1RK8A

Structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
87
Chain Sequence
PQRSVGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into the interaction of PYM with the Mago-Y14 core of the exon junction complex
pubmed doi rcsb
molecule keywords CG8781-PA protein
molecule tags Translation
source organism Drosophila melanogaster
total genus 18
structure length 87
sequence length 88
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rk8A00
2OTJS 1ZH5A 5DETA 1FJEB 4W92B 5IQQA 2N7CA 3H2VE 1WHYA 3J7YU 2DHAA 3RW7A 3MD1A 3MUTP 3FEXB 3VAHA 5GAGU 4PRFA 2GO9A 3P49B 2MQLA 2EK6A 2KM8C 4LMZA 2J0QD 1X4EA 2LKZA 2MB0B 1S72S 2V94A 2X1GA 1U2FA 4ED5A 3VAFA 3K0JA 3CTRA 3P6YC 1P1TA 4QU7A 2O3DA 3CULA 2MKIA 2CPXA 3CUNA 4TU8A 2J0SD 4WIIA 1WHWA 2CQ2A 1WHXA 2CQ1A 2GHPA 2JX2A 3BO4A 1WTBA 1KQSR 1VQ9S 5FJ4A 1QVGR 2KRBA 2RS2A 2KXHA 2XS2A 2XB2D 2EVZA 2DIUA 1YWXA 2DISA 2MY8A 1HD0A 1F9FA 1OPIA 3DXBA 2X1BA 4Y00A 2JVRA 3TP2A 4FXVA 5LJ3Y 1WF1A 2LMIA 3FEYB 2KG1A 4IOAQ 4LIRA 5DM6Q 2HGNA 4QPTA 4FXWA 3SDEB 1VQ7S 3BS9A 4CH0S 1VQMS 3MOJB 4YOEA 2DHXA 2CPJA 2X1FA 4TU9A 2HVZA 2ERRA 4TLQA 3CCJS 2NLWA 2M2BA 2DNLA 3EGNA 3N9UC 2LEBA 1X5SA 1U1OA 3THPA 2I2YA 2OJ3A 2VOOA 2L41A 2DNPA 2EK1A 5DDOC 1VC6A 3VF0B 1VQOS 5D77A 2CQ4A 2RRBA 2MKKA 1B7FA 2KVIA 1N8RT 3BO2A 2MZQA 3SDEA 2F9JA 4CH1A 2DNQA 1R8PA 3MDFA 3J7ZT 5JVHQ 1WF0A 2YH1A 4C4WA 2CQ0A 3MI7X 2DITA 1X4DA 3VAJA 2M0GB 2DNNA 4F25A 1OO0B 3CCVS 2ZJQQ 2VONA 3UD3P 3R1HA 2N82B 4V19X 2MSSA 1Q82T 4F26A 3S6EA 3NMRA 1CVJA 3LPYA 2BZ2A 2CPFA 2JRSA 2DNGA 3L3CA 3P5TL 1FJCA 1K8AT 2YKAA 5ITHA 5DDPC 1ZZFA 2DK2A 2OSQA 2DNYA 2A3JA 3TYTA 3H2UB 1SJ4P 4YB1P 4EGLA 3G71S 2ADBA 1H2VZ 1H2TZ 2HYIB 1M1KT 3RW6A 5H1SV 1X4FA 1RK8A 2MZRA 2KI2A 2ZJPQ 5GADU 2VOPA 3NNHA 5GAHU 1N52B 2E5GA 4W90B 2XSFA 4C7QA 2KU7A 1X5OA 4Z2XA 1KD1T 2VODA 2MGZA 1D8ZA 2DHSA 1DHMA 4IOCQ 2PEHA 3UD4P 2CJKA 2MHNA 3HHNB 1N54B 2CQ3A 1WWHA 2MZTA 1SJ3P 2DGUA 3CC7S 4ZKAA 1QM9A 3B4MA 1X4CA 2MYFA 4WF9Q 1M5PC 2CQPA 5LJ5Y 3JB9k 2DGSA 1U1KA 4LJMA 1G2EA 1UP1A 2RUGA 1ZZNA 2DNRA 2KT5A 3G8TA 2RRAA 2JWNA 2MZ1A 4QU6A 1NO8A 1WG5A 3Q2TC 1YTYA 1WEYA 2CQIA 1P27B 1U1QA 1WEZA 1JJ2R 2DIVA 1X4BA 4WFAQ 2XNRA 2MKSA 2N3LA 2E5JA 2MMYA 1VC5A 2DGXA 3R27A 4J5OA 2AYBA 2D9PA 4WFBQ 1SJFA 2UP1A 2CQCA 2CPDA 2MQMA 1X5PA 3B4DA 1VQ4S 3VAKA 3G9CA 1FNXH 2HGLA 2F9DA 2KG0A 3IRWP 2XS7A 2KHCA 2MSTA 4QQBA 2KFYA 2DO4A 2BOPA 1UAWA 2J8AA 2RNEA 3CMES 4BS2A 2KXFA 2MJUA 3NS5A 3CMAS 3G6ES 3UE2A 1Q81T 2QEXS 2MPUA 1HL6A 1VBXA 2I38A 2AYEA 1Q7YT 2J76E 3US5A 2LEAA 2FPHX 1WG4A 3ZZYA 2LXUA 1W2BR 1UFWA 2MKCA 3SMZA 5EN1A 3Q2SC 1X4HA 3CCRS 5MLCV 4UY8T 1YITS 1DRZA 1L3KA 2L08A 5DDRC 1VQ6S 2MY7A 3CXCR 2RS8A 2FY1A 2JVOA 2WBRA 1HA1A 3PIOQ 3BO3A 1PGZA 1SXLA 1X0FA 2E5IA 4UQTA 3OW2R 5LSOA 3VAMA 1D9AA 2CPHA 3U1LA 3G4SS 2AD9A 3HI9A 1U1PA 2KYXA 1O0PA 1N88A 1KC8T 2MGZB 1U1NA 3CCLS 2K8GA 2DNOA 2DGQA 1IQTA 3ZZZA 5BJRA 2M9KA 2MQOA 2FHOB 3BEGB 3CCSS 1A9NB 3SXLA 2MXYA 1QVFR 2DH9A 2AYMA 2LA6A 2DH7A 3P3DA 3I55S 1VBZA 3UWTA 4YUDA 2MQNA 3D2WA 3UCGA 4TU7A 2CPEA 3MXHP 3G96A 1FO1A 3V4MA 1YJWS 2U2FA 2MKHA 3CF5Q 2YTCA 1M5VC 2ADCA 2HGMA 1NU4A 5GVQA 5IFMA 2D9OA 1K73T 4RU2A 2XS5A 4OZ1A 5LXYA 2E5HA 2M8HA 2U1AA 1KOHA 2LCWA 2RVJA 2M4MA 4P6QA 2QA4S 1S79A 2OTLS 2XNQA 1YJNS 2SXLA 2DO0A 3S7RA 1JMTA 1VQLS 2CQGA 2M52A 3G8SA 1URNA 5CXTA 1DBDA 2DGWA 2LYVA 1U1MA 4IO9Q 5IM0A 3CCUS 2HZCA 3TO8A 2N3OA 1NJIT 3IWNC 2CQDA 2DNMA 1VQPS 2Q79A 4ERDA 2KM8B 3THTA 3NNAA 1DZ5A 1BY9A 1U1LA 3MURP 2RU3A 3EGZA 2YWKA 2CPZA 1WHVA 1SJQA 1A7GE 1X4GA 5JVGQ 2CPYA 3UCZP 1WEXA 2DNZA 2MKJA 4WCEQ 2ZJRQ 2DNKA 4Y0FA 1VBYA 2DGOA 1K9MT 4CIOA 2CQBA 1U6FA 2KRRA 3CCQS 3U1MA 5HO4A 2M8DB 1M5OC 1UW4A 2RQ4A 1M5KC 1M90T 2B0GA 1AUDA 2D3OR 2F3JA 2E44A 2L9WA 4F02A 2MZSA 2DGVA 1Q86T 2OSRA 3MUMP 4PKDB 2YH0A 2QFJA 2OIHA 1HD1A 3ULHA 1JJ4A 3VAIA 1WG1A 3CD6S 1FXLA 2CQHA 1X5TA 3CCES 3I56S 5HL7Q 2FC8A 3S8SA 2KH9A 1VQKS 2LQ5A 3MUVP 2PE8A 1U6BA 3MD3A 2LXIA 2K3KA 1YIJS 1R8HA 1VQ8S 2KXNB 1FT8A 4IUFA 4C0OC 5DDQC 4OZ0A 2RQCA 3CPWR 5D78A 3NNCA 2CPIA 1SJRA 3NS6A 2FC9A 5CYJA 1RKJA 1YHQS 2MZJA 2DNHA 1FJ7A 1JJHA 1WI8A 5DM7Q 1PO6A 2AYGA 3CCMS 2LA4A 1WI6A 2G1DA 1VQ5S 2KN4A 1YI2S 4PR6A 5CA5A 4WFNQ 2NZ4A 4CQ1A 1WF2A 3EX7B 1OWXA 1FHTA 3R1LA 2DGTA 5LSLA 2RT3A 3VALA 2DHGA 2MQPA 2DH8A 1OIAA 1YJ9S 1WELA 2M7SA 1KOOA 1X4AA 4U67Q 1H2UX 3S01A 1H6KX 2MJNA 3PIPQ 3UCUP 5GMKa 2M88A 2MQQA 3CC2S 2G0CA 4WKRA 2G4BA 4M5DB 5IM0B 3DLLQ 3LQVA 1VC0A 4A8XA 3VAGA 5LXRA 5GAEU 1U1RA 1VQNS 2DB1A 2LECA 2M70A 3CC4S 1XN9A 2X1AA
chains in the Genus database with same CATH superfamily
4DR7F 3H2VE 2ZKUA 4I68A 3KYLA 4PRFA 2R8HA 2ZD1B 2FY8A 3RG6A 4P2FA 3JXOA 2NZCA 4NLWA 2FJVA 4ER8A 3CULA 5AJ3J 2XY7A 1BQNB 2E1PA 1WHWA 3BO4A 4X64J 2V50A 3DI6A 3UD5A 4ZITA 3U02A 2XCAA 3KLFA 1Q95G 3NRBA 3DGPB 3GWCA 2CG8A 4QZVB 5RUBA 2X1FA 4FS1A 1S77D 1N33F 4M63A 1TP7A 4R8UB 4CO1A 4E8UA 4C9DA 2J6UA 4TY8B 1NKCA 4OYWA 1GXLA 2QC3A 3LAMA 2RE1A 1NJZA 3EJMA 4PYAA 3OVSA 2WTFA 4JI2J 3SFUA 3KLEA 3A8IA 1OSCA 3WBZA 3FDSA 1U2RA 4URGA 3CCVS 1QTNB 3GJRB 1QSLA 3A13A 3BPDA 3GR0A 1UEKA 3MMAA 3D3BJ 4H4MA 2PI5A 1DARA 1T9WA 4U8VA 3RBEA 4Q5VA 2NXCA 1CJVB 5I3PA 5HVFA 1IBMJ 4K8RA 4EFAC 2WBMA 2OPPA 1S6PB 4R25A 3QZ7A 2AKWB 1VBKA 3LGHA 4C7QA 4I2PB 1RT1B 1VRUB 3KJFB 1S6UA 4WZMA 4JI1F 3IWXA 4L72B 3C16B 4IG3A 4CH7A 4ZKAA 3F41A 3MM5B 4EEYA 2V5HG 3RAXA 1X4CA 2ZOGA 4K2JA 3WQPA 2IYIA 3CJ2A 1S1VA 4C11B 4WZQA 1G2EA 1UP1A 1NXIA 1RGVA 2JWNA 1B0VA 3QIPA 1EETA 1K47A 1T03A 5IV3A 5HROB 2ASJA 3FC9A 1HWJA 2RHSB 3GIJA 5B7WA 3BGRB 2PMWA 3W2VA 2FDNA 4J9KA 2ZNYA 1TK8A 2ZUGA 5E3PA 4JI5J 5L8RC 1LWEB 2GFFA 1RLDA 1VFJA 4KBIA 2KZMA 1MSWD 4BS2A 4JI8J 4D3HA 2GHVC 2C2MB 3W60A 1RTDA 5EN1A 1KDNA 2V8VA 5KFBA 3WC2A 1P8GA 1APSA 1HHQA 3IAM9 1SKUB 2W2OP 3MAAB 4X4SA 1SB6A 3EPGA 2ACYA 4LF4F 1FRJA 1ZETA 4F2RA 3ZZPA 3KHHA 5KFQA 1D9AA 4UT4A 2G1HA 2MGZB 3GSDA 1RT3B 3EMTA 3AH6A 2ZWOA 2CJYB 1N34F 2J9DA 2B6AA 4I69A 4CM2A 4TU7A 1TL1A 1RBAA 3IG1A 3K8WA 3A3OB 2HGMA 5GVQA 2UUBF 5F8GA 5BYSA 4YN3B 2OLWA 4BC9A 5LXYA 2E5HA 1UVMA 2M4MA 1QDUB 2DO0A 2VH7A 1AA1B 1ZAXA 2R7SA 5B0FA 4MAKA 1NH8A 4LF9F 2PD1A 5DRKA 3OFHA 3KDNA 3THTA 1HNZJ 1U1LA 1T05A 2QN6B 2GJFA 3OSPA 3OXFA 3HJFA 3DU6A 5BXIA 3P96A 1DQAA 3C6TB 1WC3A 1NUEA 4FF4A 2ZD1A 1RWWB 3DOKB 5DGAA 3PDNA 5FLXY 4E2FB 1FK9B 2BE7D 4IRKA 4DI6A 2BW2A 4NPOA 1HYSB 2LU1A 1BQNA 1GK8A 1IM4A 4EO8A 4ENOA 3SI8A 2B51A 1UA0A 3DOLB 4K5SA 2HFVA 3S8SA 3KUGA 2PE8A 1HARA 1YIJS 1NMEB 3N6LA 3DGPA 3UR0A 3EXYA 1FVQA 5CYJA 2G13A 1RU2A 1YHQS 2HFSA 2W1BA 1TZ0A 4R8UA 4CLWA 4J9QA 4KHRA 4TY8A 4O3QA 5C42B 4DU7A 3G82B 1WF2A 3VALA 1R8AA 4Y2AA 5F8HA 2RMLA 1Q5VA 2AIRB 4TQRA 3MTJA 4F0HA 1UWBB 1N6QB 1Y00A 3WDOA 4J7CA 4NLGA 3Q89A 1R6VA 3LUYA 3H59A 3K17A 4IFYB 3H25A 4H4OB 1ZTTA 4J91A 4Q7AA 1S72S 1CJVA 3VGUA 5A2QU 1YBAA 3I5CA 1S6PA 2J0SD 2H5EA 1KQSR 3RB0A 2AGPA 3DN9A 5FJ4A 1NSQA 5DO2A 2IM2A 4AYBD 1RT1A 1VRUA 4C48A 1F9FA 3QFWA 2HFNA 4LIRA 3C16A 5A8KB 2EFVA 7FD1A 2XZDB 3SDEB 1RBLA 3MM5A 1VQ7S 2IRXA 1RAAB 3E51A 3BS9A 3VVTA 5BYQA 2ERRA 4C11A 3TJAA 2CAJA 5GAGI 2DKOB 3M7VA 4ZLJA 2DNPA 3EICA 2EK1A 2QO3A 5D4LA 5HROA 1GEHA 2QLJB 4GKKF 1MWQA 5DQHA 3M6XA 4DV4F 3ONQA 2F40A 5CZVA 3T1AA 2KKHA 1VMBA 1RTJB 3BGRA 2CQ0A 3BH7B 1Q8KA 1HQ2A 1NEEA 3B54A 1LWEA 3C3LA 1TL7B 3L3CA 3P5TL 3KK3B 5AJ3F 1GMWD 2XEXA 2BR0A 4C3KA 1SJ4P 4YB1P 1LWFB 3G71S 1TK0A 3M6VA 2VKRA 2FGOA 1RTHB 3MAAA 5H1SV 2HNDB 1QAJA 1MU2B 2ZJPQ 4B17A 1EARA 2XMKA 3W5YA 1CC8A 2VODA 4KGKA 2MGZA 1YRXA 2YWGA 3HZEA 1N54B 2FHJD 4L74A 2DVIA 3O3LA 4KH1B 2XQCA 1PAUB 3IBFB 1ZZNA 2KT5A 4LF5J 2IJFA 3EM1A 2CQIA 1U1QA 4UUXA 4X66J 3PG9A 2R7WA 4J5OA 4OL8A 3FZ2A 2V4QA 1FX2A 3CSKA 1GXUA 3T9ZA 4ZIVA 1ROFA 3BYRA 3KOAA 3BB5A 1RT2B 2HVIA 3HVTB 2ALYB 2DEJA 2F4FA 3C6TA 2J8AA 3AD8C 3DOKA 4IDKB 2QEXS 4PZVA 2XY5A 3GIRA 2QSFA 4M5GA 3FBCA 1FK9A 4WE1B 3SV3A 4O3SA 1RYSA 4X4PA 1HYSA 4ELUA 2VV5A 5D0EA 3HM9A 1IKVB 1HKAA 2AZ1A 4AL6A 2VF3A 3DOLA 4UQTA 4KB7A 2Y1RI 1HHTP 1KBRA 4Q44A 2XG8A 3SXLA 3F56A 3M8WA 2BKPA 3V4IB 3O6QA 1M0SA 1MN9A 5IFMA 5C42A 1VIXA 4DF4A 4I2QB 1B3TA 1KOHA 4P6QA 5KFCA 2XNQA 3DHWC 2KB2A 4J9VA 1R8CA 1XWLA 3NLCA 4URQU 4DR4J 1NJIT 1QAIA 4J9LA 4JI8F 2GIQA 1C1CB 4ZPAA 1UWBA 1N6QA 1IR1A 2FVSA 3TA0A 4FYVB 4IFYA 1PJ6A 1UVNA 1UW4A 1RQ0A 1YK9A 1RWXB 3L7UA 3UDLA 5HQMA 1KEKA 4C8ZA 3W1YC 1TKTB 3MUMP 1D9FA 3VAIA 4ZVOB 5L1JA 2GQCA 3RB3A 3H5UA 2FC8A 4I56A 5KFWA 2Y1LB 3K5MA 3KG0A 1R8HA 1ZM2A 5A8KA 2QL5B 2VFUA 4ANCA 3IA0A 4I0WA 1GNKA 4A4JA 5IT0A 4P71A 1FX4A 3NGUA 2GNKA 2DGTA 4DCJB 1X31C 1WELA 1HNZF 1X4AA 3EVWA 2OEKA 2HKEA 4CLLA 1RTJA 1MWYA 2B4PA 4G65A 2GQ2A 3RU0A 3R7SB 4OIXA 4WP9A 4LR7A 2ZH6A 2E7VA 5DETA 4PG5A 1TL7A 3MD1A 4DV6J 3FCWA 3KK3A 2HZVA 2LLZA 1KSPA 4OHXA 1SI9A 2QE5A 1LWFA 2KVQE 3QZ8A 2OEJA 1ZAWA 4QU7A 2O3DA 3ETOA 2HNDA 1MU2A 1RTZA 3PFEA 4U7UK 4LFCF 3D6FB 2EVZA 4PWUA 3DM2B 3PW4A 4B9UA 2UV8G 3R5GA 2YWFA 2JSXA 4DL3A 3IMQJ 1UTAA 3TWZA 3JSMB 2PDAA 5GAEI 3FSXA 5KFMA 3QRPA 2V67A 4TU9A 1F9HA 2XSJB 3Q86A 2I2YA 2DTJA 1HNVB 2Z2ZA 4ECVA 2FLNA 3GB0A 5DG9A 1U7LA 4GO7X 3D6HB 4OJ1A 2IVMA 5K5MA 3O5TB 4USWA 4HHJA 1RT2A 3HVTA 2QT7A 3DOMA 3VZIA 4ECXA 1FNMA 1U26A 3HD1A 4P10A 1T8EA 4IDKA 3Q8RB 1EZZB 1BQMB 2LEPA 4LIWA 4WE1A 4RBVA 1H2TZ 5SZTA 1F3FA 5AXLA 1RK8A 4ANEA 1IKVA 1S49A 3PVXA 1N52B 2KL8A 4USIA 5KG4A 2VBXA 1FKPB 4Q8EA 1TKDA 2QX0A 2HBRB 2M3DA 2AEJA 2F4VF 2VJVA 1OSDA 1S97A 4NEYA 2MYFA 4WF9Q 5KFYA 1FWKA 3V4IA 1T11A 2GZOA 2ZZMA 3CIZA 2RUGA 3VGSA 4I2QA 1NO8A 3I31A 1QE1B 1X4BA 4WFAQ 2JZ5A 2V4RA 4CLZA 2E1MC 1Y3JA 3D1QA 2LVWA 1C1CA 2LDYA 3B78A 3NL0A 2JEIA 1UEUA 2EKNA 4ZN3A 3M05A 3ZZRA 2VG7B 2IPOB 2BOPA 3SCIE 1V3RA 4USMA 2MJUA 3CMAS 3UE2A 4CZCA 5DZ7A 1RYRA 1Z2LA 3ZZYA 2HIYA 5KFKA 1FI4A 3MMBB 4WYWA 3MWBA 1NDLA 3PHTA 4DSEA 3TUZC 3AA9A 1TKTA 2RS8A 5IWAF 1BE4A 2UXBJ 2B43A 3QT5A 3L7OA 7AT1B 4L75A 4F7VA 3AXMA 3CCLS 3LAKA 1GXTA 3PYFA 2XGQA 4F04B 2AYMA 2EKYA 4LF5F 4YUDA 3D2WA 2KTQA 4RBTA 4X66F 1G1XA 3I5AA 3RRKA 4I4BA 4RU2A 2J6SA 4OZ1A 2LCWA 3CJ5A 4LREA 2OTLS 4PUOB 4FXDA 1CBKA 2G2OA 2RDJA 4DR2F 1U1MA 1NLKL 2XYPB 4QCLA 1YJTA 2HAFA 3ZO7A 3GG1A 5K9FA 2YWKA 3W66A 3P4UB 4DR3J 3IWLA 3W5ZA 1K0VA 4M5MA 3UCZP 4CO4A 2ILZA 4Z7CA 4AUKA 1HBOB 2ZJRQ 1NK6A 1C1BB 1HI0P 4HH1A 2WRMA 2KJWA 4CTAB 4P75A 3GE9A 3CE8A 3UDEA 2CQHA 3DM2A 3DU5A 4ES2A 1R8BA 3I82A 4NLOA 3H2LA 3SCLE 4CNZA 1N5TA 3JSMA 2VC1A 1BLUA 1Q7LB 1D8YA 1CC7A 2XSJA 3CCMS 3KK1A 3UN5A 3O44A 1HNVA 1S7IA 4DR4F 1ZA1B 1MWZA 5EWFA 1FHTA 1OIAA 3MF5A 3TZZA 3DDNA 3PIPQ 2LQ9A 4A8XA 2OI2A 2DB1A 3HXMA 1XN9A 1UPMB 2N7CA 2DHAA 3RW7A 1NAQA 2MQLA 2EK6A 1TK5A 1N4LA 2KM8C 2PIIA 3V2UC 1BQMA 1U0SA 4DF8A 3BBFA 4DQSA 1UFLA 2R7VA 1VQ9S 1L3SA 2GHPA 2JX2A 1WTBA 2RS2A 1HPZB 2DISA 1TQLA 1FKPA 3AT1B 1RE1B 3DXBA 3VZHA 1XC9A 4JOUA 4CM0A 2QMXA 3FEYB 3T3FA 4RPFA 3PR4A 3MPDA 4OLOA 4MYTA 3A8KA 3LALA 5ETKA 3NY0A 5L1IA 2DNLA 3MR5A 4AT1B 3N9UC 2L41A 1VHFA 4A8MP 2ILYA 3LP1B 1QE1A 4Q45A 2FJBB 2CZ9A 1Y9OA 1LV5A 2MZQA 3QRRA 2V63A 1T9UA 1YBTA 3PFOA 1KVIA 5E5NA 4C8LA 2IM3A 4KY3A 4DV6F 3MMJA 4OHVA 1OO0B 5KFLA 1EAYC 3W8PA 2ZHAA 1WTFA 3L95X 3N6MA 1ACMB 3HHLD 3U1NA 2JOQA 3CGIA 2VG7A 4BWJA 4MKAA 2QFIA 3JQKA 2ZH4A 1XMBA 1EKRA 2YPZA 2B9XA 3ZFVA 3MFIA 3H2UB 3CNQP 2IMWP 1H0HB 3MMBA 1HWUA 3H5SA 2A18A 4K4SA 3MR2A 3SSSA 4URSA 2KI2A 2B8QA 1V5VA 4ZK7M 4DFKA 3GJQB 4G3IA 1IWGA 3TEHB 3UD4P 4ZPBA 3BGFA 2HK3A 2HHVA 4RUHA 5MAOA 1S4EA 4QW9A 4MKBA 2DNRA 3DLBA 4KFBB 4EZ9A 2R2UA 2YQ0A 4PUOA 1P27B 4JI7F 2XNRA 1UZDA 1HNWF 2MEWA 1CSJA 3M4XA 2UXCJ 4YY3J 3RBXA 1CEZA 4JV2A 2MQMA 4E98A 4C3LA 1YGYA 3L9ZA 1FNXH 3TOQA 4NXMJ 3IRWP 1RAFB 2KHCA 4QQBA 1HBMB 1FDAA 1HBOA 4USKA 2C28A 5B0AA 2BJ7A 2DT9A 3JTNA 1C1BA 2XTJP 3VVUA 1VR6A 3DRSB 4CLYA 2VQFJ 1VJWA 3TUJC 4IQXA 4LR9A 4LBPA 3SMZA 1S0OA 2V8HA 4DQRA 1WC0A 4UY8T 2HHXA 4QYRA 5H9FK 1BC6A 1JNRB 4CTAA 2DD8S 2NXEA 2N4DA 2N7YA 5LMNF 1YJVA 2IMOA 2WAQD 3U1LA 2LDIA 5JMNA 1U8SA 1P9QC 3BH6B 1U1NA 2MQOA 3J7AN 2FZKB 2VA3A 3HX9A 1C2PA 4Q2MA 2JLFA 3EZUA 5A6WA 1FO1A 4Q0BB 2B5JB 2GMHA 1FNOA 1FXRA 2HHSA 1S79A 3PRDA 2SXLA 3T6BA 2DRDA 2W7AA 2QJ3A 2HS3A 5F41A 2KM8B 1R27B 3GQCA 2XHWA 1EJ7L 4U8YA 4JI6J 1KP6A 4XIUA 4LT6A 1SL2A 3UDCA 4PPDA 2XLIA 4OV1A 4XAKA 3HHKA 2CQBA 4N47A 1M5OC 1TV6B 1W25A 3TVKA 1L5UA 4DOZA 2HS0A 5KT2A 4LSLB 3W5XA 2OIHA 2DY9A 3I56S 2W7PA 1HPZA 3SQGB 4ANDA 3C66A 3DLJA 3MD3A 1QTMA 5K8MA 5IXUA 4C8YA 5J2MB 1IJFB 4YDXA 1XNRF 1SJRA 5AXNA 3OJUA 2RDIA 5CHCB 1VYAA 1RDRA 1FA0A 1FJ7A 3BQ1A 5M2UA 3BREA 1L3UA 3JTOA 2CDRB 3LP1A 2GX8A 4JYAJ 4NLYA 3ENQA 5GMKa 1J2VA 3PW7A 4DR3F 1VC0A 1D0EA 3KG1A 4DV2F 4NI2B 3PO5A 2F8EX 3VV2B 3SSRA 2ZM6J 1DQ8A 1PBUA 3IRXB 3FCHA 3P49B 2K1RB 4TNOA 2EC2A 3W9JA 4KKOB 2G0IA 1X9SA 4IO1A 1JLGB 3HT0A 3K5OA 3M8QB 2Q6CA 5KT4A 4TU8A 2CQ1A 1JJCB 4HR2A 3PEHA 1YJUA 1E6YB 2X3GA 2JLGA 3KMQA 1U0HA 4NLSA 4N41A 4B3OB 2A2CA 2QLXA 4C8KA 5IV4A 2X3DA 2VA2A 2R42A 1OYDA 1Q8IA 2CPJA 4QOTA 2NLWA 4IR1A 3VHQA 4O3RA 1XERA 3KKFA 4KFBA 3DRXA 2IVFB 2CQ4A 2DPIA 3FMWA 1TVRB 3J80U 3VGTA 1WACA 4CH1A 4RX6A 3N6NA 3TI0A 2A2DA 3JQJA 2FTRA 4YEAA 1ZTWA 2LQ8A 2BMBA 1KR4A 3RB4A 1ICEB 1PC4A 1F5BA 5L38A 2AZ3A 2LFVA 4DFJA 4TKTA 3N79A 3DRSA 3MHYA 2IM0A 3EDRB 1QLNA 1FEEA 2HWHA 2FJAB 4U95A 5GAHU 3D6MB 5IC4B 2C1EB 1WUUA 1S9EB 2Z0GA 2MHNA 2E7XA 3QT8A 2IVYA 1KFSA 4HHUA 1RABB 5E33A 5H9EJ 4OQJA 2WW4A 4Q0BA 3ZXWA 4DV7J 2B5JA 1U47A 2XWYA 3FBEA 3DC2A 1H72C 1XR5A 4MH8A 1KTQA 2R7QA 3DFEA 1WDTA 1YJRA 1Q79A 1HNXF 4I67A 3DGVA 1XNQF 4H54A 4B08A 4IH6A 1I51B 2OPSA 2XS7A 2AV5A 3PJXA 4MKVA 2MSTA 2KFYA 4X4NA 3IC1A 2DO4A 2OEMA 5B0CA 9ATCB 2RILA 3HSDA 1OS5A 1J27A 1Q7YT 1TV6A 3US5A 4DV1J 4DFMA 3BR9A 4LSLA 2PO4A 4B3SJ 4W4MA 1SXLA 5K14B 4QWBA 3SQGA 4G6VB 1SUQB 3FSYA 2CJ9A 2QL7B 5LL6d 5J2MA 2FLOA 4RUCA 1SH3A 2U2FA 2MKHA 3OUYB 2BM0A 2D9OA 4CP5A 2IJNA 2UXCF 1K1QA 1SQEA 3MPVA 1S5ZA 1HW9A 2M52A 4NXMF 1B7YB 4ICLA 3K5PA 4PWDB 1TAQA 3TO8A 3M8ZA 4X4TA 2Y8YA 3I9V9 1FD8A 2BKNA 4NI2A 4PXBA 4FP9A 4K4WA 4FYDA 2CDQA 4OYBA 1NPRA 3W61A 2VQFF 3IRXA 3WX8A 5D0HA 5E3AA 2K1RA 3D6TB 1ZPVA 2WCXA 5ETNA 2KRRA 4FNIA 4KKOA 1TAUA 3CJQA 1JLGA 2HAIA 4GVBB 3M8QA 3KK2B 3QWPA 5A76A 4HT7A 2O01C 3DRRA 1E6YA 5HL7Q 1WJ9A 1ZBTA 3T5LA 4X4RA 2P9GA 2LQ5A 1U6BA 4B3OA 2LXIA 3N5BA 3B6BA 1RZMA 2Y9HA 5KG5A 4A8QA 3HULA 2ZH2A 2B7BB 1I1GA 1TL5A 2ZH7A 3V6HA 2RRNA 4DR6J 2MZJA 3VR1A 4DL0C 1VQ5S 4B9NA 3R7NB 3CD0A 3CDEA 2YKMB 4DL6A 1TVRA 3W8GA 2WSCC 4U67Q 1Y10A 3T41A 2WVEA 1SL0A 4JI6F 3SYZA 1SQGA 3GJTB 3E2EA 4CRJA 1U1RA 3HPOA 3GG0A 2MLYA 2ZE2B 4A8YA 4X4OA 5CZXA 2X1AA 2OTJS 4O4RA 2YWWA 2H51B 5D0RA 3QBCA 3UI3A 5E3RA 2VFSA 1RJJA 4NRTA 3C14A 3K0JA 4AL7A 4ZPCA 2R7RA 2HNZB 2HMIB 4TQSA 3KJVB 4NZ0A 1XIQA 5JJBA 1J5OB 2O66A 5J2QB 1ZOTA 2AJFE 2FVQA 6FD1A 1SVDA 3Q83A 3GCWP 1S9EA 3PEJA 3HKWA 2KG1A 4IOAQ 4WKYA 5HK4A 4F36A 2RD5C 2CADA 3W7BA 3GV7B 4JYAF 1XMQJ 1S12A 2HVHA 5EGYA 3FKBA 3THPA 3OL9A 3J81U 2DXEA 4Y2MA 3K89A 1DQ9A 1TUGB 3BO2A 3PRBA 2EG1A 1GTEA 3J7ZT 2ZM6F 3MI7X 1S76D 3IS9B 2Y3YA 1A0OB 2Z30B 1GMWA 4NCGB 2EI5A 3BV8A 1JLBB 3LPYA 1KLMB 2JRSA 5G0RB 1JLQB 1NZ8A 2RDDA 2A3JA 4EGLA 3C2PA 1TELA 3FQKA 4I6AA 4AQYF 1B64A 5T41A 4XPCA 2YKNB 2FHJA 3NNHA 1RACB 5K14A 1R43A 1CJTB 3M6UA 2EEYA 1SUQA 4YFUA 2BBEA 4EK2A 3HHNB 2CQ3A 3ZZOA 2OP5A 2HW3A 2RQKA 4ZJLA 4DV5F 1IBKJ 4Y2IA 2PC6A 5LJ5Y 3OUYA 5J2NB 3TX8A 1BQXA 1N5QA 4XO0A 2HIQA 4KV8B 2NCKL 1PKUA 2DCLA 2DIVA 2KT2A 4QIWD 3MOZA 3R9LA 4QWCA 1T7PA 2D9PA 4PWDA 4USUA 3ILJA 2V2KA 4DR7J 1SL1A 3CIMA 4F50A 1JLEB 2D41A 2VZ9A 3UQSA 1C0TB 4OYXA 4OLPA 8RUCA 3JAMY 1KQKA 1CJKB 3R6LB 2R7XA 4KPCA 3CJ0A 5F8IA 5J1EB 2GS8A 4GVBA 4RNOA 3KK2A 4K50A 1YITS 1L3KA 2CVIA 2I5JB 2QMUB 4ZA1A 2ATLA 3PJWA 1RWUA 1RT4B 2BQUA 4ELTA 5FD1A 1HFEL 2E5IA 1MLAA 2CUYA 1L3VA 3VAMA 4KHMA 4AD6A 3KLIB 1IQTA 2E9RX 3BEGB 1N33J 2R8GA 2DH9A 3HVRA 2IM1A 4CWBA 3V6JA 3ZZTA 1NPKA 2R8IA 3UCGA 3PNIA 4PABA 2LP4A 3AOBA 2XO6A 2XS5A 2YKMA 2IRYA 1RWNB 4KGZB 1KS2A 2QSWA 4ES1A 1Z2ZA 3G8SA 3QJJA 3DRYA 3BSCA 1V6HA 4ERDA 2QIFA 3PYDA 2ZE2A 1BY9A 2HSEB 3EGZA 1TUWA 4ZPWR 2W4DA 3AA8A 4DV1F 4UOGA 3HHLC 2WB1D 1C4AA 5HO4A 1TKXB 5B0BA 4JBCA 4B3SF 3PKMA 3DLKB 1ZPWX 5T7LB 1BD6A 2HNZA 2HMIA 2YVSA 3KJVA 1AUDA 1HBNB 1GTHA 4ZP9A 4C8OA 1J5OA 5J2QA 4JI1J 2W8KA 4KHPJ 1TFWA 2ZH9A 3TANA 9RUBA 3PZPA 4YDDB 5EX3A 1KN6A 2F65A 1LKZA 2BDPA 3NCRA 5I3QA 1A6LA 4NXNJ 4ECSA 5DQIA 1I3OB 4DUYF 2JDJA 3CJTA 3QJPA 3I9ZA 4HT5A 2ROPA 3R1LA 3QQCD 5LSLA 2RT3A 1FXDA 1GT8A 2ZDOA 1YJ9S 3ZNUA 4WJBA 5L46A 5DLGA 2BX6A 5KFNA 2FJEB 2YY3A 3IS9A 4HVZA 3IO1A 4WWSA 1CQNA 4NCGA 1FWPA 2FIUA 4MK9A 1JLBA 5IQ6A 1KLMA 2Z57B 5G0RA 3MEDB 1JLQA 5IZHA 4ZPTR 1HLWA 4DG1B 3X3UA 2W7OA 4DQIA 4P2MA 4EYIB 1NBEB 3BKTA 4ED5A 2ZOFA 2HWTA 4DS5A 3GSIA 2YKNA 5I4MA 2GW8A 2QYGA 5KFGA 2C2EA 2BM1A 3SV4A 1CJTA 3DLEB 2DIUA 4CLPA 1HI1A 4LVNP 2NREA 2JVRA 3FQLA 4TYAA 4DR6F 3PX0A 3NAIA 3AJ1A 4QPTA 3ICLA 1AFJA 4YMEA 3MGJA 4YOEA 2Z4PA 3UNYA 5HBMB 5J2NA 1UVKA 2OO4A 2V4JB 2C3PA 2VOOA 4LF9J 2H5IB 4JI3F 2KVIA 1DAXA 3GONA 1F5AA 2YH1A 1X4DA 4FPIA 1HR0F 3KFWX 1JLEA 1PC5A 1GMUA 4LR8A 4OV6A 1C0TA 3H4DA 4USTA 1UCNA 3MEKA 2AU0A 1CJKA 4USHA 1T9YA 3GYGA 3G86A 1LFWA 4ID5B 2NXUA 3H5XA 5J1EA 3R5DA 1S4FA 3OTEA 4FYWB 2PFDA 1EHWA 1IXKA 1H2VZ 2QA1A 4OI3A 1OMSA 3RTVA 2I5JA 1DLOB 1RT4A 1RT5B 2E5GA 1FJGJ 3CCTA 3KHLA 4P74A 2YXLA 1PG5B 3GIIA 1XMQF 1HQUB 4LF6F 3K2YA 3BKFA 2IAJB 2HFZA 1RP5A 3HP6A 2C3UA 2J7UA 1U1KA 2XLKA 4FBTA 1PBAA 3LA0A 4NL5A 1Q0NA 1HW8A 1SIWB 3HHLB 1SJFA 2HZAA 3K5NA 4ALZA 1NKEA 1JB0C 3ITHB 3H42A 3LWLA 3A12A 4MMOA 2KT3A 4DFPA 2E66A 4C8MA 2H4WB 4JV1A 1N5YA 5BR8J 1TKXA 2O1PA 4LF8F 1PYOB 5K8OA 4CLFA 2DXFA 5THWA 2FPHX 3DLKA 5T7LA 1UFWA 4OX6A 2BRKA 4KJIA 1NK0A 5IC6B 3BO3A 5D3GA 3OR1B 2BXJA 1S7HA 1VI7A 4HACB 1NJXA 3W64A 4RW4B 1KC8T 2DNOA 1IBKF 5BJRA 4ZN1A 2FHOB 4ZJQA 3P3DA 3UWTA 4NLQA 5K8NA 3R7BB 3EYZA 2J6TA 5HVGA 4HDHA 4GKKJ 4DV4J 3OHAA 1RB0A 1RTIB 4F0KA 1XEZA 3ENAA 1N0VC 4OX7A 1H38A 2R2TA 1RHMB 1X60A 2LYVA 1PILA 4IO9Q 3CCUS 2HZCA 1WOOA 2GGPB 3WHIA 1REVB 2Z58B 1SJQA 3P8BB 4UW2A 2CPYA 1VLYA 2E1RA 2AMCB 3MEDA 4WCEQ 4DG1A 4CIOA 5C7PA 1K1SA 3AFGA 3L7PA 1RISA 3VTIA 2HLTA 2DR9A 1JX4A 4LQ3A 4PKDB 2RHQB 3I0RB 2JEJA 2E1CA 1VK3A 1JJ4A 1SV5B 4QBUA 1IKWB 4GC6A 3DLEA 2V0NA 1HNIB 3GYNA 2R8JA 3TUPA 4WU3A 2CJQA 3PM9A 2MLZA 1HQEB 1RHUB 3B82A 2VPZB 3CPWR 2VU5A 4KQZA 1RKJA 4WXOA 5HBMA 3NXZA 5DM7Q 2V4JA 2NS1B 3M30B 1S0VA 3M1VB 2VPWB 1UVLA 2Q66A 3SEOA 2L9DA 3GTYX 3PV8A 2Z8QA 4LRFA 4WKRA 2CA9A 4M5DB 5IM0B 3GILA 4YHHF 3OBIA 1OPZA 3EVOA 2XMJA 2WONB 4PG7A 2B3TB 4ZVGA 3AJDA 2HRUA 2I8EA 1B4SA 4IKAA 3MUTP 3FEXB 2VHGA 5IT9Y 4ID5A 5A8RB 4JV0A 1I94J 2EFGA 4XDCA 1UPPA 4F4AA 5IS2A 1FD2A 4KHPF 4FYYB 5CCMA 3AY0A 1DLOA 2KHDA 3QYYA 3Q8PB 1FRXA 2ZH1A 1RCXB 1RT5A 1IQZA 2FZCB 1YWXA 2YKQA 2YKOA 3VGVA 1WC6A 5F9LA 2R7OA 2X1BA 2FGCA 4NXNF 2Z2LA 4FXVA 3F44A 1HQUA 4USVA 4C8NA 4OMFG 3QWUA 4U7UD 2RF2B 2IAJA 3RBDA 1N32J 1Y5NB 4CH0S 4ED8A 2DHXA 4C3MA 2L3MA 2OJ3A 1G6BA 3GMGA 5DDOC 5ETRA 3VF0B 2JEFA 4DR5J 3HHLA 4NYOA 3MDFA 2UUCF 2DITA 4NX9A 2GIRA 3IM8A 4FBUA 3N28A 3ITHA 3FRYA 4Q8FA 1IKXB 1AYEA 4PG6A 5DG8A 1SKRA 4TXSA 4WK3A 1Q4RA 1EQ0A 5L9XA 5ITHA 2H48B 4OYZA 5LMUF 2OSQA 4RNMA 4B3MJ 1TMJA 4ES3A 2L9NA 3LH2S 2HYIB 4DZ6A 3RZAA 4K4XA 5KFFA 4PYDA 3OR1A 3A1YG 3MAHA 4HACA 2AX0A 3CJKB 4RW4A 4C0BA 2NQPA 2DHSA 4YB7A 2OFHX 4IRDA 4A48A 1MW7A 1AXQA 5KOWA 1S1WB 5HMYA 2CQPA 1FFGB 2JNJA 2CIMA 2D1CA 1RTIA 4LBIA 2QRRA 1VJQA 3V81B 6FDRA 1O51A 2QMWA 1YTYA 1WEYA 2E7WA 3OFGA 5KFOA 4FS2A 4ZS6A 2E5JA 1SIZA 4QYZJ 2XCPA 3CD5A 3EGVA 4FVCA 3SCKE 4K4VA 2AJQA 3BQ2A 3AQPA 2JLEA 2GGPA 1REVA 3W63A 2ASYA 2CFXA 4DSFA 5C25B 1NJWA 1X8DA 1HL6A 2I38A 4CT8A 2BOAA 2CWKA 3Q2SC 1FJGF 4PQUB 4LFCJ 1UEVA 1UZHA 3CXCR 3I0RA 1WOSA 5KFVA 2AQ4A 1RCOB 1SV5A 1IKWA 3NCQA 2VUGA 5E0OA 1HNIA 5LSOA 1UKUA 1N88A 3PRVA 5DG7A 3CCSS 4IG0B 1QVFR 1HQEA 3I55S 4RW6B 1NB7A 3G96A 2ZDPA 1YJWS 3CEDA 2ADCA 1S48A 3M30A 5EWGA 1EKSA 1H3DA 3IN5A 3CWJA 3M1VA 6AT1B 4EBEA 3QATA 2ZKTA 5CXTA 4ZVFA 2RAQA 4M5DA 5IM0A 2CVEA 2KO1A 1FF2A 3CCWA 3NBPB 2Q79A 4ZPVR 2WONA 5BR8F 1A7GE 1TTHB 2COLA 2C2KB 3GV5B 3D3CJ 1TUVA 1ULRA 2UVVA 4GRSA 5A8RA 3T1HJ 2UU9J 4BHQA 5E7OB 2Y1IA 1RUSA 2A0FB 3A4TA 2IC3B 4NLXA 2E44A 3D4JA 3EE3A 1YRUA 2QFJA 4CLKA 1NK5A 3CCES 4DSJA 4LF1A 2F4VJ 4AXJA 2Z2MA 4B9VA 3HD2A 2KXNB 2RF2A 1FDNA 2CZVC 1XMOJ 2E9ZA 2B4OA 4CO2A 1D9DA 3OTBA 1SC6A 4O3NA 2XMTA 4CQ1A 1OWXA 2EFNA 3S01A 1FKOA 1MROB 3OL8A 2G0CA 2EFPA 3OXLA 2G4BA 3R5CA 2P5VA 3AHPA 3OVBA 2ZNZA 3R97A 2XGPA 1IKXA 1OY8A 3CC4S 4DCPB 1ZH5A 1Q53A 3QGGA 5KT5A 4P9SA 4OYAA 1U25A 4FKYA 2ZEJA 3EVMA 1FDDA 2K2PA 3QJLA 1W2IA 5IWAJ 3BR8A 3CTRA 3DYAB 3OTDA 3ENWA 2IBOA 4KGXB 5EX0A 2HHHF 2JFKA 5ETOA 4CO0A 1QVGR 1ZA2B 2UUAF 1CULB 3CJKA 1N56A 1WD6A 2QTWA 4Y00A 4Y6IA 5EWEA 1FWLA 1S1WA 1VQMS 2AJ4A 1C4CA 1X5SA 3V81A 4DR2J 3T1YJ 3DOMB 3FJ2A 1AT1B 3C19A 1H73A 2C3OA 2DHHA 3TA1A 2DNQA 4ZVSB 1R8PA 1Y0HA 4K5RA 5ETQA 2M0GB 2DNNA 1Q16B 4F8RA 3IXQA 4LRAA 3R1HA 2XC9A 2N82B 5FLXU 1IBLJ 1I94F 3AJ2A 4X4QA 5C25A 2DNGA 3D28A 1HMVB 2R8KA 3KHRA 5KFTA 5KFSA 4QIEA 1IR2A 2WK4A 3PXGa 2XYHB 2DPJA 2DNYA 5CAAA 3GIKA 4PQUA 2FVRA 5L39A 2BANB 3RW6A 1WDDA 4ILLA 2I1RA 2NXNA 1R0CB 3P45B 3A8JA 2CNLB 1X5OA 1N32F 1D8ZA 1DHMA 4K7QA 2GVDB 4IOCQ 3PX4A 4IG0A 2MZTA 4DZDA 1P9YA 4RW6A 7FDRA 3T6JA 1QJHA 3B4MA 4DLGA 2CJBA 2QLWA 3EDQB 2W2MP 4QWAA 4DR5F 2EPIA 4LF2A 4KRWA 4N8OA 1RHJB 2B7CB 2N3LA 1VC5A 2DGXA 2AYBA 3HHDA 2D7SA 3NBPA 5HAOA 2V2QA 4A8FA 3WX4A 3KLHB 2Z56B 1XQIA 2BYCA 2KG0A 1KTVA 1LNQA 2Q43A 4HDGA 2POKA 4B3MF 2KXFA 3NS5A 3V5RA 1F2HA 2EFQA 1RAJA 5HP1B 1WG4A 2IC3A 2G2ZA 3ZTRA 1WC4A 3LO3A 4J90A 3KUEA 3MPUB 4FKXA 2BE2B 1X0FA 2V8PA 2WW8A 1U1PA 1EX8A 3BGLA 3JSRA 2MXYA 2VDIA 2LA6A 3MPWA 2MHEA 2MQNA 4L6V3 1AROP 4X65J 3LGNA 3ENVA 2CYYA 2H9ZA 4WTYA 3UW1A 4OX8A 2RVJA 3PW0A 3PCOB 5A0YB 4K2XA 1VQLS 1MROA 2UVUA 2WOMB 2DNMA 2DRBA 3QFHA 3MCSA 3R2CJ 4P72A 4J9RA 1IR0A 3ZTPA 1UW9A 4HTJA 1BGXT 1RI7A 2DXDA 2CG4A 1S6QB 3GYXB 4KH0B 4K4ZA 4P2SA 1VBYA 2DGOA 5ETVA 1U6FA 3ADAC 2A1BA 4XTTA 1MN7A 4YR0A 2B0GA 1IUJA 3DYAA 3PX6A 3HFKA 4M5NA 4FYXB 4WFZA 2F63A 2EG2A 4RL1A 4UZCA 2MZSA 1F2GA 3R2DJ 1Q86T 4PG4A 3D1OA 5KG7A 4QR2A 1FXLA 1CULA 3QIDA 3BQ0A 4ZVUB 1KHVA 5KFHA 1N5VA 3KK1B 4YB6A 5CYQA 4DPYA 1NJYA 3JQMA 3DHXA 2BJ9A 3C46A 2D3ZA 4A8KA 1JWWA 1QAXA 3R3TA 4JI7J 2G1DA 4USJC 3I32A 1HNWJ 2V6AA 2W2PP 2B8PA 4KE5A 2FYXA 1IBCB 3MM9B 4HLBA 3N01A 1V9OA 1EIYB 1QSSA 2D74B 1VQNS 2V8GA 1TR0A 2VC0A 5F8MA 1KWMA 3T1HF 2UU9F 2DR7A 3OR2B 1HMVA 2QLBB 5HSPA 3HSJA 5D4PA 2J0QD 4MK7A 1NKBA 4RZRA 1VRQC 4FZVA 2BANA 5LMNJ 3P6YC 4HTIA 2XY6A 2W9CB 3GJSB 2KRBA 1DJ0A 4WFXA 2KXHA 3G87A 4Y34A 2FB0A 3RYLA 3SIPB 1KNZA 1J5EF 1XMOF 2GVDA 3RB6A 8AT1B 4LF7F 4DQQA 1JLAB 2J9EA 2B4UA 2IJRA 3LANA 2DEIA 4TLQA 5AT1B 1OYEA 3D66A 2LEBA 3M32B 3N4WA 2L48A 1AW0A 4ECTA 4EU0A 1YZ7A 1P1LA 3EUNA 2RRBA 3KLGB 1B7FA 2KDOA 1CLFA 4K4TA 1R3NA 2IYGA 4NZ6A 3CDWA 4N8NA 4JI4J 3KLHA 4NWBA 2G9OA 5KAKA 1SKWA 1P6TA 1VQYA 1S10A 4ED3A 1YZ6A 4UOFA 2CNKB 4A8SA 4ZP8A 1K8AT 1AFIA 2BJ3A 2YKAA 5HP1A 3OQ2A 4FNHA 2YNFB 2BV3A 2IBKA 1N0UA 4OI1A 4NLTA 3H0PA 1YBUA 3GFHA 2BE2A 1PAEX 2UXDJ 2HFOA 2XSFA 2RIJA 3Q22A 2AX1A 2HBYB 2YKPA 4EUVA 2HQIA 5D4NA 1UFKA 1XNRJ 2CJKA 2K7KA 2DGUA 1T9TA 2OH2A 2V34A 3T1YF 2BVZA 3OHBA 3NOCA 4CT9A 2P9CA 2NXJA 1U4BA 4LJMA 4MIWA 4F4XA 2FQQB 3D54A 3Q2TC 4KT0C 5A0YA 1JJ2R 1VISA 1WEZA 2QGFB 4DV2J 4C6AA 4I64A 1RT7B 1RWKB 1IBLF 2WOMA 1QD1A 4BBYA 3TX0A 1FVSA 2C2OB 5ETMA 3Q24A 1PYTA 1GMVA 2ZBRA 4NA1A 1S6QA 5F8JA 2HBQB 2RNEA 2HS4A 4JP8A 5C24B 3CMES 4OJHA 4ID8A 1URRA 4ECZA 3ELHA 1PCAA 2LXUA 2MKCA 4B9LA 1X4HA 2D69A 3IBWA 1X7VA 4OYIA 3RBZA 1VQ6S 4NLDA 2WZ1A 4J37A 4AXIA 2DBBA 5KFDA 4Z7YA 5A2QY 5C2CA 2J8SA 1S0NA 4X84A 1ZM4A 3TVYA 3TW0A 2M9KA 3RR8A 4FVMA 3FK4A 4DL4A 4LFBF 4C98A 4OZLA 1EP4B 1Q78A 4LSNB 5K20B 5I42B 1M5VC 4ZVTB 3GCXP 4DUZF 2V68A 3MFHA 4RW8A 3FZBA 5KTQA 2XYGB 3MM9A 4J9MA 1JMTA 3H7HB 3MCNA 3IWNC 2CQDA 2ZC4A 4V19J 3NGRA 4DX6A 1BUXA 2GMJA 4QJVA 4EI2A 3OR2A 5HVHA 5D0GA 3OTOJ 1EQMA 5KG3A 1YJ7A 5C2GA 2XMUA 2W4CA 3NGKA 1M5KC 2HQ3A 3QMQA 1U48A 3QO9B 1TMMA 4YR3A 2W9CA 1T3NA 2V2ZA 2OPRB 2VL1A 2ABYA 2OSRA 4LBHA 1E6VB 1HD1A 4IFVA 2ASDA 2ZOMA 1JXVA 2RUSA 2EBGA 3MUVP 3TNVA 2AW0A 2E29A 2P6TA 1U09A 4X65F 3E3XA 2IFXA 1JLAA 2ALZA 4OI0A 4C97A 4ATNA 2ZFHA 1OQ6A 4OZ0A 1NDKA 5K8PA 1WI6A 3M32A 2HHQA 4CO3A 2A6OA 1HNXJ 3R5BA 1NK8A 3KLGA 1XNQJ 2DH8A 3FVYA 2GMLA 1LOUA 1SPBP 1H2UX 4GKJJ 2HURA 4RKUC 3AODA 3LQVA 5HQ8A 1W26A 4CDIA 5LXRA 1KONA 4A46A 4CLSA 2RJZA 3OFEA 2YX1A 2R7TA 4DV3F 5GMEA 3TQ1A 3LP2B 2WVDA 1F0XA 1FE0A 5DLFA 5KFEA 4LMZA 3UO0A 4X4UA 2YNFA 2MB0B 1U0HB 1JKHB 3H4BA 2EC0A 3BPSP 4BCAA 3PHEA 2H1YA 4F67A 1RWOB 2CQ2A 2GV1A 1U8WA 1UL3A 2XS2A 1UETA 2XB2D 1YX2A 1UJ5A 2MLXA 4WTOB 4TLRA 4B9MA 2WSEC 4DQPA 2CJXB 5HATA 5DM6Q 1SBRA 1XR6A 4DEZA 4FXWA 2ZHOA 3RAQA 3Q8VA 5D8HB 2HVZA 5A8WB 5GADI 4A8WA 3GFZA 2MKKA 1N8RT 4X62J 1RT7A 4RJVA 2H54B 5JVHQ 3AB2B 4K4UA 5KG1A 2VBWA 4PXCA 2IY5B 2B9YA 1X9WA 2BW7A 3UD3P 4F0MA 5A6PA 4EZ6A 4HL9A 1FERA 3NMRA 1H7XA 2PA8D 5C24A 3DDKA 2OHDA 1S9FA 1KQFB 1FJCA 3IP0A 4F4WA 2ATCB 3CJ8A 4E0DA 2OPQB 3I4HX 2F8MA 3AD7C 3PYEA 4IH7A 1M1KT 4NOHA 3CVKA 1U02A 1R0BG 4DSKA 4ZHRB 3TZYA 3O1LA 3D0IE 4HH0A 2FHMA 4LRBA 4W90B 2W2NP 2QV6A 4WK1A 4TVAB 5F0UA 1RAGB 2JEGA 1GH8A 3AAWB 1EP4A 4LSNA 2V9KA 3GZ7A 3CDAA 5I42A 2B9WA 4I2PA 2K06A 3G8TA 2OPSB 3WZ0A 2FVPA 1BMQB 4JI4F 3V6DB 2RSQA 2Y1JA 2IIHA 3LPEA 1N36F 4DS4A 4WFBQ 2ASLA 4O3OA 1S1UB 4QPXA 1X5PA 1M1HA 2HGLA 4RW7B 3M9NB 5GAHI 4ZMMA 2AJ1A 1LW0B 4HHHA 2VG5B 1UWAA 2HK2A 2R3VA 3G6XA 4R0JA 1XBWA 3DMJB 1NNDA 2V2VA 3S1TA 3NKYA 1JLCB 1YDLA 1H74A 2HRTA 3KNGA 2UXDF 3QO9A 2XM3A 2W25A 3QPIA 2GQQA 2OPRA 2MY7A 1E6VA 3BYPA 5KT6A 3D7SB 3FFIB 3OW2R 5AXKA 3G4SS 3NGTA 2KYXA 4ECRA 1O0PA 4X64F 2E5LJ 5B0DA 3BN4A 1K0TA 1NB2A 5KFAA 3ZTOA 3K58A 2D3UA 3MEGB 4KO0B 4NZ7A 3KDOA 4ICLB 3MXHP 1ITPA 3V4MA 4I1TA 3CF5Q 2YTCA 3K5LA 1TL3B 1Q1KA 3THVA 3BM7A 4F2SA 4X4VA 2M8HA 1WOPA 2HQCA 2CNOB 1VIOA 1RT3A 3SZ2A 3AOAA 3NS7B 3UN3A 1RWVB 3WIUA 5L9NA 3TEGA 3NNAA 1VHIA 2DYAA 2WVCA 2RU3A 1MNEA 1C0UB 2AGQA 2W4PA 3HLUA 2CPZA 4JI2F 3MECB 3LP2A 1B99A 1WEXA 3A3NB 2HG4A 3X1LB 2MKJA 2DNKA 3TRGA 3DRRB 2HQGA 1ELOA 4AQYJ 2PFFB 2R2RA 3MM6B 1M90T 1JKHA 2F3JA 4CYUB 4F02A 1I6JA 4HEA9 2FJXA 4WP8A 4J9NA 5LT5A 1IBMF 2HQFA 1DURA 3NGSA 3AB4B 1RAOA 1AB8A 4P73A 2K3KA 4DV5J 4WFYA 2J5AA 2BJ1A 4C0OC 4RNNA 2NYHA 3FCVA 2VQEJ 2CPIA 3M8YA 4EBDA 3CDUA 1FKAF 4DN0A 1WI8A 1PO6A 3BKUA 4QR1A 2AYGA 2LA4A 5KFUA 5AE1A 5A8WA 4JV5J 5CA5A 4ED7A 2E9TA 3J81j 1FTRA 2J9CA 3EX7B 3B8HA 3KXDA 2M7SA 2UUTA 1VGYA 2ZZTA 2MQQA 4QW8A 4FF3A 4JB8B 3C14B 3OTOF 1CQMA 3OT9A 3G82A 4QIFA 1S6OA 2FLPA 2QLFB 4ZLPA 5FIIA 5GAGU 4O3PA 2GO9A 4JI5F 4M94A 2GJIA 3ISZA 4F3QA 1JLFB 2GHWA 3G8QA 4XDDA 5HMZA 2OPQA 2XMAA 1V5IB 3EGWB 3POTB 2ZWPA 2CPXA 3CUNA 4ZVHA 4ZHRA 4RWWA 3I87A 3QNWB 3TAPA 1I5OB 5DS7A 4H4OA 4KSEB 1RT6B 2LQJA 4O0NA 3QSIA 5LJ3Y 4UQGA 4PAAA 1U24A 2NUUG 1RSCA 3D0HE 1FFWB 4CO5A 3MMCB 3CJSA 3MR6A 1G3OA 1DFDA 3CCJS 4GKJF 1U1OA 1NDPA 4I7FB 1VC6A 2VBYA 5D77A 3TUIC 3V6DA 1D1UA 1W7WA 4NCAA 3SDEA 2HVDA 2KFNA 2BACA 4U6PA 1S1UA 1F6TA 4ZVQB 4EWTA 4RW7A 3T5HA 2XMWA 2ZJQQ 3GFXA 1LW0A 4R5PB 2VG5A 2OMOA 3HDSA 1WC1A 3DMJA 1YSJA 2DK2A 1JLCA 3CO9A 2ADBA 1B70B 4N7TA 4QIVA 1REGX 5F8NA 1T3OA 3H20A 3C15B 4CNYA 2JC0A 2C2RA 3FFIA 4PEOA 2XULA 2ZHBA 1PYSB 4Z2XA 2XO7A 3EZ5A 3MEGA 5F8LA 4YR2A 1WWHA 1Y3KA 4KO0A 4M95A 1SJ3P 4DUYJ 4M5HA 1RTHA 3HMJG 2W2QP 2MKYA 5U47A 5B09A 1QM9A 1U6ZA 3JYTB 1Y5IB 3JB9k 1JK9B 3FBFA 1TL3A 3IAS9 4X62F 4QU6A 4ED6A 3FBBA 1O6XA 4ECUA 4IYQA 2K3IA 2MMYA 3R27A 2CPDA 2AWZA 1OQ3A 4Y2KA 2VDHA 3QAEA 3VAKA 3G9CA 4ED0A 2F9DA 4KR0B 1C0UA 1RAHB 3MECA 3OD2A 1WKJA 2UVWA 3ZC4A 3Q23A 3HK2A 4RU9A 2ZZNA 2GVZB 1JQGA 3EWGA 3GLJA 3IGNA 3MM6A 1T9VA 1DY3A 3HSGA 4DV0J 5MLCV 4CYUA 4GC7A 2FY1A 2JVOA 1HA1A 4KPYA 3QGIA 3I0SB 1PGZA 1FRIA 5AE3A 4Y28C 4RBUA 1CPZA 3Q8QB 4OZ5A 4P52A 1XR7A 2C22A 3I6PA 4NLUA 2YPYA 2PMZD 5H9EK 5E3QA 2CPEA 1NSKL 1VS3A 4S0MA 3Q8UA 4JI3J 2PEBA 1S1XB 4DSIA 1F1BB 1NCLA 2HHPA 2NYIA 3BJYA 3BBCA 4Y3CA 1LXJA 3FRZA 5EDWA 2XBPA 1HR0J 3DNCA 4ILMA 2M5YA 3N0VA 3SSQA 3MURP 3QLHB 3NP5A 4I6YA 3OSNA 4DSLA 2BRLA 1WHVA 1X4GA 3Q0AA 3CW2C 3RGIA 2J0WA 1RU1A 4DDFA 3VQSA 2EXUA 4NMXA 2RKIB 4Y0FA 4YS2A 1JLFA 4EMDA 5GMDA 4L3NA 3V6KA 1DTTB 3NMAA 4M5KA 3HSZA 3POTA 2V9WA 1LFPA 2D3OR 2L9WA 2E5LF 2YH0A 3FNNA 1WG1A 1X5TA 4MT1A 3K8VA 4U7CA 4LF6J 3HO1A 2W24A 3J7YI 5M2PA 1RT6A 1U2CA 3BBBA 2YNHB 2G2YA 2FUG9 2CZ4A 2XZWA 2PMHA 4Z37A 3MMCA 3MM7B 5F0WA 4IOBA 2KN4A 4B9TA 3M2UB 4WFNQ 4I7FA 3MPYA 2B56A 5ETPA 5D15A 1F5CA 2DHGA 2Y0SD 1H6KX 3W3SA 4CCHA 2M88A 4DPXA 5GAEU 4MK8A 1YQHA 5CQGA 2LECA 3OJSA 2M70A 4OJGA 1VOMA 2W9BB 3RJMB 1FTCA 1QSYA 4LF8J 4R5PA 4I6WA 1FJEB 4W92B 3DRPB 3VAHA 5HN0A 4NE9C 3SBMA 4C0HA 2ROEA 1X9MA 2V94A 1O5JA 1ZM9A 1U2FA 5KG6A 1RADB 3M2VB 4ZDNA 1NHUA 3QAUA 3C15A 3TZWA 2UV8A 1R7IA 1YG0A 3G2XA 2VQEF 1HD0A 4ETXA 3MEEB 2HEKA 2LQBA 3H8YA 2HGNA 2XMVA 3HKZD 2HLUA 4JV5F 2BEFA 3JYTA 3CJRA 1WC5A 4H4KC 4DL7A 1FFSB 4GMKA 2FJDB 3EGNA 2CKWA 1ZS6A 2HHTA 4N5SA 2VPXB 1H7WA 3W2WB 2C2NA 2AEFA 1HWLA 5KG0A 5HLFB 3DKDA 1WF0A 2NUHA 2P8IA 1RHQB 2HBZB 4PWWA 3PW2A 4BWMA 4NASA 2IDLA 1Q82T 4KIAA 2VIHA 3E8OA 4RUAA 1CVJA 2CPFA 2ZH3A 3BDPA 1FCAA 5EUHA 3M6WA 1PSDA 2GVZA 1VRTB 5DDPC 3ET6B 4HKQA 3JS9A 3Q8YA 5H9FJ 3I0SA 1OY6A 1WSVA 3M9OB 3LTOA 4YB5A 2H3EB 4UZBA 2LU2A 4N76A 4RUBA 1BXNA 1TL4A 4NA3A 1RA7A 3CC7S 2I9SA 2ROGA 4OI4A 3HFZB 3PJ9A 1YKWA 1LK5A 1SKSA 3C8YA 4Y2CA 1S1XA 2GIFA 1JIHA 2RRAA 2MZ1A 1GAOA 4YHHJ 1ZM3A 5CABA 2AT1B 2MKSA 2WSFC 1N5YB 2Q6BA 3B4DA 5F3ZA 2IA0A 3GIMA 3QLHA 1YVFA 3IBCB 8ATCB 1UAWA 2ZITA 2RKIA 5D3GB 4P7VA 4ZLNA 1UVJA 1Y7PA 2J76E 1DTTA 4KGVB 4W98A 4MKYA 4MTPA 3A3PB 2J9DE 3MZIA 4DPUA 5J1NA 5DDRC 2ZBQA 2R4FA 3PIOQ 3CCZA 3HI9A 2YNHA 4XPEA 2IRUA 2DGQA 4NLRA 3UN2A 3ZZZA 5C5JA 4OZNA 5DQGA 4RR5A 1GFWB 4LVOP 2BQ3A 1VBZA 3SQOP 3TAMB 2VFVA 3M2RB 3MM7A 3CJ4A 4DX7A 2AJ2A 1SJ1A 3DLGB 1K73T 3M2UA 1RAIB 4NCBA 3MM8B 1UMJA 4O44B 3T5JA 3RRGA 4LFAJ 2UUCJ 4B02A 2YNGB 3S7RA 2G0JA 2R9LA 1DBDA 2WVFA 3OLBA 4FF1A 4MFBB 4DWIA 2KZZA 4OHZA 1WORA 3KTQA 4AE5A 1RLCL 4AFFA 1JNZB 2W9BA 3J80Y 3UPFA 3DRPA 5LMUJ 5E41A 1HIYA 4DV0F 4TYBA 4DXLA 4NRUA 3ILIA 2DJWA 1LEOA 5AE2A 4OI2A 2RQ4A 4X2BA 5JXSA 4B9SA 2AP6A 2MDAA 3M2VA 2CRLA 2QA4G 3BDEA 3CD6S 3MEEA 2VICA 2C2DA 2R7UA 2HHUA 4ZVEA 5CH7B 3IFEA 1SC4B 4B3RJ 3NOGA 3NS6A 2FC9A 4RNFA 3RUBL 3D67A 2DNHA 2RQMA 4K0KJ 4PG8A 1O8BA 2ACMA 5G4DA 1T0TV 4M1KA 4UY85 3Q8SB 2XWXA 3W2WA 5KFXA 1IVZA 5HLFA 1NH7A 1NM2A 2RU9A 4DCOB 1NRKA 2VASA 5FDLB 3JAMU 4ZCLA 4KTQA 1SH2A 3J7A1 1T9XA 2WHOA 3QRQA 3DXSX 1S59A 3KWMA 4A47A 2E1AA 1PJ5A 4UOHA 2RQCA 1KRPA 1L3TA 4OFZA 3FUYA 4ED1A 1R89A 1VRTA 4MYUA 2LKZA 4G1QB 4WBFA 3T19A 3ET6A 2HRYA 2I0XA 4F3OA 2WVBA 1P1TA 4ECYA 2GC8A 1T02A 4PPZA 1R0AB 3RRHA 2MY8A 2YQ1A 2FLLA 4OX9J 2JC1A 3K59A 2UXBF 2OD6A 2LMIA 5DZ6A 3UFCX 2BQRA 3TA2A 4LUBA 1OJ4A 4J9UE 4EBCA 2M2BA 3FGVA 1RWMB 4NLPA 2WB4A 1WKKA 4Y65A 3TAQA 2DR5A 1R6YA 1Q8BA 4F3MA 3BGUA 3H40A 1S9GB 1CS4B 2RH3A 1V3SA 4P7TA 3DLHA 3T9NA 3GV8B 4U96A 4TY9A 4V19X 4F26A 3JTPA 3HF5A 4WYLA 2XHCA 4ZVRB 3GR1A 2VKZG 2NSCA 4BDPA 5AXMA 4ELVA 1ZYQA 5J1PA 3KG4A 4CI0B 1X4FA 4ZP6A 4DUTA 3L09A 5IOLA 5GADU 2IA6A 2MQ8A 3BN7A 5DJBA 1FEHA 2C2ZB 3QT7A 4JI0J 4B3TJ 4V1Ak 3LOUA 4PXDA 1RHRB 3NGDA 3MCMA 2PEHA 2VD3A 1NSAA 2PGCA 4O4GB 3GPAA 3TAMA 3M2RA 3IM9A 2R2SA 5HQLA 1KFDA 4ITSA 1M5PC 3PACA 2ZBCA 3DLGA 5B0EA 3BF4A 2Q3PA 3MM8A 4O44A 2O5DA 1WNEA 1RA6A 2YNGA 4DJBA 3UNGC 4DL5A 4MFBA 2EBEA 1MMDA 4NA2A 3ISND 2OUGA 2OGUA 4M8LA 2VFRA 4G1PA 3EXCX 2HVEA 2PT0A 3PYGA 1NHKL 2X7IA 4ZOSA 3TZXA 3OL7A 1JXLA 3PY8A 2W01A 2UUWA 4OYOA 4NMLA 2H4YB 2HHHJ 3D5MA 3VWSA 2UUAJ 1HBMA 4LSZB 2L08A 4F4ZA 3I96A 5CYMB 3FSIA 2HQDA 2H5JB 4H4KA 5KFJA 4QWEA 4L76A 3SFGA 4RNHA 3PO4A 3LP0B 1M5SA 1T95A 1A9NB 3H98A 4ZLLA 2BE9B 3OV7A 1F9EB 2CJAA 4FN5A 1VQSA 1NU4A 1Z1ZA 1RWPB 2U1AA 3K7RA 2QA4S 1KKHA 3HHEA 5FDLA 2K7JA 3M8PB 4F4YA 1WSRA 2N3OA 3ETMA 3OFFA 1QUPA 1LK7A 2ZH5A 1LWCB 3J81Y 2PSZA 5KFZA 5JVGQ 2HPUA 4OJ3A 2Q1LA 3FMBA 4FDFA 3D68A 3GFYA 3GP9A 3U1MA 2VB6A 4G1QA 3UVJB 4RWXA 4XK8C 5D4OA 3R8YA 2BUNA 1QY7A 2F7VA 2YBVA 3MAQA 1WKLA 3MR7A 2ZUAA 1RKIA 3LW5C 2FD2A 1D09B 2DCUB 2IHR1 4L73A 2ZBPA 2HHWA 2B9EA 1R0AA 2KH9A 2JFDA 1HWIA 2VFTA 5I3UB 3DDIA 2XZTB 3R5AA 3D1HA 1NZAA 2OD4A 2C3MA 1FKOB 4N77A 4JUZA 2YQ3A 4EYHB 4LFAF 1VDHA 1JJHA 3JSBA 1YI2S 1B0PA 3HCXA 4IRCA 3AQOA 5L1KA 2W9AA 3QSYB 1S9GA 4IQMA 1CS4A 2A10A 3UCUP 2MJNA 1QUVA 3CC2S 1D3WA 4DX5A 4DPTA 5SUHA 2HNYB 1MMNA 3AD9C 1NK4A 4OZ3A 2EFOA 4YY3F 4F4KA 1IJEB 2VJUA 1WHYA 5KOXA 3LWMA 1RBOB 5KFPA 2O67A 1X4EA 4FF2A 2XLJA 1SH0A 2X1GA 2CWXA 3WC0A 2MKIA 4Q2LA 3VCDA 4DL2A 3R6GB 4WIIA 1DTQB 1Y11A 4ZJOA 3CO0P 2FJWA 3D9BA 1IN0A 2AF6A 3UDVA 4QR0A 4B3RF 2JH3A 3LGMA 3TP2A 1WF1A 2J7KA 4UTGA 2YNIB 4K0KF 1V3ZA 4O4GA 4QIGA 2A6MA 3E01B 1F60B 5EHHA 2B4VA 3CMQA 1TFYA 3F0NA 2HWIA 2AGOA 3IR5B 2F9JA 1M1GA 5IT4A 1TU0B 1T94A 3G6VA 2YWEA 1RHKB 2W8LA 4F25A 2VONA 1K44A 3W9HA 4O23A 2MSSA 1XTZA 3KJQB 2BZ2A 4LRDA 5ADZA 1HI8A 3OLAA 3TYTA 2YWHA 4UF4A 1UA1A 2DR6A 5LOQA 2AHOB 4QWDA 2BJ8A 3KLVA 5F3TA 3HJVA 5CYMA 4OX9F 4LRCA 4DPOA 4GO5X 2XMMA 3OXGA 3FEZA 5BYRA 1Q8LA 4WIQA 2BJDA 5KFRA 3LP0A 3TARA 3DCAA 3TJ8A 2QG9B 2V69A 4P2XA 4PXEA 5HJYA 4NLVA 4TN2A 2APOA 3EZOA 2GO8A 2P9EA 2J7WA 1HBUB 2VPYB 3GU0A 2DGSA 4OYMA 2EW9A 5LM7E 2UZAA 1YRTA 1WG5A 2AJ0A 2IDEA 5ETSA 3MTKA 3M8PA 2UP1A 2CQCA 4DBQA 2OELA 1VQ4S 5IT9U 1LWCA 4C2MA 2OFGX 4D3GA 2VG6B 4AL5A 4CLUA 1Q81T 1RAEB 2MPUA 5E2QA 3UVJA 1VBXA 2AYEA 2JHEA 4ZCIA 2LEAA 2AEMA 1S0MA 4JI0F 1DRZA 4B3TF 1IM6A 1VLOA 2KJVA 1J5EJ 3J7Z5 2WBRA 3AOCA 2Y8WA 1PJ7A 3OPKA 4LF7J 5HMXA 5ETLA 2CPHA 2AD9A 4G1IA 5I3UA 2K8GA 4WU2A 2FHKA 2PA3A 3F73A 3HT3A 1VCTA 3LF0A 1TKZB 1LXNA 2V8DA 4OHWA 3T5KA 3KHGA 1CJUB 3KNAA 5LSRA 5KG2A 2ZC3A 4DX8H 3BGOP 4Q43A 4DR1J 1YJNS 1MG7A 4LQ9A 2F8HA 2UVRA 4KYZA 4QYZK 2DGWA 2D3O1 1FRMA 2HNYA 1YLXA 1VQPS 4MJKA 2NSBA 3WIVA 4YP3A 1Y4ZB 3HFVA 5CCLA 2QYCA 3BSAA 1FDBA 2DNZA 3ZZ0A 4ZIWA 1S1TB 2C42A 3CCQS 4DPWA 1AUSL 5KFIA 1KQGB 1SCJB 4MIAA 3NWRA 1IWAA 3CJ3A 5CYQB 3TVZA 1G4CA 2OKQA 2QL9B 4NEZA 1OY9A 1DTQA 2CNNB 3U27A 3ILLA 4OHYA 4N56A 1NDCA 1N48A 2YNIA 3U7JA 3MCOA 4ED2A 4IUFA 5CD4A 4ZVPB 3G6YA 5D78A 3NNCA 2P2CB 3QT6A 2CXEA 3E01A 3IR7B 3BSOA 3OL6A 1IKYB 3RAMA 4DV7F 2N4CA 2ZVIA 3I4PA 3RR7A 4MIBA 3C6UB 3D0GE 5B08A 5CD4H 5HANA 5KT3A 3N5FA 1S57A 1QAYA 5M2RA 4DN9A 1UJ6A 5IQQA 1NPPA 1CG2A 3J7YU 3HVWA 4BC7A 3W62A 2KFZA 4U9RA 1LW2B 3MR3A 4OZ2A 3SCJE 3VAFA 1BWVA 3TR5A 4FPRA 4KC5A 4GVLA 1FRHA 3BSNA 2GA7A 3KJNB 1KVJA 1WHXA 4J9PA 1MMLA 5JUMA 4DU8A 4O0IA 3KMSA 4LFBJ 1OPIA 1NK9A 1F3VA 3EPIA 1FRLA 3L4BC 1AZSB 4DUZJ 3MOJB 4KAIA 1HBUA 3BZQA 4KGMA 1FE4A 5L1LA 4ETZA 1VQOS 3CB4A 2BA9A 1UVIA 5J2PB 4RW9B 2BABA 1B0TA 3CDBA 3ZZUA 4C4WA 3VAJA 4EO6A 4J9SA 3PW5A 2VG6A 3S6EA 2C3YA 2LXFA 2Y0BB 2ZH8A 4HYKA 3PTWA 3W9IA 3PR5B 5B0GA 2BKOA 1ZZFA 3ZNJ1 4ECQA 3O8WA 1S99A 2MZRA 5HI7A 3W65A 4WP3A 2VOPA 4PQAA 1RXOB 2KU7A 3NAHA 3DI6B 1EB0A 1KD1T 4NYPA 2JJ4D 1BHNA 1GX5A 1X0PA 3O2IA 3QGHA 3NCPA 5KT7A 5ETTA 4LF4J 1U49A 2JL9A 3KLFB 2PN6A 4PCQA 1Q5YA 2DR8A 1TKZA 1NHVA 1CJUA 1SQFA 1M5HA 4K59A 1N34J 1SC3B 5HJXA 4IH5A 1PIEA 2EWHA 4RLEA 2GAGC 2UUBJ 4RO0A 4DV3J 2ZVSA 2GCFA 3KLEB 4KV8A 2VBZA 1XJWB 3ZTQA 2P6SA 4IR9A 1ZAVA 3MMAB 1KVKA 3CT9A 2GJ2A 4UUWA 1UJ4A 4H4MB 1S1TA 1BWEA 4ZCMA 3AXKA 3G6ES 4A8OA 4NYZA 3M8RA 1W2BR 3CCRS 3NWGA 2I6WA 2OPPB 4DLEA 2PI4A 1NSPA 4UOCA 3CD7A 3ZTSA 4ZP7A 4ZPDA 2MTLA 2HFUA 1KLNA 4RW8B 2XI2A 3PKYA 4OYPA 4M5LA 3QGPA 2DH7A 1Z4UA 4IG3B 4OZJA 2OAUA 5DGBA 4ZCKA 3NEKA 2F5GA 1R31A 1HWKA 1S1VB 1HHSA 3R5JB 3KLIA 1VK8A 2QZ8A 3M9MB 3OVAA 1IKYA 3QIPB 1EETB 1G7CB 1LQ9A 1NK7A 1T03B 2CQGA 1XK8A 1URNA 2QA2A 3C6UA 3A8EA 4M5IA 3JSYA 2DRAA 4M5JA 2Z2YB 3NG8A 2RB7A 4ECWA 4BLGA 3W2VB 1LWXA 3P5BP 1DZ5A 2H65B 2J0XA 2NR0A 2FVCA 2ZBIA 4R0EA 2GAHC 3HVAA 2XI3A 2NPFA 5F9NA 4IFVB 5HMWA 1K9MT 1LW2A 5E3CA 4L3KA 2M8DB 3IGVA 1KHWA 3ILOA 1RTDB 4ED4A 2OMLA 1GX6A 4HI1A 2DGVA 4ILRA 1FESA 3VQTA 3K57A 4DMZA 3ULHA 3H5YA 3I5BA 3M8SA 5D6GA 2YX4A 1VQKS 2NPIA 4DHVA 4WXWA 2KYZA 1VQ8S 1HBNA 1FT8A 1AZSA 3H90A 3IR6B 5DDQC 1SC1B 2DY1A 1H98A 2B6AB 1FRKA 1TL1B 3IG1B 4DR1F 2F1FA 3HZGA 3TJ9A 1U45A 3TQEA 4WPAA 2YX7A 4OI6A 1N36J 4PR6A 2NZ4A 3UR3C 4HI2A 4YQWA 2MQPA 5T14A 1Y5LB 2BJEA 5J2PA 1KOOA 4RW9A 3KUHA 2X51A 4J9OA 2FZGB 3DLLQ 1GQEA 3VAGA 3OTCA 1JXEA 3ISNC 1T05B 4CLTA 4K4YA 1N5SA
chains in the Genus database with same CATH topology
1FTCA 1QSYA 4R5PA 1DQ8A 4I6WA 1Q53A 3QGGA 1FJEB 4W92B 1ZH5A 4DR7F 3DRPB 3H2VE 5KT5A 3IRXB 2ZKUA 3FCHA 3VAHA 4I68A 5HN0A 1U25A 3KYLA 4PRFA 3P49B 2R8HA 2K1RB 4TNOA 4C0HA 2ZD1B 2ROEA 1FDDA 2K2PA 3QJLA 4KKOB 1W2IA 1X9SA 2V94A 1X9MA 3BR8A 4IO1A 1O5JA 1ZM9A 1JLGB 1U2FA 4NLWA 5KG6A 3K5OA 3CTRA 2FJVA 3M8QB 2Q6CA 3DYAB 3M2VB 3OTDA 5KT4A 3CULA 3ENWA 4ZDNA 2IBOA 2XY7A 1NHUA 1BQNB 4TU8A 5EX0A 3QAUA 2HHHF 1WHWA 3BO4A 2CQ1A 2JFKA 4CO0A 1QVGR 2UUAF 2UV8A 1R7IA 1YG0A 3PEHA 1YJUA 3DI6A 1E6YB 2X3GA 3CJKA 1N56A 2JLGA 3KMQA 2VQEF 1HD0A 4ETXA 4NLSA 1WD6A 3MEEB 4N41A 4Y00A 4B3OB 2LQBA 2A2CA 3U02A 4Y6IA 5EWEA 2XCAA 3KLFA 2QLXA 3H8YA 2HGNA 2XMVA 4C8KA 1S1WA 3NRBA 3HKZD 2HLUA 4JV5F 3JYTA 2VA2A 3GWCA 1VQMS 4QZVB 2AJ4A 1Q8IA 2CPJA 2X1FA 4FS1A 4H4KC 4DL7A 1S77D 1N33F 4M63A 1TP7A 4QOTA 2NLWA 4R8UB 4GMKA 4IR1A 4CO1A 4E8UA 2FJDB 3EGNA 1C4CA 2CKWA 2J6UA 4O3RA 1X5SA 1XERA 3KKFA 4KFBA 4TY8B 2HHTA 1NKCA 3V81A 3DRXA 2IVFB 3FJ2A 4N5SA 2VPXB 1H7WA 3W2WB 2CQ4A 2DPIA 1GXLA 3FMWA 2C3OA 1TVRB 1HWLA 5KG0A 5HLFB 1WACA 3TA1A 3LAMA 4CH1A 2RE1A 4RX6A 2DNQA 1R8PA 3N6NA 1NJZA 3OVSA 2WTFA 3TI0A 2A2DA 1WF0A 1Y0HA 2FTRA 2NUHA 4YEAA 4K5RA 3SFUA 3KLEA 1OSCA 3WBZA 2M0GB 2DNNA 1ZTWA 3FDSA 1KR4A 3RB4A 1Q16B 4F8RA 3PW2A 1U2RA 4URGA 3IXQA 3CCVS 4BWMA 3R1HA 2XC9A 2N82B 1QSLA 1Q82T 3GR0A 1I94F 3AJ2A 4KIAA 4X4QA 3MMAA 3E8OA 4RUAA 1CVJA 5C25A 2CPFA 2DNGA 4H4MA 1PC4A 2ZH3A 1F5BA 3D28A 5L38A 2PI5A 1HMVB 4DFJA 2R8KA 3BDPA 3KHRA 4TKTA 1FCAA 3N79A 5EUHA 3M6WA 3DRSA 1DARA 3MHYA 5KFTA 1PSDA 2IM0A 1VRTB 4QIEA 3PXGa 2WK4A 5KFSA 5DDPC 2DPJA 2DNYA 3RBEA 4Q5VA 1QLNA 5I3PA 3GIKA 4PQUA 2FVRA 5L39A 2BANB 4HKQA 1FEEA 2HWHA 3RW6A 4EFAC 2WBMA 4ILLA 2OPPA 1S6PB 4R25A 2FJAB 3QZ7A 5H9FJ 2I1RA 3I0SA 5GAHU 4C7QA 4I2PB 3M9OB 1X5OA 4YB5A 1RT1B 2LU2A 1VRUB 1N32F 1D8ZA 4N76A 1S9EB 1S6UA 4WZMA 1DHMA 4IOCQ 2Z0GA 4JI1F 2MHNA 3PX4A 1TL4A 3IWXA 2E7XA 4IG0A 4NA3A 2MZTA 4L72B 2IVYA 1RA7A 4IG3A 4CH7A 2I9SA 4RW6A 4ZKAA 7FDRA 1KFSA 3T6JA 3CC7S 5E33A 2ROGA 3F41A 1QJHA 4OI4A 3MM5B 3B4MA 4EEYA 2V5HG 4DLGA 2CJBA 3RAXA 1X4CA 5H9EJ 2QLWA 4OQJA 2ZOGA 1LK5A 2IYIA 3C8YA 1SKSA 4Y2CA 4Q0BA 1S1XA 3CJ2A 1S1VA 2B5JA 4QWAA 4C11B 4DR5F 1U47A 1G2EA 4WZQA 2XWYA 1UP1A 2EPIA 1RGVA 3DC2A 1JIHA 4KRWA 2RRAA 4N8OA 1XR5A 2JWNA 4MH8A 2MZ1A 2B7CB 1KTQA 2R7QA 1GAOA 3DFEA 1B0VA 3QIPA 1ZM3A 1EETA 1T03A 1YJRA 5HROB 2ASJA 2MKSA 2N3LA 1Q79A 1HWJA 1VC5A 2DGXA 2AYBA 3GIJA 5B7WA 3HHDA 1HNXF 2D7SA 2WSFC 3NBPA 1N5YB 4I67A 2Q6BA 3BGRB 4A8FA 3W2VA 3B4DA 2FDNA 1XNQF 5F3ZA 3WX4A 2IA0A 3GIMA 4J9KA 4H54A 4B08A 2ZNYA 3KLHB 1TK8A 2ZUGA 5E3PA 4IH6A 3QLHA 1YVFA 2BYCA 2OPSA 2KG0A 2XS7A 5L8RC 1LWEB 1KTVA 2GFFA 2AV5A 3PJXA 2MSTA 2KFYA 1VFJA 4X4NA 3IC1A 4KBIA 2KZMA 2DO4A 1MSWD 5B0CA 2Q43A 1UAWA 2ZITA 4HDGA 2POKA 2RKIA 4BS2A 4B3MF 4D3HA 2KXFA 4P7VA 5D3GB 2RILA 3NS5A 3V5RA 2GHVC 1UVJA 1OS5A 1Y7PA 2EFQA 1Q7YT 1RAJA 1TV6A 2J76E 3US5A 5HP1B 1WG4A 1DTTA 4MKYA 1RTDA 4MTPA 2IC3A 4DFMA 2J9DE 5EN1A 3BR9A 2V8VA 3MZIA 5KFBA 3WC2A 1P8GA 1APSA 3IAM9 4LSLA 5J1NA 5DDRC 2R4FA 2PO4A 4X4SA 3LO3A 1SB6A 3PIOQ 3EPGA 3CCZA 2ACYA 4LF4F 1SXLA 2BE2B 1FRJA 1ZETA 1X0FA 4F2RA 5K14B 4QWBA 3ZZPA 3KHHA 3SQGA 5KFQA 1D9AA 2WW8A 1U1PA 3HI9A 4G6VB 1SUQB 2YNHA 3FSYA 2CJ9A 2MGZB 3BGLA 4XPEA 2IRUA 2DGQA 4NLRA 5LL6d 3ZZZA 5C5JA 4OZNA 5DQGA 3GSDA 5J2MA 1RT3B 3JSRA 2MXYA 2FLOA 3AH6A 2LA6A 3MPWA 4LVOP 1N34F 2BQ3A 1VBZA 4RUCA 2J9DA 2B6AA 2MHEA 2MQNA 2VFVA 4I69A 3TAMB 4L6V3 3M2RB 4TU7A 1AROP 1TL1A 3MM7A 3IG1A 3K8WA 1SH3A 3CJ4A 2U2FA 2MKHA 3LGNA 2HGMA 3ENVA 5GVQA 3OUYB 5F8GA 1SJ1A 2UUBF 2CYYA 5BYSA 3DLGB 2BM0A 2D9OA 2H9ZA 3M2UA 2OLWA 2IJNA 4WTYA 3UW1A 1K73T 2UXCF 4BC9A 4OX8A 1K1QA 1SQEA 5LXYA 4NCBA 2E5HA 3MM8B 2RVJA 1UMJA 3PW0A 4O44B 2M4MA 3T5JA 3RRGA 3MPVA 5A0YB 1UVMA 4B02A 2DO0A 1HW9A 2VH7A 2YNGB 4K2XA 3S7RA 1VQLS 1ZAXA 2R7SA 2M52A 2R9LA 5B0FA 4MAKA 1NH8A 1MROA 1DBDA 4NXMF 3OLBA 4LF9F 2PD1A 4ICLA 2UVUA 4FF1A 3K5PA 4MFBB 4DWIA 4PWDB 1TAQA 3TO8A 5DRKA 2WOMB 4OHZA 2KZZA 2DNMA 4X4TA 2DRBA 3OFHA 3I9V9 1FD8A 4PXBA 4FP9A 3MCSA 3THTA 4K4WA 4J9RA 3KTQA 4FYDA 1IR0A 1U1LA 2CDQA 4AE5A 4HTJA 1T05A 4AFFA 1JNZB 1BGXT 1RI7A 3OSPA 2W9BA 3OXFA 2CG4A 3DU6A 3J80Y 3HJFA 2VQFF 3UPFA 3DRPA 3IRXA 1S6QB 3GYXB 5E41A 3P96A 1DQAA 3C6TB 4K4ZA 4FF4A 4P2SA 5E3AA 2K1RA 1VBYA 2DGOA 1ZPVA 4DV0F 2WCXA 1U6FA 2KRRA 2ZD1A 4TYBA 4FNIA 3DOKB 4NRUA 5DGAA 2DJWA 3PDNA 4KKOA 5AE2A 2A1BA 2RQ4A 4OI2A 5FLXY 1TAUA 4X2BA 1JLGA 5JXSA 4YR0A 2B0GA 2HAIA 4B9SA 1IUJA 1FK9B 3M8QA 3DYAA 3PX6A 2AP6A 2MDAA 3M2VA 2CRLA 3KK2B 3HFKA 4IRKA 2QA4G 2BW2A 3QWPA 4NPOA 4WFZA 1HYSB 2EG2A 2LU1A 1BQNA 2MZSA 1F2GA 3BDEA 1Q86T 1IM4A 4PG4A 4EO8A 4HT7A 3SI8A 2O01C 3D1OA 5KG7A 2B51A 4QR2A 1UA0A 3CD6S 1FXLA 3DRRA 3DOLB 1E6YA 4K5SA 3QIDA