1RK8A

Structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
87
Chain Sequence
b'PQRSVGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG8781-PA protein
publication title Molecular insights into the interaction of PYM with the Mago-Y14 core of the exon junction complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Translation
total genus 18
structure length 87
sequence length 88
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rk8A00
2J0SD 2KT5A 4YB1P 2CQ2A 4QQBA 3Q2SC 2KH9A 2VOPA 4YUDA 2MY8A 1OPIA 4Y00A 5IFMA 3CC7S 3UD4P 1JMTA 2MMYA 3P49B 2X1FA 2M88A 1O0PA 2E5HA 2DHXA 2DGXA 3CCUS 2FY1A 1HA1A 2F9JA 4M5DB 2N7CA 1WTBA 1YHQS 4WFAQ 1SJQA 2CQ0A 4PR6A 5CYJA 1W2BR 4OZ0A 2M8HA 4BS2A 3THPA 4WCEQ 2MJUA 5HL7Q 3TP2A 3B4MA 3VF0B 4QU7A 1UW4A 4QU6A 2MQMA 2CJKA 5IM0B 1VQNS 3CCES 2I2YA 2JVRA 3G8TA 1U1LA 4TU8A 1U1KA 3UWTA 4TU7A 3MUVP 3J7YU 2KM8C 1KD1T 4IOAQ 1DZ5A 1SXLA 5LXRA 2MHNA 1WG1A 3CF5Q 1OWXA 2HGLA 3EX7B 2KYXA 3UCZP 2MY7A 2MYFA 2KXHA 1IQTA 1FO1A 1VQ5S 2K3KA 3VALA 2DNRA 1PO6A 1CVJA 3VAFA 4F26A 3UE2A 3EGNA 3R1LA 1WG4A 1VC6A 3CCMS 2E5JA 2RT3A 4CIOA 1JJ4A 1KC8T 2QEXS 1NU4A 1VQ4S 2KXNB 4FXWA 4F02A 3BEGB 2LMIA 2CPJA 1SJRA 2I38A 1D8ZA 3D2WA 1U1QA 1U1PA 2DNGA 2XNQA 2DK2A 3NNHA 1HD0A 3NS6A 5IQQA 3G6ES 2DNZA 2PEHA 3H2VE 3CCJS 2MPUA 1VQOS 2XS5A 2RU3A 1KOHA 3MD1A 3ZZZA 3CMES 4RU2A 2CQGA 3HHNB 2QA4S 4WFBQ 1DRZA 1ZH5A 4Y0FA 1WG5A 2HYIB 3NNAA 2CQ1A 5GAGU 2NZ4A 4TLQA 2M52A 2K8GA 1WEYA 3CCRS 4WFNQ 2D3OR 2MJNA 1VQLS 1YITS 1H6KX 1N52B 2L41A 3CC4S 2DNHA 3HI9A 5D77A 2LEBA 3US5A 1U1NA 3L3CA 4ED5A 2AYGA 3JB9k 2Q79A 5LSLA 1P1TA 2MZSA 2DNLA 2YKAA 1D9AA 2OTLS 3MI7X 2DGOA 2DIUA 1WHWA 3CC2S 1M90T 1URNA 2D9OA 1WHYA 2HGNA 1JJ2R 4IOCQ 5DM6Q 2RRAA 2M9KA 4ZKAA 1WI8A 1U6FA 3TO8A 4C0OC 2DNMA 1K9MT 2KHCA 4TU9A 2DNQA 2YH1A 2FHOB 2MQOA 5JVGQ 2RQCA 2KXFA 2DHGA 2HVZA 1FJEB 3K0JA 1ZZFA 2BZ2A 2DO0A 5DM7Q 3N9UC 4IO9Q 2VONA 3UCUP 3CMAS 1NO8A 4C4WA 1KOOA 1N54B 3CCVS 2E5GA 1X5TA 1S72S 5H1SV 1H2UX 3U1LA 2CQCA 3IWNC 3Q2TC 5GVQA 3S8SA 1VBXA 4U67Q 1VQ8S 3CPWR 2KRBA 1K8AT 3LPYA 2MKSA 1VC0A 1U1MA 1R8HA 3MUTP 2LXUA 1X5SA 1ZZNA 1VQKS 1Q86T 1H2TZ 2F9DA 2CQDA 3BO2A 3I55S 3BS9A 2CQPA 3G96A 3CUNA 3V4MA 1OIAA 3LQVA 3S01A 2DNYA 4WF9Q 3P3DA 2NLWA 2CQIA 1WWHA 3MURP 4W92B 1X4BA 2XB2D 2MGZA 1PGZA 2RUGA 2KG0A 4YOEA 5LJ5Y 2DGQA 2QFJA 1H2VZ 3IRWP 1VQPS 2XS7A 4C7QA 3OW2R 2ZJRQ 2CQ3A 3G4SS 2DGUA 2FPHX 3MDFA 3MXHP 1HD1A 5DDPC 1B7FA 5CXTA 2WBRA 2DNKA 2L08A 2EVZA 1WEZA 1VQ6S 2KG1A 1QM9A 2XNRA 2MKCA 2L9WA 2N3OA 4WKRA 2OIHA 1X4EA 2LQ5A 1JJHA 1Q7YT 2MKHA 4PKDB 2DISA 1UFWA 3SMZA 2HGMA 2MKIA 2X1BA 2MQPA 1X4HA 3I56S 2M4MA 2LKZA 2M70A 2DO4A 2RVJA 5JVHQ 2UP1A 3PIOQ 2ZJQQ 4CH0S 1U1OA 2XSFA 1WELA 2M2BA 1DHMA 1VBZA 2CQ4A 2DNOA 3UCGA 1SJFA 1FXLA 1OO0B 4PRFA 3SDEA 2MKJA 2LXIA 1AUDA 2ADCA 1WF0A 3VAMA 5DETA 1M5VC 2RRBA 2GHPA 1M5PC 2YH0A 2GO9A 5GAEU 1X5PA 2MZ1A 2JVOA 3CCQS 3RW7A 1UAWA 3ULHA 2LYVA 5BJRA 2LA6A 2KVIA 1SJ3P 2AYBA 1FJ7A 2MKKA 3CCLS 3UD3P 3VAJA 1P27B 2J76E 2LA4A 2MZRA 1Q81T 3SXLA 1XN9A 3BO4A 2CPYA 1X4GA 2DGTA 1SJ4P 3S6EA 4J5OA 5GADU 2DHAA 2DHSA 4V19X 1WEXA 3RW6A 2AYEA 1YIJS 2SXLA 3CULA 5GMKa 1N8RT 3NS5A 2MSTA 2LEAA 1M5OC 2DIVA 5ITHA 4EGLA 3S7RA 2KI2A 1X5OA 2DB1A 2U2FA 4OZ1A 3B4DA 3SDEB 4CQ1A 5LSOA 5MLCV 2X1GA 2RNEA 2DH9A 3CCSS 1VQ9S 1QVGR 1YWXA 5DDRC 2EK6A 4ERDA 2MXYA 1WHXA 4LIRA 3DXBA 2N3LA 1RK8A 5FJ4A 1VQ7S 3FEYB 2ZJPQ 3J7ZT 1U1RA 2O3DA 1F9FA 2V94A 1WF1A 5GAHU 2U1AA 2CQBA 2DH7A 1A7GE 5CA5A 3P6YC 2MQQA 1RKJA 2CQHA 1FT8A 2KN4A 1X4CA 2FC9A 2G0CA 2JX2A 4LJMA 2M8DB 1WF2A 2CPHA 2CPDA 2E44A 1X0FA 3CXCR 2HZCA 3VAGA 1NJIT 2J8AA 3TYTA 1KQSR 2LECA 4A8XA 2VODA 1N88A 3VAKA 5HO4A 2ADBA 2MZTA 1S79A 2FC8A 2CPZA 2MQLA 2MQNA 2DGVA 3H2UB 2CPIA 4UY8T 3G71S 2JWNA 1FNXH 3EGZA 2E5IA 1R8PA 1WI6A 3MD3A 2LCWA 2MZQA 2OTJS 2CPFA 5D78A 1G2EA 3NMRA 2F3JA 4FXVA 2DITA 1X4DA 2XS2A 3G9CA 3FEXB 3G8SA 4UQTA 1M1KT 2N82B 1U6BA 3MUMP 3P5TL 2ERRA 2MZJA 1UP1A 2RQ4A 2DGSA 1WHVA 3VAIA 1BY9A 2M7SA 1X4AA 3ZZYA 2KU7A 3VAHA 2YTCA 2X1AA 2G1DA 4F25A 2JRSA 2B0GA 2D9PA 2DNPA 5LXYA 2MGZB 1YJWS 2AYMA 2EK1A 5DDQC 2AD9A 5EN1A 4W90B 1HL6A 1YJNS 4CH1A 2OSQA 1Q82T 2VOOA 2G4BA 1YI2S 2DGWA 3PIPQ 2KM8B 1A9NB 2CPEA 4Z2XA 3CTRA 4WIIA 1U2FA 2MSSA 1X4FA 2CPXA 2OJ3A 1VBYA 1VQMS 4P6QA 1DBDA 2M0GB 2RS8A 3CD6S 3BO3A 2KFYA 1QVFR 2DH8A 2KRRA 2J0QD 2YWKA 5IM0A 2PE8A 2BOPA 5DDOC 2RS2A 3R1HA 3THTA 3MOJB 2A3JA 2OSRA 1L3KA 2DNNA 3R27A 1YJ9S 1K73T 1M5KC 4LMZA 3DLLQ 1FJCA 1YTYA 3U1MA 5LJ3Y 4IUFA 4QPTA 1VC5A 3NNCA 1FHTA 2MB0B
chains in the Genus database with same CATH superfamily
5E3PA 4QQBA 2VB6A 1QAYA 3CJSA 2MY8A 3CMQA 3CJ0A 3DHXA 1KFDA 1UTAA 4P72A 4W98A 3CB4A 3BBBA 2Q66A 3GG0A 4HTIA 4HLBA 4K4VA 2AJ2A 3VQSA 4RNNA 5IWAJ 3QFWA 4WXOA 4JI7F 2XG8A 4X66J 3PX4A 1Q78A 3Q83A 3G8TA 4CO5A 4CLFA 3CNQP 4DZDA 1GMWA 1TKTA 2E1CA 3BV8A 5F9NA 3M8RA 4M5NA 2BX6A 1ZOTA 4KPCA 2KT2A 4CTAB 2KXNB 4RW9A 2I38A 3U1NA 5L46A 2XMKA 1GFWB 5E3QA 1HD0A 2RHQB 4QYRA 1VRTB 2MPUA 1RJJA 2BV3A 1KR4A 3ZZZA 3OR2A 3F0NA 4PWWA 1Q1KA 1WORA 2NZ4A 1HBOB 5BYQA 1YJ7A 1RT6A 3L4BC 4OX7A 4UOCA 2QX0A 1N5VA 3NLCA 1HI1A 2G0JA 5IC4B 4WFZA 1HBMB 2VUGA 3J7AN 5EWEA 4EUVA 4QW8A 3PR4A 5KOWA 2C2RA 3QRRA 3AJ1A 3RRGA 1U6FA 4OYOA 2WVCA 1TR0A 2DNMA 1T9VA 3PW2A 3RRHA 1C4CA 5CHCB 3KLGA 3GV5B 5GMEA 2D41A 1KOOA 4MAKA 1G3OA 2AEFA 2XI3A 4DFPA 4G65A 1S1XA 1H2UX 2QMWA 2XY5A 4TY8B 1GMVA 4NLUA 4ED8A 3PW0A 3DLKA 5ETTA 5M2PA 4DR3F 3OTBA 1T0TV 4KFBB 4KKOB 1RB0A 4KTQA 2PDAA 1L3UA 1WC5A 1RBAA 3NWGA 3W3SA 4N76A 3DLBA 1HARA 2W9CB 2KJWA 3D6TB 5M2UA 1J5EF 1C0UB 1HPZA 3C19A 2AF6A 2IA6A 3JYTB 3QSIA 2YX7A 2WSEC 2Y0BB 4XDDA 4O3NA 5CYQA 4RW8B 2X1BA 2HHUA 1VHFA 1R3NA 4DL6A 4RW6B 2RVJA 4CH0S 1SJFA 2HQIA 2MKJA 2RJZA 2AX1A 3C16B 1XWLA 2CG4A 3GYGA 1KRPA 3MMCB 4A8MP 4K0KF 1RT1B 5BJRA 3TEHB 3VAJA 2VIHA 1FFGB 3AXKA 4ZVFA 2RD5C 1X0PA 1GMUA 1SQEA 3CJRA 1NXIA 3DLJA 2XGQA 3DRXA 1YIJS 1T94A 5GMKa 2ZBCA 2GO8A 2ZBRA 2VFTA 1NJWA 3I5CA 2MSTA 3H0PA 4E98A 5FDLB 2KI2A 3PV8A 4OZ1A 5H9EJ 4IFYA 5J2PB 4CQ1A 3X1LB 2YY3A 4ECWA 2X1GA 2LEPA 1HWIA 4O3OA 3EXCX 1VQ9S 3D6FB 3NKYA 5SUHA 5CD4A 4Y2CA 4OI2A 3UNGC 3NOGA 2DRDA 3FEYB 5ETPA 2WVDA 3HKZD 2LDIA 2MQQA 3E3XA 1SC6A 4OL8A 1X0FA 4ECQA 3CXCR 4K5RA 1NK6A 1NKEA 2J8AA 2V8PA 1R89A 1ZS6A 2D3UA 5DGAA 2GAHC 2MQLA 3E01B 4WK1A 2E1AA 1FNXH 1WI6A 3MD3A 1U0HB 3ISZA 1RT7A 1TELA 4V1Ak 4QIGA 3GONA 3DMJA 4H54A 3K5MA 1HNVB 5KG2A 2ZH9A 2ERRA 4IG3B 5E7OB 1XC9A 4NPOA 4DXLA 1LOUA 2HBZB 1SH2A 3M9NB 3P96A 3M6WA 2HMIB 3RG6A 1WUUA 2JRSA 5HBMB 3DYAA 4L74A 1Q82T 2G4BA 1N0VC 4KQZA 4Q8EA 2FVCA 3DOKB 1SL0A 4QWAA 3C14A 2RQKA 1ZM4A 3H59A 2FY8A 3ILOA 2HHWA 3D9BA 5E3AA 2GVDB 3P45B 4MKVA 4RR5A 1C1CB 1H7WA 1TUWA 3VV2B 4USKA 1O8BA 2BJDA 2NPIA 3UD4P 2CVIA 3AT1B 2GVZA 3KHLA 2C2MB 2PN6A 2FY1A 1CSJA 1HA1A 3MEDA 5D0EA 3IBFB 5J2QB 3W9IA 3KK2A 3KLEB 1F9HA 1MSWD 3OVAA 1APSA 2UZAA 2WTFA 1NLKL 4OI4A 4TU7A 1U24A 2H65B 1M1GA 3NWRA 1SXLA 5HQ8A 2VPXB 5DG8A 1HNIB 4GVBB 2MYFA 3WHIA 2DNRA 1CVJA 2FJEB 4ZJOA 2ZNYA 4F02A 1S12A 2UVVA 3PEHA 3W2WB 1YX2A 2G0IA 1R0BG 1S99A 5K9FA 3DLHA 4IRKA 3ZZOA 1JLGA 1S9EB 5ETOA 3OUYB 4WFBQ 4X4PA 3GYNA 4NCBA 3H5UA 4F4AA 2M52A 1KS2A 2HVHA 3KKFA 2K1RB 3N0VA 3IRXA 2LQBA 3IFEA 3MR5A 3SYZA 3FQLA 4ED5A 2MZSA 1W2IA 1UFLA 1FVQA 2VKRA 1DQ8A 4IOCQ 2RRAA 1FNOA 1WI8A 1U8WA 5KAKA 2DNQA 4DI6A 2YH1A 2JEIA 5KFXA 1I51B 2RKIA 2JEFA 2QE5A 3FK4A 4Y2IA 1FESA 2JC1A 3OTDA 4GO7X 3CMAS 2DY9A 1UVMA 3L95X 1QD1A 3HHDA 3U1LA 3D0HE 1RT2B 4DPXA 2AZ1A 3CJKA 3CPWR 3TA1A 2OKQA 5ETRA 3MCSA 3IMQJ 4IQXA 4QYZK 3MM6A 1VQKS 1EKSA 1Y3KA 2IIHA 1U2CA 3DRYA 1N5TA 4NXNF 2A1BA 4K50A 1GK8A 1F60B 4W92B 1O5JA 2RUGA 3MXHP 3QAUA 1B7FA 4PQAA 5CXTA 1F2HA 4KO0B 3H90A 2QYGA 1T9WA 3OXLA 2NCKL 2H5IB 1Q5YA 4ZVGA 4DS5A 1PJ6A 4CLUA 4HACA 1QSLA 3NCRA 4RNMA 3GFHA 3I56S 4DUYF 1R43A 5IC6B 2ZNZA 1HQUA 4JV5J 3UCGA 2BUNA 1TMJA 4ZPVR 1FXLA 4ZVEA 2H9ZA 1IR0A 1XR7A 2KZZA 4JI4J 5DETA 1M5VC 3RBXA 2GHPA 2BJ9A 1M5PC 4H4MB 5GAEU 2MZ1A 2HKEA 3M32A 4ATNA 4RW9B 4B9UA 5J2NB 3CD7A 2NQPA 3TR5A 1VIXA 4J7CA 5GADU 1LW2A 3OR2B 1PJ7A 2YWWA 4DCJB 4OZ2A 1ELOA 3QBCA 1FDBA 2QG9B 2YNHA 2F5GA 4GC6A 1TTHB 2YNIB 4Y2MA 1H38A 4G3IA 3HULA 1VQ7S 3J7ZT 2KHDA 5KT3A 4ZJLA 2XY7A 1RAAB 1AYEA 3H5XA 1W25A 1X4CA 3T6BA 2XCPA 1GXTA 1RA6A 2D7SA 2E44A 5MAOA 4DV4F 1KLMB 2DR7A 1I94F 4FNHA 3KNGA 3VAKA 2W2OP 3J81U 3EXYA 4FBTA 4DUYJ 2O5DA 5HANA 1RTHB 1S1XB 1CQMA 3KJFB 1FRLA 3D7SB 1JLEA 3KK1A 3LALA 4C3KA 4PXEA 2OO4A 1HWLA 4FZVA 5KTQA 3CCTA 4WZMA 2BJEA 2J9CA 1IBMF 4AL6A 4C8ZA 2UUCF 1YJWS 2NUHA 3RTVA 2V0NA 1AROP 4W90B 4DL0C 1ZM2A 4YY3F 1A9NB 2Y1JA 4ZDNA 5B0AA 4H4KC 5F8LA 4HYKA 2XLKA 4XDCA 4CT8A 2KFYA 4DR2J 4Q0BB 1YKWA 4RWWA 2V68A 2YWKA 2GQQA 2ASYA 5C25B 2BOPA 1DY3A 5LSRA 3GV7B 1NPPA 1JJCB 5IQ6A 3RB6A 1FCAA 4QOTA 4CLZA 3W2VB 4J9RA 1OYEA 2V2ZA 2XEXA 3PYGA 2HLUA 2XZWA 3ZTOA 2F9JA 3C3LA 3MAQA 2GQ2A 4WFAQ 3DLGB 2CQ0A 5KFMA 1HBUB 5F41A 1FXRA 4DN0A 3MR3A 1SKSA 3GCWP 2R7QA 2LU2A 2JVRA 3SZ2A 1U1LA 2QA1A 3D1OA 1GXUA 3OR1B 2BACA 3BGFA 3FBCA 3FRZA 4O3SA 4Y2KA 1NMEB 1JJ4A 3R2CJ 3CJQA 2UUCJ 1NSKL 4F0KA 4IFVB 3NOCA 3AA8A 3Q8PB 5L1KA 3Q89A 1T9XA 1E6YA 5T14A 3G6ES 2GMHA 2DR5A 4P2FA 3SFUA 2RQMA 5B0BA 3MD1A 1JLQB 4B9SA 1NK5A 3PRDA 2HHXA 3VGUA 3PW5A 3M1VA 4CH7A 1YJRA 2R9LA 3KWMA 4HL9A 4HTJA 2K8GA 4PXBA 3CCRS 5KFWA 4KGXB 3QFHA 4JB8B 4M5MA 1VRUA 2DR8A 1WSVA 1VLYA 4GVLA 3WZ0A 2Z4PA 1FWKA 2PA8D 3AODA 3MI7X 4E0DA 4CO0A 4CYUB 4HHHA 2XCAA 4DU8A 2VASA 2IRXA 5HROB 4X2BA 1FEHA 2KDOA 1NB2A 5JVGQ 5HATA 2JDJA 3SSSA 5KFIA 3DYAB 5KFHA 2VDIA 1JLCB 2EKNA 1EQMA 2WOMA 5B0FA 3SV4A 2XSJB 2X7IA 4NL5A 3AD7C 4DPOA 1R8HA 4LRFA 4LVNP 1PAEX 2MTLA 2F9DA 1RAGB 1R27B 4L75A 5KFVA 5DJBA 2F8MA 3ZC4A 5KG6A 4QWDA 1KBRA 1KN6A 2Q6CA 3AXMA 2WZ1A 4C8YA 3G4SS 2VJVA 2OUGA 4DS4A 5F8JA 4PWUA 4BC9A 3MEDB 1QM9A 1GEHA 4DR1F 1MU2A 3DN9A 5D3GB 3F44A 1RE1B 1TL1B 1NJZA 1RSCA 4TQRA 4X64J 3VZHA 4I6YA 1N0UA 2UV8A 4RUHA 4A48A 4WFXA 3K5PA 4K4SA 3DGVA 2ZOMA 2HZAA 2NR0A 3BKFA 2F40A 3QGHA 4X4TA 1SC1B 1EP4A 2LXIA 5C5JA 1AUDA 4WP9A 3R7BB 1TZ0A 2YH0A 3DFEA 5BYSA 1NUEA 2OEJA 1ZBTA 1ZPWX 4PUOB 4B3TJ 4Q2MA 1Q81T 1S1TA 2QO3A 4C2MA 4NXMF 2DGTA 1SJ4P 2DHAA 2UUTA 1EX8A 3IGVA 4YB6A 1MROA 1MN7A 1BWVA 1JLFB 2QYCA 1XMOF 1HWJA 4L76A 3PKMA 2DH9A 3BSOA 4DV2J 1N34F 2Z58B 4MYTA 2WVFA 3IR5B 2BE2B 1N32F 1WF1A 3QGIA 3A13A 2YQ1A 1V5VA 3NEKA 4LJMA 2M8DB 1MWZA 4B3MF 2A6MA 3HLUA 2IM1A 3TYTA 2VODA 2VG5B 2KT3A 1CJVA 1NHUA 2GGPB 3KHHA 3CO9A 2RDDA 2C2KB 3FSXA 2DITA 4ZVUB 3CJKB 1NKBA 1ULRA 4C6AA 4M5HA 1G1XA 1JXLA 3VAIA 3ZZYA 4USTA 2YTCA 2BVZA 4PQUA 3D6HB 4F25A 1RWNB 2RMLA 5GMDA 2EBEA 1PCAA 4WE1B 4TNOA 4PWDA 4FYXB 2VOOA 4Z2XA 2IC3A 4NLWA 4PPZA 1RTIA 3BO3A 3TAMA 4ES2A 2RU9A 2E1MC 3TVZA 3M8YA 2H3EB 5D0GA 2OSRA 2XWXA 1DTTA 3GJQB 5LJ3Y 4QBUA 4DL5A 3NNCA 1X60A 1XQIA 3TI0A 2GJ2A 4P75A 2MMYA 3DRSB 2ZH5A 4R5PA 3V6DA 3ISND 3T3FA 2ZVIA 1XEZA 2YQ0A 4B3MJ 1CJUB 2GMLA 2GHVC 4ICLB 2BABA 3BR8A 4BS2A 2CAJA 5HL7Q 1UETA 4M95A 2B8PA 4USHA 4OYXA 1QSYA 5BXIA 3JAMU 3R5CA 4RNHA 1Q16B 2WB4A 2KXHA 1FXDA 4QJVA 5D15A 5LT5A 1P9YA 3GILA 4FXWA 2OEMA 5CCMA 3AOCA 2DNZA 3M2UA 4JI2F 1GX5A 1KOHA 1FRKA 2ZDOA 3JSMA 3NCQA 3FDSA 5CABA 2K2PA 1ZH5A 4CLKA 3TZYA 3TVYA 1Z1ZA 2N4CA 3FZBA 3WX4A 3KLHA 1HMVB 1YVFA 2YNGA 4Q8FA 3A8IA 3CC4S 2DNHA 5I42A 1UJ6A 3L3CA 1YG0A 2VBYA 1P1TA 1JLEB 3MM8B 1NDPA 3JXOA 2CRLA 2D9OA 1JJ2R 4I1TA 3BN7A 1UVJA 2HFUA 4UOHA 4YDXA 4B17A 4RW4A 4I67A 5AJ3J 3DOMA 2BM0A 4USWA 2ZZNA 4MT1A 3MCNA 3K0JA 1ZZFA 5C24B 2B7CB 3MPDA 3EWGA 1X5TA 2B6AB 3S8SA 2F63A 1VQ8S 1Q7LB 4ED6A 2OD4A 4FN5A 1NRKA 1VC0A 1QAIA 3R8YA 4DR5J 1RZMA 2VICA 4OX6A 4EFAC 2QLJB 1RTDA 3DLEB 3I0SA 1SUQA 2CQIA 1WWHA 2ZKTA 2OLWA 4IDKB 5I3PA 1I5OB 1IN0A 4N77A 1FDAA 2IA0A 5DZ6A 1K0VA 3MTJA 1S0VA 4PKDB 1RABB 4HH0A 5E3CA 4TXSA 2VA3A 2CNLB 3ELHA 2M70A 3N01A 3UVJB 1IKVA 2L9NA 2R7OA 4GKJJ 2CXEA 1RI7A 2AHOB 4P2MA 1XMQJ 5LM7E 2HVDA 3MCOA 1N36F 2AJQA 1FKPB 2IJFA 5J2MA 1EIYB 4LSLA 1HQEB 1RWWB 3R5BA 3KK3A 3IWLA 2MZRA 1T02A 2C3OA 1E6YB 4TYBA 1NNDA 1BQXA 1P6TA 5CYMA 3ETMA 1WEXA 3NMAA 1B4SA 1N8RT 3QAEA 2R2TA 5EGYA 1HNWF 2PO4A 2VQFJ 1WDTA 3VGTA 2OPSB 2YQ3A 1BHNA 1FDDA 4IH6A 1ZAVA 1WHXA 2B8QA 4DLGA 2DH7A 4NASA 1MWQA 1SKWA 3HZEA 4H4OA 3NXZA 2JNJA 1NH7A 4GRSA 3IAS9 2HZCA 2HHHF 3J81Y 1AFIA 5HO4A 1S79A 1T03A 2QSWA 1ZTTA 5E5NA 2A6OA 4I4BA 2E5IA 2XMWA 3K5LA 2WOMB 4HHJA 4QR1A 5D78A 1WJ9A 1LNQA 4RBTA 2BXJA 1U6BA 2BEFA 4OMFG 2MZJA 4PYDA 3OJSA 4RUAA 3K5NA 2RQ4A 3PW4A 2PI4A 1BY9A 4KV8B 4RKUC 3PFOA 2HNYB 1RWVB 4DN9A 3IWXA 4DG1B 2IPOB 2R3VA 2EK1A 4UZBA 4ZPCA 1YI2S 2R8HA 3MM7A 4LSZB 3MMJA 2FVPA 4YR2A 3G86A 2V63A 4DPUA 4NLVA 2K7JA 1D0EA 3SEOA 1UCNA 1FFSB 3T1YF 3MOZA 1WC1A 4QYZJ 2PD1A 1EP4B 4ZPWR 3CC7S 1OSDA 1IWAA 4KE5A 1JLBB 1EB0A 4Y28C 2W01A 4LBIA 4LRCA 2HHHJ 4ECUA 4Z7YA 2VU5A 5EX0A 1SJQA 2FDNA 1J2VA 5I3UB 1RACB 2QV6A 4WCEQ 2PMHA 3GU0A 3QT6A 3TJ8A 1U1KA 2GIFA 2YWGA 2H1YA 2GJIA 3AHPA 4KBIA 2XC9A 1EETB 2DEIA 2EWHA 1OWXA 2DHHA 4IRCA 2W24A 3R97A 2OH2A 1IQTA 1FO1A 2KYZA 5KG7A 3VAFA 1VC6A 1UW9A 2E5JA 1NU4A 1JX4A 4RNOA 3NBPA 1NHVA 5C42B 3HO1A 9RUBA 4E8UA 2BQRA 2UUBF 1FTRA 3ZTQA 5IQQA 1FFWB 3PZPA 4NLPA 3CMES 3LP0B 1NSPA 5A6WA 2CQGA 2IJRA 1Y4ZB 1DTQA 2X51A 2HFVA 4Y0FA 1YBUA 3Q8RB 3T1YJ 3GFZA 1SL1A 4OQJA 2DEJA 2NPFA 3C6UB 4LSNB 5A76A 4RWXA 4NLGA 2DIUA 2JEJA 3M8PA 3IS9A 1WHYA 2V5HG 2RRNA 1MMNA 2UU9F 3KLFB 1K47A 2O01C 2KVQE 2P6TA 1FRMA 4EZ9A 3OHBA 2VC1A 2KXFA 4P2XA 1AXQA 7FD1A 4NMXA 4ZVQB 3AOAA 2XMAA 1TL7A 3M6XA 2AP6A 3PO5A 1VBXA 4B3SJ 1E6VA 1K8AT 3N79A 2LXUA 1TL3A 1ZZNA 4X4UA 2VV5A 1DTTB 4N7TA 2V9KA 3BS9A 4LF9J 4F4KA 1U4BA 1F5CA 3HVAA 3ZZUA 3Q86A 3Q24A 2WW8A 4OYAA 4U96A 4WF9Q 5GAGI 2PEBA 4PG6A 2UUBJ 1S6PB 4J9VA 2DGUA 1F5AA 2IRUA 3AD9C 2MDAA 3QWUA 4I0WA 2MKCA 2ACMA 1U48A 3TJAA 2CWXA 2DISA 2J9EA 4QW9A 4ECYA 4CP5A 2MQPA 2WVEA 4CNYA 3QLHA 4FVCA 5FIIA 1RTJB 4R0JA 3EVMA 3MWBA 5B08A 1RAOA 2HVIA 4B02A 1OO0B 4PRFA 2KB2A 2ZITA 4JI3F 4KSEB 2GJFA 5AXNA 1BQNB 2ZKUA 1UVIA 4OJHA 1OY8A 2EFNA 3OTCA 3C66A 3BO4A 3MM9A 2CPYA 1Q0NA 4F8RA 4LFAF 1SBRA 3A1YG 1UJ5A 1N6QA 2ZZMA 3RW6A 3JSMB 1RISA 1P9QC 4V19J 1RT5A 3W60A 3CIMA 3HFVA 4DSFA 2B3TB 3FGVA 4OHZA 1LFPA 4I2PA 3KLHB 3B4DA 3TX0A 4KR0B 2OGUA 2RB7A 1IM6A 3TUZC 3DRRA 4F7VA 1MWYA 2R8IA 1SCJB 1UWBB 3MMBB 3A4TA 2YXLA 4O4GA 4NLRA 1RKJA 2VQEF 2KN4A 3H4DA 3GSDA 1IXKA 4I68A 1RTZA 3AJ2A 4JI8F 4LVOP 4C3MA 1IKYA 5KFUA 3C2PA 2VZ9A 4NLYA 2GIRA 1RLDA 3EGZA 4NA3A 5KFSA 2HS4A 2PIIA 2B4VA 1J27A 1FD8A 1M1KT 2N82B 3UO0A 2RF2A 2Z56B 4B3RF 4JP8A 1R6YA 4DPYA 4JI3J 3KJVB 1NKCA 4OI0A 5F3TA 2CZ4A 4TKTA 3GPAA 1RTDB 2IY5B 3J7A1 2X1AA 2G1DA 3ENAA 3LUYA 3RR7A 2WONB 2PMWA 3BJYA 3MM5B 1OY6A 3IXQA 2GHWA 3M8QB 5D4NA 3L9ZA 2DTJA 1Z2LA 2HQCA 4JI0F 1VBYA 4ZMMA 4YMEA 4ANEA 1HWUA 4HEA9 5IM0A 1RHKB 4LF6F 4OHVA 1K1SA 2FD2A 1K73T 5IZHA 3D28A 4KB7A 2BKNA 4OJ3A 4QR2A 4GMKA 2KH9A 3LA0A 1EAYC 4KHPF 3P49B 1HHSA 4F50A 1LWCA 1BE4A 4IH5A 2LP4A 3M30B 4DSLA 5J2MB 4JI8J 1WTBA 1I3OB 5IT9U 3Q8VA 2E29A 2VFUA 5AE1A 3VF0B 5CYMB 4F2SA 1RT4A 2IAJB 4J91A 3Q0AA 3JAMY 4MKYA 3FEZA 2O1PA 3QT5A 2ZM6J 1IKWA 1KD1T 3V2UC 4B3RJ 3FUYA 3IP0A 2OPPB 2MQ8A 1QUPA 1LWXA 1VBKA 4Y3CA 2ZHBA 1WG4A 3CCMS 4OHWA 5EWFA 2QEXS 1CJTA 2UVWA 2LMIA 1D8ZA 2V67A 5J1EA 2W9BA 2DK2A 1YLXA 4NYZA 4N47A 3TAPA 3FFIB 3C6TA 1UZHA 2GS8A 4KHMA 3OLBA 3OFFA 1WG5A 4R8UB 2ASLA 2MEWA 3JSBA 4EEYA 2ILZA 2QMXA 2JZ5A 2YX1A 4RW7A 4XK8C 2DJWA 4M1KA 5D77A 2E9ZA 3US5A 3DU6A 1IBCB 4FF3A 3JB9k 2EFGA 4DR4F 1V3RA 4K2XA 2BM1A 3BF4A 2W9AA 1M90T 2VH7A 2QT7A 3PHTA 3BBCA 3BH7B 1HW8A 1IWGA 2OAUA 2Y8WA 5IV4A 3FQKA 2I5JB 1HYSA 3I96A 2DHGA 1FJEB 4P74A 1GTEA 2IYIA 2W7AA 4AL7A 3KYLA 2J5AA 2CWKA 1TUGB 3KLVA 3B82A 2XYPB 3I5AA 2EBGA 1Y5IB 2KRBA 2ROGA 5D0RA 3LPYA 2MKSA 5KG0A 4X62F 2XMUA 3PCOB 4IR9A 1Q86T 4I6AA 3V4MA 4DBQA 1Y0HA 3TQEA 1IBLJ 2KG0A 4DUZF 3MMAB 1HNXJ 3BKUA 2AT1B 4DF8A 3DU5A 1S5ZA 4NOHA 2UXBF 4NZ7A 5HVGA 1Y10A 2HGMA 3IA0A 2M4MA 1JQGA 4J9MA 2J7WA 4AD6A 3NCPA 3SFGA 2CQ4A 2APOA 1LK5A 1XNQF 2WSFC 5HVFA 2CADA 4DPWA 3MEGB 4A8QA 4OFZA 4G1PA 2AYBA 3CCLS 3NAHA 3DGPA 4DEZA 1T3NA 1N33F 3I0RA 3K5OA 4NLXA 5L9NA 4F3OA 4V19X 4WP3A 2E9RX 4OX8A 1M1HA 2HEKA 5L39A 2ZH3A 3PM9A 4X62J 3QZ7A 2QA4G 4ZHRA 3GG1A 1JLAB 4DFJA 3A3PB 1V5IB 5D4PA 4OHYA 2UVUA 4WYWA 1AFJA 2HAIA 1NDLA 1RAEB 3DXBA 2FHJA 4AXIA 4MKAA 3QJLA 2O3DA 3IS9B 1M0SA 5A8WA 4RBUA 4OHXA 3OFEA 4PCQA 2UXBJ 2C2NA 1OQ6A 1PBAA 4WIQA 4EO6A 2AU0A 4I2QB 2DGVA 4ZVSB 2JWNA 4WXWA 2MZQA 1LV5A 3CGIA 3OXFA 1S9GB 3MUMP 3BPDA 2CIMA 5RUBA 1NJYA 4B3OB 1DFDA 3W1YC 2V8DA 4IYQA 4LF5F 2BQUA 3M9MB 4ED1A 3FC9A 1F2GA 4DF4A 5KG3A 2GZOA 2DNPA 1N33J 4OI3A 3GV8B 2FLPA 2OSQA 2DGWA 3PIPQ 3W9HA 4DV6F 2CPXA 1VQMS 2VL1A 2BANA 4LREA 1WKLA 2FYXA 1FK9B 3F56A 3UNYA 2UXDF 4NCAA 4NCGA 1JKHA 4JYAJ 2JSXA 4DJBA 4OV1A 3VCDA 5DDOC 4GC7A 3QJJA 1TFWA 3U1MA 3ZNJ1 1SV5A 4QIFA 3GJSB 5A8KA 3OHAA 2J0SD 1RT3A 2Y0SD 1YZ7A 1XIQA 4MH8A 1NSAA 2VOPA 1FTCA 2XBPA 1OPIA 3N5BA 2V6AA 4UOGA 2X1FA 1O51A 4DR6J 1S49A 3I32A 2AGQA 3UDVA 2CUYA 2DGXA 3W5XA 1T05B 4C8KA 4OX9F 5L38A 4L73A 3Q8UA 2BE7D 1OSCA 2R7UA 1U25A 4NI2A 3OBIA 2R7RA 3O1LA 3MM9B 3GR1A 2IHR1 2RE1A 5D8HB 5K8PA 4CDIA 3SCLE 1N6QB 4ZCKA 2HIQA 1G6BA 1RT5B 3KNAA 3H42A 3IGNA 3D3CJ 1WG1A 1FJGJ 2VD3A 3EX7B 3EZUA 1PG5B 5HQMA 2HVEA 2K3KA 1J5OA 3BR9A 4LF5J 4KH1B 3DRRB 4CIOA 1PAUB 1BXNA 4G1QA 1KC8T 3EDRB 1OPZA 3D2WA 4ES1A 2O67A 4F0HA 4UF4A 4DV6J 3TQ1A 2RU3A 5KFPA 2HHSA 3HF5A 4DQQA 2DKOB 1AT1B 4C8OA 1RWKB 1R8CA 2CZ9A 2Q6BA 1WOOA 1TKXA 3D67A 1RDRA 2JL9A 1NPRA 1WEYA 1YITS 3HFKA 2HNDA 2WW4A 1URRA 2CA9A 2QC3A 4CLWA 3H40A 1CJKB 2HS3A 3MECA 2R8GA 4O44A 4Q2LA 4OX9J 2IMWP 1HR0F 2KHCA 2JLEA 2W2QP 5EX3A 3KMQA 3N9UC 2I8EA 4RBVA 3GR0A 4KC5A 5DQHA 3NY0A 1NK0A 1QAJA 2ZH8A 3KHGA 2IVYA 3UFCX 2DVIA 1N5QA 3OXGA 1RAJA 4EBCA 4WU3A 1X5SA 1YRUA 2CQPA 4L3KA 3NAIA 1KP6A 1B3TA 3HHLD 1UZDA 3O5TB 4Y65A 4YOEA 4R0EA 2QFJA 3O44A 2UXCJ 4J9OA 2CQ3A 3TUPA 2VFRA 5DDPC 4O4RA 2V2KA 2XNRA 3HVTB 4FS1A 3ITHA 2JEGA 1X4EA 4X66F 1VJQA 5F8MA 5F8HA 1C4AA 1RT4B 4ES3A 3PIOQ 4A8OA 2DNOA 1TVRB 1D3WA 3SDEA 4QIWD 4I7FB 1RU1A 1S6QA 2JH3A 3C15A 4CI0B 2GX8A 2IJNA 1FJ7A 2ASDA 1P27B 4Z7CA 2OPRA 2ATLA 3POTB 1T95A 2V4JA 4X84A 5KFJA 3HSJA 3C6TB 4FPRA 1FF2A 4RUBA 2WCXA 3QO9A 3FMBA 3SQOP 1TU0B 1M5OC 2ZBIA 2PMZD 4P2SA 4RW7B 4DV3J 1YWXA 5DDRC 3DM2B 2AIRB 1BD6A 2YKNA 4N8OA 3BSAA 1G7CB 4P10A 5FJ4A 5K8NA 5IV3A 4LFCJ 5GAHU 4XTTA 2QL7B 2OMLA 5M2RA 1B64A 1Y5NB 4URQU 3MR7A 5A0YB 3KG1A 1K44A 5HP1B 2WRMA 4K4UA 3JTPA 2CG8A 1SIWB 2MQNA 5F0UA 1UKUA 3AJDA 3PR5B 1HNZJ 2L9DA 1KEKA 3HM9A 5ADZA 4M5IA 4YDDB 1G2EA 2F3JA 1JWWA 4C11B 1F3FA 3GCXP 3AD8C 2AZ3A 3LH2S 4C0BA 4LBPA 2B4OA 3ETOA 4IG0A 1PIEA 3RB0A 5HMZA 1BQMA 3VAHA 3EUNA 4FP9A 3HHLA 2ROPA 4DQRA 1XERA 5EN1A 4JV2A 3Q8SB 1ZM9A 2RUSA 4DDFA 3PX0A 3ZNUA 1VLOA 4TLRA 1U7LA 1YRTA 3LP1B 4DX8H 2K3IA 3IG1A 4I6WA 2J0QD 2EG2A 2PE8A 2A3JA 3G2XA 3DLLQ 1FJCA 1YTYA 3PNIA 3D4JA 4M8LA 1FKOA 3DHWC 3M2RB 1U26A 3E2EA 2A2DA 4DQPA 4LUBA 1KHWA 4J9UE 3FCWA 3CSKA 5IT9Y 1ZA2B 1FI4A 1YHQS 1T8EA 1WTFA 3V81A 4PR6A 1BC6A 4OZ0A 4RLEA 3MR6A 4MMOA 4QU6A 2JJ4D 1VQNS 2YKPA 4DX6A 3T1AA 3ET6A 1EQ0A 3VVTA 5G0RA 4IOAQ 3LAMA 5AE2A 1AZSB 4OI6A 1C0TA 1H74A 4EYHB 3DI6B 2EG1A 3KJNB 1VYAA 4OLOA 5KFCA 2HS0A 3LANA 4B9VA 6FDRA 1IKXB 2AGPA 3T1HJ 4TQSA 1RWOB 4G6VB 4NLTA 4JBCA 1X7VA 1KWMA 5F8NA 5B7WA 1SPBP 3HHNB 1PBUA 2HRUA 2I9SA 3MR2A 3NGKA 3BGRA 4TLQA 2AKWB 1LKZA 2AEJA 1PYSB 3MHYA 1KLNA 2EKYA 2OI2A 2QJ3A 3N6NA 3Q22A 4ETXA 3CC2S 3H5SA 5B0DA 4OZ5A 2VJUA 2QSFA 1AW0A 4DFMA 4ZVPB 1K9MT 4U8YA 2FHOB 5A8RB 1RCOB 3AH6A 5KOXA 3TARA 1CC7A 3VHQA 4OYZA 4PABA 5KT2A 5C2GA 3M2VA 3BDPA 1N54B 4MIAA 2QL5B 2P9EA 4FPIA 1S1VA 4MKBA 3R2DJ 3RAXA 1R0AA 1FRIA 1TKZB 3MEEB 4P52A 4UW2A 2YPYA 1U1MA 3AAWB 1F9EB 1ACMB 6FD1A 1PKUA 4OYMA 1S1WA 5KT7A 3G96A 1UMJA 3GP9A 2EFVA 1RT3B 3KMSA 2DNYA 3P3DA 2XB2D 4ED4A 3DOLA 2DGQA 3TA0A 4OI1A 4KYZA 3OW2R 2HHTA 4DL7A 1VFJA 4PXDA 4C9DA 2L9WA 2R2SA 2J6SA 3SMZA 3W5YA 1WOSA 4NI2B 5L1IA 3MF5A 4ZN3A 2HHPA 2GV1A 2CJQA 3D1QA 1CULA 3H20A 2VG6B 1LWEB 4PZVA 2A18A 3GFXA 3RJMB 1S59A 2PA3A 5JXSA 2GQCA 4JI1F 3W66A 2BMBA 2M5YA 1F3VA 1M5SA 3BPSP 1R6VA 1J5OB 4XAKA 2YVSA 4EU0A 5KG1A 5F0WA 4RUCA 3M6VA 3ENWA 3K57A 1V3SA 3SCIE 3S6EA 3RRKA 9ATCB 4FYWB 1GAOA 3G82A 3PEJA 3A12A 1TKXB 1RBLA 1LWFA 1K1QA 2U2FA 5KFOA 4CLSA 2OMOA 4USJC 2NREA 5T41A 2YKQA 2E5LJ 1IJFB 3OV7A 1WC0A 5H9FJ 3W65A 4FYYB 3KJQB 1C1BA 2N3LA 4ER8A 1QY7A 2ZJPQ 2U1AA 4ZCMA 1UL3A 3N6MA 4ZJQA 3MECB 1FT8A 4UT4A 1LK7A 4K4TA 3DNCA 1MG7A 1RADB 2ZVSA 3T9ZA 3VAGA 4A8XA 5AXLA 3K58A 2FQQB 3BYPA 3G71S 1RYRA 5JMNA 5GAEI 1S1UA 1HFEL 4TY9A 1YJVA 2DCLA 3TANA 3M6UA 1LW0A 5B0CA 3BGOP 4C97A 3DRPA 3N28A 3FEXB 4DPTA 4JI1J 2QIFA 1X9SA 2XMMA 2V2QA 4MFBB 2HNZB 2ZOFA 4PG8A 1REVA 1SQFA 1FA0A 2W8KA 2BE9B 5DO2A 4DR7J 1XBWA 1X4AA 4I56A 5F3ZA 3PJXA 2LQ8A 4C3LA 1ZTWA 4EZ6A 2CNOB 1JNRB 2B9WA 1U09A 3EVOA 1YJNS 4CH1A 5IS2A 3G6YA 4KHRA 1TL5A 4UUXA 1KVIA 2B5JA 2B43A 3PVXA 3W5ZA 1KQGB 2HW3A 2KRRA 1TK5A 4JV5F 4DL2A 3VTIA 2B56A 3HVRA 4B9LA 2ZC4A 4JI4F 2DPIA 2MB0B 4DQSA 2ZD1B 3GTYX 3W63A 3J7YI 2R7VA 1RWXB 4WYLA 2ZUAA 4CTAA 3UN5A 3R5AA 2EC2A 1RHQB 4A8KA 3MEKA 4ENOA 1ITPA 2N7CA 4GKKF 2R42A 1VRTA 4MK7A 2M8HA 2G2OA 2HFZA 2MJUA 2V4JB 5AXMA 4LF4J 1VRQC 3OSPA 2NYHA 3QO9B 1RHMB 1L3VA 2ATCB 3QIPB 1HBOA 5KFNA 4G1IA 1S0OA 4ILLA 4HT5A 4CLTA 5I3QA 3VALA 1HBMA 3DDIA 4MK8A 3I31A 3HT3A 2CPJA 3FNNA 4D3GA 2V2VA 3NNHA 4CM0A 3NS6A 4ZVTB 3T9NA 3A8EA 5A2QU 3CCJS 3UW1A 2XYHB 2ALZA 1NK9A 4AQYJ 1D9DA 4LQ3A 5HAOA 1TKTB 1FE4A 2AJ1A 2VPZB 3KUGA 1AA1B 3HPOA 2DNLA 2OTLS 5IOLA 4LFBJ 3GJTB 2BR0A 1WSRA 4KKOA 4ZP7A 2J0XA 4ZPTR 3OJUA 2M9KA 4ZKAA 1BQMB 1S77D 1VK8A 3HJFA 4ZS6A 4GKKJ 1RLCL 2Y1LB 1C0UA 5ETNA 1SQGA 2DO0A 2E7XA 4NEYA 5DM7Q 4OLPA 4WU2A 4FS2A 3JYTA 4DR2F 1RT6B 2G13A 2HSEB 1DARA 3UN2A 4ZP6A 4RW8A 1VCTA 3IG1B 4NRTA 2DBBA 2HK2A 4RW6A 3LAKA 4WZQA 4HH1A 3MUTP 2BJ1A 4U8VA 1UA1A 1H2TZ 4CLLA 4LF8F 3L7PA 2IFXA 3H25A 4DUTA 1Y7PA 4A4JA 3C16A 2B4UA 2CJ9A 4YB5A 2HQFA 2G1HA 3LP2A 4IRDA 3TNVA 1FX4A 3MMCA 5DRKA 3KLGB 1RT1A 4YN3B 2DNKA 2L08A 3WC2A 4FKYA 2KG1A 4IR1A 3R6GB 2MKHA 2R4FA 3OFHA 1VJWA 3DLKB 1QAXA 1MMDA 2VPYB 3RYLA 2H4YB 2I6WA 2ZJQQ 4N41A 1HI8A 3ET6B 4LRBA 5FDLA 1RCXB 3BH6B 2HPUA 2PFDA 1C0TB 4O23A 1TP7A 2KTQA 1WF0A 2OFGX 1O6XA 4F4WA 2GO9A 2A2CA 5K8MA 1BMQB 2P9GA 1HPZB 3CWJA 2KVIA 4ZK7M 1JXEA 2C42A 2LA4A 1FX2A 3IBWA 2HFNA 5CYQB 2FVRA 2ZH2A 3QT8A 1NB7A 5F9LA 3E01A 3ZTRA 3PTWA 2J6UA 2NXUA 1X5OA 1U0HA 2KKHA 4J9PA 4LF8J 5AXKA 2D69A 2WSCC 3D0GE 3PY8A 1HNVA 3CEDA 2DXFA 4WPAA 4M5GA 3QZ8A 4FXDA 4IG3A 3NGUA 1U1RA 1OYDA 1S0MA 3MPVA 5CD4H 2HMIA 3U7JA 4ED7A 5C7PA 5HBMA 1UVLA 1U49A 2RH3A 4AXJA 1Y3JA 1K0TA 4LR9A 4IFYB 2C3YA 1S57A 5K8OA 2PT0A 3R7SB 2GVDA 2J8SA 3S1TA 5LMNJ 4USIA 1C1CA 3BN4A 4RX6A 4DV7J 3GMGA 4EYIB 4OIXA 2B0GA 2HG4A 2CJYB 3UR3C 4WWSA 3H5YA 1HL6A 3T41A 3PG9A 1ZETA 4FVMA 4WIIA 4X4NA 5J2QA 4X64F 1RT7B 4P6QA 1WACA 3CD6S 3KLEA 3DMJB 1Q8KA 1QVFR 2FJAB 2DH8A 4KAIA 4LF7J 3ILIA 1EZZB 3QGPA 4YR0A 4ILRA 3MOJB 1L3KA 1WC4A 4K4YA 1YJ9S 5ETLA 3HD2A 1HNIA 1U6ZA 4GVBA 4B3TF 1VGYA 2OD6A 2XZTB 1OY9A 5L8RC 4DSKA 1X9WA 3W2WA 3IC1A 5FLXU 2XQCA 2AGOA 2BQ3A 3C14B 2VDHA 2DR6A 3ZFVA 2GCFA 1S9EA 3B4MA 4P71A 2XHCA 2PFFB 3PW7A 3OUYA 1H3DA 2EPIA 4DZ6A 2VF3A 3MAAA 5HVHA 3T6JA 2KM8C 2FJXA 3M8ZA 2COLA 4DV2F 4NE9C 2P9CA 2Z0GA 1VQ5S 4EMDA 1PO6A 2GVZB 2B9YA 2C2DA 1FVSA 1QSSA 4QWBA 2Y1IA 2UUAJ 2DNGA 4F36A 2BJ3A 5T7LA 3KK2B 2CDQA 1Q4RA 2AWZA 2IDEA 1KSPA 2RHSB 2CQ1A 2XMJA 3SCJE 1S1UB 4B9NA 1RT2A 1U1NA 1LW0B 5KG4A 3GIMA 2QLWA 1WKKA 4PAAA 1DJ0A 2YKAA 1SIZA 4BWMA 3QPIA 1JIHA 1RU2A 2BA9A 4M5KA 3T19A 1JLGB 1YGYA 2XULA 3V5RA 2FUG9 3WDOA 3LGMA 4FF1A 1NO8A 1U2RA 4KO0A 3IRXB 2B5JB 5GVQA 2X3GA 3D68A 1QTMA 2IBKA 2ZOGA 3F73A 2BJ8A 2Z8QA 4WKYA 2ZC3A 2F4VJ 2AJ0A 4OJ1A 4ECTA 4RU9A 2NXEA 2L3MA 5D4OA 4ZP8A 3S01A 1N48A 3MURP 4J9NA 1UJ4A 4Q7AA 4H4MA 2RKIB 3QWPA 5J2NA 2EVZA 3JTOA 4CM2A 2H5EA 4CLPA 3BBFA 3B78A 3TWZA 2F8EX 1U8SA 2QLBB 1MMLA 1RHRB 4BLGA 2XMVA 1S9FA 2NUUG 4ZIVA 3MM6B 4OJGA 1JK9B 1DHMA 1VBZA 1KTQA 4JI6F 4Q44A 2KFZA 1UEUA 2YNIA 3R3TA 2P8IA 1RKIA 3VAMA 4AYBD 1X5PA 1Q8LA 5ETMA 3ULHA 2LA6A 3PDNA 1ICEB 3J81j 1X4GA 4HACB 2HIYA 1KLMA 1RHJB 1U47A 3WX8A 3RBEA 4OYWA 1HQUB 3SI8A 4JI7J 1RTHA 5KFFA 5DQGA 1T3OA 5HMYA 2HBYB 4QWCA 3CCSS 3FCHA 2EK6A 1S6OA 3O3LA 2XY6A 4I64A 3M32B 3M7VA 5AJ3F 3UQSA 1A7GE 4HR2A 4YS2A 2I1RA 2ROEA 2V4RA 2QFIA 1LW2B 4DFKA 3P5BP 4RZRA 1NK8A 2MZTA 2FC8A 1CLFA 1DQ9A 4EBDA 3WC0A 2YNHB 4J90A 4JI6J 2E1RA 1NK7A 4HKQA 3NGDA 3OL7A 4Q0BA 4DR5F 1HW9A 5C25A 2LQ9A 4D3HA 1RAIB 2FVQA 3CD0A 4YR3A 4JOUA 1QJHA 1YJTA 3W2VA 2E66A 2QL9B 1VI7A 5AE3A 3BQ1A 3LP2B 2UVRA 3JQMA 2R7WA 3DLGA 4L72B 3PRBA 1FKAF 4LQ9A 2RS8A 5F8GA 1HBUA 1N5YA 3G8QA 4GKJF 3WIVA 3NGSA 1RP5A 2MHEA 2RS2A 1BLUA 1H73A 3KK1B 2GA7A 1M5KC 4LMZA 1XMQF 2BDPA 1RQ0A 4DR3J 2KZMA 3OR1A 3MPUB 5L1JA 4YUDA 2WB1D 5IFMA 1Z2ZA 1BGXT 1VMBA 4DSIA 1RXOB 3N4WA 3NS7B 4U95A 1J5EJ 4IFVA 3CO0P 4U9RA 4RO0A 1W2BR 1UVNA 3JSYA 3CJ3A 1JLQA 3ZXWA 2VQFF 2VFSA 5C2CA 3QRQA 3CCES 4FYDA 2VFVA 2V8GA 4YP3A 5E2QA 4DSJA 1EKRA 1ZPVA 4NLQA 4LR8A 5LXRA 2GIQA 2MHNA 2HGLA 1L5UA 2KYXA 3R6LB 2QLXA 3VVUA 3D66A 4F26A 4KH0B 3LWMA 2RT3A 1VQ4S 5EUHA 4CYUA 1SJRA 1F6TA 5HMXA 3H2LA 5HROA 4DQIA 1XJWB 4WK3A 2FZKB 4K0KJ 4K4XA 5A2QY 3D3BJ 2GMJA 4A8WA 2DYAA 3HHLC 2XS5A 1CPZA 2R2RA 1PC5A 2HFSA 4DV0F 3PO4A 3MFHA 1WC3A 1JLCA 1VQLS 5HQLA 2XSJA 2ZE2A 3NG8A 2R7TA 4A8SA 1UEKA 4W4MA 3HK2A 1HHTP 1WHWA 2HGNA 3A3NB 1S7IA 3H98A 4F0MA 2R8KA 2NYIA 3OPKA 2RQCA 1GX6A 3M1VB 3V4IA 2VONA 3EE3A 2BJ7A 2NZCA 1D9FA 5KFTA 2NXJA 1S97A 1B0PA 3Q2TC 1VRUB 5D3GA 4DWIA 1TL1A 3T5JA 3EPGA 3HFZB 4YHHF 2Q43A 2FLLA 4O3RA 3CUNA 2B4PA 2AJFE 4ZVRB 4JV1A 1SB6A 3FZ2A 5LJ5Y 1XR6A 3IRWP 1X31C 5KG5A 4X4OA 4BDPA 4PUOA 2X3DA 4ECXA 4DV0J 4DL4A 2N3OA 3PJ9A 1GT8A 1UFWA 1GNKA 2FJVA 2E9TA 2DR9A 5ETVA 2UP1A 2B51A 1NAQA 4USUA 1WELA 3MAAB 3L09A 4LIWA 1JLFA 2J6TA 1H72C 4CO1A 1CBKA 1NEEA 3D5MA 4O0IA 2HZVA 3K8VA 5E33A 4X65F 2GW8A 2BE2A 1Y9OA 4DCOB 2IM0A 2J76E 1MNEA 4NZ0A 3SQGA 2FIUA 2L48A 4DV5F 1R7IA 5T7LB 3ZTPA 1MU2B 5HLFA 4XPCA 4J5OA 3F41A 3PHEA 2EEYA 2CJAA 4Q5VA 2H4WB 2VG5A 2NSBA 2D74B 2LEAA 5ITHA 4EGLA 3TZZA 5D4LA 2GGPA 4FF4A 2R2UA 3PRVA 4ALZA 4YHHJ 3V6HA 4FF2A 4E2FB 3ZO7A 4IQMA 2V94A 1IJEB 3P6YC 4CO4A 4FYVB 1S1TB 1VK3A 4X4RA 2YWEA 2CPHA 4OV6A 3KUHA 2KO1A 4PPDA 3HX9A 2AJ4A 1XMBA 1MROB 1KQSR 1N88A 2Z2MA 4O0NA 4WE1A 3W8PA 2YBVA 4B3SF 3QNWB 3W9JA 1MLAA 1R8PA 3OL8A 2ZH4A 4K5SA 3M8SA 3Q8YA 2OTJS 4NRUA 4Q45A 5J1PA 4IH7A 3G8SA 2ZH7A 3D1HA 4LF9F 1IVZA 3J80U 5KFYA 2OEKA 3RGIA 1SC3B 3O2IA 4ZLNA 1WHVA 5KFZA 1KQFB 3UN3A 4X65J 3ENVA 3OTEA 2ABYA 2FHKA 3DRSA 4HHUA 2ZZTA 3IR6B 5I4MA 3H4BA 3NGRA 4DV5J 3KDNA 3CJ5A 1SH3A 1AB8A 2IRYA 1CJVB 1X8DA 1CJUA 2FGOA 3ILLA 4ICLA 4ANCA 2D1CA 1NK4A 4QWEA 3D0IE 3AA9A 4IUFA 3OVBA 4YB7A 3V6KA 4PQUB 2M88A 4NXNJ 2E5HA 2DHXA 3K8WA 1QDUB 3CCUS 2P5VA 5FLXY 4PWDB 2DRAA 4Z37A 2IC3B 1RTIB 5CYJA 2WK4A 3THPA 3R5GA 3TAMB 4NLSA 4PG7A 3W62A 4UQGA 2A10A 2FLOA 1S6UA 4KJIA 1KTVA 1OJ4A 3MUVP 3J7YU 3KUEA 1HMVA 2B9EA 2QLFB 3LTOA 3TA2A 3UCZP 2MY7A 3R9LA 2R7SA 4UUWA 4R5PB 3UE2A 3V6DB 3R1LA 2BRLA 5SZTA 3MM8A 5K20B 3N5FA 4Y34A 2XNQA 3HHKA 1HQ2A 1PC4A 2DCUB 3AFGA 8ATCB 3K2YA 3T5KA 3T5HA 2YNFA 3W8GA 2PEHA 4UOFA 4QCLA 5C24A 3HJVA 1B70B 2B6AA 2YKMA 4WFNQ 2MJNA 2J9DA 1GQEA 3HI9A 3NP5A 2ZDPA 4ZVHA 2FJBB 2Q79A 1S4FA 5DGBA 2ZHAA 3ZZPA 3IN5A 5LL6d 1URNA 5DM6Q 4ZCLA 5IXUA 3H8YA 4U7UD 3DLEA 2ZWOA 3TO8A 5ETQA 3M2UB 4IDKA 3ZTSA 3TEGA 1FD2A 2Z2YB 2XGPA 1NDKA 2ASJA 1Q8IA 4DV4J 4KGVB 1SL2A 1I6JA 3UCUP 7AT1B 3O8WA 3IM9A 1I94J 1LXNA 2E5GA 2B9XA 4EWTA 4OZ3A 2YNGB 5HJYA 3BM7A 3RBDA 2CVEA 1VQYA 3Q23A 2LFVA 2P2CB 5I42B 3P8BB 1N5YB 2D3ZA 2V8HA 2XLJA 3UVJA 4IOBA 3I55S 3M9OB 4XO0A 4KPYA 2EFQA 3ZZRA 4RW4B 2FGCA 1N5SA 4LRDA 2NLWA 1NSQA 3DOMB 5E0OA 4S0MA 2MGZA 1BUXA 1RAHB 4M5LA 3A8JA 1H2VZ 1VQPS 2ZJRQ 1FKPA 2C2EA 3CE8A 1IBMJ 4HVZA 5HJXA 1HQEA 1YDLA 2E1PA 1Q7YT 4YY3J 5HK4A 2NS1B 2ZM6F 1X4HA 1GTHA 2LVWA 3CDWA 1NJXA 2Y9HA 3FJ2A 2W4DA 3QATA 1Y00A 2EC0A 3NL0A 1QE1A 4FDFA 3I0SB 1SUQB 2ILYA 2OPSA 4C8NA 3RW7A 1WOPA 3PXGa 2QRRA 4HI2A 2VG7A 3CDUA 1Y11A 4ZA1A 3O6QA 5B0EA 2ZBQA 3SXLA 1TV6A 2C1EB 4NA2A 2VPWB 3NGTA 3FVYA 2W8LA 2SXLA 1KFSA 4P7VA 1IKVB 4ECVA 1U0SA 3NS5A 4PG5A 4ELTA 3TRGA 3S7RA 2DB1A 5KFLA 3UDLA 3R7NB 2ZE2B 3K89A 1QVGR 4K2JA 4LIRA 2OHDA 4ITSA 2C22A 4LSLB 1F9FA 2PC6A 2XMTA 4KV8A 3KK3B 2CQHA 2G0CA 2HNYA 3FRYA 4DG1A 2H54B 3C46A 1RHUB 2YX4A 1QTNB 3V4IB 2BOAA 3FBBA 4EO8A 1SJ1A 3VQTA 5H9FK 3NMRA 4FXVA 1X4DA 4ECRA 1S7HA 4QZVB 4UQTA 4PG4A 3EPIA 5HSPA 1TFYA 2UV8G 1IBLF 3FBEA 3PYDA 1VISA 1HNXF 1T9TA 4H4OB 3CDAA 3IAM9 4Y6IA 1JLBA 3OL6A 4F3MA 2C3MA 3ADAC 3MPYA 4AL5A 1T03B 3PKYA 3OLAA 2CPEA 4URSA 2MSSA 3VGVA 3QJPA 1CS4A 1VDHA 2MLYA 4F2RA 5I3UA 1FRXA 1SKUB 1OQ3A 6AT1B 3BKTA 3K7RA 3PJWA 1FDNA 4F3QA 3FSIA 2LQJA 3BB5A 4MIBA 3TW0A 4KGMA 3UI3A 3R27A 2Y1RI 1CG2A 4QPTA 2N7YA 2G2YA 4YEAA 1FHTA 1EETA 2KT5A 2CQ2A 3WIUA 4Y00A 4U6PA 2CKWA 3OL9A 4ELUA 4KY3A 2WHOA 3P4UB 3NRBA 5C42A 1A6LA 3MM7B 2HURA 3GLJA 2K06A 3SQGB 2NXCA 1RUSA 3EMTA 5HLFB 4FBUA 3LP0A 4M5JA 1UW4A 2CJKA 4DR1J 2AW0A 4K59A 4BC7A 3QMQA 5KFKA 3TZWA 4M94A 1RWPB 2J7KA 3H7HB 2A0FB 3GQCA 5E41A 1ZAWA 1NBEB 2CJXB 3C6UA 4AT1B 2CNKB 4USMA 3L7OA 4LSNA 3DXSX 3D54A 3EGNA 3CCZA 2NSCA 2BBEA 3KLFA 2J0WA 5CAAA 3H2VE 5BYRA 1RYSA 4Q43A 3HSZA 4NXMJ 2QA4S 3HSGA 1T9YA 2BKPA 2XI2A 4KIAA 1N52B 4ZPBA 2L41A 2LEBA 3KOAA 2AYGA 2HRTA 3OT9A 2DY1A 5LSLA 2DXEA 3BGUA 1XMOJ 4DU7A 4DSEA 3VGSA 3NBPB 5KFAA 1N34J 2FHMA 4NYOA 5DG9A 4A8FA 5D6GA 1N32J 4C0OC 3IBCB 3JS9A 3T5LA 2MQOA 3RZAA 3RUBL 4MTPA 1S6PA 2JHEA 1DTQB 2VHGA 4HDGA 2DD8S 3CJ8A 3CCVS 4EBEA 4JYAF 2FTRA 4DLEA 4ECZA 3G6XA 3THVA 3IWNC 1IQZA 1VQSA 3B8HA 4U67Q 2WVBA 4JUZA 3I4HX 2Y8YA 4DCPB 1RTJA 3EYZA 1HHQA 3AB2B 4ED2A 3M8PB 3BO2A 1Q8BA 2OFHX 4DR6F 2Z2ZA 1PGZA 3PYEA 3FKBA 4C7QA 2V50A 4NZ6A 1BQNA 5D0HA 2FPHX 2ZUGA 2V4QA 1P8GA 1WEZA 4LF1A 3CCWA 4WKRA 1TL7B 2W4PA 1V6HA 2LQ5A 2DPJA 5IT0A 2FZCB 1E6VB 4K4WA 2DO4A 1YQHA 1FJGF 1WKJA 1TL3B 1TAUA 3LOUA 2AQ4A 1B0TA 4KT0C 1XTZA 1MW7A 3HXMA 2G9OA 3SSRA 5THWA 2C3UA 3DC2A 1RWMB 3RB4A 2JC0A 3CCQS 3LGNA 4M5DA 1UAWA 5DLFA 1D8YA 1UWBA 3MMBA 2HWHA 4ZN1A 3FSYA 2MKKA 4PXCA 1AUSL 5J1NA 1UEVA 2YNFB 1W26A 4ZOSA 4QR0A 2AYEA 3QLHB 5HMWA 5U47A 2DIVA 3UPFA 2W25A 2YKMB 5IT4A 3GIJA 3HD1A 2HQDA 2Y3YA 4ERDA 2MXYA 1Y5LB 3KXDA 3ZZ0A 2W2PP 1Q53A 2HLTA 3KJVA 4GO5X 2KJVA 2FC9A 2JX2A 2H51B 2LLZA 2WONA 3MM5A 2ADBA 4JI2J 4UY85 2P6SA 2KL8A 2LDYA 5ETKA 3M8QA 4C48A 1KNZA 2CPIA 4I2PB 1EARA 3CW2C 1UWAA 3EM1A 4CWBA 2FJWA 4A47A 4LT6A 1PSDA 4NA1A 3J80Y 2R7XA 2RDJA 2HHQA 2IMOA 2RDIA 2HK3A 3UD5A 2M7SA 4KRWA 4O4GB 5EHHA 1L3TA 2KU7A 2UXCF 1NDCA 2QN6B 2I0XA 4MJKA 2MGZB 2IM3A 1IKYB 2AD9A 3CDEA 3M30A 5L9XA 3CTRA 3A3OB 2OJ3A 3BQ2A 1LEOA 1R0CB 4ID5A 1D09B 3KG4A 3RU0A 3MGJA 5GAHI 3I87A 4LF2A 2IAJA 2RF2B 4OYBA 2JFKA 2DNNA 3N6LA 5FD1A 4WBFA 2DRBA 4IKAA 1CEZA 2C2OB 1Q95G 4YB1P 1QE1B 2OPPA 4OZJA 5LOQA 1O0PA 1WC6A 4LR7A 4UTGA 3QSYB 2ZHOA 2QA2A 2YKOA 2ACYA 1TQLA 3TAQA 1FNMA 2VG7B 1F0XA 3EZOA 1R31A 4K8RA 4WFYA 1TV6B 4O3PA 3FFIA 1EHWA 1FRJA 2JLGA 3SIPB 1KHVA 2MQMA 2V69A 3EGVA 5IM0B 2HBQB 1WDDA 2VBZA 3CT9A 3EGWB 4TU8A 3UWTA 4ZPAA 4CO2A 4NWBA 4R8UA 4DV3F 2HQ3A 1DZ5A 3AQPA 1H7XA 3CF5Q 3Q8QB 4WTYA 4XPEA 4RPFA 1PYOB 2IVMA 3PYFA 3K17A 1JB0C 4LFCF 2OELA 1LWCB 1YK9A 4RJVA 3BEGB 2XO6A 1N36J 3BZQA 2CJBA 1U1PA 4DX5A 4URGA 5BR8F 4OYPA 1LFWA 3RR8A 2LXFA 1FEEA 2I5JA 1HNZF 2GC8A 1XR5A 1TL4A 2HYIB 3NNAA 1IKWB 1Z4UA 4CCHA 2E7VA 1HBNA 3BREA 1H6KX 2M3DA 1HNWJ 5JUMA 1SH0A 4WTOB 4ECSA 3KLIA 1IBKF 1CJTB 2DGOA 1P1LA 5DQIA 1TKDA 5J1EB 2W9BB 3DCAA 5K14A 4K7QA 3ONQA 4TU9A 3MMAA 2BZ2A 4OYIA 8RUCA 2G2ZA 1S76D 4C4WA 4YFUA 1S72S 4JI5F 1CS4B 2ZBPA 3VZIA 4AUKA 2ALYB 5KFDA 5DG7A 1YRXA 3JQKA 4L3NA 2HWTA 4ZLJA 4F4YA 4AE5A 3RAMA 3SCKE 1Q79A 1X4BA 4K4ZA 3I82A 1HYSB 5BR8J 3ISNC 3MEGA 3QRPA 4BCAA 3MDFA 2RSQA 4P73A 2OP5A 2VA2A 4BHQA 3EVWA 2F8HA 2QZ8A 3FMWA 2PGCA 4FKXA 1S10A 1U1OA 3CJTA 1IBKJ 5CQGA 1JLAA 2ADCA 3PX6A 3T1HF 2CZVC 2LYVA 3MFIA 5CZXA 4C8MA 4F67A 4CNZA 2XO7A 2XLIA 4JI5J 3PFEA 2Z30B 3CULA 2HAFA 4MIWA 4I2QA 2RAQA 4ZLLA 3B6BA 4J9LA 2OPQA 1N56A 5MLCV 4B08A 4BWJA 1S9GA 1QUVA 3SSQA 1RK8A 3QIDA 4B3OA 1SI9A 3RBZA 3ILJA 2CQBA 1V3ZA 3GE9A 3DGPB 4A8YA 4QPXA 3I0RB 3CVKA 3I4PA 2QTWA 4DV1F 2LECA 4IO1A 1JNZB 2CPZA 3SBMA 3H2UB 3HCXA 1N4LA 4ILMA 1KDNA 2LCWA 2YWFA 4ZHRB 1UVKA 1FK9A 1ROFA 3EJMA 8AT1B 2Q3PA 4ZP9A 2J9DE 4CLYA 1B0VA 2WAQD 2FVSA 5A8WB 2E7WA 1A0OB 3OVSA 3TUIC 2UU9J 5DDQC 1T05A 1RWUA 2KM8B 2ZEJA 3MPWA 2FLNA 2IBOA 4M63A 2GFFA 4A46A 1S0NA 1NCLA 2H5JB 4OZLA 3GSIA 3R1HA 3THTA 3IR7B 3MTKA 4O3QA 2EXUA 5KT5A 3HZGA 1VC5A 3CJ2A 3LO3A 4MYUA 1ZYQA 3Q2SC 2F65A 3OD2A 1TMMA 1JMTA 2ZH1A 2C2ZB 1C2PA 3KHRA 2HRYA 2CDRB 4M5DB 3IO1A 2D3O1 1DLOA 4DV1J 2BANB 3BDEA 1REGX 4F4ZA 2AEMA 3KTQA 1ZM3A 1PILA 4NCGB 1HKAA 2FJDB 1JKHB 3TP2A 1U02A 3B54A 2XTJP 5H9EK 1SC4B 2I2YA 4DHVA 2O66A 4JV0A 1SV5B 5A8KB 2E5LF 3KFWX 4NX9A 2BKOA 3QT7A 4USVA 4DMZA 1D1UA 5HN0A 1Q5VA 2YPZA 2VBWA 1CJKA 2Z57B 3TX8A 1T7PA 3SV3A 3IM8A 3WBZA 3CIZA 3JQJA 4KGKA 3U27A 4RU2A 4LFAJ 1DRZA 4ETZA 5GAGU 5B09A 4ANDA 4HI1A 2D3OR 3UDCA 1EJ7L 3I5BA 1S48A 2FZGB 1KONA 4DR7F 3UDEA 4G1QB 2RILA 5KFRA 3BSCA 2EI5A 2JFDA 4UZCA 1RGVA 3CDBA 1OMSA 2YWHA 1VS3A 2UUWA 3E51A 3HVWA 2VQEJ 3TJ9A 2R8JA 2H48B 3VR1A 2ZH6A 5B0GA 4IO9Q 5KFQA 2XZDB 3HVTA 1YBAA 1CQNA 5H1SV 5EWGA 1VR6A 2CQCA 4P9SA 2HNDB 2J7UA 1MN9A 2W7OA 4ID5B 1G4CA 1VIOA 3QGGA 2GAGC 3MCMA 2FB0A 3PACA 1W7WA 1RAFB 1TVRA 4O44B 3QYYA 3LQVA 2IDLA 4YQWA 4I7FA 2V9WA 1TK8A 2AMCB 2K7KA 5HI7A 1HD1A 1B99A 1NZ8A 2WBRA 5ETSA 3TZXA 4PEOA 2MLXA 4LF4F 1JJHA 2AX0A 3POTA 2MKIA 1TAQA 3RB3A 2WBMA 3LPEA 3GYXB 4JI0J 4LRAA 2VC0A 3WQPA 5JVHQ 5GADI 1DQAA 3CD5A 2M2BA 1RBOB 4LF6J 1B7YB 2C3PA 5L1LA 2NXNA 2RRBA 1S4EA 3DM2A 4NEZA 2C28A 1SKRA 1HLWA 2JVOA 3ENQA 5CH7B 4KHPJ 2FHJD 4QIEA 3MAHA 4H4KA 3HHEA 3HSDA 3ITHB 1KVKA 1XN9A 4AQYF 3AY0A 4CRJA 5A0YA 5HP1A 4EK2A 3OTOF 2F7VA 1FWLA 3UR0A 3M4XA 1HBNB 3SDEB 3TVKA 4LFBF 2RNEA 4C11A 3LF0A 2LU1A 1S6QB 3C15B 3KLIB 5A6PA 4J37A 2OPRB 3OSNA 4WP8A 4ZVOB 5K14B 1U45A 1WF2A 3OFGA 3G6VA 1NJIT 5DLGA 4N56A 2BYCA 2W2MP 1FERA 3GIIA 3QQCD 2PSZA 5CCLA 3A8KA 2POKA 4UY8T 3MZIA 1DAXA 1T9UA 3DKDA 3LP1A 4L6V3 3HKWA 3G9CA 5KFGA 4LBHA 2V34A 3P5TL 2YKNB 1UP1A 5LMUF 4CO3A 2DGSA 4ED0A 3HMJG 4DR4J 3M2RA 5DS7A 5KT6A 2XWYA 5AT1B 3R5DA 2XYGB 2D9PA 5LXYA 2JOQA 1V9OA 2AYMA 4RL1A 1U2FA 4ZCIA 3R5JB 1X4FA 3E8OA 4KGZB 4TY8A 1DBDA 3OTOJ 4OZNA 1YSJA 1PJ5A 1KKHA 2DXDA 5K5MA 4R25A 1NZAA 1KQKA 4NMLA 4KFBA 2HFOA 4IG0B 2MLZA 1H0HB 1AZSA 5KFEA 3HHLB 3DI6A 1WD6A 2W9CA 3BGLA 4B9TA 1WNEA 2VKZG 1IKXA 2B7BB 1FWPA 5DZ7A 2BRKA 4DUZJ 2HWIA 4C98A 4NLDA 3GB0A 4N8NA 5CZVA 3I9V9 3DDKA 4CT9A 3RAQA 1GH8A 1YJUA 4QU7A 2W4CA 4ELVA 3K59A 2W1BA 1FKOB 5LMUJ 2EFPA 2QMUB 3HDSA 3U02A 2OPQB 3I6PA 3FBFA 3GZ7A 1FE0A 4B9MA 1XNQJ 3X3UA 2CNNB 3AQOA 3TOQA 2W2NP 2Z2LA 1U1QA 3V81B 1VQOS 2F1FA 1SVDA 3GWCA 5A8RA 3LGHA 4Y2AA 3G87A 2ZFHA 4X4SA 4CZCA 5G0RB 2JLFA 5J2PA 4HT7A 5LMNF 4TVAB 3ZZTA 3MEEA 1TKZA 2V8VA 1D9AA 4DV7F 2RIJA 1VHIA 3L7UA 2HQGA 3JTNA 5F8IA 5KT4A 2F4FA 1QLNA 1X9MA 4C0HA 3VWSA 4I69A 4U7CA 1BWEA 3M05A 1IR1A 1PYTA 4QIVA 2HVZA 3OQ2A 3W64A 4ZLPA 1XNRF 3BGRB 1UPMB 4LF7F 1NH8A 4EI2A 1TK0A 3CJ4A 3JSRA 1H98A 3GIRA 4HDHA 2VG6A 1NHKL 1LWEA 3W61A 4AFFA 4J9SA 2CQDA 4U7UK 3D6MB 1TUVA 1OIAA 3GFYA 4J9KA 3GIKA 4RNFA 2XS7A 1ZA1B 3EICA 2HHVA 1YZ6A 3I9ZA 3M2VB 1OS5A 1VQ6S 2IM2A 1DLOB 3DOKA 2OIHA 4X4VA 1ZAXA 1S1VB 3BSNA 1IM4A 1R0AB 3M8WA 1JXVA 4C8LA 4F04B 2LKZA 3KDOA 2UXDJ 1UPPA 1IR2A 3TUJC 2XSFA 4TYAA 1FRHA 1S1WB 4WJBA 2AV5A 2EW9A 5EDWA 2UUAF 3DOLB 3BYRA 3EDQB 1SJ3P 4N5SA 3UD3P 2W7PA 2EFOA 4ZITA 1KVJA 1LXJA 1LQ9A 1L3SA 1XNRJ 3KG0A 2DT9A 2GNKA 3V6JA 3BQ0A 4MK9A 2KFNA 5JJBA 2DHSA 3ICLA 1CULB 3DDNA 7FDRA 1CC8A 1NPKA 2BW2A 2PI5A 2XM3A 1GMWD 3C8YA 5E3RA 5LSOA 1F1BB 4DX7A 4PYAA 4ZPDA 4ED3A 4TN2A 1RA7A 4MFBA 5KFBA 1YBTA 3J7Z5 2HNZA 3LWLA 5G4DA 1R8BA 3FCVA 5CA5A 3AB4B 3HP6A 1XK8A 2IYGA 1DURA 1GXLA 2CPDA 2CYYA 1T11A 2ZWPA 1M5HA 3G82B 4XIUA 1LWFB 4NLOA 2K1RA 4J9QA 5IWAF 1VOMA 2CPFA 3LW5C 4X4QA 2XS2A 2HBRB 2IVFB 3W7BA 2F4VF 1F5BA 4DL3A 1C1BB 4FNIA 1UFKA 1HI0P 2Q1LA 2VBXA 2XHWA 1HIYA 3GJRB 3AOBA 2ZD1A 1I1GA 1UA0A 2N4DA 3EZ5A 1HR0J 4F4XA 4BBYA 4P7TA 2QGFB 2MKYA 2BW7A 1NM2A 4ID8A 2M0GB 1HWKA 2CFXA 3DRPB 4ZIWA 4DOZA 4NYPA 1IUJA 1R8AA 1REVB 3QIPA 3HT0A
chains in the Genus database with same CATH topology
4DQSA 1EETA 2ZD1B 4QYZJ 2KT5A 2PD1A 5E3PA 2CQ2A 4QQBA 2VB6A 1EP4B 1QAYA 4ZPWR 2MY8A 4Y00A 3J7YI 3CC7S 1OSDA 4U6PA 2CKWA 3CJ0A 4KE5A 2R7VA 3DHXA 4ELUA 3OL9A 1JLBB 1KFDA 4WYLA 4Y28C 4CTAA 3R5AA 2WHOA 4A8KA 3MEKA 5C42A 3NRBA 2N7CA 1A6LA 4GKKF 3CB4A 3MM7B 2Q66A 4ECUA 3GG0A 4HTIA 4HLBA 5EX0A 1SJQA 1VRTA 3SQGB 4K4VA 4MK7A 2FDNA 2M8HA 1J2VA 5I3UB 2QV6A 5HLFB 2HFZA 2MJUA 2V4JB 3VQSA 4WCEQ 5AXMA 4RNNA 4FBUA 3LP0A 4WXOA 1UW4A 2PMHA 4JI7F 3OSPA 2CJKA 2XG8A 3PX4A 3QO9B 1Q78A 1L3VA 2AW0A 3G8TA 4K59A 4BC7A 3QMQA 1U1KA 4CO5A 1L3SA 2YWGA 3QIPB 5KFKA 1HBOA 4M94A 2GJIA 1TKTA 2J7KA 5KFNA 4G1IA 2E1CA 3AHPA 4KBIA 2XC9A 1S0OA 1EETB 5F9NA 3GQCA 5E41A 4ILLA 2EWHA 1OWXA 1ZAWA 3M8RA 4HT5A 4IRCA 2W24A 3C6UA 2OH2A 1IQTA 1FO1A 3VALA 3L7OA 5I3QA 2KYZA 4LSNA 1ZOTA 1HBMA 5KG7A 2KT2A 3DXSX 3VAFA 1VC6A 3D54A 3EGNA 4MK8A 2E5JA 1NU4A 4CTAB 2KXNB 1JX4A 3I31A 4RNOA 3HT3A 4RW9A 2CPJA 3NBPA 2I38A 3FNNA 1NHVA 5C42B 3HO1A 3CCZA 3U1NA 2BQRA 4E8UA 2NSCA 2XMKA 2BBEA 4D3GA 3KLFA 2J0WA 5E3QA 3NNHA 1HD0A 4QYRA 3NS6A 1VRTB 2UUBF 3T9NA 1FTRA 3A8EA 5IQQA 3H2VE 3UW1A 3CCJS 2MPUA 3PZPA 2ALZA 1RJJA 2BV3A 1KR4A 4NLPA 5BYRA 3ZZZA 1NK9A 3LP0B 1RYSA 4Q43A 3CMES 3OR2A 5A6WA 1D9DA 2CQGA 1Y4ZB 2QA4S 1DTQA 2X51A 1Q1KA 2HHSA 4LQ3A 4Y0FA 3Q8RB 2NZ4A 1HBOB 5BYQA 1TKTB 2XI2A 1RT6A 4KIAA 4OX7A 4UOCA 3GFZA 1SL1A 1N52B 4ZPBA 1N5VA 4OQJA 2L41A 1FE4A 3NLCA 2NPFA 2LEBA 3KOAA 3C6UB 2AJ1A 1HI1A 2VPZB 3HPOA 2AYGA 4WFZA 4LSNB 5LSLA 1HBMB 2VUGA 2DNLA 2OTLS 3BGUA 4DSEA 2BR0A 5EWEA 4EUVA 4QW8A 4RWXA 4NLGA 4KKOA 2DIUA 4ZP7A 2JEJA 3M8PA 3NBPB 2J0XA 1WHYA 3IS9A 3PR4A 5KFAA 2V5HG 5KOWA 2RRNA 1MMNA 2FHMA 4ZPTR 2C2RA 2UU9F 3OJUA 3AJ1A 3KLFB 2M9KA 4ZKAA 3RRGA 2O01C 1U6FA 2P6TA 1BQMB 4NYOA 1S77D 1FRMA 1TR0A 5DG9A 1VK8A 4A8FA 5D6GA 4EZ9A 4ZS6A 3HJFA 4C0OC 2DNMA 3PW2A 3T5LA 2MQOA 3OHBA 1RTDA 2VC1A 3RZAA 2KXFA 3RRHA 1AXQA 1C4CA 7FD1A 4MTPA 1C0UA 1S6PA 2DO0A 2E7XA 5CHCB 5DM7Q 2JHEA 3KLGA 4OLPA 1DTQB 3GV5B 4WU2A 4HDGA 2D41A 4FS2A 1KOOA 4MAKA 2DD8S 3JYTA 1G3OA 4DR2F 3CCVS 2XI3A 4DFPA 4EBEA 4JYAF 2FTRA 1S1XA 1RT6B 2G13A 1H2UX 4DLEA 2QMWA 3G6XA 3M6XA 4ECZA 2XY5A 3THVA 4TY8B 3IWNC 1IQZA 1DARA 1VQSA 2AP6A 3PO5A 1VBXA 4NLUA 4ZP6A 3B8HA 4U67Q 4ED8A 3PW0A 4RW8A 3DLKA 4JUZA 3I4HX 5M2PA 3IG1B 4NRTA 1E6VA 2DBBA 1K8AT 4DR3F 4RW6A 1RTJA 3LAKA 4WZQA 3N79A 4HH1A 3MUTP 3EYZA 2LXUA 3OTBA 1TL3A 1ZZNA 3AB2B 4ED2A 4KFBB 1UA1A 4KKOB 1H2TZ 2VV5A 4X4UA 1DTTB 3M8PB 4LF8F 3L7PA 3BO2A 1Q8BA 4KTQA 2PDAA 2V9KA 3BS9A 2IFXA 1L3UA 3H25A 2OFHX 1U4BA 4F4KA 3NWGA 1F5CA 3HVAA 3ZZUA 4DR6F 3W3SA 3Q24A 2WW8A 4N76A 1Y7PA 4A4JA 4WF9Q 3DLBA 5GAGI 1HARA 2B4UA 2W9CB 1PGZA 2KJWA 5M2UA 2CJ9A 4PG6A 4YB5A 1J5EF 3LP2A 4IRDA 4C7QA 1C0UB 1S6PB 3TNVA 4NZ6A 1BQNA 3MMCA 1HPZA 5DRKA 2DGUA 2FPHX 3KLGB 1RT1A 1F5AA 2IRUA 2AF6A 2ZUGA 2DNKA 2MDAA 2L08A 2V4QA 3WC2A 3QWUA 2IA6A 4I0WA 1P8GA 1WEZA 3JYTB 2KG1A 2YX7A 3CCWA 2WSEC 4IR1A 2MKCA 4XDDA 4WKRA 2W4PA 1V6HA 1U48A 4O3NA 2LQ5A 2MKHA 2DISA 2DPJA 2R4FA 3OFHA 2J9EA 5IT0A 4QW9A 4ECYA 5CYQA 4RW8B 2X1BA 1VJWA 3DLKB 1QAXA 2HHUA 2MQPA 1MMDA 2VPYB 1VHFA 1E6VB 4K4WA 1R3NA 4CNYA 3QLHA 4FVCA 5FIIA 2DO4A 1RTJB 4RW6B 4DL6A 3RYLA 2RVJA 4R0JA 1YQHA 1FJGF 1TL3B 1TAUA 2ZJQQ 3LOUA 4CH0S 3MWBA 4N41A 1HI8A 5B08A 2AQ4A 1B0TA 4KT0C 5FDLA 1SJFA 2HVIA 4B02A 1OO0B 1XTZA 4PRFA 2HQIA 2HPUA 1MW7A 2KB2A 2MKJA 3HXMA 2RJZA 1C0TB 2AX1A 2ZITA 1TP7A 4O23A 2KTQA 1WF0A 2G9OA 3SSRA 2OFGX 1XWLA 2CG4A 4F4WA 4JI3F 4KSEB 1KRPA 2GO9A 5THWA 2C3UA 3DC2A 2A2CA 5AXNA 3RB4A 5K8MA 2JC0A 1BQNB 3MMCB 4A8MP 2P9GA 3CCQS 1HPZB 4K0KF 2ZKUA 3LGNA 4M5DA 1UAWA 3CWJA 1RT1B 5DLFA 1D8YA 1UWBA 3MMBA 5BJRA 1UVIA 2HWHA 4OJHA 2KVIA 3FSYA 4ZK7M 2MKKA 1JXEA 3VAJA 2C42A 2LA4A 2EFNA 4PXCA 3OTCA 3C66A 3BO4A 4ZVFA 2RD5C 3MM9A 2CPYA 3IBWA 5J1NA 4F8RA 2YNFB 1UEVA 1X0PA 2HFNA 4ZOSA 4LFAF 1SBRA 5CYQB 2FVRA 3A1YG 1SQEA 1UJ5A 1N6QA 3DLJA 2XGQA 3DRXA 4QR0A 3JSMB 2ZH2A 2ZZMA 3RW6A 2AYEA 1RISA 1YIJS 3QLHB 1P9QC 1T94A 5GMKa 2ZBCA 4V19J 1NB7A 2GO8A 5F9LA 1RT5A 2VFTA 1NJWA 3CIMA 3I5CA 3E01A 2MSTA 4DSFA 2B3TB 5HMWA 3FGVA 5U47A 2DIVA 4OHZA 1LFPA 3UPFA 2W25A 5FDLB 4E98A 2J6UA 2NXUA 2KI2A 1X5OA 3PV8A 4OZ1A 4I2PA 5H9EJ 2YKMB 3KLHB 2KKHA 3B4DA 4IFYA 4CQ1A 2YY3A 5IT4A 5J2PB 4J9PA 3X1LB 4ECWA 2X1GA 2LEPA 4KR0B 1HWIA 5AXKA 3GIJA 2RB7A 4O3OA 3EXCX 1VQ9S 2WSCC 3TUZC 3D0GE 3PY8A 3DRRA 3NKYA 1HNVA 1MWYA 2R8IA 4ERDA 3CEDA 5SUHA 4Y2CA 2MXYA 4OI2A 3UNGC 3QZ8A 4FXDA 1UWBB 1Y5LB 3MMBB 3FEYB 4IG3A 1U1RA 3ZZ0A 1Q53A 2HLTA 3KJVA 1S0MA 3HKZD 4O4GA 2LDIA 3MPVA 4NLRA 4GO5X 2MQQA 1RKJA 2KJVA 2VQEF 2KN4A 2FC9A 5CD4H 2JX2A 3E3XA 2HMIA 3U7JA 3GSDA 3H4DA 1IXKA 4I68A 4ED7A 1SC6A 4OL8A 1X0FA 4ECQA 5HBMA 3CXCR 3AJ2A 4K5RA 4JI8F 1NK6A 1NKEA 2J8AA 2LLZA 2WONA 1IKYA 4LVOP 4C3MA 1U49A