APQA 2MMOA 3DVWA 2G2QA 5BMUA 1UVZA 3F3RA 4IP6A 2H30A 4PX1A 1SL0B 2R2JA 5J9BA 1GTBA 2CA8A 1FAAA 2AYTA 1XZOA 4PUFC 1QUWA 2XPDA 3R3EA 2P5RA 1HNCA 2E2MA 3Q19A 5IO2A 1VF2A 1FO5A 4KCEA 1GNEA 3GH6A 2EC4A 1K3YA 4K6XA 2L57A 3M9KA 5ECHB 4MZBA 3ZYWA 3D0ZA 5FT3A 5JCGA 1TU7A 3GTUB 1B9XC 3LYKA 1Y25A 3WT2A 3D5JA 3L4NA 1YKAA 1DE1A 4I6XA 2IMFA 3ZMKA 1V98A 2GQMA 3M9JA 2JZRA 1VF4A 1O6JA 3V1WA 3TOTA 1A23A 2C4JA 4KCAA 2ON7A 3EE2A 5IPGA 1B4PA 4JZQA 5KN3A 2KLXA 1ZZYA 2QKEA 4PURA 4JU5A 2CVDA 5LNKe 19GSA 1TKDB 3WT1A 3CSIA 2OE1A 2H0IA 3IA1A 2H1GA 1Z6NA 4I5QA 1EV4A 5DJMA 4F0CA 4GSTA 2B3SA 2LTKA 4PQIA 3ME8A 6GSUA 3VWVA 4QQ7A 1YZXA 3R2QA 5GZZB 3EURA 1ZOFA 5D73A 1AIUA 4EC0A 4BPYA 2PPTA 3TCOA 3FR3A 2H6ZA 2GGTA 3DEXA 2IPAA 3ZVJA 4MLYA 1OC9B 5EL8A 4ECCA 4TVEA 2YPMA 3G7IA 4TR3A 3GTUA 1XWAA 3UL3A 3IXRA 1NSWA 3QDNA 2YNXA 3IV4A 3QCPA 2FHEA 3KMNA 4AF2A 2VM2A 2EIQA 1GSQA 1G0TA 1NHOA 3FW2A 5AGYA 2VL9A 1R7HA 3G7YA 4NXIA 4ZL7A 5CP1A 1UA5A 4FYBA 2C3TA 2J23A 4L8EA 3SWLA 4HU9A 4EE0A 2A2SA 2X99A 4EDZA 11GSA 1WIKA 2WZ9A 4I97A 3CYNA 4TN8A 1XFLA 2WGRA 2IWTA 1GSUA 2VUPA 2X64A 2JZTA 2YWNA 4PGTA 4F2IA 5ECRB 3GFKA 1ML6A 3HJPA 1M9BA 1GSFA 3KP8A 1X9MB 1GP1A 5ECIB 4NMUA 1DE2A 1TK5B 3GHAA 2GTUA 5CRWA 4GXZA 4XRDA 2LKUA 4K0GA 5AN1A 5ECLB 3GA4A 4K1FA 4OD7A 4ZXGA 4MA9A 5KN0A 5B7CA 2E7PA 2PVOC 3UVHA 4GCIA 1EOHA 4KAEA 3GURA 3Q6OA 3FR9A 3PPUA 2AB6A 1C72A 1DBYA 1ZMAA 3VWUA 1SK1A 3LXZA 1WPIA 3WGXA 2YANA 1PL1A 1MDKA 4I2UA 5B6MA 3KH9A 2CQ9A 1YEPA 3EC3A 2D2ZA 1O7UA 1BYEA 7GSSA 3LYPA 1X5EA 3N5OA 5H5RA 2R6KA 1LU4A 2HFDA 2VCVA 3H4KA 4NHZA 2PWJA 2V32A 3A5WA 3KH7A 4P3YB 2FD3A 1AUCA 4GQFA 1O8WA 2KP2A 4WEYA 3ZVJD 1T1VA 1PN9A 4PTSA 2DJ0A 3HVXA 9GSSA 2REMA 3UAPA 2VCWA 2PU9C 5G5EA 3TKSA 1FW1A 2C80A 4RI7A 4XCSA 4KSMA 1OC3A 2YOIA 4HZ4A 3IHQA 2H74A 3CXGA 4J2FA 3C7MA 2OE3A 4MJBA 2JZSA 1MDIA 3G9BA 3EYTA 3KTLA 1X9SB 3C73A 1X9WB 1SYXA 3H8QA 3CTFA 2C0FA 3C8EA 4QL9A 1ZL9A 2MMNA 3A2XA 4TW5A 1EOGA 1XWBA 5A4VA 2YWOA 2GS3A 3IC4A 1QFNA 1OVNA 2LS5A 3O6TA 3MWHA 1GUMA 1SYRA 2LJAA 3QD9A 4EXJA 2FCHA 3VURA 4XIHA 2IL3A 1Z6MA 1GULA 1EEJA 4POBA 2R4VA 3PINA 1JLVA 2ES7A 5ECMB 3HZ8A 2P31A 3MSZA 1NM3A 2RM5A 1EZKA 2XHFA 1YDKA 3VK9A 2WFCA 5E59A 2H1BA 2L4QA 5H5QA 2PVQA 1PL2A 1AAZA 1Z5YE 1YKCA 1QXHA 1BX9A 1EEMA 2F8AA 4KX4A 3F63A 2O89A 4IBPA 2NVLA 2YV9A 3I9V2 2CVKA 5FHIA 3E9JB 4YQUA 1E6BA 4EVMA 1U87A 1JZRA 2CX3A 4BL7B 2I1UA 1TI1A 5ID2B 2AAWA 2I4AA 2GZPA 1Q4JA 1UN2A 4MJCA 1BG5A 1YEXA 1U3AA 1JZWA 2EIOA 2GZZA 3EWLA 3K8NA 2CAQA 4MP4A 5J41A 4RQXA 3TKSC 3EMXA 1KTEA 4NAXA 2AHEA 2H6XA 4NV2A 3HYPA 4ID0A 12GSA 2LRCA 3LSZA 4LA1A 2DJJA 1GTAA 1B9YC 2F51A 6GSSA 5EY6A 1OKDA 2PUKC 1YJ6A 1I5GA 4GSNA 1OE8A 1W4VA 2VL3A 2WCIA 4IQ1A 2JSYA 3F4TA 2FGXA 1SENA 3KCMA 1RQMA 3C1RA 2LJRA 2L5OA 4YH2A 1N8JA 2AV4A 3FKFA 3ZFBA 4BL7A 1THXA 4TKYA 5ID2A 1S3CA 4DVCA 2KP1A 1A2MA 3VPTA 2K18A 5GSTA 4ZBDA 1ERTA 5DALB 2FA4A 5J4UA 1T00A 3VWWA 3ZL5A 2PBJA 4BVYB 1B8XA 4ZIJA 1UC7A 1KBNA 4JR4A 3ZLPA 3BCIA 3IRAA 3GX8A 1QQ2A 2DJ3A 3FR6A 4AGSA 1CQHA 1LJRA 2OBKA 1FHEA 3CRTA 1BAYA 2HRAA 5CYYA 3D21A 2PN8A 4GF0A 3RPPA 3QFBC 4NHWA 2FUG2 1XOAA 1F9MA 3I69A 1JLWA 2MBSA 3DD3A 3RDWA 5EPFA 1AC1A 3CMIA 2RLIA 1ABAA 1K0OA 1O81A 1TRWA 1FVKA 3LORA 1U6TA 3U5RE 4JR6A 2B7JA 2OACA 1R4WA 2IJYA 4Q5RA 4MZCA 2IFQB 1MD4A 4OCFA 1EV9A 3A2VA 5A4UA 4F9ZA 1JHBA 3G7JA 1F2EA 2N5AA 1PSQA 4MCUA 1Z7RA 1SD8A 4PNFA 4MZWA 1XW5A 3CSHA 4F03A 2UZ8A 2BMXA 3GMFA 5F05A 5G30A 1HNBA 2TRXA 2MZCA 3HJMA 3TJJA 3EVIA 3GL5A 1PKZA 2A4VA 1AW9A 3J7Yb 2NTOA 4LLRA 1TDIA 1U88A 4HEA2 4BWQA 1FG4A 4O5RA 3RHCA 5IOWA 5GAND 2WDUA 2XBQA 1V58A 2FLSA 2TRCP 2IIYA 4FYCA 3PGTA 1I9DA 1XVWA 2B7KA 1J08A 3L9VA 1G7OA 3LGCA 3KGKA 4CW9A 2JL4A 2O7KA 1DUGA 1TRSA 1OC8A 2K8VA 1O8XA 3DRNA 4HOJA 2VLVA 4G0LA 6GSTA 5EVOA 2HRKB 4WF4A 3N9JA 4MABA 4TR1B 2V6OA 2HSMB 5G2ZA 4ILFA 3FZ5A 1OYJA 4L5LA 3DKSA 2VCZA 3DXBA 2XPEA 3QAVA 1M2DA 5IMFA 4XS1A 2A2RA 4L5OA 2HLSA 1K0MA 3CRUA 2VLTA 6GSXA 4N10A 2FWEA 3ZFLA 3LQ7A 2N5BA 5D9XA 5CREA 4GQCA 5D9WA 3I43A 4K7OA 3ME7A 5C00A 3UOMA 3TJKA 3TRPA 5ECNB 4OFNA 4ZILA 1V57A 2OKAA 1A0RP 1GSDA 1H75A 2YN1A 2I81A 2I9HA 1SJZA 2L6CA 1Z7PA 3FK8A 3VI7A 1PD21 1T4ZA 1U3IA 2OA7A 2PMTA 3WYWA
chains in the Genus database with same CATH superfamily
3FRCA 2C0DA 1GSYA 5GAPD 4ACSA 2AJQB 2HRKA 2MMAA 1AQWA 5HFGA 4MK3A 4TR1A 1TOFA 2QSIA 2R3XA 3US3A 3MIXA 3QOUA 2CT6A 3DIEA 3VLNA 4K7IA 5AIVA 4Q5NA 2A2PA 4MNNA 5CAXA 4DSQA 2P0GA 5CNWA 1FB6A 2VCQA 3BBYA 5C04A 1OC9A 4IVFA 2FWFA 4IGJA 3IAM2 2FWGA 1S3AA 4MJEA 2E2GA 2C8UA 4YKGA 1SL1B 3ERWA 1GL8A 2K9FA 3GKXA 3TKPA 4JEDA 2DSAA 2O85A 5KEJA 2LNTA 4LL4B 3A2WA 3HVSA 3SBCA 5HFKA 4HJ2A 4I2TA 1G6WA 1M99A 3EMPA 3HA9A 2H0HA 4MF6A 2ZNMA 2DJ1A 4MH2A 2WB9A 3F8UA 3LJRA 5DQYA 3VPQA 4A5PA 3BD2A 2PGTA 2R5GA 1KNGA 2CX4A 5B8AA 2O3EA 4ECBA 3GV1A 4XRAA 2JACA 4GDFA 3CSJA 5B8BA 4IW9A 5BRTA 3BJ5A 3HXSA 4ULXA 4IJIA 4QMKA 2R37A 1Z9HA 5D8IA 3HMJG 1YF1A 3ZITA 3JCML 4K5RA 4TOPA 2C3QA 5ELGA 3CBUA 3BOAA 4CHSA 2GSRA 4DEJA 5DQSA 5GSSA 4F82A 4G2EA 3P8WA 3TJBA 4NPBA 2LRTA 3IK7A 5DVBA 4AJ6A 3TJGA 2YCDA 3F0IA 4G01A 3UARA 2R0CA 2WULA 2OJLA 4AKHA 2YZHA 1TRVA 4TR0A 3LW9A 2IN3A 5CRHA 4POMA 2DIYA 2HRNA 2I3YA 3ZMLA 1AQXA 1W89A 3GKNA 4V2NA 1URMA 4MPFA 5JCWA 1EGRA 4OMVA 2QGVA 4TXOB 1YF0A 1KEBA 2EFCA 1V2AA 2LNSA 4IP1A 1F3AA 3WGDA 2L4CA 5HQPA 18GSA 1V9WA 1SK2A 4V2LA 2IMKA 2VIMA 4IN0A 4HU7A 3WGEA 1ZCPA 4KA0A 5IMDA 4GTUA 1Y6EA 3GH9A 4YAPA 1X5DA 5IOXA 4IQAA 2H0GA 3DVXA 4ZB8A 3C1SA 1TI3A 4V1Ap 1XWKA 2YJHA 3H93A 3ZRDA 1N25A 1SVOA 2GDRA 2O8VB 4L0WA 1M2AA 5CRDA 1SKSB 3VFIA 14GSA 5A5HB 5F0GA 2B5XA 3E0UA 4AKGA 2HRFA 3WD6A 4ECIA 3J7Yk 1A8YA 3RPNA 4TR4A 1A24A 4NWYA 1K3OA 4YKFA 5DCHA 4HDEA 4HQSA 1WP0A 1FB0A 3HHVA 2VL2A 4ISDA 3F9UA 4WF5A 3RBTA 1TU8A 2L5LA 3HDCA 4H86A 2VCXA 4ZBBA 1MDJA 3F4SA 2HZFA 3EPTA 4TXOA 3D22A 1GUHA 1SL2B 6GSVA 4BVXB 2ON5A 2C1YA 2LRNA 1QK8A 1BJXA 3NIVA 4FXYP 3PH9A 2DJ2A 2HZEB 3DGQA 2X8GA 4E8EA 3HY2A 2VD1A 3KP9A 5E4WA 3KM6A 5INYA 1XBSA 4MDCA 1TXXA 1BQ7A 4FIWA 22GSA 2E0QA 3DMLA 1M2BA 2PERA 5A5HA 2WW1A 2VO4A 5H5SA 1MTCA 2WJUA 3DWVA 2AUVA 1TK8B 2LJKA 2LEGA 4X0XA 1T3BA 5IQYA 2DIZA 1O73A 2KUCA 2YWMA 1XOBA 5D96A 1SKRB 4BWSA 2J9HA 1R5PA 2DMMA 4O5UA 5G1LA 1F3BA 1A0FA 4FH8A 2LV3A 3HD5A 1A8LA 1HD2A 5KN1A 2O87A 4J57E 5BMUB 1G6YA 2H1AA 2F9SA 3TRQA 3QAGA 3IPZA 4XTSA 2CVBA 3FEUA 5IM9A 3FZ4A 4KGIA 4BVXA 4KDUA 2RM6A 4IHUA 4E8HA 2HZEA 5HR3A 1XW6A 5IO0A 3GKMA 4K5SA 4ZBAA 1EWXA 3LXTA 3TU3B 2VD0A 3FHKA 2L6DA 2NDOA 2H70A 4TRXA 1ST9A 4WXTA 1GSEA 1VF3A 4IS0A 1HNAA 1GUKA 5HR2A 2ZUPA 2YV7A 5DALA 2H76A 3M0FA 3OR5A 2VL2C 3GKKA 1VRSD 1M3JA 1GTIA 1MEKA 4BVYA 3F3QA 2VAFA 3IOSA 1ERUA 3TRXA 1LBKA 3UJ1A 1J0FA 3L9SA 1PKWA 2ZCTA 4PQ1A 1YQ1A 2VM1A 3Q18A 3KEBA 4ML6A 4ZB6A 4MJAA 1ERVA 3IR4A 3GNJA 4KB3A 1O85A 1K0NA 4Z7XA 1USBA 4D73B 3EU3A 4HJMA 2ALBA 2NPBA 2VCTA 3TKSE 3GN3A 4PNGA 2GLRA 1EGOA 3TKRA 4WBJA 1B48A 4HZ2A 3O3TA 2DC5A 3IC8A 2F3MA 2FA8A 1B4QA 1I1IP 4K2DA 5ECQB 1WWJA 1PFOA 3ZREA 2HXKA 1K0BA 1HQOA 5ECPB 2VOCA 4AKXB 3ZTLA 3GUSA 3HJOA 2F8FA 4ZL8A 2HSYA 4QL7A 1SU9A 3KXOA 3ERGA 4MPGA 1J9BA 2IFQA 5KN2A 5ECKB 2IMEA 4AKIA 3QPMA 4K8MA 2EFDA 4ECJA 1OE7A 1VF1A 4IKHA 5ABRA 4KDYA 4ZB9A 4KE3A 1Z3EA 20GSA 5JWOB 5G1KA 2HSHA 1TP9A 2V1MA 4GWRA 3APOA 5DJLA 4POKA 1QMVA 3KJYA 4D73A 3VI5A 1K3LA 4HUAA 2LQQA 1YVLA 2DKIA 2V41A 3NZNA 3IE3A 1WMJA 1PX7A 1PN0A 5DAKB 3FZ9A 1R26A 1EP8A 5F06A 2X4AA 3AY8A 2OE0A 2LUSA 2H66A 1SKWB 4KH7A 1K0AA 3C71A 4V2MA 2WVXA 5AIXA 6GSYA 1HYUA 1PX6A 1PA3A 4POLA 2RIIA 3P90A 2B1LA 5ENUA 1A2JA 4O7HA 3LFLA 4GSSA 3TB2A 5KOWA 3H1NA 2HI7A 1XIYA 4I8BA 3ISOA 1ZGNA 3IDVA 1N2AA 3MAKA 3LEFA 2HSMA 3QR6A 3HZ4A 4MH3A 2YWIA 2YP6A 4OCEA 4EF0A 3FYGA 1F6MC 2K6VA 3W8JA 2YZUA 2H6YA 5D9VA 4O92A 2X8CA 3KIJA 2HT9A 4OO4A 4ICYA 1PRXA 1SD9A 2KOKA 3TKQA 2OT3A 3TJFA 1GH2A 3H79A 1GTUA 3GRXA 1GNWA 1GSSA 4HQZA 1PGTA 5F07A 3BCKA 4GRFA 5DAKA 2GSTA 5A4WA 3A5IA 1G7EA 5J5NA 3ERFA 3KD0A 1GRXA 2OBIA 2JU5A 1SJIA 1WE0A 4DSRA 4BIKA 3KTBA 4FQUA 4RQRA 3ZIVA 4AI6A 3TGZA 4RI6A 1XPVA 5LCZA 1JZDA 4YAVA 3KZQA 1OKTA 5CO3A 1TK0B 4KUNA 4PUAA 3GSSA 4O32A 4GLTA 1BEDA 8GSSA 5D93A 4X4JA 1BG1A 1SK0A 3F4RA 1T7PB 2H71A 3QFAC 1GLQA 1H4OA 4LL1B 5IPHA 2CV4A 4F0BA 2DLXA 1M0UA 1PMTA 3DYRA 1JZOA 4XS6A 1S3RA 3HCZA 2MBTA 4G0KA 5J47A 3EU4A 1GLPA 4L0UA 4WETA 4DSSB 2V2GA 5F8BA 3W6GA 3CHXC 3I6AA 4MMMA 4YQVA 2DMLA 4MF7A 3IAS2 4XHMA 1F37A 4OO5A 3VWXA 3Q74A 1XG8A 3LWAA 1YY7A 5ECSA 3L78A 1Q98A 2WVZA 1X0RA 2MYGA 3D4MA 5LD0A 4KDXA 2Z9SA 4G19A 2GSSA 3CQFA 3UVTA 1SVMA 4OFTA 3ED3A 4HI7A 4EL1A 2CZ3A 2HNLA 4WR5A 1X5CA 3GYKA 3L0HA 1TW9A 4Q5QA 4G9HA 5HR1A 1E2YA 1M9AA 2CAIA 1RK4A 3MDKA 2XC2A 3GIXA 2V6KA 4NV5A 4YQMA 4G10A 2QA1A 5COHA 2H75A 2HQTA 2NBSA 1NW2A 2FY6A 3MNGA 4JRRA 2H1DA 2M72A 3HKRA 4N0ZA 3TDGA 3HVVA 3A3TA 2QC7A 1XCCA 4XS4B 4EDYA 5G5FA 3M3MA 4AJ8A 1ACVA 1XXUA 2C0EA 1IYHA 5ECOB 2TIRA 2MMZA 3ZZXA 4N3ZA 4PXOA 2JADA 3GX0A 4DSSA 5AISA 2DBCA 5B6NA 2RUEA 1EP7A 1PQNA 2G0FA 3ZIJA 1T4YA 5IIZA 2B1KA 4PQHA 2BJXA 3UIWA 1AQVA 2H8LA 1CQGA 4JBBA 1XWGA 3M1GA 1TTZA 1ZYQB 1WRYA 4TXVA 5J3RA 5IMVA 3W8SA 3IBHA 1DSBA 4RUVA 2WW2A 4G0IA 2HE3A 10GSA 3E3EA 2M46A 3UBLA 2H73A 2GT6A 2YJ7A 3RAZA 4FYUA 4N0VA 2KHPA 17GSA 2X8HA 2HYXA 1ON4A 5HR0A 2O5VA 1S3DA 1R5AA 4OWYA 4K2XA 6GSWA 4EKZA 4KW6A 4LMWA 4XS4A 2H72A 5JWQB 4USSA 5J9CA 4WR4A 5A1NB 2GSQA 4ZL9A 3O76A 1VGLA 2GZYA 2BTOT 1RW1A 2C0GA 1M3IA 4K9ZA 4KF9A 3MYDA 4N30A 1A2LA 3UEMA 3GSTA 2IMIA 1T8EB 1TRUA 1XW9A 16GSA 1TJDA 3KMOA 2GT5A 2WS2A 4K0NA 4J56E 5IMCA 4CY6A 1ERWA 3D4TA 4EIPA 5JCUA 2GQLA 2LSTA 3APSA 3QAWA 4OFMA 3UMAA 2B5YA 2XBIA 2GVPA 3F6DA 1WJKA 1V40A 4JE1A 1SJ6A 3RHBA 5L71A 4Q5FA 2K8SA 1FOHA 3TUEA 2C3NA 3S9FA 4X43A 4AJ7A 3LG6A 5DCGA 5ELAA 3P2AA 3GL3A 4FO5A 3UBKA 4ML1A 5FWGA 3P7XA 2RUFA 4WBRD 2HSNB 2WW0A 1K0CA 5JWRB 5DBQA 4HS1A 5IMZA 13GSA 1MD3A 3M8NA 4LMVA 1OAZA 1ILOA 3U6VA 2GQKA 3NOFA 2VLUA 2FWHA 4WKWA 5A1NA 3D6IA 1FOVA 5HFIA 5A5KA 5DDLA 4MF5A 4EUYA 2P5QA 2EFHA 5CRGA 2N5FA 4PI0C 1M7TA 3PR8A 2M80A 2OADA 3CTGA 2O36A 2L59A 1XVQA 2H19A 2IMDA 4N11A 2H01A 1FVJA 1QGVA 4K7NA 4X1UA 4CDOA 4Z2RA 2B6MA 2WRTA 3F6FA 3QMXA 5IMAA 1AXDA 2LQOA 4KNDA 4BA7A 5D9TA 1XWCA 3FZAA 1BF5A 3TOUA 3L9UA 4V1Ag 4KSOA 4EO3A 1NHYA 1JFUA 1ZYEA 3IK9A 3EINA 3FY7A 4IJ3A 2CZ2A 1IYIA 5A34B 1THOA 2DJKA 4IELA 1K0DA 1WOUA 2JSZA 5G31A 2FNOA 1GWCA 2EIRA 2B5EA 3APQA 2MMOA 3DVWA 2G2QA 5BMUA 1UVZA 3F3RA 4IP6A 2H30A 4PX1A 1SL0B 2R2JA 5J9BA 1ZYNA 1GTBA 2CA8A 1FAAA 2AYTA 1XZOA 4PUFC 1QUWA 2XPDA 3R3EA 2P5RA 1HNCA 2E2MA 3Q19A 5IO2A 1VF2A 2QA2A 1FO5A 4KCEA 1GNEA 3GH6A 2EC4A 1K3YA 4K6XA 2L57A 3M9KA 5ECHB 4MZBA 3ZYWA 3D0ZA 5FT3A 5JCGA 1TU7A 3GTUB 1B9XC 3LYKA 1Y25A 3WT2A 3D5JA 3L4NA 1YKAA 1DE1A 4I6XA 2IMFA 3ZMKA 1V98A 2GQMA 3M9JA 2JZRA 1VF4A 1O6JA 3V1WA 3TOTA 1A23A 2C4JA 4KCAA 2ON7A 3EE2A 5IPGA 1B4PA 4JZQA 5KN3A 2KLXA 1ZZYA 2QKEA 4PURA 4JU5A 2CVDA 5LNKe 19GSA 1TKDB 3WT1A 3CSIA 2OE1A 2H0IA 3IA1A 2H1GA 1Z6NA 4I5QA 1EV4A 5DJMA 4F0CA 4GSTA 2B3SA 2LTKA 4PQIA 3ME8A 2X49A 6GSUA 3VWVA 4QQ7A 1YZXA 3R2QA 5GZZB 3EURA 1ZOFA 5D73A 1AIUA 4EC0A 4BPYA 2PPTA 3TCOA 3CWGA 3FR3A 2H6ZA 2GGTA 3RGBC 3DEXA 2IPAA 3ZVJA 4MLYA 1OC9B 5EL8A 4ECCA 4Z2TA 4TVEA 2YPMA 2H1LA 3G7IA 4TR3A 3GTUA 1XWAA 3UL3A 3IXRA 1NSWA 3QDNA 2YNXA 3IV4A 3QCPA 2FHEA 3KMNA 4AF2A 2VM2A 2EIQA 1GSQA 1G0TA 1NHOA 3FW2A 5AGYA 2VL9A 1R7HA 3G7YA 4NXIA 4ZL7A 5CP1A 1UA5A 4FYBA 2UV8G 2C3TA 4PHZC 2J23A 4L8EA 3SWLA 4HU9A 4O5QA 4EE0A 2A2SA 2X99A 4EDZA 11GSA 1ZYPA 1WIKA 4Z2UA 2WZ9A 2R0PA 4I97A 3CYNA 4TN8A 1XFLA 2WGRA 2IWTA 1GSUA 2VUPA 2X64A 2JZTA 2YWNA 4PGTA 4F2IA 5ECRB 3GFKA 1ML6A 3HJPA 1M9BA 1GSFA 3KP8A 1X9MB 1GP1A 5ECIB 4NMUA 1DE2A 1TK5B 3GHAA 2GTUA 5CRWA 4GXZA 4XRDA 2LKUA 4K0GA 5AN1A 5ECLB 3GA4A 4K1FA 4OD7A 4ZXGA 4MA9A 5KN0A 5B7CA 2E7PA 2PVOC 3UVHA 4GCIA 1EOHA 4KAEA 3GURA 3Q6OA 3FR9A 1SVLA 3PPUA 2AB6A 1C72A 1DBYA 1ZMAA 3VWUA 1SK1A 3LXZA 1WPIA 3WGXA 2YANA 1Y1UA 1PL1A 1MDKA 4I2UA 5B6MA 3KH9A 1YEWC 2CQ9A 1YEPA 3EC3A 2D2ZA 1O7UA 1BYEA 7GSSA 3LYPA 1X5EA 3N5OA 5H5RA 2R6KA 1LU4A 2HFDA 2VCVA 3H4KA 4NHZA 2PWJA 2V32A 3A5WA 3KH7A 4P3YB 2FD3A 1AUCA 4GQFA 1O8WA 2KP2A 4WEYA 3ZVJD 1T1VA 1PN9A 4PTSA 2DJ0A 3HVXA 9GSSA 2REMA 3UAPA 2VCWA 2PU9C 5G5EA 3TKSA 1FW1A 2C80A 4RI7A 4XCSA 4KSMA 1OC3A 2YOIA 4HZ4A 3IHQA 2H74A 3HVNA 3CXGA 4J2FA 3C7MA 2OE3A 4MJBA 2DKHA 2JZSA 1MDIA 2R0GA 3G9BA 3EYTA 3KTLA 1X9SB 3C73A 1X9WB 1SYXA 3H8QA 3CTFA 2C0FA 3C8EA 4QL9A 2VKZG 1ZL9A 2MMNA 3A2XA 4TW5A 1EOGA 1XWBA 5A4VA 2YWOA 2GS3A 3IC4A 1QFNA 1OVNA 2LS5A 3O6TA 3MWHA 1GUMA 1SYRA 2LJAA 3QD9A 4EXJA 2FCHA 3VURA 2WW3A 4XIHA 2IL3A 1Z6MA 1GULA 1EEJA 4POBA 2R4VA 3PINA 1JLVA 2ES7A 5ECMB 3HZ8A 2P31A 3MSZA 1NM3A 2RM5A 1EZKA 2XHFA 1YDKA 3VK9A 2WFCA 5E59A 2H1BA 2L4QA 5H5QA 2PVQA 4HSCX 1PL2A 1AAZA 1Z5YE 1YKCA 1QXHA 1BX9A 1EEMA 2F8AA 4KX4A 3F63A 2O89A 4IBPA 2NVLA 2YV9A 3I9V2 2CVKA 5FHIA 3E9JB 4YQUA 1E6BA 4EVMA 1U87A 1JZRA 2CX3A 4BL7B 2I1UA 1TI1A 5ID2B 2AAWA 2I4AA 2GZPA 1Q4JA 1UN2A 4MJCA 1BG5A 1YEXA 3IHGA 1U3AA 1JZWA 2EIOA 2GZZA 3EWLA 3K8NA 2CAQA 2EFEA 4MP4A 5J41A 4RQXA 3TKSC 3EMXA 1KTEA 4NAXA 2AHEA 2H6XA 4NV2A 3HYPA 4ID0A 12GSA 2LRCA 3LSZA 4LA1A 2DJJA 1GTAA 1B9YC 2F51A 6GSSA 5EY6A 1OKDA 2PUKC 1YJ6A 2A4HA 1I5GA 4GSNA 5J4YA 1OE8A 1W4VA 2VL3A 5J40A 2WCIA 4IQ1A 2JSYA 3F4TA 2FGXA 1SENA 3KCMA 1RQMA 3C1RA 2LJRA 2L5OA 4YH2A 1N8JA 2AV4A 3FKFA 3ZFBA 4BL7A 1THXA 4TKYA 5ID2A 1S3CA 4DVCA 2KP1A 1A2MA 2WVYA 3VPTA 2K18A 5GSTA 4ZBDA 1ERTA 5DALB 2FA4A 4EIQA 5J4UA 1T00A 3VWWA 3ZL5A 2PBJA 4BVYB 1B8XA 4ZIJA 1UC7A 1KBNA 4JR4A 3ZLPA 3BCIA 1S4BP 3IRAA 3GX8A 1QQ2A 2DJ3A 3FR6A 4AGSA 1CQHA 1LJRA 2OBKA 1FHEA 3CRTA 1BAYA 2HRAA 5CYYA 3D21A 2PN8A 4GF0A 4PI2C 3RPPA 3QFBC 4NHWA 2FUG2 1XOAA 1F9MA 3I69A 1JLWA 2MBSA 3DD3A 3RDWA 5EPFA 3FMWA 1AC1A 3CMIA 2RLIA 1ABAA 1K0OA 1O81A 1TRWA 1FVKA 2HSNA 3LORA 1U6TA 3U5RE 4JR6A 2B7JA 2OACA 1R4WA 2IJYA 3RFRC 4Q5RA 4MZCA 2IFQB 1MD4A 4OCFA 1EV9A 3A2VA 5A4UA 4F9ZA 1JHBA 3G7JA 1F2EA 2N5AA 1PSQA 4MCUA 1Z7RA 1SD8A 4PNFA 4MZWA 1XW5A 3CSHA 4F03A 2UZ8A 2BMXA 3GMFA 5F05A 5G30A 1HNBA 2TRXA 2MZCA 3HJMA 3TJJA 4CY8A 3EVIA 3GL5A 1PKZA 2A4VA 1AW9A 3J7Yb 2NTOA 4LLRA 1TDIA 1U88A 4HEA2 4BWQA 1FG4A 4O5RA 3RHCA 5IOWA 5GAND 2WDUA 2WZSA 2XBQA 1V58A 2FLSA 2TRCP 2IIYA 4FYCA 3PGTA 1I9DA 1XVWA 2B7KA 2WVXB 1J08A 3L9VA 1G7OA 3LGCA 3KGKA 4CW9A 2JL4A 2O7KA 1DUGA 1TRSA 1OC8A 2K8VA 1O8XA 3DRNA 4HOJA 2VLVA 5A34A 1TXUA 4G0LA 6GSTA 5EVOA 2HRKB 4WF4A 4E68A 3N9JA 4MABA 4TR1B 5KOXA 2V6OA 2HSMB 5G2ZA 4ILFA 3FZ5A 1OYJA 4L5LA 3DKSA 2VCZA 3DXBA 2XPEA 3QAVA 1M2DA 5IMFA 4XS1A 2A2RA 2HLSA 4L5OA 1K0MA 3CRUA 2VLTA 6GSXA 4N10A 2FWEA 3ZFLA 3LQ7A 2N5BA 5D9XA 5CREA 4GQCA 5J4VA 5D9WA 4W66A 3I43A 4K7OA 3ME7A 5C00A 3UOMA 3TJKA 3TRPA 5ECNB 4OFNA 4ZILA 1V57A 2OKAA 1A0RP 1GSDA 1H75A 2YN1A 2I81A 2I9HA 1SJZA 2L6CA 1Z7PA 3FK8A 3VI7A 1PD21 1T4ZA 1U3IA 2OA7A 2PMTA 3WYWA 4ZB7A
chains in the Genus database with same CATH topology
3FRCA 2C0DA 1GSYA 5GAPD 4ACSA 2AJQB 2HRKA 2MMAA 1AQWA 5HFGA 4MK3A 4TR1A 1TOFA 2QSIA 2R3XA 3US3A 3MIXA 3QOUA 2CT6A 3DIEA 3VLNA 4K7IA 5AIVA 4Q5NA 2A2PA 4MNNA 5CAXA 4DSQA 2P0GA 5CNWA 1FB6A 2VCQA 3BBYA 5C04A 1OC9A 4IVFA 2FWFA 4IGJA 3IAM2 2FWGA 1S3AA 4MJEA 2E2GA 2C8UA 4YKGA 1SL1B 3ERWA 1GL8A 2K9FA 3GKXA 3TKPA 4JEDA 2DSAA 2O85A 5KEJA 2LNTA 4LL4B 3A2WA 3HVSA 3SBCA 5HFKA 4HJ2A 4I2TA 1G6WA 1M99A 3EMPA 3HA9A 2H0HA 4MF6A 2ZNMA 2DJ1A 4MH2A 2WB9A 3F8UA 3LJRA 5DQYA 3VPQA 4A5PA 3BD2A 2PGTA 2R5GA 1KNGA 2CX4A 5B8AA 4ECBA 3GV1A 4XRAA 2JACA 4GDFA 3CSJA 5B8BA 4IW9A 5BRTA 3BJ5A 3HXSA 4ULXA 4IJIA 4QMKA 2R37A 1Z9HA 5D8IA 3HMJG 1YF1A 3ZITA 3JCML 4K5RA 4TOPA 2C3QA 5ELGA 3CBUA 3BOAA 4CHSA 2GSRA 4DEJA 5DQSA 5GSSA 4F82A 4G2EA 3P8WA 3TJBA 4NPBA 2LRTA 3IK7A 5DVBA 4AJ6A 3TJGA 2YCDA 3F0IA 4G01A 3UARA 2R0CA 2WULA 2OJLA 4AKHA 2YZHA 1TRVA 4TR0A 3LW9A 2IN3A 5CRHA 4POMA 2DIYA 2HRNA 2I3YA 3ZMLA 1AQXA 1W89A 3GKNA 4V2NA 1URMA 4MPFA 5JCWA 1EGRA 4OMVA 2QGVA 4TXOB 1YF0A 1KEBA 2EFCA 1V2AA 2LNSA 4IP1A 1F3AA 3WGDA 2L4CA 5HQPA 18GSA 1V9WA 1SK2A 4V2LA 2IMKA 2VIMA 4IN0A 4HU7A 3WGEA 1ZCPA 4KA0A 5IMDA 4GTUA 1Y6EA 3GH9A 4YAPA 1X5DA 5IOXA 4IQAA 2H0GA 3DVXA 4ZB8A 3C1SA 1TI3A 4V1Ap 1XWKA 2YJHA 3H93A 3ZRDA 1N25A 1SVOA 2GDRA 2O8VB 4L0WA 1M2AA 5CRDA 1SKSB 3VFIA 14GSA 5A5HB 5F0GA 2B5XA 3E0UA 4AKGA 2HRFA 3WD6A 4ECIA 3J7Yk 1A8YA 3RPNA 4TR4A 1A24A 4NWYA 1K3OA 4YKFA 5DCHA 4HDEA 4HQSA 1WP0A 1FB0A 3HHVA 2VL2A 4ISDA 3F9UA 4WF5A 3RBTA 1TU8A 2L5LA 3HDCA 4H86A 2VCXA 4ZBBA 1MDJA 3F4SA 2HZFA 3EPTA 4TXOA 3D22A 1GUHA 1SL2B 6GSVA 4BVXB 2ON5A 2C1YA 2LRNA 1QK8A 1BJXA 3NIVA 3PH9A 2DJ2A 2HZEB 3DGQA 2X8GA 4E8EA 3HY2A 2VD1A 3KP9A 5E4WA 3KM6A 5INYA 1XBSA 4MDCA 1TXXA 1BQ7A 4FIWA 22GSA 2E0QA 3DMLA 1M2BA 2PERA 5A5HA 2VO4A 5H5SA 1MTCA 2WJUA 3DWVA 2AUVA 1TK8B 2LJKA 2LEGA 4X0XA 1T3BA 5IQYA 2DIZA 1O73A 2KUCA 2YWMA 1XOBA 5D96A 1SKRB 4BWSA 2J9HA 1R5PA 2DMMA 4O5UA 5G1LA 1F3BA 1A0FA 4FH8A 2LV3A 3HD5A 1A8LA 1HD2A 5KN1A 2O87A 4J57E 5BMUB 1G6YA 2H1AA 2F9SA 3TRQA 3QAGA 3IPZA 4XTSA 2CVBA 3FEUA 5IM9A 3FZ4A 4KGIA 4BVXA 4KDUA 2RM6A 4IHUA 4E8HA 2HZEA 5HR3A 1XW6A 5IO0A 3GKMA 4K5SA 4ZBAA 1EWXA 3LXTA 3TU3B 2VD0A 3FHKA 2L6DA 2NDOA 2H70A 4TRXA 1ST9A 4WXTA 1GSEA 1VF3A 4IS0A 1HNAA 1GUKA 5HR2A 2ZUPA 2YV7A 5DALA 2H76A 3M0FA 3OR5A 2VL2C 3GKKA 1VRSD 1GTIA 1MEKA 4BVYA 3F3QA 2VAFA 3IOSA 1ERUA 3TRXA 1LBKA 3UJ1A 1J0FA 3L9SA 1PKWA 2ZCTA 4PQ1A 1YQ1A 2VM1A 3Q18A 3KEBA 4ML6A 4ZB6A 4MJAA 1ERVA 3IR4A 3GNJA 4KB3A 1O85A 1K0NA 4Z7XA 1USBA 4D73B 3EU3A 4HJMA 2ALBA 2NPBA 2VCTA 3TKSE 3GN3A 4PNGA 2GLRA 1EGOA 3TKRA 4WBJA 1B48A 4HZ2A 3O3TA 2DC5A 3IC8A 2F3MA 2FA8A 1B4QA 4K2DA 5ECQB 1WWJA 3ZREA 2HXKA 1K0BA 1HQOA 5ECPB 2VOCA 4AKXB 3ZTLA 3GUSA 3HJOA 2F8FA 4ZL8A 2HSYA 4QL7A 1SU9A 3KXOA 3ERGA 4MPGA 1J9BA 2IFQA 5KN2A 5ECKB 2IMEA 4AKIA 3QPMA 4K8MA 2EFDA 4ECJA 1OE7A 1VF1A 4IKHA 5ABRA 4KDYA 4ZB9A 4KE3A 1Z3EA 20GSA 5JWOB 5G1KA 2HSHA 1TP9A 2V1MA 4GWRA 3APOA 5DJLA 4POKA 1QMVA 3KJYA 4D73A 3VI5A 1K3LA 4HUAA 2LQQA 1YVLA 2DKIA 2V41A 3NZNA 3IE3A 1WMJA 1PX7A 1PN0A 5DAKB 3FZ9A 1R26A 1EP8A 5F06A 2X4AA 3AY8A 2OE0A 2LUSA 2H66A 1SKWB 4KH7A 1K0AA 3C71A 4V2MA 5AIXA 6GSYA 1HYUA 1PX6A 1PA3A 4POLA 2RIIA 3P90A 2B1LA 5ENUA 1A2JA 4O7HA 3LFLA 4GSSA 3TB2A 5KOWA 3H1NA 2HI7A 1XIYA 4I8BA 3ISOA 1ZGNA 3IDVA 1N2AA 3MAKA 3LEFA 2HSMA 3QR6A 3HZ4A 4MH3A 2YWIA 2YP6A 4OCEA 4EF0A 3FYGA 1F6MC 2K6VA 3W8JA 2YZUA 2H6YA 5D9VA 4O92A 2X8CA 3KIJA 2HT9A 4OO4A 4ICYA 1PRXA 1SD9A 2KOKA 3TKQA 2OT3A 3TJFA 1GH2A 3H79A 1GTUA 3GRXA 1GNWA 1GSSA 4HQZA 1PGTA 5F07A 3BCKA 4GRFA 5DAKA 2GSTA 5A4WA 3A5IA 1G7EA 5J5NA 3ERFA 3KD0A 1GRXA 2OBIA 2JU5A 1SJIA 1WE0A 4DSRA 3KTBA 4FQUA 4RQRA 3ZIVA 4AI6A 3TGZA 4RI6A 1XPVA 5LCZA 1JZDA 4YAVA 3KZQA 1OKTA 5CO3A 1TK0B 4KUNA 4PUAA 3GSSA 4O32A 4GLTA 1BEDA 8GSSA 5D93A 4X4JA 1BG1A 1SK0A 3F4RA 1T7PB 2H71A 3QFAC 1GLQA 1H4OA 4LL1B 5IPHA 2CV4A 4F0BA 2DLXA 1M0UA 1PMTA 3DYRA 1JZOA 4XS6A 3HCZA 2MBTA 4G0KA 5J47A 3EU4A 1GLPA 4L0UA 4WETA 4DSSB 2V2GA 5F8BA 3W6GA 3I6AA 4MMMA 4YQVA 2DMLA 4MF7A 3IAS2 4XHMA 1F37A 4OO5A 3VWXA 3Q74A 3LWAA 1YY7A 5ECSA 3L78A 1Q98A 1X0RA 2MYGA 3D4MA 5LD0A 4KDXA 2Z9SA 4G19A 2GSSA 3UVTA 1SVMA 4OFTA 3ED3A 4HI7A 4EL1A 2CZ3A 2HNLA 4WR5A 1X5CA 3GYKA 3L0HA 1TW9A 4Q5QA 4G9HA 5HR1A 1E2YA 1M9AA 2CAIA 1RK4A 3MDKA 2XC2A 3GIXA 2V6KA 4NV5A 4YQMA 4G10A 2QA1A 5COHA 2H75A 2HQTA 2NBSA 1NW2A 2FY6A 3MNGA 4JRRA 2H1DA 2M72A 3HKRA 4N0ZA 3TDGA 3HVVA 3A3TA 2QC7A 1XCCA 4XS4B 4EDYA 5G5FA 3M3MA 4AJ8A 1ACVA 1XXUA 2C0EA 1IYHA 5ECOB 2TIRA 2MMZA 3ZZXA 4N3ZA 4PXOA 2JADA 3GX0A 4DSSA 5AISA 2DBCA 5B6NA 2RUEA 1EP7A 1PQNA 2G0FA 3ZIJA 1T4YA 5IIZA 2B1KA 4PQHA 2BJXA 3UIWA 1AQVA 2H8LA 1CQGA 4JBBA 1XWGA 3M1GA 1TTZA 1ZYQB 1WRYA 4TXVA 5J3RA 5IMVA 3W8SA 3IBHA 1DSBA 4RUVA 4G0IA 2HE3A 10GSA 3E3EA 2M46A 3UBLA 2H73A 2GT6A 2YJ7A 3RAZA 4FYUA 4N0VA 2KHPA 17GSA 2X8HA 2HYXA 1ON4A 5HR0A 2O5VA 1S3DA 1R5AA 4OWYA 4K2XA 6GSWA 4EKZA 4KW6A 4LMWA 4XS4A 2H72A 5JWQB 4USSA 5J9CA 4WR4A 5A1NB 2GSQA 4ZL9A 3O76A 1VGLA 2GZYA 2BTOT 1RW1A 2C0GA 4K9ZA 4KF9A 3MYDA 4N30A 1A2LA 3UEMA 3GSTA 2IMIA 1T8EB 1TRUA 1XW9A 16GSA 1TJDA 3KMOA 2GT5A 2WS2A 4K0NA 4J56E 5IMCA 4CY6A 1ERWA 3D4TA 4EIPA 5JCUA 2GQLA 2LSTA 3APSA 3QAWA 4OFMA 3UMAA 2B5YA 2XBIA 2GVPA 3F6DA 1WJKA 1V40A 4JE1A 1SJ6A 3RHBA 5L71A 4Q5FA 2K8SA 1FOHA 3TUEA 2C3NA 3S9FA 4X43A 4AJ7A 3LG6A 5DCGA 5ELAA 3P2AA 3GL3A 4FO5A 3UBKA 4ML1A 5FWGA 3P7XA 2RUFA 4WBRD 2HSNB 1K0CA 5JWRB 5DBQA 4HS1A 5IMZA 13GSA 1MD3A 3M8NA 4LMVA 1OAZA 1ILOA 3U6VA 2GQKA 3NOFA 2VLUA 2FWHA 4WKWA 5A1NA 3D6IA 1FOVA 5HFIA 5A5KA 5DDLA 4MF5A 4EUYA 2P5QA 2EFHA 5CRGA 2N5FA 1M7TA 3PR8A 2M80A 2OADA 3CTGA 2L59A 1XVQA 2H19A 2IMDA 4N11A 2H01A 1FVJA 1QGVA 4K7NA 4X1UA 4CDOA 4Z2RA 2B6MA 2WRTA 3F6FA 3QMXA 5IMAA 1AXDA 2LQOA 4KNDA 4BA7A 5D9TA 1XWCA 3FZAA 1BF5A 3TOUA 3L9UA 4V1Ag 4KSOA 4EO3A 1NHYA 1JFUA 1ZYEA 3IK9A 3EINA 3FY7A 4IJ3A 2CZ2A 1IYIA 5A34B 1THOA 2DJKA 4IELA 1K0DA 1WOUA 2JSZA 5G31A 2FNOA 1GWCA 2EIRA 2B5EA 3APQA 2MMOA 3DVWA 2G2QA 5BMUA 1UVZA 3F3RA 4IP6A 2H30A 4PX1A 1SL0B 2R2JA 5J9BA 1ZYNA 1GTBA 2CA8A 1FAAA 2AYTA 1XZOA 4PUFC 1QUWA 2XPDA 3R3EA 2P5RA 1HNCA 2E2MA 3Q19A 5IO2A 1VF2A 2QA2A 1FO5A 4KCEA 1GNEA 3GH6A 2EC4A 1K3YA 4K6XA 2L57A 3M9KA 5ECHB 4MZBA 3ZYWA 3D0ZA 5FT3A 5JCGA 1TU7A 3GTUB 1B9XC 3LYKA 1Y25A 3WT2A 3D5JA 3L4NA 1YKAA 1DE1A 4I6XA 2IMFA 3ZMKA 1V98A 2GQMA 3M9JA 2JZRA 1VF4A 1O6JA 3V1WA 3TOTA 1A23A 2C4JA 4KCAA 2ON7A 3EE2A 5IPGA 1B4PA 4JZQA 5KN3A 2KLXA 1ZZYA 2QKEA 4PURA 4JU5A 2CVDA 5LNKe 19GSA 1TKDB 3WT1A 3CSIA 2OE1A 2H0IA 3IA1A 2H1GA 1Z6NA 4I5QA 1EV4A 5DJMA 4F0CA 4GSTA 2B3SA 2LTKA 4PQIA 3ME8A 2X49A 6GSUA 3VWVA 4QQ7A 1YZXA 3R2QA 5GZZB 3EURA 1ZOFA 5D73A 1AIUA 4EC0A 4BPYA 2PPTA 3TCOA 3CWGA 3FR3A 2H6ZA 2GGTA 3DEXA 2IPAA 3ZVJA 4MLYA 1OC9B 5EL8A 4ECCA 4Z2TA 4TVEA 2YPMA 2H1LA 3G7IA 4TR3A 3GTUA 1XWAA 3UL3A 3IXRA 1NSWA 3QDNA 2YNXA 3IV4A 3QCPA 2FHEA 3KMNA 4AF2A 2VM2A 2EIQA 1GSQA 1G0TA 1NHOA 3FW2A 5AGYA 2VL9A 1R7HA 3G7YA 4NXIA 4ZL7A 5CP1A 1UA5A 4FYBA 2UV8G 2C3TA 2J23A 4L8EA 3SWLA 4HU9A 4O5QA 4EE0A 2A2SA 2X99A 4EDZA 11GSA 1ZYPA 1WIKA 4Z2UA 2WZ9A 2R0PA 4I97A 3CYNA 4TN8A 1XFLA 2WGRA 2IWTA 1GSUA 2VUPA 2X64A 2JZTA 2YWNA 4PGTA 4F2IA 5ECRB 3GFKA 1ML6A 3HJPA 1M9BA 1GSFA 3KP8A 1X9MB 1GP1A 5ECIB 4NMUA 1DE2A 1TK5B 3GHAA 2GTUA 5CRWA 4GXZA 4XRDA 2LKUA 4K0GA 5AN1A 5ECLB 3GA4A 4K1FA 4OD7A 4ZXGA 4MA9A 5KN0A 5B7CA 2E7PA 2PVOC 3UVHA 4GCIA 1EOHA 4KAEA 3GURA 3Q6OA 3FR9A 1SVLA 3PPUA 2AB6A 1C72A 1DBYA 1ZMAA 3VWUA 1SK1A 3LXZA 1WPIA 3WGXA 2YANA 1Y1UA 1PL1A 1MDKA 4I2UA 5B6MA 3KH9A 2CQ9A 1YEPA 3EC3A 2D2ZA 1O7UA 1BYEA 7GSSA 3LYPA 1X5EA 3N5OA 5H5RA 2R6KA 1LU4A 2HFDA 2VCVA 3H4KA 4NHZA 2PWJA 2V32A 3A5WA 3KH7A 4P3YB 2FD3A 1AUCA 4GQFA 1O8WA 2KP2A 4WEYA 3ZVJD 1T1VA 1PN9A 4PTSA 2DJ0A 3HVXA 9GSSA 2REMA 3UAPA 2VCWA 2PU9C 5G5EA 3TKSA 1FW1A 2C80A 4RI7A 4XCSA 4KSMA 1OC3A 2YOIA 4HZ4A 3IHQA 2H74A 3CXGA 4J2FA 3C7MA 2OE3A 4MJBA 2DKHA 2JZSA 1MDIA 2R0GA 3G9BA 3EYTA 3KTLA 1X9SB 3C73A 1X9WB 1SYXA 3H8QA 3CTFA 2C0FA 3C8EA 4QL9A 2VKZG 1ZL9A 2MMNA 3A2XA 4TW5A 1EOGA 1XWBA 5A4VA 2YWOA 2GS3A 3IC4A 1QFNA 1OVNA 2LS5A 3O6TA 3MWHA 1GUMA 1SYRA 2LJAA 3QD9A 4EXJA 2FCHA 3VURA 4XIHA 2IL3A 1Z6MA 1GULA 1EEJA 4POBA 2R4VA 3PINA 1JLVA 2ES7A 5ECMB 3HZ8A 2P31A 3MSZA 1NM3A 2RM5A 1EZKA 2XHFA 1YDKA 3VK9A 2WFCA 5E59A 2H1BA 2L4QA 5H5QA 2PVQA 1PL2A 1AAZA 1Z5YE 1YKCA 1QXHA 1BX9A 1EEMA 2F8AA 4KX4A 3F63A 2O89A 4IBPA 2NVLA 2YV9A 3I9V2 2CVKA 5FHIA 3E9JB 4YQUA 1E6BA 4EVMA 1U87A 1JZRA 2CX3A 4BL7B 2I1UA 1TI1A 5ID2B 2AAWA 2I4AA 2GZPA 1Q4JA 1UN2A 4MJCA 1BG5A 1YEXA 3IHGA 1U3AA 1JZWA 2EIOA 2GZZA 3EWLA 3K8NA 2CAQA 2EFEA 4MP4A 5J41A 4RQXA 3TKSC 3EMXA 1KTEA 4NAXA 2AHEA 2H6XA 4NV2A 3HYPA 4ID0A 12GSA 2LRCA 3LSZA 4LA1A 2DJJA 1GTAA 1B9YC 2F51A 6GSSA 5EY6A 1OKDA 2PUKC 1YJ6A 2A4HA 1I5GA 4GSNA 5J4YA 1OE8A 1W4VA 2VL3A 5J40A 2WCIA 4IQ1A 2JSYA 3F4TA 2FGXA 1SENA 3KCMA 1RQMA 3C1RA 2LJRA 2L5OA 4YH2A 1N8JA 2AV4A 3FKFA 3ZFBA 4BL7A 1THXA 4TKYA 5ID2A 1S3CA 4DVCA 2KP1A 1A2MA 3VPTA 2K18A 5GSTA 4ZBDA 1ERTA 5DALB 2FA4A 4EIQA 5J4UA 1T00A 3VWWA 3ZL5A 2PBJA 4BVYB 1B8XA 4ZIJA 1UC7A 1KBNA 4JR4A 3ZLPA 3BCIA 3IRAA 3GX8A 1QQ2A 2DJ3A 3FR6A 4AGSA 1CQHA 1LJRA 2OBKA 1FHEA 3CRTA 1BAYA 2HRAA 5CYYA 3D21A 2PN8A 4GF0A 3RPPA 3QFBC 4NHWA 2FUG2 1XOAA 1F9MA 3I69A 1JLWA 2MBSA 3DD3A 3RDWA 5EPFA 3FMWA 1AC1A 3CMIA 2RLIA 1ABAA 1K0OA 1O81A 1TRWA 1FVKA 2HSNA 3LORA 1U6TA 3U5RE 4JR6A 2B7JA 2OACA 1R4WA 2IJYA 4Q5RA 4MZCA 2IFQB 1MD4A 4OCFA 1EV9A 3A2VA 5A4UA 4F9ZA 1JHBA 3G7JA 1F2EA 2N5AA 1PSQA 4MCUA 1Z7RA 1SD8A 4PNFA 4MZWA 1XW5A 3CSHA 4F03A 2UZ8A 2BMXA 3GMFA 5F05A 5G30A 1HNBA 2TRXA 2MZCA 3HJMA 3TJJA 4CY8A 3EVIA 3GL5A 1PKZA 2A4VA 1AW9A 3J7Yb 2NTOA 4LLRA 1TDIA 1U88A 4HEA2 4BWQA 1FG4A 4O5RA 3RHCA 5IOWA 5GAND 2WDUA 2XBQA 1V58A 2FLSA 2TRCP 2IIYA 4FYCA 3PGTA 1I9DA 1XVWA 2B7KA 1J08A 3L9VA 1G7OA 3LGCA 3KGKA 4CW9A 2JL4A 2O7KA 1DUGA 1TRSA 1OC8A 2K8VA 1O8XA 3DRNA 4HOJA 2VLVA 5A34A 1TXUA 4G0LA 6GSTA 5EVOA 2HRKB 4WF4A 4E68A 3N9JA 4MABA 4TR1B 5KOXA 2V6OA 2HSMB 5G2ZA 4ILFA 3FZ5A 1OYJA 4L5LA 3DKSA 2VCZA 3DXBA 2XPEA 3QAVA 1M2DA 5IMFA 4XS1A 2A2RA 4L5OA 2HLSA 1K0MA 3CRUA 2VLTA 6GSXA 4N10A 2FWEA 3ZFLA 3LQ7A 2N5BA 5D9XA 5CREA 4GQCA 5J4VA 5D9WA 4W66A 3I43A 4K7OA 3ME7A 5C00A 3UOMA 3TJKA 3TRPA 5ECNB 4OFNA 4ZILA 1V57A 2OKAA 1A0RP 1GSDA 1H75A 2YN1A 2I81A 2I9HA 1SJZA 2L6CA 1Z7PA 3FK8A 3VI7A 1PD21 1T4ZA 1U3IA 2OA7A 2PMTA 3WYWA 4ZB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FRC A;  2C0D A;  1GSY A;  5GAP D;  4ACS A;  2AJQ B;  2HRK A;  2MMA A;  1AQW A;  5HFG A;  4MK3 A;  4TR1 A;  1TOF A;  2QSI A;  2R3X A;  3US3 A;  3QOU A;  2CT6 A;  3DIE A;  3VLN A;  4K7I A;  5AIV A;  4Q5N A;  5CAX A;  4DSQ A;  2P0G A;  5CNW A;  1FB6 A;  2VCQ A;  3BBY A;  5C04 A;  1OC9 A;  4IVF A;  2FWF A;  4IGJ A;  3IAM 2;  2FWG A;  1S3A A;  4MJE A;  2E2G A;  2C8U A;  1SL1 B;  3ERW A;  1GL8 A;  2K9F A;  3GKX A;  3TKP A;  4JED A;  2DSA A;  2O85 A;  5KEJ A;  2LNT A;  4LL4 B;  3A2W A;  3HVS A;  3SBC A;  5HFK A;  4HJ2 A;  4I2T A;  1G6W A;  1M99 A;  3EMP A;  3HA9 A;  2H0H A;  4MF6 A;  2ZNM A;  2DJ1 A;  4MH2 A;  2WB9 A;  3F8U A;  3LJR A;  5DQY A;  3VPQ A;  3BD2 A;  2PGT A;  2R5G A;  1KNG A;  2CX4 A;  5B8A A;  4ECB A;  3GV1 A;  4XRA A;  2JAC A;  3CSJ A;  5B8B A;  4IW9 A;  3BJ5 A;  3HXS A;  4ULX A;  4IJI A;  2R37 A;  1Z9H A;  5D8I A;  1YF1 A;  3ZIT A;  3JCM L;  4TOP A;  2C3Q A;  5ELG A;  3CBU A;  3BOA A;  4CHS A;  2GSR A;  4DEJ A;  5DQS A;  5GSS A;  4F82 A;  4G2E A;  3P8W A;  3TJB A;  4NPB A;  2LRT A;  3IK7 A;  5DVB A;  4AJ6 A;  3TJG A;  2YCD A;  3F0I A;  3UAR A;  2WUL A;  2OJL A;  2YZH A;  1TRV A;  4TR0 A;  2IN3 A;  5CRH A;  4POM A;  2DIY A;  2HRN A;  2I3Y A;  3ZML A;  1AQX A;  1W89 A;  3GKN A;  4V2N A;  1URM A;  4MPF A;  5JCW A;  1EGR A;  4OMV A;  2QGV A;  4TXO B;  1YF0 A;  1KEB A;  1V2A A;  2LNS A;  4IP1 A;  1F3A A;  3WGD A;  2L4C A;  5HQP A;  18GS A;  1V9W A;  1SK2 A;  4V2L A;  2IMK A;  2VIM A;  4IN0 A;  4HU7 A;  3WGE A;  1ZCP A;  4KA0 A;  5IMD A;  4GTU A;  1Y6E A;  3GH9 A;  4YAP A;  1X5D A;  5IOX A;  4IQA A;  2H0G A;  3DVX A;  4ZB8 A;  3C1S A;  1TI3 A;  4V1A p;  1XWK A;  2YJH A;  3H93 A;  3ZRD A;  2GDR A;  2O8V B;  4L0W A;  1M2A A;  5CRD A;  1SKS B;  3VFI A;  14GS A;  5F0G A;  2B5X A;  3E0U A;  2HRF A;  3WD6 A;  4ECI A;  3J7Y k;  1A8Y A;  3RPN A;  4TR4 A;  1A24 A;  4NWY A;  1K3O A;  5DCH A;  4HDE A;  4HQS A;  1WP0 A;  1FB0 A;  3HHV A;  2VL2 A;  4ISD A;  3F9U A;  4WF5 A;  3RBT A;  1TU8 A;  2L5L A;  3HDC A;  4H86 A;  2VCX A;  4ZBB A;  1MDJ A;  3F4S A;  2HZF A;  4TXO A;  3D22 A;  1GUH A;  1SL2 B;  6GSV A;  4BVX B;  2ON5 A;  2C1Y A;  2LRN A;  1QK8 A;  1BJX A;  3NIV A;  3PH9 A;  2DJ2 A;  2HZE B;  3DGQ A;  2X8G A;  4E8E A;  3HY2 A;  2VD1 A;  3KP9 A;  5E4W A;  3KM6 A;  5INY A;  1XBS A;  4MDC A;  1TXX A;  1BQ7 A;  4FIW A;  22GS A;  2E0Q A;  3DML A;  1M2B A;  2PER A;  2VO4 A;  5H5S A;  1MTC A;  2WJU A;  3DWV A;  2AUV A;  1TK8 B;  2LJK A;  2LEG A;  4X0X A;  1T3B A;  5IQY A;  2DIZ A;  1O73 A;  2KUC A;  2YWM A;  1XOB A;  5D96 A;  1SKR B;  4BWS A;  2J9H A;  1R5P A;  2DMM A;  5G1L A;  1F3B A;  1A0F A;  4FH8 A;  2LV3 A;  3HD5 A;  1A8L A;  1HD2 A;  5KN1 A;  2O87 A;  4J57 E;  1G6Y A;  2H1A A;  2F9S A;  3TRQ A;  3QAG A;  3IPZ A;  4XTS A;  2CVB A;  3FEU A;  5IM9 A;  3FZ4 A;  4KGI A;  4BVX A;  4KDU A;  2RM6 A;  4IHU A;  4E8H A;  2HZE A;  5HR3 A;  1XW6 A;  5IO0 A;  3GKM A;  4ZBA A;  1EWX A;  3LXT A;  2VD0 A;  3FHK A;  2L6D A;  2NDO A;  2H70 A;  4TRX A;  1ST9 A;  4WXT A;  1GSE A;  1VF3 A;  4IS0 A;  1HNA A;  1GUK A;  5HR2 A;  2ZUP A;  2YV7 A;  5DAL A;  2H76 A;  3OR5 A;  3M0F A;  2VL2 C;  3GKK A;  1VRS D;  1GTI A;  1MEK A;  4BVY A;  3F3Q A;  2VAF A;  3IOS A;  1ERU A;  3TRX A;  1LBK A;  3UJ1 A;  1J0F A;  3L9S A;  1PKW A;  2ZCT A;  4PQ1 A;  1YQ1 A;  2VM1 A;  3Q18 A;  3KEB A;  4ML6 A;  4ZB6 A;  4MJA A;  1ERV A;  3IR4 A;  3GNJ A;  4KB3 A;  1O85 A;  1K0N A;  4Z7X A;  1USB A;  4D73 B;  3EU3 A;  4HJM A;  2ALB A;  2NPB A;  2VCT A;  3TKS E;  3GN3 A;  4PNG A;  2GLR A;  1EGO A;  3TKR A;  4WBJ A;  1B48 A;  4HZ2 A;  3O3T A;  2DC5 A;  3IC8 A;  2F3M A;  2FA8 A;  1B4Q A;  4K2D A;  5ECQ B;  1WWJ A;  3ZRE A;  2HXK A;  1K0B A;  1HQO A;  5ECP B;  2VOC A;  3ZTL A;  3GUS A;  3HJO A;  2F8F A;  4ZL8 A;  2HSY A;  4QL7 A;  1SU9 A;  3KXO A;  3ERG A;  4MPG A;  1J9B A;  2IFQ A;  5KN2 A;  5ECK B;  2IME A;  3QPM A;  4K8M A;  4ECJ A;  1OE7 A;  1VF1 A;  4IKH A;  5ABR A;  4KDY A;  4ZB9 A;  4KE3 A;  1Z3E A;  20GS A;  5JWO B;  5G1K A;  2HSH A;  1TP9 A;  2V1M A;  4GWR A;  3APO A;  5DJL A;  4POK A;  1QMV A;  3KJY A;  4D73 A;  3VI5 A;  1K3L A;  4HUA A;  2LQQ A;  2V41 A;  3NZN A;  3IE3 A;  1WMJ A;  1PX7 A;  5DAK B;  3FZ9 A;  1R26 A;  1EP8 A;  5F06 A;  3AY8 A;  2OE0 A;  2LUS A;  2H66 A;  1SKW B;  4KH7 A;  1K0A A;  3C71 A;  4V2M A;  5AIX A;  6GSY A;  1HYU A;  1PX6 A;  1PA3 A;  4POL A;  2RII A;  3P90 A;  2B1L A;  5ENU A;  1A2J A;  4O7H A;  3LFL A;  4GSS A;  3TB2 A;  3H1N A;  2HI7 A;  1XIY A;  4I8B A;  3ISO A;  1ZGN A;  3IDV A;  1N2A A;  3MAK A;  3LEF A;  2HSM A;  3QR6 A;  3HZ4 A;  4MH3 A;  2YWI A;  2YP6 A;  4OCE A;  4EF0 A;  3FYG A;  1F6M C;  2K6V A;  3W8J A;  2YZU A;  2H6Y A;  5D9V A;  4O92 A;  2X8C A;  3KIJ A;  2HT9 A;  4OO4 A;  1PRX A;  1SD9 A;  2KOK A;  3TKQ A;  3TJF A;  1GH2 A;  3H79 A;  1GTU A;  3GRX A;  1GNW A;  1GSS A;  4HQZ A;  1PGT A;  5F07 A;  3BCK A;  4GRF A;  5DAK A;  2GST A;  5A4W A;  1G7E A;  5J5N A;  3ERF A;  3KD0 A;  1GRX A;  2OBI A;  2JU5 A;  1SJI A;  1WE0 A;  4DSR A;  3KTB A;  4FQU A;  4RQR A;  3ZIV A;  3TGZ A;  4RI6 A;  1XPV A;  5LCZ A;  1JZD A;  4YAV A;  3KZQ A;  1OKT A;  5CO3 A;  1TK0 B;  4KUN A;  4PUA A;  3GSS A;  4O32 A;  4GLT A;  1BED A;  8GSS A;  5D93 A;  1SK0 A;  3F4R A;  1T7P B;  2H71 A;  3QFA C;  1GLQ A;  1H4O A;  4LL1 B;  5IPH A;  2CV4 A;  4F0B A;  2DLX A;  1M0U A;  1PMT A;  3DYR A;  1JZO A;  4XS6 A;  3HCZ A;  2MBT A;  4G0K A;  3EU4 A;  1GLP A;  4L0U A;  4WET A;  4DSS B;  2V2G A;  5F8B A;  3W6G A;  3I6A A;  4MMM A;  4YQV A;  2DML A;  4MF7 A;  3IAS 2;  4XHM A;  1F37 A;  4OO5 A;  3VWX A;  3Q74 A;  3LWA A;  1YY7 A;  5ECS A;  3L78 A;  1Q98 A;  1X0R A;  2MYG A;  3D4M A;  5LD0 A;  4KDX A;  2Z9S A;  4G19 A;  2GSS A;  3UVT A;  4OFT A;  3ED3 A;  4HI7 A;  4EL1 A;  2CZ3 A;  2HNL A;  4WR5 A;  1X5C A;  3GYK A;  3L0H A;  1TW9 A;  4Q5Q A;  4G9H A;  5HR1 A;  1E2Y A;  1M9A A;  2CAI A;  1RK4 A;  3MDK A;  2XC2 A;  3GIX A;  2V6K A;  4NV5 A;  4YQM A;  4G10 A;  5COH A;  2H75 A;  2HQT A;  2NBS A;  1NW2 A;  2FY6 A;  3MNG A;  4JRR A;  2H1D A;  2M72 A;  3HKR A;  4N0Z A;  3TDG A;  3HVV A;  3A3T A;  2QC7 A;  1XCC A;  4XS4 B;  4EDY A;  5G5F A;  3M3M A;  4AJ8 A;  1ACV A;  1XXU A;  2C0E A;  1IYH A;  5ECO B;  2TIR A;  2MMZ A;  3ZZX A;  4PXO A;  2JAD A;  3GX0 A;  4DSS A;  5AIS A;  2DBC A;  5B6N A;  2RUE A;  1EP7 A;  1PQN A;  2G0F A;  3ZIJ A;  1T4Y A;  5IIZ A;  2B1K A;  4PQH A;  2BJX A;  3UIW A;  1AQV A;  2H8L A;  1CQG A;  4JBB A;  1XWG A;  3M1G A;  1TTZ A;  1ZYQ B;  1WRY A;  4TXV A;  5J3R A;  5IMV A;  3W8S A;  3IBH A;  1DSB A;  4RUV A;  4G0I A;  2HE3 A;  10GS A;  3E3E A;  2M46 A;  3UBL A;  2H73 A;  2GT6 A;  2YJ7 A;  3RAZ A;  4FYU A;  4N0V A;  2KHP A;  17GS A;  2X8H A;  2HYX A;  1ON4 A;  5HR0 A;  1S3D A;  1R5A A;  4OWY A;  6GSW A;  4EKZ A;  4KW6 A;  4LMW A;  4XS4 A;  2H72 A;  5JWQ B;  4USS A;  5J9C A;  4WR4 A;  2GSQ A;  4ZL9 A;  3O76 A;  1VGL A;  2GZY A;  2BTO T;  1RW1 A;  2C0G A;  4K9Z A;  4KF9 A;  4N30 A;  1A2L A;  3UEM A;  3GST A;  2IMI A;  1T8E B;  1TRU A;  1XW9 A;  16GS A;  1TJD A;  3KMO A;  2GT5 A;  2WS2 A;  4K0N A;  4J56 E;  5IMC A;  1ERW A;  3D4T A;  5JCU A;  2GQL A;  2LST A;  3APS A;  3QAW A;  4OFM A;  3UMA A;  2B5Y A;  2XBI A;  2GVP A;  3F6D A;  1WJK A;  1V40 A;  4JE1 A;  1SJ6 A;  3RHB A;  5L71 A;  4Q5F A;  2K8S A;  3TUE A;  2C3N A;  3S9F A;  4X43 A;  4AJ7 A;  3LG6 A;  5DCG A;  5ELA A;  3P2A A;  3GL3 A;  4FO5 A;  3UBK A;  4ML1 A;  5FWG A;  3P7X A;  2RUF A;  4WBR D;  2HSN B;  1K0C A;  5JWR B;  5DBQ A;  4HS1 A;  5IMZ A;  13GS A;  1MD3 A;  3M8N A;  4LMV A;  1OAZ A;  1ILO A;  3U6V A;  2GQK A;  3NOF A;  2VLU A;  2FWH A;  4WKW A;  3D6I A;  1FOV A;  5HFI A;  5A5K A;  5DDL A;  4MF5 A;  4EUY A;  2P5Q A;  5CRG A;  2N5F A;  1M7T A;  3PR8 A;  2M80 A;  2OAD A;  3CTG A;  2L59 A;  1XVQ A;  2H19 A;  2IMD A;  4N11 A;  2H01 A;  1FVJ A;  1QGV A;  4K7N A;  4X1U A;  4CDO A;  2B6M A;  2WRT A;  3F6F A;  3QMX A;  5IMA A;  1AXD A;  2LQO A;  4KND A;  4BA7 A;  5D9T A;  1XWC A;  3FZA A;  3TOU A;  3L9U A;  4V1A g;  4KSO A;  4EO3 A;  1NHY A;  1JFU A;  1ZYE A;  3IK9 A;  3EIN A;  3FY7 A;  4IJ3 A;  2CZ2 A;  1IYI A;  1THO A;  2DJK A;  4IEL A;  1K0D A;  1WOU A;  2JSZ A;  5G31 A;  2FNO A;  1GWC A;  2EIR A;  2B5E A;  3APQ A;  2MMO A;  3DVW A;  2G2Q A;  5BMU A;  1UVZ A;  3F3R A;  4IP6 A;  2H30 A;  4PX1 A;  1SL0 B;  2R2J A;  5J9B A;  1GTB A;  2CA8 A;  1FAA A;  2AYT A;  1XZO A;  4PUF C;  1QUW A;  2XPD A;  3R3E A;  2P5R A;  1HNC A;  2E2M A;  3Q19 A;  5IO2 A;  1VF2 A;  1FO5 A;  4KCE A;  1GNE A;  3GH6 A;  2EC4 A;  1K3Y A;  4K6X A;  2L57 A;  3M9K A;  5ECH B;  4MZB A;  3ZYW A;  3D0Z A;  5FT3 A;  5JCG A;  1TU7 A;  3GTU B;  1B9X C;  3LYK A;  1Y25 A;  3WT2 A;  3D5J A;  3L4N A;  1YKA A;  1DE1 A;  4I6X A;  2IMF A;  3ZMK A;  1V98 A;  2GQM A;  3M9J A;  2JZR A;  1VF4 A;  1O6J A;  3V1W A;  3TOT A;  1A23 A;  2C4J A;  4KCA A;  2ON7 A;  3EE2 A;  5IPG A;  1B4P A;  4JZQ A;  5KN3 A;  2KLX A;  1ZZY A;  2QKE A;  4PUR A;  4JU5 A;  2CVD A;  5LNK e;  19GS A;  1TKD B;  3WT1 A;  3CSI A;  2OE1 A;  2H0I A;  3IA1 A;  2H1G A;  1Z6N A;  4I5Q A;  1EV4 A;  5DJM A;  4F0C A;  4GST A;  2B3S A;  2LTK A;  4PQI A;  3ME8 A;  6GSU A;  3VWV A;  4QQ7 A;  1YZX A;  3R2Q A;  5GZZ B;  3EUR A;  1ZOF A;  5D73 A;  1AIU A;  4EC0 A;  4BPY A;  2PPT A;  3TCO A;  3FR3 A;  2H6Z A;  2GGT A;  3DEX A;  2IPA A;  3ZVJ A;  4MLY A;  1OC9 B;  5EL8 A;  4ECC A;  4TVE A;  2YPM A;  3G7I A;  4TR3 A;  3GTU A;  1XWA A;  3UL3 A;  3IXR A;  1NSW A;  3QDN A;  2YNX A;  3IV4 A;  3QCP A;  2FHE A;  3KMN A;  4AF2 A;  2VM2 A;  2EIQ A;  1GSQ A;  1G0T A;  1NHO A;  3FW2 A;  5AGY A;  2VL9 A;  1R7H A;  3G7Y A;  4NXI A;  4ZL7 A;  5CP1 A;  1UA5 A;  4FYB A;  2C3T A;  2J23 A;  4L8E A;  3SWL A;  4HU9 A;  4EE0 A;  2A2S A;  2X99 A;  4EDZ A;  11GS A;  1WIK A;  2WZ9 A;  4I97 A;  3CYN A;  4TN8 A;  1XFL A;  2WGR A;  2IWT A;  1GSU A;  2VUP A;  2X64 A;  2JZT A;  2YWN A;  4PGT A;  4F2I A;  5ECR B;  3GFK A;  1ML6 A;  3HJP A;  1M9B A;  1GSF A;  3KP8 A;  1X9M B;  1GP1 A;  5ECI B;  4NMU A;  1DE2 A;  1TK5 B;  3GHA A;  2GTU A;  5CRW A;  4GXZ A;  4XRD A;  2LKU A;  4K0G A;  5AN1 A;  5ECL B;  3GA4 A;  4K1F A;  4OD7 A;  4ZXG A;  4MA9 A;  5KN0 A;  5B7C A;  2E7P A;  2PVO C;  3UVH A;  4GCI A;  1EOH A;  4KAE A;  3GUR A;  3Q6O A;  3FR9 A;  3PPU A;  2AB6 A;  1C72 A;  1DBY A;  1ZMA A;  3VWU A;  1SK1 A;  3LXZ A;  1WPI A;  3WGX A;  2YAN A;  1PL1 A;  1MDK A;  4I2U A;  5B6M A;  3KH9 A;  2CQ9 A;  1YEP A;  3EC3 A;  2D2Z A;  1O7U A;  1BYE A;  7GSS A;  3LYP A;  1X5E A;  3N5O A;  5H5R A;  2R6K A;  1LU4 A;  2HFD A;  2VCV A;  3H4K A;  4NHZ A;  2PWJ A;  2V32 A;  3A5W A;  3KH7 A;  4P3Y B;  2FD3 A;  1AUC A;  4GQF A;  1O8W A;  2KP2 A;  4WEY A;  3ZVJ D;  1T1V A;  1PN9 A;  4PTS A;  2DJ0 A;  3HVX A;  9GSS A;  2REM A;  3UAP A;  2VCW A;  2PU9 C;  5G5E A;  3TKS A;  1FW1 A;  2C80 A;  4RI7 A;  4XCS A;  4KSM A;  1OC3 A;  2YOI A;  4HZ4 A;  3IHQ A;  2H74 A;  3CXG A;  4J2F A;  3C7M A;  2OE3 A;  4MJB A;  2JZS A;  1MDI A;  3G9B A;  3EYT A;  3KTL A;  1X9S B;  3C73 A;  1X9W B;  1SYX A;  3H8Q A;  3CTF A;  2C0F A;  3C8E A;  4QL9 A;  1ZL9 A;  2MMN A;  3A2X A;  4TW5 A;  1EOG A;  1XWB A;  5A4V A;  2YWO A;  2GS3 A;  3IC4 A;  1QFN A;  1OVN A;  2LS5 A;  3O6T A;  3MWH A;  1GUM A;  1SYR A;  2LJA A;  3QD9 A;  4EXJ A;  2FCH A;  3VUR A;  4XIH A;  2IL3 A;  1Z6M A;  1GUL A;  1EEJ A;  4POB A;  2R4V A;  3PIN A;  1JLV A;  2ES7 A;  5ECM B;  3HZ8 A;  2P31 A;  3MSZ A;  1NM3 A;  2RM5 A;  1EZK A;  2XHF A;  1YDK A;  3VK9 A;  2WFC A;  5E59 A;  2H1B A;  2L4Q A;  5H5Q A;  2PVQ A;  1PL2 A;  1AAZ A;  1Z5Y E;  1YKC A;  1QXH A;  1BX9 A;  1EEM A;  2F8A A;  4KX4 A;  3F63 A;  2O89 A;  4IBP A;  2NVL A;  2YV9 A;  3I9V 2;  2CVK A;  5FHI A;  3E9J B;  4YQU A;  1E6B A;  4EVM A;  1U87 A;  1JZR A;  2CX3 A;  4BL7 B;  2I1U A;  1TI1 A;  5ID2 B;  2AAW A;  2I4A A;  2GZP A;  1Q4J A;  1UN2 A;  4MJC A;  1BG5 A;  1YEX A;  1U3A A;  1JZW A;  2EIO A;  2GZZ A;  3EWL A;  3K8N A;  2CAQ A;  4MP4 A;  5J41 A;  4RQX A;  3TKS C;  3EMX A;  1KTE A;  4NAX A;  2AHE A;  2H6X A;  4NV2 A;  3HYP A;  4ID0 A;  12GS A;  2LRC A;  3LSZ A;  4LA1 A;  2DJJ A;  1GTA A;  1B9Y C;  2F51 A;  6GSS A;  5EY6 A;  1OKD A;  2PUK C;  1YJ6 A;  1I5G A;  4GSN A;  1OE8 A;  1W4V A;  2VL3 A;  2WCI A;  4IQ1 A;  2JSY A;  3F4T A;  2FGX A;  1SEN A;  3KCM A;  1RQM A;  3C1R A;  2LJR A;  2L5O A;  4YH2 A;  1N8J A;  2AV4 A;  3FKF A;  3ZFB A;  4BL7 A;  1THX A;  4TKY A;  5ID2 A;  1S3C A;  4DVC A;  2KP1 A;  1A2M A;  3VPT A;  2K18 A;  5GST A;  4ZBD A;  1ERT A;  5DAL B;  2FA4 A;  5J4U A;  1T00 A;  3VWW A;  3ZL5 A;  2PBJ A;  4BVY B;  1B8X A;  4ZIJ A;  1UC7 A;  1KBN A;  4JR4 A;  3ZLP A;  3BCI A;  3IRA A;  3GX8 A;  1QQ2 A;  2DJ3 A;  3FR6 A;  4AGS A;  1CQH A;  1LJR A;  2OBK A;  1FHE A;  3CRT A;  1BAY A;  2HRA A;  5CYY A;  3D21 A;  2PN8 A;  4GF0 A;  3RPP A;  3QFB C;  4NHW A;  2FUG 2;  1XOA A;  1F9M A;  3I69 A;  1JLW A;  2MBS A;  3DD3 A;  3RDW A;  5EPF A;  1AC1 A;  3CMI A;  2RLI A;  1ABA A;  1K0O A;  1O81 A;  1TRW A;  1FVK A;  3LOR A;  1U6T A;  3U5R E;  4JR6 A;  2B7J A;  2OAC A;  1R4W A;  2IJY A;  4Q5R A;  4MZC A;  2IFQ B;  1MD4 A;  4OCF A;  1EV9 A;  3A2V A;  5A4U A;  4F9Z A;  1JHB A;  3G7J A;  1F2E A;  2N5A A;  1PSQ A;  4MCU A;  1Z7R A;  1SD8 A;  4PNF A;  4MZW A;  1XW5 A;  3CSH A;  4F03 A;  2UZ8 A;  2BMX A;  3GMF A;  5F05 A;  5G30 A;  1HNB A;  2TRX A;  2MZC A;  3HJM A;  3TJJ A;  3EVI A;  3GL5 A;  1PKZ A;  2A4V A;  1AW9 A;  3J7Y b;  2NTO A;  4LLR A;  1TDI A;  1U88 A;  4HEA 2;  4BWQ A;  1FG4 A;  4O5R A;  3RHC A;  5IOW A;  5GAN D;  2WDU A;  2XBQ A;  1V58 A;  2FLS A;  2TRC P;  2IIY A;  4FYC A;  3PGT A;  1I9D A;  1XVW A;  2B7K A;  1J08 A;  3L9V A;  1G7O A;  3LGC A;  3KGK A;  4CW9 A;  2JL4 A;  2O7K A;  1DUG A;  1TRS A;  1OC8 A;  2K8V A;  1O8X A;  3DRN A;  4HOJ A;  2VLV A;  4G0L A;  6GST A;  5EVO A;  2HRK B;  4WF4 A;  3N9J A;  4MAB A;  4TR1 B;  2V6O A;  2HSM B;  5G2Z A;  4ILF A;  3FZ5 A;  1OYJ A;  4L5L A;  3DKS A;  2VCZ A;  3DXB A;  2XPE A;  3QAV A;  1M2D A;  5IMF A;  4XS1 A;  2A2R A;  4L5O A;  2HLS A;  1K0M A;  3CRU A;  2VLT A;  6GSX A;  4N10 A;  2FWE A;  3ZFL A;  3LQ7 A;  2N5B A;  5D9X A;  5CRE A;  4GQC A;  5D9W A;  3I43 A;  4K7O A;  3ME7 A;  5C00 A;  3UOM A;  3TJK A;  3TRP A;  5ECN B;  4OFN A;  4ZIL A;  1V57 A;  2OKA A;  1A0R P;  1GSD A;  1H75 A;  2YN1 A;  2I81 A;  2I9H A;  1SJZ A;  2L6C A;  1Z7P A;  3FK8 A;  3VI7 A;  1PD2 1;  1T4Z A;  1U3I A;  2OA7 A;  2PMT A;  3WYW A; 
#chains in the Genus database with same CATH topology
 3FRC A;  2C0D A;  1GSY A;  5GAP D;  4ACS A;  2AJQ B;  2HRK A;  2MMA A;  1AQW A;  5HFG A;  4MK3 A;  4TR1 A;  1TOF A;  2QSI A;  2R3X A;  3US3 A;  3MIX A;  3QOU A;  2CT6 A;  3DIE A;  3VLN A;  4K7I A;  5AIV A;  4Q5N A;  2A2P A;  4MNN A;  5CAX A;  4DSQ A;  2P0G A;  5CNW A;  1FB6 A;  2VCQ A;  3BBY A;  5C04 A;  1OC9 A;  4IVF A;  2FWF A;  4IGJ A;  3IAM 2;  2FWG A;  1S3A A;  4MJE A;  2E2G A;  2C8U A;  4YKG A;  1SL1 B;  3ERW A;  1GL8 A;  2K9F A;  3GKX A;  3TKP A;  4JED A;  2DSA A;  2O85 A;  5KEJ A;  2LNT A;  4LL4 B;  3A2W A;  3HVS A;  3SBC A;  5HFK A;  4HJ2 A;  4I2T A;  1G6W A;  1M99 A;  3EMP A;  3HA9 A;  2H0H A;  4MF6 A;  2ZNM A;  2DJ1 A;  4MH2 A;  2WB9 A;  3F8U A;  3LJR A;  5DQY A;  3VPQ A;  4A5P A;  3BD2 A;  2PGT A;  2R5G A;  1KNG A;  2CX4 A;  5B8A A;  2O3E A;  4ECB A;  3GV1 A;  4XRA A;  2JAC A;  4GDF A;  3CSJ A;  5B8B A;  4IW9 A;  5BRT A;  3BJ5 A;  3HXS A;  4ULX A;  4IJI A;  4QMK A;  2R37 A;  1Z9H A;  5D8I A;  3HMJ G;  1YF1 A;  3ZIT A;  3JCM L;  4K5R A;  4TOP A;  2C3Q A;  5ELG A;  3CBU A;  3BOA A;  4CHS A;  2GSR A;  4DEJ A;  5DQS A;  5GSS A;  4F82 A;  4G2E A;  3P8W A;  3TJB A;  4NPB A;  2LRT A;  3IK7 A;  5DVB A;  4AJ6 A;  3TJG A;  2YCD A;  3F0I A;  4G01 A;  3UAR A;  2R0C A;  2WUL A;  2OJL A;  4AKH A;  2YZH A;  1TRV A;  4TR0 A;  3LW9 A;  2IN3 A;  5CRH A;  4POM A;  2DIY A;  2HRN A;  2I3Y A;  3ZML A;  1AQX A;  1W89 A;  3GKN A;  4V2N A;  1URM A;  4MPF A;  5JCW A;  1EGR A;  4OMV A;  2QGV A;  4TXO B;  1YF0 A;  1KEB A;  2EFC A;  1V2A A;  2LNS A;  4IP1 A;  1F3A A;  3WGD A;  2L4C A;  5HQP A;  18GS A;  1V9W A;  1SK2 A;  4V2L A;  2IMK A;  2VIM A;  4IN0 A;  4HU7 A;  3WGE A;  1ZCP A;  4KA0 A;  5IMD A;  4GTU A;  1Y6E A;  3GH9 A;  4YAP A;  1X5D A;  5IOX A;  4IQA A;  2H0G A;  3DVX A;  4ZB8 A;  3C1S A;  1TI3 A;  4V1A p;  1XWK A;  2YJH A;  3H93 A;  3ZRD A;  1N25 A;  1SVO A;  2GDR A;  2O8V B;  4L0W A;  1M2A A;  5CRD A;  1SKS B;  3VFI A;  14GS A;  5A5H B;  5F0G A;  2B5X A;  3E0U A;  4AKG A;  2HRF A;  3WD6 A;  4ECI A;  3J7Y k;  1A8Y A;  3RPN A;  4TR4 A;  1A24 A;  4NWY A;  1K3O A;  4YKF A;  5DCH A;  4HDE A;  4HQS A;  1WP0 A;  1FB0 A;  3HHV A;  2VL2 A;  4ISD A;  3F9U A;  4WF5 A;  3RBT A;  1TU8 A;  2L5L A;  3HDC A;  4H86 A;  2VCX A;  4ZBB A;  1MDJ A;  3F4S A;  2HZF A;  3EPT A;  4TXO A;  3D22 A;  1GUH A;  1SL2 B;  6GSV A;  4BVX B;  2ON5 A;  2C1Y A;  2LRN A;  1QK8 A;  1BJX A;  3NIV A;  4FXY P;  3PH9 A;  2DJ2 A;  2HZE B;  3DGQ A;  2X8G A;  4E8E A;  3HY2 A;  2VD1 A;  3KP9 A;  5E4W A;  3KM6 A;  5INY A;  1XBS A;  4MDC A;  1TXX A;  1BQ7 A;  4FIW A;  22GS A;  2E0Q A;  3DML A;  1M2B A;  2PER A;  5A5H A;  2WW1 A;  2VO4 A;  5H5S A;  1MTC A;  2WJU A;  3DWV A;  2AUV A;  1TK8 B;  2LJK A;  2LEG A;  4X0X A;  1T3B A;  5IQY A;  2DIZ A;  1O73 A;  2KUC A;  2YWM A;  1XOB A;  5D96 A;  1SKR B;  4BWS A;  2J9H A;  1R5P A;  2DMM A;  4O5U A;  5G1L A;  1F3B A;  1A0F A;  4FH8 A;  2LV3 A;  3HD5 A;  1A8L A;  1HD2 A;  5KN1 A;  2O87 A;  4J57 E;  5BMU B;  1G6Y A;  2H1A A;  2F9S A;  3TRQ A;  3QAG A;  3IPZ A;  4XTS A;  2CVB A;  3FEU A;  5IM9 A;  3FZ4 A;  4KGI A;  4BVX A;  4KDU A;  2RM6 A;  4IHU A;  4E8H A;  2HZE A;  5HR3 A;  1XW6 A;  5IO0 A;  3GKM A;  4K5S A;  4ZBA A;  1EWX A;  3LXT A;  3TU3 B;  2VD0 A;  3FHK A;  2L6D A;  2NDO A;  2H70 A;  4TRX A;  1ST9 A;  4WXT A;  1GSE A;  1VF3 A;  4IS0 A;  1HNA A;  1GUK A;  5HR2 A;  2ZUP A;  2YV7 A;  5DAL A;  2H76 A;  3M0F A;  3OR5 A;  2VL2 C;  3GKK A;  1VRS D;  1M3J A;  1GTI A;  1MEK A;  4BVY A;  3F3Q A;  2VAF A;  3IOS A;  1ERU A;  3TRX A;  1LBK A;  3UJ1 A;  1J0F A;  3L9S A;  1PKW A;  2ZCT A;  4PQ1 A;  1YQ1 A;  2VM1 A;  3Q18 A;  3KEB A;  4ML6 A;  4ZB6 A;  4MJA A;  1ERV A;  3IR4 A;  3GNJ A;  4KB3 A;  1O85 A;  1K0N A;  4Z7X A;  1USB A;  4D73 B;  3EU3 A;  4HJM A;  2ALB A;  2NPB A;  2VCT A;  3TKS E;  3GN3 A;  4PNG A;  2GLR A;  1EGO A;  3TKR A;  4WBJ A;  1B48 A;  4HZ2 A;  3O3T A;  2DC5 A;  3IC8 A;  2F3M A;  2FA8 A;  1B4Q A;  1I1I P;  4K2D A;  5ECQ B;  1WWJ A;  1PFO A;  3ZRE A;  2HXK A;  1K0B A;  1HQO A;  5ECP B;  2VOC A;  4AKX B;  3ZTL A;  3GUS A;  3HJO A;  2F8F A;  4ZL8 A;  2HSY A;  4QL7 A;  1SU9 A;  3KXO A;  3ERG A;  4MPG A;  1J9B A;  2IFQ A;  5KN2 A;  5ECK B;  2IME A;  4AKI A;  3QPM A;  4K8M A;  2EFD A;  4ECJ A;  1OE7 A;  1VF1 A;  4IKH A;  5ABR A;  4KDY A;  4ZB9 A;  4KE3 A;  1Z3E A;  20GS A;  5JWO B;  5G1K A;  2HSH A;  1TP9 A;  2V1M A;  4GWR A;  3APO A;  5DJL A;  4POK A;  1QMV A;  3KJY A;  4D73 A;  3VI5 A;  1K3L A;  4HUA A;  2LQQ A;  1YVL A;  2DKI A;  2V41 A;  3NZN A;  3IE3 A;  1WMJ A;  1PX7 A;  1PN0 A;  5DAK B;  3FZ9 A;  1R26 A;  1EP8 A;  5F06 A;  2X4A A;  3AY8 A;  2OE0 A;  2LUS A;  2H66 A;  1SKW B;  4KH7 A;  1K0A A;  3C71 A;  4V2M A;  2WVX A;  5AIX A;  6GSY A;  1HYU A;  1PX6 A;  1PA3 A;  4POL A;  2RII A;  3P90 A;  2B1L A;  5ENU A;  1A2J A;  4O7H A;  3LFL A;  4GSS A;  3TB2 A;  5KOW A;  3H1N A;  2HI7 A;  1XIY A;  4I8B A;  3ISO A;  1ZGN A;  3IDV A;  1N2A A;  3MAK A;  3LEF A;  2HSM A;  3QR6 A;  3HZ4 A;  4MH3 A;  2YWI A;  2YP6 A;  4OCE A;  4EF0 A;  3FYG A;  1F6M C;  2K6V A;  3W8J A;  2YZU A;  2H6Y A;  5D9V A;  4O92 A;  2X8C A;  3KIJ A;  2HT9 A;  4OO4 A;  4ICY A;  1PRX A;  1SD9 A;  2KOK A;  3TKQ A;  2OT3 A;  3TJF A;  1GH2 A;  3H79 A;  1GTU A;  3GRX A;  1GNW A;  1GSS A;  4HQZ A;  1PGT A;  5F07 A;  3BCK A;  4GRF A;  5DAK A;  2GST A;  5A4W A;  3A5I A;  1G7E A;  5J5N A;  3ERF A;  3KD0 A;  1GRX A;  2OBI A;  2JU5 A;  1SJI A;  1WE0 A;  4DSR A;  4BIK A;  3KTB A;  4FQU A;  4RQR A;  3ZIV A;  4AI6 A;  3TGZ A;  4RI6 A;  1XPV A;  5LCZ A;  1JZD A;  4YAV A;  3KZQ A;  1OKT A;  5CO3 A;  1TK0 B;  4KUN A;  4PUA A;  3GSS A;  4O32 A;  4GLT A;  1BED A;  8GSS A;  5D93 A;  4X4J A;  1BG1 A;  1SK0 A;  3F4R A;  1T7P B;  2H71 A;  3QFA C;  1GLQ A;  1H4O A;  4LL1 B;  5IPH A;  2CV4 A;  4F0B A;  2DLX A;  1M0U A;  1PMT A;  3DYR A;  1JZO A;  4XS6 A;  1S3R A;  3HCZ A;  2MBT A;  4G0K A;  5J47 A;  3EU4 A;  1GLP A;  4L0U A;  4WET A;  4DSS B;  2V2G A;  5F8B A;  3W6G A;  3CHX C;  3I6A A;  4MMM A;  4YQV A;  2DML A;  4MF7 A;  3IAS 2;  4XHM A;  1F37 A;  4OO5 A;  3VWX A;  3Q74 A;  1XG8 A;  3LWA A;  1YY7 A;  5ECS A;  3L78 A;  1Q98 A;  2WVZ A;  1X0R A;  2MYG A;  3D4M A;  5LD0 A;  4KDX A;  2Z9S A;  4G19 A;  2GSS A;  3CQF A;  3UVT A;  1SVM A;  4OFT A;  3ED3 A;  4HI7 A;  4EL1 A;  2CZ3 A;  2HNL A;  4WR5 A;  1X5C A;  3GYK A;  3L0H A;  1TW9 A;  4Q5Q A;  4G9H A;  5HR1 A;  1E2Y A;  1M9A A;  2CAI A;  1RK4 A;  3MDK A;  2XC2 A;  3GIX A;  2V6K A;  4NV5 A;  4YQM A;  4G10 A;  2QA1 A;  5COH A;  2H75 A;  2HQT A;  2NBS A;  1NW2 A;  2FY6 A;  3MNG A;  4JRR A;  2H1D A;  2M72 A;  3HKR A;  4N0Z A;  3TDG A;  3HVV A;  3A3T A;  2QC7 A;  1XCC A;  4XS4 B;  4EDY A;  5G5F A;  3M3M A;  4AJ8 A;  1ACV A;  1XXU A;  2C0E A;  1IYH A;  5ECO B;  2TIR A;  2MMZ A;  3ZZX A;  4N3Z A;  4PXO A;  2JAD A;  3GX0 A;  4DSS A;  5AIS A;  2DBC A;  5B6N A;  2RUE A;  1EP7 A;  1PQN A;  2G0F A;  3ZIJ A;  1T4Y A;  5IIZ A;  2B1K A;  4PQH A;  2BJX A;  3UIW A;  1AQV A;  2H8L A;  1CQG A;  4JBB A;  1XWG A;  3M1G A;  1TTZ A;  1ZYQ B;  1WRY A;  4TXV A;  5J3R A;  5IMV A;  3W8S A;  3IBH A;  1DSB A;  4RUV A;  2WW2 A;  4G0I A;  2HE3 A;  10GS A;  3E3E A;  2M46 A;  3UBL A;  2H73 A;  2GT6 A;  2YJ7 A;  3RAZ A;  4FYU A;  4N0V A;  2KHP A;  17GS A;  2X8H A;  2HYX A;  1ON4 A;  5HR0 A;  2O5V A;  1S3D A;  1R5A A;  4OWY A;  4K2X A;  6GSW A;  4EKZ A;  4KW6 A;  4LMW A;  4XS4 A;  2H72 A;  5JWQ B;  4USS A;  5J9C A;  4WR4 A;  5A1N B;  2GSQ A;  4ZL9 A;  3O76 A;  1VGL A;  2GZY A;  2BTO T;  1RW1 A;  2C0G A;  1M3I A;  4K9Z A;  4KF9 A;  3MYD A;  4N30 A;  1A2L A;  3UEM A;  3GST A;  2IMI A;  1T8E B;  1TRU A;  1XW9 A;  16GS A;  1TJD A;  3KMO A;  2GT5 A;  2WS2 A;  4K0N A;  4J56 E;  5IMC A;  4CY6 A;  1ERW A;  3D4T A;  4EIP A;  5JCU A;  2GQL A;  2LST A;  3APS A;  3QAW A;  4OFM A;  3UMA A;  2B5Y A;  2XBI A;  2GVP A;  3F6D A;  1WJK A;  1V40 A;  4JE1 A;  1SJ6 A;  3RHB A;  5L71 A;  4Q5F A;  2K8S A;  1FOH A;  3TUE A;  2C3N A;  3S9F A;  4X43 A;  4AJ7 A;  3LG6 A;  5DCG A;  5ELA A;  3P2A A;  3GL3 A;  4FO5 A;  3UBK A;  4ML1 A;  5FWG A;  3P7X A;  2RUF A;  4WBR D;  2HSN B;  2WW0 A;  1K0C A;  5JWR B;  5DBQ A;  4HS1 A;  5IMZ A;  13GS A;  1MD3 A;  3M8N A;  4LMV A;  1OAZ A;  1ILO A;  3U6V A;  2GQK A;  3NOF A;  2VLU A;  2FWH A;  4WKW A;  5A1N A;  3D6I A;  1FOV A;  5HFI A;  5A5K A;  5DDL A;  4MF5 A;  4EUY A;  2P5Q A;  2EFH A;  5CRG A;  2N5F A;  4PI0 C;  1M7T A;  3PR8 A;  2M80 A;  2OAD A;  3CTG A;  2O36 A;  2L59 A;  1XVQ A;  2H19 A;  2IMD A;  4N11 A;  2H01 A;  1FVJ A;  1QGV A;  4K7N A;  4X1U A;  4CDO A;  4Z2R A;  2B6M A;  2WRT A;  3F6F A;  3QMX A;  5IMA A;  1AXD A;  2LQO A;  4KND A;  4BA7 A;  5D9T A;  1XWC A;  3FZA A;  1BF5 A;  3TOU A;  3L9U A;  4V1A g;  4KSO A;  4EO3 A;  1NHY A;  1JFU A;  1ZYE A;  3IK9 A;  3EIN A;  3FY7 A;  4IJ3 A;  2CZ2 A;  1IYI A;  5A34 B;  1THO A;  2DJK A;  4IEL A;  1K0D A;  1WOU A;  2JSZ A;  5G31 A;  2FNO A;  1GWC A;  2EIR A;  2B5E A;  3APQ A;  2MMO A;  3DVW A;  2G2Q A;  5BMU A;  1UVZ A;  3F3R A;  4IP6 A;  2H30 A;  4PX1 A;  1SL0 B;  2R2J A;  5J9B A;  1ZYN A;  1GTB A;  2CA8 A;  1FAA A;  2AYT A;  1XZO A;  4PUF C;  1QUW A;  2XPD A;  3R3E A;  2P5R A;  1HNC A;  2E2M A;  3Q19 A;  5IO2 A;  1VF2 A;  2QA2 A;  1FO5 A;  4KCE A;  1GNE A;  3GH6 A;  2EC4 A;  1K3Y A;  4K6X A;  2L57 A;  3M9K A;  5ECH B;  4MZB A;  3ZYW A;  3D0Z A;  5FT3 A;  5JCG A;  1TU7 A;  3GTU B;  1B9X C;  3LYK A;  1Y25 A;  3WT2 A;  3D5J A;  3L4N A;  1YKA A;  1DE1 A;  4I6X A;  2IMF A;  3ZMK A;  1V98 A;  2GQM A;  3M9J A;  2JZR A;  1VF4 A;  1O6J A;  3V1W A;  3TOT A;  1A23 A;  2C4J A;  4KCA A;  2ON7 A;  3EE2 A;  5IPG A;  1B4P A;  4JZQ A;  5KN3 A;  2KLX A;  1ZZY A;  2QKE A;  4PUR A;  4JU5 A;  2CVD A;  5LNK e;  19GS A;  1TKD B;  3WT1 A;  3CSI A;  2OE1 A;  2H0I A;  3IA1 A;  2H1G A;  1Z6N A;  4I5Q A;  1EV4 A;  5DJM A;  4F0C A;  4GST A;  2B3S A;  2LTK A;  4PQI A;  3ME8 A;  2X49 A;  6GSU A;  3VWV A;  4QQ7 A;  1YZX A;  3R2Q A;  5GZZ B;  3EUR A;  1ZOF A;  5D73 A;  1AIU A;  4EC0 A;  4BPY A;  2PPT A;  3TCO A;  3CWG A;  3FR3 A;  2H6Z A;  2GGT A;  3RGB C;  3DEX A;  2IPA A;  3ZVJ A;  4MLY A;  1OC9 B;  5EL8 A;  4ECC A;  4Z2T A;  4TVE A;  2YPM A;  2H1L A;  3G7I A;  4TR3 A;  3GTU A;  1XWA A;  3UL3 A;  3IXR A;  1NSW A;  3QDN A;  2YNX A;  3IV4 A;  3QCP A;  2FHE A;  3KMN A;  4AF2 A;  2VM2 A;  2EIQ A;  1GSQ A;  1G0T A;  1NHO A;  3FW2 A;  5AGY A;  2VL9 A;  1R7H A;  3G7Y A;  4NXI A;  4ZL7 A;  5CP1 A;  1UA5 A;  4FYB A;  2UV8 G;  2C3T A;  4PHZ C;  2J23 A;  4L8E A;  3SWL A;  4HU9 A;  4O5Q A;  4EE0 A;  2A2S A;  2X99 A;  4EDZ A;  11GS A;  1ZYP A;  1WIK A;  4Z2U A;  2WZ9 A;  2R0P A;  4I97 A;  3CYN A;  4TN8 A;  1XFL A;  2WGR A;  2IWT A;  1GSU A;  2VUP A;  2X64 A;  2JZT A;  2YWN A;  4PGT A;  4F2I A;  5ECR B;  3GFK A;  1ML6 A;  3HJP A;  1M9B A;  1GSF A;  3KP8 A;  1X9M B;  1GP1 A;  5ECI B;  4NMU A;  1DE2 A;  1TK5 B;  3GHA A;  2GTU A;  5CRW A;  4GXZ A;  4XRD A;  2LKU A;  4K0G A;  5AN1 A;  5ECL B;  3GA4 A;  4K1F A;  4OD7 A;  4ZXG A;  4MA9 A;  5KN0 A;  5B7C A;  2E7P A;  2PVO C;  3UVH A;  4GCI A;  1EOH A;  4KAE A;  3GUR A;  3Q6O A;  3FR9 A;  1SVL A;  3PPU A;  2AB6 A;  1C72 A;  1DBY A;  1ZMA A;  3VWU A;  1SK1 A;  3LXZ A;  1WPI A;  3WGX A;  2YAN A;  1Y1U A;  1PL1 A;  1MDK A;  4I2U A;  5B6M A;  3KH9 A;  1YEW C;  2CQ9 A;  1YEP A;  3EC3 A;  2D2Z A;  1O7U A;  1BYE A;  7GSS A;  3LYP A;  1X5E A;  3N5O A;  5H5R A;  2R6K A;  1LU4 A;  2HFD A;  2VCV A;  3H4K A;  4NHZ A;  2PWJ A;  2V32 A;  3A5W A;  3KH7 A;  4P3Y B;  2FD3 A;  1AUC A;  4GQF A;  1O8W A;  2KP2 A;  4WEY A;  3ZVJ D;  1T1V A;  1PN9 A;  4PTS A;  2DJ0 A;  3HVX A;  9GSS A;  2REM A;  3UAP A;  2VCW A;  2PU9 C;  5G5E A;  3TKS A;  1FW1 A;  2C80 A;  4RI7 A;  4XCS A;  4KSM A;  1OC3 A;  2YOI A;  4HZ4 A;  3IHQ A;  2H74 A;  3HVN A;  3CXG A;  4J2F A;  3C7M A;  2OE3 A;  4MJB A;  2DKH A;  2JZS A;  1MDI A;  2R0G A;  3G9B A;  3EYT A;  3KTL A;  1X9S B;  3C73 A;  1X9W B;  1SYX A;  3H8Q A;  3CTF A;  2C0F A;  3C8E A;  4QL9 A;  2VKZ G;  1ZL9 A;  2MMN A;  3A2X A;  4TW5 A;  1EOG A;  1XWB A;  5A4V A;  2YWO A;  2GS3 A;  3IC4 A;  1QFN A;  1OVN A;  2LS5 A;  3O6T A;  3MWH A;  1GUM A;  1SYR A;  2LJA A;  3QD9 A;  4EXJ A;  2FCH A;  3VUR A;  2WW3 A;  4XIH A;  2IL3 A;  1Z6M A;  1GUL A;  1EEJ A;  4POB A;  2R4V A;  3PIN A;  1JLV A;  2ES7 A;  5ECM B;  3HZ8 A;  2P31 A;  3MSZ A;  1NM3 A;  2RM5 A;  1EZK A;  2XHF A;  1YDK A;  3VK9 A;  2WFC A;  5E59 A;  2H1B A;  2L4Q A;  5H5Q A;  2PVQ A;  4HSC X;  1PL2 A;  1AAZ A;  1Z5Y E;  1YKC A;  1QXH A;  1BX9 A;  1EEM A;  2F8A A;  4KX4 A;  3F63 A;  2O89 A;  4IBP A;  2NVL A;  2YV9 A;  3I9V 2;  2CVK A;  5FHI A;  3E9J B;  4YQU A;  1E6B A;  4EVM A;  1U87 A;  1JZR A;  2CX3 A;  4BL7 B;  2I1U A;  1TI1 A;  5ID2 B;  2AAW A;  2I4A A;  2GZP A;  1Q4J A;  1UN2 A;  4MJC A;  1BG5 A;  1YEX A;  3IHG A;  1U3A A;  1JZW A;  2EIO A;  2GZZ A;  3EWL A;  3K8N A;  2CAQ A;  2EFE A;  4MP4 A;  5J41 A;  4RQX A;  3TKS C;  3EMX A;  1KTE A;  4NAX A;  2AHE A;  2H6X A;  4NV2 A;  3HYP A;  4ID0 A;  12GS A;  2LRC A;  3LSZ A;  4LA1 A;  2DJJ A;  1GTA A;  1B9Y C;  2F51 A;  6GSS A;  5EY6 A;  1OKD A;  2PUK C;  1YJ6 A;  2A4H A;  1I5G A;  4GSN A;  5J4Y A;  1OE8 A;  1W4V A;  2VL3 A;  5J40 A;  2WCI A;  4IQ1 A;  2JSY A;  3F4T A;  2FGX A;  1SEN A;  3KCM A;  1RQM A;  3C1R A;  2LJR A;  2L5O A;  4YH2 A;  1N8J A;  2AV4 A;  3FKF A;  3ZFB A;  4BL7 A;  1THX A;  4TKY A;  5ID2 A;  1S3C A;  4DVC A;  2KP1 A;  1A2M A;  2WVY A;  3VPT A;  2K18 A;  5GST A;  4ZBD A;  1ERT A;  5DAL B;  2FA4 A;  4EIQ A;  5J4U A;  1T00 A;  3VWW A;  3ZL5 A;  2PBJ A;  4BVY B;  1B8X A;  4ZIJ A;  1UC7 A;  1KBN A;  4JR4 A;  3ZLP A;  3BCI A;  1S4B P;  3IRA A;  3GX8 A;  1QQ2 A;  2DJ3 A;  3FR6 A;  4AGS A;  1CQH A;  1LJR A;  2OBK A;  1FHE A;  3CRT A;  1BAY A;  2HRA A;  5CYY A;  3D21 A;  2PN8 A;  4GF0 A;  4PI2 C;  3RPP A;  3QFB C;  4NHW A;  2FUG 2;  1XOA A;  1F9M A;  3I69 A;  1JLW A;  2MBS A;  3DD3 A;  3RDW A;  5EPF A;  3FMW A;  1AC1 A;  3CMI A;  2RLI A;  1ABA A;  1K0O A;  1O81 A;  1TRW A;  1FVK A;  2HSN A;  3LOR A;  1U6T A;  3U5R E;  4JR6 A;  2B7J A;  2OAC A;  1R4W A;  2IJY A;  3RFR C;  4Q5R A;  4MZC A;  2IFQ B;  1MD4 A;  4OCF A;  1EV9 A;  3A2V A;  5A4U A;  4F9Z A;  1JHB A;  3G7J A;  1F2E A;  2N5A A;  1PSQ A;  4MCU A;  1Z7R A;  1SD8 A;  4PNF A;  4MZW A;  1XW5 A;  3CSH A;  4F03 A;  2UZ8 A;  2BMX A;  3GMF A;  5F05 A;  5G30 A;  1HNB A;  2TRX A;  2MZC A;  3HJM A;  3TJJ A;  4CY8 A;  3EVI A;  3GL5 A;  1PKZ A;  2A4V A;  1AW9 A;  3J7Y b;  2NTO A;  4LLR A;  1TDI A;  1U88 A;  4HEA 2;  4BWQ A;  1FG4 A;  4O5R A;  3RHC A;  5IOW A;  5GAN D;  2WDU A;  2WZS A;  2XBQ A;  1V58 A;  2FLS A;  2TRC P;  2IIY A;  4FYC A;  3PGT A;  1I9D A;  1XVW A;  2B7K A;  2WVX B;  1J08 A;  3L9V A;  1G7O A;  3LGC A;  3KGK A;  4CW9 A;  2JL4 A;  2O7K A;  1DUG A;  1TRS A;  1OC8 A;  2K8V A;  1O8X A;  3DRN A;  4HOJ A;  2VLV A;  5A34 A;  1TXU A;  4G0L A;  6GST A;  5EVO A;  2HRK B;  4WF4 A;  4E68 A;  3N9J A;  4MAB A;  4TR1 B;  5KOX A;  2V6O A;  2HSM B;  5G2Z A;  4ILF A;  3FZ5 A;  1OYJ A;  4L5L A;  3DKS A;  2VCZ A;  3DXB A;  2XPE A;  3QAV A;  1M2D A;  5IMF A;  4XS1 A;  2A2R A;  2HLS A;  4L5O A;  1K0M A;  3CRU A;  2VLT A;  6GSX A;  4N10 A;  2FWE A;  3ZFL A;  3LQ7 A;  2N5B A;  5D9X A;  5CRE A;  4GQC A;  5J4V A;  5D9W A;  4W66 A;  3I43 A;  4K7O A;  3ME7 A;  5C00 A;  3UOM A;  3TJK A;  3TRP A;  5ECN B;  4OFN A;  4ZIL A;  1V57 A;  2OKA A;  1A0R P;  1GSD A;  1H75 A;  2YN1 A;  2I81 A;  2I9H A;  1SJZ A;  2L6C A;  1Z7P A;  3FK8 A;  3VI7 A;  1PD2 1;  1T4Z A;  1U3I A;  2OA7 A;  2PMT A;  3WYW A;  4ZB7 A; 
#chains in the Genus database with same CATH homology
 3FRC A;  2C0D A;  1GSY A;  5GAP D;  4ACS A;  2AJQ B;  2HRK A;  2MMA A;  1AQW A;  5HFG A;  4MK3 A;  4TR1 A;  1TOF A;  2QSI A;  2R3X A;  3US3 A;  3MIX A;  3QOU A;  2CT6 A;  3DIE A;  3VLN A;  4K7I A;  5AIV A;  4Q5N A;  2A2P A;  4MNN A;  5CAX A;  4DSQ A;  2P0G A;  5CNW A;  1FB6 A;  2VCQ A;  3BBY A;  5C04 A;  1OC9 A;  4IVF A;  2FWF A;  4IGJ A;  3IAM 2;  2FWG A;  1S3A A;  4MJE A;  2E2G A;  2C8U A;  4YKG A;  1SL1 B;  3ERW A;  1GL8 A;  2K9F A;  3GKX A;  3TKP A;  4JED A;  2DSA A;  2O85 A;  5KEJ A;  2LNT A;  4LL4 B;  3A2W A;  3HVS A;  3SBC A;  5HFK A;  4HJ2 A;  4I2T A;  1G6W A;  1M99 A;  3EMP A;  3HA9 A;  2H0H A;  4MF6 A;  2ZNM A;  2DJ1 A;  4MH2 A;  2WB9 A;  3F8U A;  3LJR A;  5DQY A;  3VPQ A;  4A5P A;  3BD2 A;  2PGT A;  2R5G A;  1KNG A;  2CX4 A;  5B8A A;  4ECB A;  3GV1 A;  4XRA A;  2JAC A;  4GDF A;  3CSJ A;  5B8B A;  4IW9 A;  5BRT A;  3BJ5 A;  3HXS A;  4ULX A;  4IJI A;  4QMK A;  2R37 A;  1Z9H A;  5D8I A;  3HMJ G;  1YF1 A;  3ZIT A;  3JCM L;  4K5R A;  4TOP A;  2C3Q A;  5ELG A;  3CBU A;  3BOA A;  4CHS A;  2GSR A;  4DEJ A;  5DQS A;  5GSS A;  4F82 A;  4G2E A;  3P8W A;  3TJB A;  4NPB A;  2LRT A;  3IK7 A;  5DVB A;  4AJ6 A;  3TJG A;  2YCD A;  3F0I A;  4G01 A;  3UAR A;  2R0C A;  2WUL A;  2OJL A;  4AKH A;  2YZH A;  1TRV A;  4TR0 A;  3LW9 A;  2IN3 A;  5CRH A;  4POM A;  2DIY A;  2HRN A;  2I3Y A;  3ZML A;  1AQX A;  1W89 A;  3GKN A;  4V2N A;  1URM A;  4MPF A;  5JCW A;  1EGR A;  4OMV A;  2QGV A;  4TXO B;  1YF0 A;  1KEB A;  2EFC A;  1V2A A;  2LNS A;  4IP1 A;  1F3A A;  3WGD A;  2L4C A;  5HQP A;  18GS A;  1V9W A;  1SK2 A;  4V2L A;  2IMK A;  2VIM A;  4IN0 A;  4HU7 A;  3WGE A;  1ZCP A;  4KA0 A;  5IMD A;  4GTU A;  1Y6E A;  3GH9 A;  4YAP A;  1X5D A;  5IOX A;  4IQA A;  2H0G A;  3DVX A;  4ZB8 A;  3C1S A;  1TI3 A;  4V1A p;  1XWK A;  2YJH A;  3H93 A;  3ZRD A;  1N25 A;  1SVO A;  2GDR A;  2O8V B;  4L0W A;  1M2A A;  5CRD A;  1SKS B;  3VFI A;  14GS A;  5A5H B;  5F0G A;  2B5X A;  3E0U A;  4AKG A;  2HRF A;  3WD6 A;  4ECI A;  3J7Y k;  1A8Y A;  3RPN A;  4TR4 A;  1A24 A;  4NWY A;  1K3O A;  4YKF A;  5DCH A;  4HDE A;  4HQS A;  1WP0 A;  1FB0 A;  3HHV A;  2VL2 A;  4ISD A;  3F9U A;  4WF5 A;  3RBT A;  1TU8 A;  2L5L A;  3HDC A;  4H86 A;  2VCX A;  4ZBB A;  1MDJ A;  3F4S A;  2HZF A;  3EPT A;  4TXO A;  3D22 A;  1GUH A;  1SL2 B;  6GSV A;  4BVX B;  2ON5 A;  2C1Y A;  2LRN A;  1QK8 A;  1BJX A;  3NIV A;  3PH9 A;  2DJ2 A;  2HZE B;  3DGQ A;  2X8G A;  4E8E A;  3HY2 A;  2VD1 A;  3KP9 A;  5E4W A;  3KM6 A;  5INY A;  1XBS A;  4MDC A;  1TXX A;  1BQ7 A;  4FIW A;  22GS A;  2E0Q A;  3DML A;  1M2B A;  2PER A;  5A5H A;  2VO4 A;  5H5S A;  1MTC A;  2WJU A;  3DWV A;  2AUV A;  1TK8 B;  2LJK A;  2LEG A;  4X0X A;  1T3B A;  5IQY A;  2DIZ A;  1O73 A;  2KUC A;  2YWM A;  1XOB A;  5D96 A;  1SKR B;  4BWS A;  2J9H A;  1R5P A;  2DMM A;  4O5U A;  5G1L A;  1F3B A;  1A0F A;  4FH8 A;  2LV3 A;  3HD5 A;  1A8L A;  1HD2 A;  5KN1 A;  2O87 A;  4J57 E;  5BMU B;  1G6Y A;  2H1A A;  2F9S A;  3TRQ A;  3QAG A;  3IPZ A;  4XTS A;  2CVB A;  3FEU A;  5IM9 A;  3FZ4 A;  4KGI A;  4BVX A;  4KDU A;  2RM6 A;  4IHU A;  4E8H A;  2HZE A;  5HR3 A;  1XW6 A;  5IO0 A;  3GKM A;  4K5S A;  4ZBA A;  1EWX A;  3LXT A;  3TU3 B;  2VD0 A;  3FHK A;  2L6D A;  2NDO A;  2H70 A;  4TRX A;  1ST9 A;  4WXT A;  1GSE A;  1VF3 A;  4IS0 A;  1HNA A;  1GUK A;  5HR2 A;  2ZUP A;  2YV7 A;  5DAL A;  2H76 A;  3M0F A;  3OR5 A;  2VL2 C;  3GKK A;  1VRS D;  1GTI A;  1MEK A;  4BVY A;  3F3Q A;  2VAF A;  3IOS A;  1ERU A;  3TRX A;  1LBK A;  3UJ1 A;  1J0F A;  3L9S A;  1PKW A;  2ZCT A;  4PQ1 A;  1YQ1 A;  2VM1 A;  3Q18 A;  3KEB A;  4ML6 A;  4ZB6 A;  4MJA A;  1ERV A;  3IR4 A;  3GNJ A;  4KB3 A;  1O85 A;  1K0N A;  4Z7X A;  1USB A;  4D73 B;  3EU3 A;  4HJM A;  2ALB A;  2NPB A;  2VCT A;  3TKS E;  3GN3 A;  4PNG A;  2GLR A;  1EGO A;  3TKR A;  4WBJ A;  1B48 A;  4HZ2 A;  3O3T A;  2DC5 A;  3IC8 A;  2F3M A;  2FA8 A;  1B4Q A;  4K2D A;  5ECQ B;  1WWJ A;  3ZRE A;  2HXK A;  1K0B A;  1HQO A;  5ECP B;  2VOC A;  4AKX B;  3ZTL A;  3GUS A;  3HJO A;  2F8F A;  4ZL8 A;  2HSY A;  4QL7 A;  1SU9 A;  3KXO A;  3ERG A;  4MPG A;  1J9B A;  2IFQ A;  5KN2 A;  5ECK B;  2IME A;  4AKI A;  3QPM A;  4K8M A;  2EFD A;  4ECJ A;  1OE7 A;  1VF1 A;  4IKH A;  5ABR A;  4KDY A;  4ZB9 A;  4KE3 A;  1Z3E A;  20GS A;  5JWO B;  5G1K A;  2HSH A;  1TP9 A;  2V1M A;  4GWR A;  3APO A;  5DJL A;  4POK A;  1QMV A;  3KJY A;  4D73 A;  3VI5 A;  1K3L A;  4HUA A;  2LQQ A;  1YVL A;  2DKI A;  2V41 A;  3NZN A;  3IE3 A;  1WMJ A;  1PX7 A;  1PN0 A;  5DAK B;  3FZ9 A;  1R26 A;  1EP8 A;  5F06 A;  2X4A A;  3AY8 A;  2OE0 A;  2LUS A;  2H66 A;  1SKW B;  4KH7 A;  1K0A A;  3C71 A;  4V2M A;  5AIX A;  6GSY A;  1HYU A;  1PX6 A;  1PA3 A;  4POL A;  2RII A;  3P90 A;  2B1L A;  5ENU A;  1A2J A;  4O7H A;  3LFL A;  4GSS A;  3TB2 A;  5KOW A;  3H1N A;  2HI7 A;  1XIY A;  4I8B A;  3ISO A;  1ZGN A;  3IDV A;  1N2A A;  3MAK A;  3LEF A;  2HSM A;  3QR6 A;  3HZ4 A;  4MH3 A;  2YWI A;  2YP6 A;  4OCE A;  4EF0 A;  3FYG A;  1F6M C;  2K6V A;  3W8J A;  2YZU A;  2H6Y A;  5D9V A;  4O92 A;  2X8C A;  3KIJ A;  2HT9 A;  4OO4 A;  4ICY A;  1PRX A;  1SD9 A;  2KOK A;  3TKQ A;  2OT3 A;  3TJF A;  1GH2 A;  3H79 A;  1GTU A;  3GRX A;  1GNW A;  1GSS A;  4HQZ A;  1PGT A;  5F07 A;  3BCK A;  4GRF A;  5DAK A;  2GST A;  5A4W A;  3A5I A;  1G7E A;  5J5N A;  3ERF A;  3KD0 A;  1GRX A;  2OBI A;  2JU5 A;  1SJI A;  1WE0 A;  4DSR A;  3KTB A;  4FQU A;  4RQR A;  3ZIV A;  4AI6 A;  3TGZ A;  4RI6 A;  1XPV A;  5LCZ A;  1JZD A;  4YAV A;  3KZQ A;  1OKT A;  5CO3 A;  1TK0 B;  4KUN A;  4PUA A;  3GSS A;  4O32 A;  4GLT A;  1BED A;  8GSS A;  5D93 A;  4X4J A;  1BG1 A;  1SK0 A;  3F4R A;  1T7P B;  2H71 A;  3QFA C;  1GLQ A;  1H4O A;  4LL1 B;  5IPH A;  2CV4 A;  4F0B A;  2DLX A;  1M0U A;  1PMT A;  3DYR A;  1JZO A;  4XS6 A;  3HCZ A;  2MBT A;  4G0K A;  5J47 A;  3EU4 A;  1GLP A;  4L0U A;  4WET A;  4DSS B;  2V2G A;  5F8B A;  3W6G A;  3I6A A;  4MMM A;  4YQV A;  2DML A;  4MF7 A;  3IAS 2;  4XHM A;  1F37 A;  4OO5 A;  3VWX A;  3Q74 A;  3LWA A;  1YY7 A;  5ECS A;  3L78 A;  1Q98 A;  1X0R A;  2MYG A;  3D4M A;  5LD0 A;  4KDX A;  2Z9S A;  4G19 A;  2GSS A;  3UVT A;  1SVM A;  4OFT A;  3ED3 A;  4HI7 A;  4EL1 A;  2CZ3 A;  2HNL A;  4WR5 A;  1X5C A;  3GYK A;  3L0H A;  1TW9 A;  4Q5Q A;  4G9H A;  5HR1 A;  1E2Y A;  1M9A A;  2CAI A;  1RK4 A;  3MDK A;  2XC2 A;  3GIX A;  2V6K A;  4NV5 A;  4YQM A;  4G10 A;  2QA1 A;  5COH A;  2H75 A;  2HQT A;  2NBS A;  1NW2 A;  2FY6 A;  3MNG A;  4JRR A;  2H1D A;  2M72 A;  3HKR A;  4N0Z A;  3TDG A;  3HVV A;  3A3T A;  2QC7 A;  1XCC A;  4XS4 B;  4EDY A;  5G5F A;  3M3M A;  4AJ8 A;  1ACV A;  1XXU A;  2C0E A;  1IYH A;  5ECO B;  2TIR A;  2MMZ A;  3ZZX A;  4N3Z A;  4PXO A;  2JAD A;  3GX0 A;  4DSS A;  5AIS A;  2DBC A;  5B6N A;  2RUE A;  1EP7 A;  1PQN A;  2G0F A;  3ZIJ A;  1T4Y A;  5IIZ A;  2B1K A;  4PQH A;  2BJX A;  3UIW A;  1AQV A;  2H8L A;  1CQG A;  4JBB A;  1XWG A;  3M1G A;  1TTZ A;  1ZYQ B;  1WRY A;  4TXV A;  5J3R A;  5IMV A;  3W8S A;  3IBH A;  1DSB A;  4RUV A;  4G0I A;  2HE3 A;  10GS A;  3E3E A;  2M46 A;  3UBL A;  2H73 A;  2GT6 A;  2YJ7 A;  3RAZ A;  4FYU A;  4N0V A;  2KHP A;  17GS A;  2X8H A;  2HYX A;  1ON4 A;  5HR0 A;  2O5V A;  1S3D A;  1R5A A;  4OWY A;  4K2X A;  6GSW A;  4EKZ A;  4KW6 A;  4LMW A;  4XS4 A;  2H72 A;  5JWQ B;  4USS A;  5J9C A;  4WR4 A;  5A1N B;  2GSQ A;  4ZL9 A;  3O76 A;  1VGL A;  2GZY A;  2BTO T;  1RW1 A;  2C0G A;  4K9Z A;  4KF9 A;  3MYD A;  4N30 A;  1A2L A;  3UEM A;  3GST A;  2IMI A;  1T8E B;  1TRU A;  1XW9 A;  16GS A;  1TJD A;  3KMO A;  2GT5 A;  2WS2 A;  4K0N A;  4J56 E;  5IMC A;  4CY6 A;  1ERW A;  3D4T A;  4EIP A;  5JCU A;  2GQL A;  2LST A;  3APS A;  3QAW A;  4OFM A;  3UMA A;  2B5Y A;  2XBI A;  2GVP A;  3F6D A;  1WJK A;  1V40 A;  4JE1 A;  1SJ6 A;  3RHB A;  5L71 A;  4Q5F A;  2K8S A;  1FOH A;  3TUE A;  2C3N A;  3S9F A;  4X43 A;  4AJ7 A;  3LG6 A;  5DCG A;  5ELA A;  3P2A A;  3GL3 A;  4FO5 A;  3UBK A;  4ML1 A;  5FWG A;  3P7X A;  2RUF A;  4WBR D;  2HSN B;  1K0C A;  5JWR B;  5DBQ A;  4HS1 A;  5IMZ A;  13GS A;  1MD3 A;  3M8N A;  4LMV A;  1OAZ A;  1ILO A;  3U6V A;  2GQK A;  3NOF A;  2VLU A;  2FWH A;  4WKW A;  5A1N A;  3D6I A;  1FOV A;  5HFI A;  5A5K A;  5DDL A;  4MF5 A;  4EUY A;  2P5Q A;  2EFH A;  5CRG A;  2N5F A;  1M7T A;  3PR8 A;  2M80 A;  2OAD A;  3CTG A;  2L59 A;  1XVQ A;  2H19 A;  2IMD A;  4N11 A;  2H01 A;  1FVJ A;  1QGV A;  4K7N A;  4X1U A;  4CDO A;  4Z2R A;  2B6M A;  2WRT A;  3F6F A;  3QMX A;  5IMA A;  1AXD A;  2LQO A;  4KND A;  4BA7 A;  5D9T A;  1XWC A;  3FZA A;  1BF5 A;  3TOU A;  3L9U A;  4V1A g;  4KSO A;  4EO3 A;  1NHY A;  1JFU A;  1ZYE A;  3IK9 A;  3EIN A;  3FY7 A;  4IJ3 A;  2CZ2 A;  1IYI A;  5A34 B;  1THO A;  2DJK A;  4IEL A;  1K0D A;  1WOU A;  2JSZ A;  5G31 A;  2FNO A;  1GWC A;  2EIR A;  2B5E A;  3APQ A;  2MMO A;  3DVW A;  2G2Q A;  5BMU A;  1UVZ A;  3F3R A;  4IP6 A;  2H30 A;  4PX1 A;  1SL0 B;  2R2J A;  5J9B A;  1ZYN A;  1GTB A;  2CA8 A;  1FAA A;  2AYT A;  1XZO A;  4PUF C;  1QUW A;  2XPD A;  3R3E A;  2P5R A;  1HNC A;  2E2M A;  3Q19 A;  5IO2 A;  1VF2 A;  2QA2 A;  1FO5 A;  4KCE A;  1GNE A;  3GH6 A;  2EC4 A;  1K3Y A;  4K6X A;  2L57 A;  3M9K A;  5ECH B;  4MZB A;  3ZYW A;  3D0Z A;  5FT3 A;  5JCG A;  1TU7 A;  3GTU B;  1B9X C;  3LYK A;  1Y25 A;  3WT2 A;  3D5J A;  3L4N A;  1YKA A;  1DE1 A;  4I6X A;  2IMF A;  3ZMK A;  1V98 A;  2GQM A;  3M9J A;  2JZR A;  1VF4 A;  1O6J A;  3V1W A;  3TOT A;  1A23 A;  2C4J A;  4KCA A;  2ON7 A;  3EE2 A;  5IPG A;  1B4P A;  4JZQ A;  5KN3 A;  2KLX A;  1ZZY A;  2QKE A;  4PUR A;  4JU5 A;  2CVD A;  5LNK e;  19GS A;  1TKD B;  3WT1 A;  3CSI A;  2OE1 A;  2H0I A;  3IA1 A;  2H1G A;  1Z6N A;  4I5Q A;  1EV4 A;  5DJM A;  4F0C A;  4GST A;  2B3S A;  2LTK A;  4PQI A;  3ME8 A;  2X49 A;  6GSU A;  3VWV A;  4QQ7 A;  1YZX A;  3R2Q A;  5GZZ B;  3EUR A;  1ZOF A;  5D73 A;  1AIU A;  4EC0 A;  4BPY A;  2PPT A;  3TCO A;  3CWG A;  3FR3 A;  2H6Z A;  2GGT A;  3DEX A;  2IPA A;  3ZVJ A;  4MLY A;  1OC9 B;  5EL8 A;  4ECC A;  4Z2T A;  4TVE A;  2YPM A;  2H1L A;  3G7I A;  4TR3 A;  3GTU A;  1XWA A;  3UL3 A;  3IXR A;  1NSW A;  3QDN A;  2YNX A;  3IV4 A;  3QCP A;  2FHE A;  3KMN A;  4AF2 A;  2VM2 A;  2EIQ A;  1GSQ A;  1G0T A;  1NHO A;  3FW2 A;  5AGY A;  2VL9 A;  1R7H A;  3G7Y A;  4NXI A;  4ZL7 A;  5CP1 A;  1UA5 A;  4FYB A;  2UV8 G;  2C3T A;  2J23 A;  4L8E A;  3SWL A;  4HU9 A;  4O5Q A;  4EE0 A;  2A2S A;  2X99 A;  4EDZ A;  11GS A;  1ZYP A;  1WIK A;  4Z2U A;  2WZ9 A;  2R0P A;  4I97 A;  3CYN A;  4TN8 A;  1XFL A;  2WGR A;  2IWT A;  1GSU A;  2VUP A;  2X64 A;  2JZT A;  2YWN A;  4PGT A;  4F2I A;  5ECR B;  3GFK A;  1ML6 A;  3HJP A;  1M9B A;  1GSF A;  3KP8 A;  1X9M B;  1GP1 A;  5ECI B;  4NMU A;  1DE2 A;  1TK5 B;  3GHA A;  2GTU A;  5CRW A;  4GXZ A;  4XRD A;  2LKU A;  4K0G A;  5AN1 A;  5ECL B;  3GA4 A;  4K1F A;  4OD7 A;  4ZXG A;  4MA9 A;  5KN0 A;  5B7C A;  2E7P A;  2PVO C;  3UVH A;  4GCI A;  1EOH A;  4KAE A;  3GUR A;  3Q6O A;  3FR9 A;  1SVL A;  3PPU A;  2AB6 A;  1C72 A;  1DBY A;  1ZMA A;  3VWU A;  1SK1 A;  3LXZ A;  1WPI A;  3WGX A;  2YAN A;  1Y1U A;  1PL1 A;  1MDK A;  4I2U A;  5B6M A;  3KH9 A;  2CQ9 A;  1YEP A;  3EC3 A;  2D2Z A;  1O7U A;  1BYE A;  7GSS A;  3LYP A;  1X5E A;  3N5O A;  5H5R A;  2R6K A;  1LU4 A;  2HFD A;  2VCV A;  3H4K A;  4NHZ A;  2PWJ A;  2V32 A;  3A5W A;  3KH7 A;  4P3Y B;  2FD3 A;  1AUC A;  4GQF A;  1O8W A;  2KP2 A;  4WEY A;  3ZVJ D;  1T1V A;  1PN9 A;  4PTS A;  2DJ0 A;  3HVX A;  9GSS A;  2REM A;  3UAP A;  2VCW A;  2PU9 C;  5G5E A;  3TKS A;  1FW1 A;  2C80 A;  4RI7 A;  4XCS A;  4KSM A;  1OC3 A;  2YOI A;  4HZ4 A;  3IHQ A;  2H74 A;  3CXG A;  4J2F A;  3C7M A;  2OE3 A;  4MJB A;  2DKH A;  2JZS A;  1MDI A;  2R0G A;  3G9B A;  3EYT A;  3KTL A;  1X9S B;  3C73 A;  1X9W B;  1SYX A;  3H8Q A;  3CTF A;  2C0F A;  3C8E A;  4QL9 A;  2VKZ G;  1ZL9 A;  2MMN A;  3A2X A;  4TW5 A;  1EOG A;  1XWB A;  5A4V A;  2YWO A;  2GS3 A;  3IC4 A;  1QFN A;  1OVN A;  2LS5 A;  3O6T A;  3MWH A;  1GUM A;  1SYR A;  2LJA A;  3QD9 A;  4EXJ A;  2FCH A;  3VUR A;  4XIH A;  2IL3 A;  1Z6M A;  1GUL A;  1EEJ A;  4POB A;  2R4V A;  3PIN A;  1JLV A;  2ES7 A;  5ECM B;  3HZ8 A;  2P31 A;  3MSZ A;  1NM3 A;  2RM5 A;  1EZK A;  2XHF A;  1YDK A;  3VK9 A;  2WFC A;  5E59 A;  2H1B A;  2L4Q A;  5H5Q A;  2PVQ A;  1PL2 A;  1AAZ A;  1Z5Y E;  1YKC A;  1QXH A;  1BX9 A;  1EEM A;  2F8A A;  4KX4 A;  3F63 A;  2O89 A;  4IBP A;  2NVL A;  2YV9 A;  3I9V 2;  2CVK A;  5FHI A;  3E9J B;  4YQU A;  1E6B A;  4EVM A;  1U87 A;  1JZR A;  2CX3 A;  4BL7 B;  2I1U A;  1TI1 A;  5ID2 B;  2AAW A;  2I4A A;  2GZP A;  1Q4J A;  1UN2 A;  4MJC A;  1BG5 A;  1YEX A;  3IHG A;  1U3A A;  1JZW A;  2EIO A;  2GZZ A;  3EWL A;  3K8N A;  2CAQ A;  2EFE A;  4MP4 A;  5J41 A;  4RQX A;  3TKS C;  3EMX A;  1KTE A;  4NAX A;  2AHE A;  2H6X A;  4NV2 A;  3HYP A;  4ID0 A;  12GS A;  2LRC A;  3LSZ A;  4LA1 A;  2DJJ A;  1GTA A;  1B9Y C;  2F51 A;  6GSS A;  5EY6 A;  1OKD A;  2PUK C;  1YJ6 A;  2A4H A;  1I5G A;  4GSN A;  5J4Y A;  1OE8 A;  1W4V A;  2VL3 A;  5J40 A;  2WCI A;  4IQ1 A;  2JSY A;  3F4T A;  2FGX A;  1SEN A;  3KCM A;  1RQM A;  3C1R A;  2LJR A;  2L5O A;  4YH2 A;  1N8J A;  2AV4 A;  3FKF A;  3ZFB A;  4BL7 A;  1THX A;  4TKY A;  5ID2 A;  1S3C A;  4DVC A;  2KP1 A;  1A2M A;  3VPT A;  2K18 A;  5GST A;  4ZBD A;  1ERT A;  5DAL B;  2FA4 A;  4EIQ A;  5J4U A;  1T00 A;  3VWW A;  3ZL5 A;  2PBJ A;  4BVY B;  1B8X A;  4ZIJ A;  1UC7 A;  1KBN A;  4JR4 A;  3ZLP A;  3BCI A;  3IRA A;  3GX8 A;  1QQ2 A;  2DJ3 A;  3FR6 A;  4AGS A;  1CQH A;  1LJR A;  2OBK A;  1FHE A;  3CRT A;  1BAY A;  2HRA A;  5CYY A;  3D21 A;  2PN8 A;  4GF0 A;  3RPP A;  3QFB C;  4NHW A;  2FUG 2;  1XOA A;  1F9M A;  3I69 A;  1JLW A;  2MBS A;  3DD3 A;  3RDW A;  5EPF A;  3FMW A;  1AC1 A;  3CMI A;  2RLI A;  1ABA A;  1K0O A;  1O81 A;  1TRW A;  1FVK A;  2HSN A;  3LOR A;  1U6T A;  3U5R E;  4JR6 A;  2B7J A;  2OAC A;  1R4W A;  2IJY A;  4Q5R A;  4MZC A;  2IFQ B;  1MD4 A;  4OCF A;  1EV9 A;  3A2V A;  5A4U A;  4F9Z A;  1JHB A;  3G7J A;  1F2E A;  2N5A A;  1PSQ A;  4MCU A;  1Z7R A;  1SD8 A;  4PNF A;  4MZW A;  1XW5 A;  3CSH A;  4F03 A;  2UZ8 A;  2BMX A;  3GMF A;  5F05 A;  5G30 A;  1HNB A;  2TRX A;  2MZC A;  3HJM A;  3TJJ A;  4CY8 A;  3EVI A;  3GL5 A;  1PKZ A;  2A4V A;  1AW9 A;  3J7Y b;  2NTO A;  4LLR A;  1TDI A;  1U88 A;  4HEA 2;  4BWQ A;  1FG4 A;  4O5R A;  3RHC A;  5IOW A;  5GAN D;  2WDU A;  2XBQ A;  1V58 A;  2FLS A;  2TRC P;  2IIY A;  4FYC A;  3PGT A;  1I9D A;  1XVW A;  2B7K A;  1J08 A;  3L9V A;  1G7O A;  3LGC A;  3KGK A;  4CW9 A;  2JL4 A;  2O7K A;  1DUG A;  1TRS A;  1OC8 A;  2K8V A;  1O8X A;  3DRN A;  4HOJ A;  2VLV A;  5A34 A;  1TXU A;  4G0L A;  6GST A;  5EVO A;  2HRK B;  4WF4 A;  4E68 A;  3N9J A;  4MAB A;  4TR1 B;  5KOX A;  2V6O A;  2HSM B;  5G2Z A;  4ILF A;  3FZ5 A;  1OYJ A;  4L5L A;  3DKS A;  2VCZ A;  3DXB A;  2XPE A;  3QAV A;  1M2D A;  5IMF A;  4XS1 A;  2A2R A;  4L5O A;  2HLS A;  1K0M A;  3CRU A;  2VLT A;  6GSX A;  4N10 A;  2FWE A;  3ZFL A;  3LQ7 A;  2N5B A;  5D9X A;  5CRE A;  4GQC A;  5J4V A;  5D9W A;  4W66 A;  3I43 A;  4K7O A;  3ME7 A;  5C00 A;  3UOM A;  3TJK A;  3TRP A;  5ECN B;  4OFN A;  4ZIL A;  1V57 A;  2OKA A;  1A0R P;  1GSD A;  1H75 A;  2YN1 A;  2I81 A;  2I9H A;  1SJZ A;  2L6C A;  1Z7P A;  3FK8 A;  3VI7 A;  1PD2 1;  1T4Z A;  1U3I A;  2OA7 A;  2PMT A;  3WYW A;  4ZB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...