1RK8A

Structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
87
Chain Sequence
PQRSVGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG8781-PA protein
publication title Molecular insights into the interaction of PYM with the Mago-Y14 core of the exon junction complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Translation
total genus 18
structure length 87
sequence length 88
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rk8A00
2F9DA 2LA4A 3SMZA 3CTRA 3NNHA 2CPJA 2DHGA 4WFNQ 1U1QA 2KRRA 2GHPA 3SDEA 3S8SA 2MKSA 5JVHQ 3NS6A 2VOPA 3RW7A 1UP1A 1UW4A 2CPEA 2BZ2A 3NS5A 3I55S 4W90B 1N52B 2MQQA 1ZZNA 2FY1A 2MY7A 3CD6S 3MXHP 2K8GA 3CCLS 1OIAA 1VQOS 4CQ1A 4LMZA 2CPFA 1G2EA 2DGTA 3CCES 3EX7B 1X4BA 1YJNS 2MHNA 2MZ1A 1JJ2R 2DH7A 2DB1A 5D77A 3THPA 3CCVS 3IWNC 2E44A 2EVZA 1N8RT 2DNLA 1M5VC 2MKJA 1D9AA 3G4SS 4Y0FA 2DNMA 2N3LA 2A3JA 2MXYA 1WF2A 2E5JA 1N54B 2N7CA 1U6FA 1JJ4A 3Q2SC 2RQ4A 3VALA 3N9UC 3BO4A 3H2VE 2LEAA 2CQIA 1HD0A 1WG4A 1Q82T 5IM0B 2OSQA 2CQ1A 2G0CA 1P27B 2RS8A 1D8ZA 5CXTA 1FJ7A 3TYTA 2QA4S 3G9CA 1K8AT 4TLQA 3CCMS 4V19X 1YTYA 1DRZA 2J0QD 1JMTA 2E5IA 2KXHA 3MDFA 5DDRC 3SDEB 4ZKAA 1SJ3P 4IOAQ 2N82B 1VBYA 2J76E 1B7FA 1H2UX 5LJ3Y 4J5OA 2ADBA 1SXLA 1BY9A 2DGUA 5LJ5Y 2DNHA 4P6QA 1VBXA 2PEHA 2DNGA 4RU2A 5DM7Q 1U1RA 4TU7A 1YIJS 3MI7X 1CVJA 4TU9A 2G4BA 2DO4A 5GADU 2LXIA 2YH1A 1HD1A 1WWHA 2E5HA 1M1KT 3UCUP 4CH0S 4F25A 4YOEA 2FC9A 1HL6A 3FEYB 3UE2A 3DLLQ 2LCWA 4C7QA 3R1HA 1KD1T 2HZCA 4BS2A 1FJCA 4QPTA 3UD3P 2MKHA 3B4DA 3MURP 3CMAS 2CPDA 1OPIA 3V4MA 2MPUA 2VONA 2MQMA 1FT8A 2RU3A 2FPHX 2RT3A 3VAMA 2AYGA 1UFWA 2M4MA 2MY8A 2ADCA 4FXWA 1WHVA 1O0PA 5GAHU 2ZJQQ 2AYMA 3UCZP 3CC7S 3EGZA 5IFMA 1VQ6S 4OZ1A 4UQTA 1X4AA 2YH0A 3G8TA 5BJRA 1M5KC 1VQ5S 2J8AA 2CJKA 2DIUA 2JX2A 3D2WA 1SJFA 2LECA 5GAEU 1NO8A 2KXNB 3CUNA 2DISA 1M5OC 2I38A 2MZSA 2MQPA 1VQMS 5LSOA 2KT5A 2LKZA 3L3CA 3CCUS 1DHMA 1NU4A 3MUTP 3VAKA 1U1OA 3CCSS 1UAWA 2DGXA 3CMES 4PR6A 2MQOA 1AUDA 2DGVA 3NNCA 2VODA 1Q81T 2OJ3A 4U67Q 2L08A 1X4HA 1U1KA 2FHOB 1WHYA 3U1LA 1H6KX 3CCRS 2LEBA 1YHQS 1VQNS 1FJEB 2XS2A 2U2FA 2DHAA 1U6BA 2AYBA 3PIOQ 1JJHA 2L9WA 2CQCA 1M90T 2HGMA 1WI6A 4LJMA 3FEXB 1VC5A 2N3OA 2KG0A 2MSTA 3G96A 2I2YA 2RRBA 2RUGA 3MUMP 3VAGA 3G8SA 2DNZA 4UY8T 4CH1A 1IQTA 2M0GB 2DGOA 1ZZFA 2DNPA 2CQ4A 5CYJA 3BO3A 5DM6Q 4OZ0A 2ERRA 1X4FA 2RNEA 2X1GA 1KOHA 2YKAA 4YUDA 3UD4P 2ZJRQ 3MD3A 2CPHA 2X1AA 2D9OA 2MKKA 2CPXA 3LQVA 3P49B 2CQGA 2DNYA 4WCEQ 1KQSR 4QU7A 1YWXA 1M5PC 1YJ9S 2DNKA 1A9NB 1WEZA 2CQ2A 2KH9A 4F26A 2HVZA 2MYFA 1A7GE 2LXUA 1NJIT 1OO0B 4IO9Q 3CPWR 1VQKS 1U2FA 2DNOA 2M8HA 1FNXH 1OWXA 1R8PA 2O3DA 2V94A 4LIRA 4IUFA 5MLCV 1VQ9S 2M7SA 3THTA 2VOOA 2DH8A 3PIPQ 2KM8C 3G6ES 2DK2A 2OSRA 4Y00A 2HYIB 1FXLA 2DITA 3CXCR 2KRBA 4C4WA 3OW2R 4F02A 5DETA 1PGZA 1X5TA 2XSFA 1VQ8S 3TO8A 1Q86T 1K9MT 1FHTA 1DBDA 1X5SA 3J7YU 3P6YC 2CQ3A 3CCJS 2XB2D 1VQ4S 2XNQA 1SJQA 1L3KA 2D9PA 1WF1A 2E5GA 2CPIA 5D78A 5CA5A 2HGLA 4WFBQ 2MZTA 2CPZA 1VBZA 4WF9Q 2KU7A 3BS9A 2DGQA 3BEGB 2MKCA 1HA1A 1SJRA 1WG5A 1WG1A 2OTJS 3HHNB 1X4EA 4IOCQ 3JB9k 5DDOC 4M5DB 2MZQA 1N88A 2DHXA 1YITS 1X4CA 5DDQC 2AYEA 1WHWA 4QU6A 3CF5Q 2CQDA 1S72S 1VC0A 2DNQA 2MZJA 3SXLA 2MJNA 2X1FA 2M8DB 5LSLA 3NNAA 1H2TZ 2MZRA 2KM8B 3RW6A 2MKIA 2JVRA 3VF0B 5FJ4A 2DIVA 3VAIA 4A8XA 2HGNA 2M88A 2DNNA 2D3OR 3P5TL 1H2VZ 3S01A 3CC2S 1SJ4P 2DO0A 2X1BA 5IQQA 3IRWP 5EN1A 3HI9A 1ZH5A 5GAGU 3US5A 3DXBA 2NLWA 3R27A 1VQLS 3Q2TC 1DZ5A 2XS7A 1KC8T 2DGSA 2YTCA 2AD9A 1YI2S 3S6EA 2DGWA 4WFAQ 5GMKa 2FC8A 1Q7YT 2ZJPQ 4C0OC 4ED5A 4WKRA 1PO6A 1XN9A 3LPYA 2YWKA 2NZ4A 2RQCA 2MSSA 2KI2A 5JVGQ 5LXRA 2JWNA 1WI8A 1WELA 4QQBA 1F9FA 3VAHA 2K3KA 3CCQS 2JRSA 2QFJA 1R8HA 5HL7Q 1VQ7S 2RRAA 2RVJA 2DH9A 3R1LA 3CC4S 1QVFR 2LQ5A 5HO4A 1RK8A 2J0SD 4CIOA 1W2BR 1X4DA 1VQPS 2KN4A 2OTLS 5ITHA 3J7ZT 4Z2XA 2CQBA 2CPYA 1U1LA 2LA6A 2UP1A 2CQPA 2SXLA 1X0FA 4EGLA 1WHXA 3P3DA 3G71S 2CQ0A 2M9KA 2B0GA 5LXYA 1U1NA 4PKDB 2L41A 2MMYA 2WBRA 2CQHA 2F3JA 3TP2A 1FO1A 1URNA 3VAFA 4PRFA 5GVQA 3NMRA 2MJUA 3ZZYA 4W92B 1QM9A 2MGZA 2RS2A 3MOJB 2U1AA 2Q79A 2QEXS 2DHSA 1P1TA 2BOPA 3U1MA 2M2BA 1X5OA 2LMIA 4WIIA 1VC6A 2KG1A 2MB0B 3UWTA 5H1SV 1U1PA 2MQLA 2MQNA 4FXVA 2OIHA 2M70A 2LYVA 3VAJA 3CULA 2EK6A 1U1MA 1X5PA 2KYXA 3H2UB 2XS5A 2F9JA 3ULHA 2KHCA 4YB1P 3ZZZA 1WEXA 4TU8A 2G1DA 2PE8A 4ERDA 2KXFA 5DDPC 3S7RA 1S79A 2KVIA 3EGNA 1WEYA 3MD1A 2GO9A 1RKJA 3UCGA 3B4MA 1QVGR 3MUVP 1WF0A 1YJWS 1X4GA 1KOOA 1K73T 3BO2A 3K0JA 2DNRA 2JVOA 1WTBA 2XNRA 3I56S 5IM0A 2MGZB 2KFYA 2EK1A 2M52A
chains in the Genus database with same CATH superfamily
3SMZA 2PFDA 4HI2A 5E3RA 1BUXA 2JZ5A 3JQKA 1HFEL 3D6HB 3OTEA 5KFIA 2MDAA 2H9ZA 5DZ6A 4B3SJ 3EZ5A 2A6OA 2HW3A 2BJ9A 4B3MJ 2MY7A 1FFWB 5C24B 3M2VB 1VQOS 2NPIA 4CYUB 1J5OB 3CCTA 3KOAA 4DV4F 1IBMJ 2YNHA 4JI2J 2ZVSA 3DHXA 4B9TA 4KGVB 2N3LA 3R5GA 5ETQA 4X4SA 5H9EJ 1QSYA 2KFNA 4K7QA 3BO4A 1WD6A 3C6TA 5KFSA 3DXSX 3KHLA 4MKAA 1K8AT 5ADZA 3OJSA 4IOAQ 2UUCF 2YBVA 4ED1A 3ZC4A 3K17A 1WC1A 1T9YA 5D3GB 1HMVB 4KHRA 4I4BA 1XTZA 3LTOA 4X66F 2YX4A 3ENQA 1B0PA 4YOEA 2D69A 2UUBJ 1S77D 5D6GA 1RBOB 1KD1T 3W3SA 3MURP 1NZAA 2QLWA 1S9GA 4Z7YA 2VBXA 1TL4A 5GAHU 4Y2CA 1VQ6S 2YH0A 3G8TA 1R27B 4DV6F 2K06A 5HBMA 1LWFB 4ZITA 4ZPWR 1FCAA 2RF2B 5BXIA 4WU2A 1RT5B 4LIWA 3OTOF 3QMQA 2YKNB 1CQMA 4DV5F 4ATNA 2JEJA 5B0EA 4QIGA 3E01B 2IPOB 3SCLE 2AYBA 3N28A 2P5VA 3DLHA 4K4TA 1B99A 1HHQA 1D0EA 1MWYA 2B8QA 3RBDA 1AROP 1FX4A 2DNPA 2IFXA 5E3PA 5HQMA 2RHQB 2ERRA 2EWHA 1KOHA 4WP8A 2CPHA 4J37A 1XMQJ 4CZCA 1E6YA 3QO9B 1YJ9S 1JLGB 2XSJB 1SH3A 2B3TB 2IVYA 2AZ1A 3J7YI 2NR0A 2XY6A 3CO9A 2M8HA 2NXJA 1VRTA 5GMEA 4EWTA 4E98A 4H4OB 2HHXA 4ECQA 2VOOA 2HIQA 1I94J 1NK8A 4IFYB 3G6ES 3N01A 3CXCR 5DETA 4G1QB 3KFWX 2E66A 1EJ7L 3SBMA 2FVQA 3P6YC 2XNQA 3HJVA 1L3KA 3EVWA 4ZVGA 4TYAA 1HARA 1XR5A 4U8YA 4NWBA 3BS9A 2V50A 5K8OA 3VTIA 1B4SA 4PWWA 1HHSA 5C7PA 4FF3A 2ACMA 4KHPF 3CJ2A 4N56A 1QY7A 2PSZA 4ENOA 2HZAA 4NLQA 1NXIA 2DIVA 2HK3A 5EWFA 4JI0F 5IQQA 2XY5A 1IBCB 4J7CA 4NLUA 1Q16B 4I6AA 2NUHA 2LQ9A 3KK1A 2WW4A 4EZ6A 1T9XA 4ZVRB 2VU5A 2ZD1A 4PYDA 3WIVA 3H42A 2NYIA 3ZFVA 1U49A 2W8LA 1FVQA 4EZ9A 1RT4B 4KJIA 1R8AA 2FYXA 4K4ZA 3KDOA 2QFJA 3QRRA 2R2UA 4DHVA 4KH1B 1RK8A 5B09A 3CCZA 2E9TA 4ZS6A 3HO1A 2SXLA 1UEKA 3MMAA 1X0FA 1NDPA 2FVPA 1IJEB 1TL7A 1VJQA 3PW0A 5KG6A 4P72A 1VQYA 3CCWA 4DEZA 2K2PA 5HMWA 4I6WA 2P9EA 1FF2A 4QIWD 2LMIA 4X65F 1TK8A 3TI0A 2MB0B 1T7PA 2VBWA 2OIHA 2DJWA 1Q79A 3WDOA 1XEZA 1HQUB 3G87A 3ZZZA 4QR0A 2PE8A 5D0HA 4XO0A 4C2MA 4OHYA 2J6SA 2GO9A 3KUHA 4C0BA 4NA1A 4FYYB 3RB4A 2IYIA 4UOGA 2XLKA 2Z30B 2OMLA 3CJ5A 3J7A1 2Z2ZA 3NNHA 3Q23A 1RACB 1NK7A 1N4LA 1SQFA 3H20A 1RKIA 4LSLB 2RHSB 2ACYA 2W9BA 4KGMA 1S6UA 3OL6A 4WJBA 3NWRA 2C3YA 1JJ2R 4RKUC 4J9PA 5D77A 1PC4A 5KT2A 1D9AA 2X7IA 2MXYA 1NDLA 2N7CA 2OD4A 3Q2SC 4M5NA 2G0CA 1D8ZA 1N32F 3TYTA 2HFZA 4WZQA 2W25A 3QNWB 1N0UA 2N82B 1OY8A 2HHTA 5LJ5Y 2DGUA 1EP4A 2DNGA 1Q95G 1CS4B 2UXCF 3N6MA 3MEGB 5J1EB 4CH0S 2XYGB 1JLFA 2IC3A 1NM2A 2H5EA 1NK0A 3Q8YA 1U47A 1OPIA 4DBQA 1QAXA 3DLKA 4DL2A 3KJVA 1SC4B 2WVBA 3FCWA 1UFWA 4ECXA 3W65A 2ADCA 3QGGA 3W62A 4F8RA 2JDJA 3MMJA 1DFDA 1T8EA 4PUOB 1LFPA 2IVMA 4PG7A 3TUJC 2VC1A 4RW6A 2CJKA 3D2WA 2KXNB 1PKUA 2B5JA 2CAJA 5F8GA 4ID5A 5E33A 4YHHF 1ULRA 5SUHA 3UDVA 4B9VA 1FA0A 1DY3A 4DSIA 4NXNJ 3HDSA 2L9DA 3CMES 1Q81T 4U67Q 3PKYA 3K8VA 3Q22A 1H6KX 3GE9A 4DFPA 1O6XA 3QGIA 5DGBA 3UQSA 5HAOA 1T05B 4X4QA 3PHTA 3K5OA 3Q86A 3NXZA 3PJWA 4HHUA 3H59A 3R9LA 1RHJB 4AXJA 1JLQA 4NLTA 4QU7A 4P74A 3KG4A 4DV1F 5K5MA 3VQSA 3NWGA 4J9LA 4F36A 2QZ8A 4LIRA 1HNWJ 2OSRA 4OX7A 1RHRB 4N41A 1TKZB 3OW2R 3MM6B 3Q8RB 3MECB 3LALA 2VC0A 1FHTA 4X4RA 2DYAA 1DBDA 3I31A 1X8DA 3ILOA 3MR7A 4B9UA 3K5NA 5KOXA 3FBFA 2MZTA 1CSJA 1HNZF 1BWVA 1FK9B 2MKCA 1HA1A 4DR7J 4EBCA 4ETXA 3ETOA 3DI6B 2QJ3A 1WHWA 2PO4A 2AIRB 3SXLA 2Y9HA 2X1FA 2WRMA 4PXCA 3C8YA 4I0WA 2KJVA 1JX4A 4MTPA 3TJ9A 1F5CA 1T94A 1UA0A 3DRPB 3KK2B 1DZ5A 1F6TA 3DKDA 1KC8T 4DV7F 3OQ2A 3MM9B 5GMKa 3IWXA 3OXLA 3DM2A 4C0OC 4LSNA 4YEAA 1S6PA 3DGPA 3FBBA 2GNKA 4PQUA 4KAIA 5K8NA 4ZVTB 2EI5A 2KI2A 4A46A 1KHVA 2LU2A 4B3SF 5BYRA 3E51A 3TR5A 2BW7A 4B3MF 4EFAC 2KN4A 3QBCA 1N6QB 5KFNA 4IRKA 1U1LA 2EFQA 3ISND 3GILA 1NPKA 2M9KA 3C3LA 3M05A 3V6HA 1IXKA 2IJFA 2HS0A 3LAKA 2NCKL 3HPOA 2VASA 4JI2F 1NLKL 3IRXB 1JXLA 3M6WA 3J80U 5J2MA 2GJ2A 4N76A 5IV3A 1HKAA 5DQIA 4CLKA 4NLWA 2M70A 3A3NB 3LA0A 3IBFB 3MTJA 4P2MA 4B02A 3BQ0A 4ZPBA 2ZFHA 1ROFA 3W2WB 1FEHA 1FRKA 4LRBA 3CJKB 3HJFA 4HTIA 4IDKA 4ZP8A 3B4MA 1RWUA 4YR0A 1F2GA 4ALZA 1X4GA 1QAJA 3QGPA 1JLEA 4W4MA 1DQ8A 1WTBA 2DT9A 3OL9A 5KFJA 3E2EA 3QJLA 4YFUA 2BANA 3JYTA 2ROEA 2MKSA 3OFHA 5B7WA 3FRYA 2JJ4D 1J5EJ 3GJRB 1S1TB 2W2MP 1M0SA 3MM7B 2KL8A 2PGCA 1T3OA 2HEKA 3CD5A 3CCES 2VJVA 1ZA1B 3W9IA 1SV5B 2CADA 4Q5VA 4QR1A 5M2RA 4IRCA 4DL4A 3M30B 2IRYA 1HWIA 4KFBB 4RW8A 3G4SS 1RE1B 4E0DA 1PIEA 3LUYA 3T19A 3A12A 4DR1J 1EETB 3N9UC 2LEAA 2QV6A 3PEJA 3I5CA 3OT9A 3SYZA 3PW2A 3G9CA 4C8YA 4V19X 4F3OA 3O1LA 4LF6J 4N8NA 4AUKA 1S99A 2WVFA 2J76E 3BH7B 5LJ3Y 4J5OA 1JIHA 2FLLA 4R8UA 5CYQA 4HR2A 3BGRA 5KFYA 1YDLA 1IKXA 1H72C 1U1RA 3ZTRA 3RB6A 2E1RA 3N4WA 2G4BA 3OTDA 3D28A 4M5GA 2YNHB 2C3MA 1X31C 2F8HA 2V67A 1XMQF 3J81U 1YBTA 4K50A 4L3NA 2MKHA 2K1RA 3H4BA 3LO3A 2FGCA 2BYCA 3VAMA 5J2QA 3LWMA 1KEKA 2BVZA 4C3MA 2J8AA 1W26A 1NDCA 4ILRA 2F4VJ 4KGXB 5GAEU 1MN7A 1KLMA 3PG9A 4DUYJ 5KFXA 2I38A 2P6SA 3D9BA 4JI8J 5E3CA 1Y10A 4P2FA 3UDEA 2JHEA 2Z2LA 5C2CA 1F5AA 2YWGA 2CVIA 2RSQA 4C8LA 2R7VA 1J27A 3IG1A 1VQNS 1Y4ZB 4URSA 2IBOA 2QX0A 1Y00A 2CQCA 2QN6B 5KAKA 1DAXA 1GXUA 2VQEJ 2KT2A 2RRBA 3MUMP 4QIFA 1RCOB 5HBMB 2XMWA 3OHAA 2M0GB 2WSFC 2RRNA 3ILLA 4LF5J 4KRWA 1HI1A 2HMIB 2GIRA 2D9OA 2MKKA 1S1WA 1Y5NB 4O0IA 2GFFA 5B0FA 2F7VA 3CJSA 3B78A 3DRXA 2EFNA 4M5DA 4NLSA 1YZ6A 3BREA 1N33J 2AX1A 5MLCV 4DN9A 5FDLA 2VG6A 2DCLA 4C4WA 1BQNA 2ZDPA 1X5TA 4LFAJ 2R8IA 1C4CA 3J7YU 4UOCA 3BN4A 3MR6A 1WF1A 2Y8WA 2CPIA 1IQZA 2A18A 2CDRB 2CPZA 4KYZA 3S1TA 3UDCA 1S0NA 4LREA 5MAOA 5IC4B 2Y1JA 4ZCIA 2H1YA 1YITS 2V9KA 1RWKB 5ETLA 1VRTB 2B4OA 2Y1LB 4CLZA 3FSIA 4ZVUB 5LMUJ 3SQGB 4P9SA 3M9MB 1H2TZ 4RBUA 4F0KA 5AXMA 3C15A 4DQIA 3S01A 3NOGA 1SJ4P 1R6VA 1T95A 2ZHAA 4TLRA 1UCNA 3BR8A 4AT1B 5EWGA 4ZVOB 1KNZA 5K8MA 3G6YA 5F8HA 5HMYA 1YI2S 3KWMA 4NCAA 4AL6A 1DURA 1G4CA 2J9EA 3OFEA 3H90A 4B9MA 3R5BA 4DUTA 2RRAA 5D0GA 2KYZA 1VRQC 4OZ2A 4DF4A 3D0HE 2E1CA 5CD4A 1IM6A 4Z2XA 1AW0A 2CPYA 2PD1A 2ZKUA 1UL3A 1XMOJ 1QAIA 3T6JA 3JAMY 3ZZOA 2BE9B 3F73A 4BHQA 2AJ2A 3KK1B 1FKAF 3ZZYA 1QM9A 2RS2A 4JV5J 2DXDA 4A8SA 5ETMA 5CYMA 2Y1RI 1TL1A 2MQLA 3T1HF 3TW0A 4HHJA 2XS5A 3KK3A 1C1CA 4ECRA 3NS7B 4KSEB 5D4OA 1OQ6A 1FE4A 1S79A 3MMAB 4USMA 4O3NA 1B0VA 4GO7X 1RWWB 1MU2B 1TL7B 3EGNA 4OHWA 5IZHA 4DG1A 4OZLA 2HQDA 2GC8A 4PAAA 2HNYA 4NRUA 3HHLD 3K0JA 4ANCA 4X4VA 2JFKA 4G6VB 1FKPA 4PWUA 3CTRA 2CPJA 3Q8QB 1VI7A 4Y3CA 4TY9A 1EX8A 3I6PA 2CPEA 2NXEA 2CG8A 2MQQA 4ZN3A 2FGOA 4D3GA 5L38A 1GT8A 2WZ1A 4NA3A 1L3SA 2G0IA 3KLIA 1VISA 2FLPA 1Z1ZA 2EVZA 3MF5A 2FZGB 1DARA 1N0VC 4DQRA 4LF9J 3TJ8A 2ZWOA 4NXNF 2CQ1A 3W1YC 5CXTA 1FJ7A 5CZVA 5HN0A 2UXBJ 4JYAJ 2AMCB 1YTYA 4DS4A 5DDRC 4CLSA 5ETRA 1E6VA 4YMEA 2WONA 5ETSA 5HMZA 3IMQJ 4PCQA 1V3SA 3A13A 5KFHA 5KFCA 1ACMB 2W9BB 2VFRA 2XWXA 3MR2A 1U26A 3PVXA 2QC3A 3L95X 5KOWA 4QCLA 2LXIA 1RAOA 4NLYA 3FEYB 1NK6A 1FJCA 3SCKE 2N7YA 2FJVA 3ITHA 4KPYA 4WFZA 4U7CA 2CWKA 4JI5J 2ZJQQ 3HD1A 2R42A 3PR4A 1HNWF 3O3LA 2ZITA 4FF1A 2VG7A 2OEMA 1LW2B 1RA6A 1EP4B 1IKVA 4RJVA 1N36F 2DISA 2YQ3A 4F4YA 3TANA 4IQXA 3DLJA 2Z57B 3JSMA 3UO0A 1JLFB 3CCSS 1UAWA 3FKBA 2FJEB 4J9MA 3LGNA 2GVDA 1RTIA 1RAHB 2BBEA 4DR7F 3DLKB 3BKUA 4USKA 1JXVA 3OTBA 4NYPA 2HGMA 9RUBA 4LFBJ 3LP0A 2N3OA 2KG0A 3BQ2A 5DG8A 3FUYA 4RW6B 2C3PA 4O44B 4LBPA 1Q8KA 1D1UA 4RO0A 2ZNZA 2ZJRQ 3AH6A 4ID5B 1FRXA 5KFQA 3JSRA 1M5PC 3HK2A 2DNKA 3PW4A 2KVQE 4FXDA 3DRYA 1GTHA 3TUPA 2BKNA 2Z58B 1VQKS 2XYHB 5G0RA 4CT9A 2C2DA 2HVDA 1Q8BA 1LWEA 4C8KA 1FRJA 2HK2A 2FD2A 1TR0A 1NH8A 5J2NA 1ZA2B 4RW4A 2OPSB 1KQKA 3M8SA 1KVKA 5SZTA 4HH0A 4IQMA 5LT5A 3D1QA 4AL5A 2KZZA 3MGJA 1UEUA 3SFUA 1RAAB 4FS1A 2XI3A 4UZBA 4OYBA 4KO0A 4Y2IA 3MAHA 1TKTA 1V3ZA 4QJVA 5T7LA 2M8DB 1HBNA 1VR6A 2KM8B 2MKIA 2FHJD 1VIOA 3MM8B 3VGSA 1RZMA 4N7TA 4IYQA 2Y3YA 4NZ6A 4XPCA 2BQUA 4K0KJ 1T3NA 2B9WA 4MK9A 1GTEA 4I7FA 2BW2A 1DQAA 2YKQA 3M6VA 5CCMA 3GR1A 3K2YA 5JVGQ 3QATA 1NSQA 3GG1A 1BGXT 2RVJA 1LNQA 4NPOA 1J5EF 2V8PA 3I0RA 5HO4A 3GSIA 4NLVA 2MLZA 5KFMA 2OTLS 1KN6A 5KFTA 4EGLA 2KKHA 4GVLA 4ZVHA 3MEKA 2YWWA 1FO1A 3CDWA 3DM2B 2A0FB 2AEFA 4KC5A 1S6PB 4U9RA 3DGPB 4PQUB 1S48A 4DR1F 4DX8H 3OL8A 4K4UA 1QTNB 2HNZB 4ES1A 4G1PA 5M2UA 4LF6F 2JFDA 2CJAA 2K7KA 3HD2A 3TVYA 2HZVA 3I5BA 3SCIE 2BDPA 2EKYA 1TL3B 1PJ5A 3PYGA 2C28A 1B7YB 1QTMA 3A8KA 2Y8YA 1QUPA 1TP7A 4DR2J 1WOOA 1YJWS 1NB2A 1KOOA 2B4UA 3UFCX 1JLBA 2QO3A 4Q43A 5C5JA 2ROGA 1LEOA 2R3VA 5J2MB 3S8SA 1AXQA 3IXQA 1UVLA 1UW4A 4MK8A 2OFHX 1HQEA 4W90B 3M1VA 1YJVA 2J0WA 2Q43A 1SCJB 4CQ1A 1R8BA 2VFTA 3UVJB 3B82A 4IKAA 4DL5A 2J7KA 4I69A 4JI8F 3BSNA 3IP0A 4IDKB 3A3PB 3AB2B 1TVRA 4FYVB 1JLEB 1LW0A 2XEXA 4EU0A 3KNAA 2COLA 5EX3A 3NGSA 2FVRA 4ZKAA 3JYTB 2LDIA 2YY3A 4FN5A 1VBYA 1NJXA 1YRTA 3N79A 1RUSA 1QUVA 2ZBCA 2ZBIA 4DL3A 1HNIA 1UPPA 1NJZA 1FRIA 3MAAA 3TQEA 1CVJA 4TU9A 4L74A 3GYNA 2A10A 3LGMA 2UU9J 4P2XA 2YH1A 1B64A 2V8GA 4L73A 1M1KT 4F25A 1H3DA 1SL1A 3UE2A 4EYHB 3AA8A 3P45B 2EXUA 2HZCA 4YR2A 3DYAA 4HEA9 4OHXA 3UD3P 1U02A 2Y1IA 4MIWA 1LK7A 2VICA 3BR9A 4LF4F 1EHWA 2ZH7A 4ELVA 1VS3A 2XWYA 1N33F 4S0MA 3DU6A 1X4AA 3TJAA 2AV5A 2IJNA 4ZJOA 5CYQB 3BGRB 1IR0A 1IKXB 2RDJA 5EHHA 1KFDA 1AA1B 2LKZA 4Y28C 1DHMA 3R7BB 3KMSA 1H7WA 4PXBA 2B43A 2OJ3A 2ILZA 4FNHA 2K1RB 4WXWA 1UWBA 4RZRA 3GYGA 1KONA 1WI6A 4DSLA 3H0PA 3FEXB 2MSTA 2PFFB 2I2YA 2HQCA 5LMUF 5DM6Q 1EARA 1RWOB 3GONA 3OR1A 3MCOA 1WDTA 1SC6A 4WYLA 4XK8C 4YB5A 5D4PA 2E1AA 2V8HA 4F26A 2VF3A 4PXDA 2FZCB 1PAEX 4DDFA 2YPYA 4PZVA 5LOQA 3BF4A 1AUSL 2HHSA 3IG1B 2ZBRA 2LP4A 1VQ9S 1GXTA 1ZM2A 3D1OA 2DK2A 3M2RA 1FXLA 4CO2A 2RMLA 3GG0A 2XC9A 1S0VA 3G86A 4C97A 2DHHA 1SJQA 4N5SA 2Z2MA 2VBYA 1S1WB 3KMQA 5K20B 3Q8PB 4F4WA 1SJRA 3HX9A 4F4XA 2MHEA 3BPSP 4M5DB 2WCXA 5DDQC 4JV5F 3QT5A 1GFWB 5FDLB 1NKEA 1U0HB 4CCHA 4C8ZA 1BQNB 2D3OR 1SIZA 4UOHA 5I3PA 2D3ZA 2HNDA 3Q2TC 2DR5A 2HRUA 4O3SA 2YTCA 4WWSA 1KWMA 3MPYA 1OQ3A 3MMCA 1S57A 2MSSA 5DO2A 2AHOB 1OYDA 2JWNA 1WELA 1R0BG 4OYOA 1FXDA 3DDKA 3FSYA 3MCSA 1BXNA 3C15B 1Q8IA 4ZPVR 1Z2ZA 4J9NA 1N5YB 2VPZB 4OX8A 4PKDB 2WBRA 4J9VA 3C6UA 4RUHA 3PDNA 4Q8EA 5KG0A 4DL7A 4ZHRA 2XYPB 3SEOA 4BCAA 5IOLA 2BQ3A 4JI3J 2R7UA 2CZ4A 2U1AA 1VYAA 4LF9F 5AJ3J 5BR8J 3T5KA 4OI2A 4NASA 4M5MA 1N34J 3KG0A 2UXBF 1R3NA 4JYAF 1L3UA 1R0CB 1RXOB 3ULHA 1FVSA 3ZTPA 5K14A 1XJWB 2XMTA 5EWEA 4WTYA 3BGOP 1PSDA 1WDDA 3DC2A 5C25A 2EBEA 1HBUB 3V2UC 2M52A 4DV4J 3BBCA 3KG1A 1S97A 1NMEB 2GHPA 5CYMB 3GIKA 2LDYA 1JNZB 1TL1B 3V5RA 1HNXJ 2IAJB 2YNIA 3CJTA 3JQJA 4JI5F 3TA2A 1RWNB 4CWBA 2J9CA 3MXHP 3KK3B 1NCLA 1C1CB 3LPEA 3NGRA 2ZHBA 3THPA 5E3QA 1S9EA 3R5JB 2IDLA 4DG1B 2E9RX 2VHGA 3KKFA 1HNVA 2HNYB 1BE4A 3EPIA 2RE1A 2H65B 2OSQA 3TUZC 2CJXB 4ZLJA 2C1EB 2LU1A 4X66J 2ZC4A 2XTJP 1JMTA 2RIJA 1RCXB 4MYTA 1B7FA 2HBZB 2W1BA 2ADBA 3IBCB 4LT6A 4Y2MA 4YS2A 3K89A 5KFAA 4RU2A 4Q7AA 2B51A 1EZZB 1ITPA 2V4QA 1VQSA 2XY7A 1ZPWX 3M8RA 4DV6J 1IKWA 1V6HA 4ZVEA 3DLLQ 2ZOGA 4O23A 2OI2A 2VPXB 4JBCA 2PA8D 2B4PA 3DLEA 2ZH1A 2PN6A 2DRDA 1N5VA 3TA0A 4WU3A 2MKYA 2RKIB 4DPUA 4UQTA 1E6VB 2WONB 4K4XA 3MFIA 1VGYA 3I9ZA 5I42A 2LECA 2NXCA 3CUNA 1ZM3A 2HHHJ 2R8JA 4IG0A 1NU4A 3T5LA 3BSAA 1HPZA 3FNNA 1WOPA 4B3TF 2P2CB 2HVHA 2R7XA 5I3QA 3HHDA 3JSYA 3CGIA 3ITHB 3JQMA 1OJ4A 1S6OA 3ELHA 3G96A 4ZJQA 3QRPA 2F65A 2DGOA 4WPAA 2W9CA 5D0EA 1Y5LB 4DR3J 1H0HB 4LF8J 1M1HA 2DNYA 1FJGJ 1A9NB 1VIXA 3JSMB 4OL8A 3QZ8A 3I4HX 1UFKA 2GVDB 4DSEA 4ILMA 4A8QA 1S1UA 3THTA 2DH8A 3KHGA 2HYIB 3LP0B 1GMWA 1KFSA 3DOLA 1X0PA 5HI7A 4KQZA 4IR9A 2V6AA 3CCJS 2GIFA 5DQGA 2BA9A 2FJBB 3M8WA 3GU0A 1D3WA 3HF5A 4WP3A 5E3AA 2QL7B 1N5SA 2DY1A 1N88A 2HURA 5G0RB 4LF1A 1SIWB 4M94A 3MPUB 1LXNA 3EGVA 3OHBA 2VA2A 8RUCA 1UJ4A 5L9NA 2MZRA 1LWEB 2HHUA 3VAIA 2M88A 2DNNA 1DTQA 3GIRA 3M8ZA 1MWZA 3HXMA 5J2NB 4FDFA 4ED4A 3BSOA 1HHTP 3R27A 5A6WA 1YLXA 5EUHA 1AFJA 4L75A 4TY8A 5KFPA 2J7UA 3BBFA 4DXLA 1YQHA 3WZ0A 4DR2F 4RBVA 3LPYA 4FF2A 1TELA 2FHKA 3O2IA 3OR2A 3QT8A 2QGFB 3X1LB 2AZ3A 2I6WA 1TKTB 3HSZA 5T7LB 3W2VA 4R0JA 4U95A 1HBNB 3CJ0A 1IJFB 4X65J 2JC0A 4F4ZA 2QYCA 3C14A 3G71S 2CDQA 1C0UB 4PPDA 4B3OA 4YR3A 4A8OA 2YKMB 2C2NA 3FVYA 2RQMA 2MQ8A 2XZTB 3ZZUA 3TAPA 4WIIA 5H1SV 1RT2A 2MQNA 4QPXA 2XGQA 2EK6A 2W2OP 3I0RB 3AODA 3HCXA 3MPVA 4LR7A 1CG2A 1TKXA 1H73A 3V4IB 2VB6A 2UU9F 2AP6A 1ZBTA 4OZ3A 3CJRA 4WK1A 2HHQA 4WBFA 3WIUA 3K57A 4IG3A 3VZIA 5F8JA 2F9DA 2HHVA 4OYPA 4WFNQ 2KDOA 1QDUB 3FFIA 3TVZA 2VOPA 3CD7A 2HLTA 4FBTA 3NS5A 1V3RA 4I2QA 2R8HA 1PYOB 3GPAA 1GX5A 3ET6A 5H9FJ 1J2VA 3BH6B 1WACA 1N8RT 5M2PA 2RDIA 4LR8A 4JV2A 1FWPA 2OPQA 2A3JA 1KRPA 3D67A 4ICLB 2C22A 2UXCJ 1U7LA 1JLBB 2CQIA 2CKWA 2FLOA 2YX1A 4HI1A 5GADI 4HLBA 4RWWA 4OJGA 3K5LA 1BHNA 1H2UX 2PIIA 1BY9A 2A6MA 1MG7A 3T5JA 3M1VB 2HBRB 5DM7Q 4WK3A 1S1XA 2ZHOA 3MI7X 3WX8A 1HD1A 2OEKA 4EK2A 4NE9C 4AL7A 2CJ9A 3KHRA 1FNOA 1LW0B 3I87A 3DOKA 1LKZA 4DPWA 4HT7A 4A8FA 1PYTA 3C16A 3MEEA 3PCOB 3UCZP 2L3MA 3EGZA 5B08A 4FPIA 3EVMA 3THVA 5A76A 4H54A 4ZPTR 4CO0A 4X4OA 1HNIB 3CEDA 2N4CA 3Q24A 1M5OC 2HAFA 1CEZA 3GMGA 4KV8A 3I32A 2BOAA 2IJRA 1IM4A 2KT5A 2R9LA 5CAAA 2PDAA 1X9MA 5L9XA 3OXGA 2MQOA 3NNCA 2VA3A 4DR4J 1X4HA 2FHOB 1B0TA 2JSXA 1DTTB 3W66A 4YP3A 3PYEA 3PFEA 2DNZA 2XZWA 5J2PA 3HHEA 1MSWD 3CIZA 1KBRA 5F3ZA 2YWEA 1B3TA 2I1RA 1X60A 2IRXA 1MNEA 1WEZA 3MEDA 2DTJA 3ISNC 3MR3A 2DR6A 3CJ8A 3GIMA 3SV3A 1UWBB 2V94A 1HNZJ 5L1KA 4ED3A 4LRFA 1W2IA 2EC2A 2GMLA 1NKBA 1OPZA 2KRBA 4HKQA 2V4RA 3TO8A 2AQ4A 2XB2D 2UUAF 2YNFA 1K0TA 4DCJB 2PMWA 3OR1B 4X84A 3BBBA 1RAEB 4I64A 3TAMB 4ECYA 2JOQA 4ZVSB 4JI3F 3C19A 2JLGA 3E8OA 5AJ3F 4DV7J 3CF5Q 2BJ1A 5BR8F 1N34F 2OPPA 4LF2A 4RPFA 1VFJA 5FJ4A 3DNCA 1NB7A 4CRJA 4RR5A 2DO0A 2BABA 3QIPA 3US5A 1VQLS 5A8RA 3RUBL 4KB7A 4WFAQ 4CM0A 4DR5F 4XPEA 2PA3A 1JQGA 4ZCLA 3JAMU 1CBKA 4LRDA 4F4KA 2Z4PA 4USTA 4ZPCA 1HNXF 3TZWA 3CC4S 2HQGA 3HP6A 3EMTA 6FD1A 2ZVIA 4ZCKA 1RB0A 4NMXA 2AGPA 4NZ7A 2L41A 3CNQP 5A8KA 2BJDA 3OD2A 4OJ3A 2CNKB 5GVQA 4U7UK 1IKYB 2BUNA 1P6TA 1XNRF 3MMCB 1CULA 3GZ7A 5F8IA 4ZP7A 4ED7A 2DEJA 3VAJA 2OD6A 3EZUA 2CXEA 1URRA 1U2RA 3GYXB 3BDPA 2C2RA 1RTHB 3UPFA 3H5YA 3BPDA 3S7RA 4U6PA 2KVIA 3KUEA 1O51A 1C1BB 3QT7A 3VVUA 4B9LA 1QVGR 3EWGA 2ZE2A 3MUVP 3QLHB 4ZHRB 1UA1A 1DLOB 2NZCA 2DNRA 2XNRA 1X9WA 4FKYA 1RGVA 3RR8A 5JXSA 3NS6A 1T9TA 2KJWA 4X4NA 5FIIA 4RWXA 4UUWA 3QSYB 2F40A 3PO5A 4BDPA 1TL5A 1VJWA 4DQSA 1BMQB 4YDXA 2JEGA 3GSDA 4KPCA 2HVIA 1WUUA 2IDEA 2QT7A 4K59A 3RGIA 4DPTA 4XDDA 2HHHF 1PBUA 5HLFA 1K1QA 2MEWA 4Q44A 4FBUA 2RS8A 3QQCD 2QA4S 4AD6A 4KGKA 2E5IA 1RTJA 3FGVA 2H48B 1OY9A 2IM1A 2YNIB 5KT5A 3K7RA 1EAYC 4DQQA 3NAIA 2XMAA 7FDRA 3NGTA 1YIJS 1RI7A 1S49A 1S9EB 1WWHA 4RNFA 1T9UA 4DR3F 1YBAA 2YKPA 3DDIA 4LF8F 1L3VA 3TARA 2YKOA 1FJGF 4Q2LA 5C24A 4PEOA 5KT7A 1HNVB 4QWAA 1YJUA 5KG7A 1RT7A 1J5OA 4DJBA 1RYRA 1WHVA 2C3OA 2V0NA 2Q6CA 2HRTA 1Q8LA 4CNZA 2DIUA 2JX2A 3P8BB 1ZAVA 1NO8A 4XTTA 3RJMB 3PNIA 2Z0GA 3CSKA 5ETOA 3BZQA 3HULA 1WC0A 4OI6A 4LVNP 5HQLA 3GV7B 3HLUA 3FBCA 4D3HA 2UV8G 2RD5C 2PMZD 1YHQS 4DPYA 1BWEA 1FTRA 2HBQB 1HMVA 3VVTA 1U6BA 2FHMA 2W01A 4OZJA 1RJJA 4LBIA 3MPWA 4QWEA 3W63A 1W25A 5I42B 4P52A 1KLNA 1FERA 1RHQB 4IG0B 3NGUA 3GFXA 5IT4A 1K0VA 4CLLA 1HPZB 1FNMA 1LK5A 2NPFA 2DNOA 2G1HA 3TRGA 2Z56B 1T03B 4CO5A 4J9OA 1TAQA 1RHUB 2GO8A 1R6YA 4F02A 4OHZA 2RH3A 5KT3A 2DR8A 1O8BA 3FJ2A 3E01A 1YGYA 3DRRB 1UVMA 1KR4A 5F9NA 5CA5A 2F8EX 4NA2A 4DWIA 1RQ0A 1Y9OA 1R0AA 3BEGB 4DLEA 4TQRA 1X4EA 3GV5B 3V6DA 3JB9k 2W4CA 2H3EB 4XAKA 2AYEA 3SCJE 3ZNJ1 4USVA 1G1XA 1S1UB 2C3UA 4DCPB 3QO9A 3M9NB 3TWZA 4FKXA 1SQGA 3HHLC 2EFOA 4JP8A 2O5DA 3QAUA 3OPKA 5KFLA 3P5TL 4LQ3A 1VOMA 3DOLB 1A0OB 3ISZA 1QE1A 3M2UA 1VHFA 1SUQB 2IBKA 1XK8A 2AJ0A 2ZZMA 1GX6A 3CJ3A 2GJFA 1H38A 1RLCL 2AX0A 2R4FA 3ILIA 2RQCA 2CFXA 3D4JA 3D3CJ 3VAHA 3CCQS 7FD1A 4F0HA 5IQ6A 1RTDA 5KFDA 1XC9A 3M7VA 5DJBA 5A2QY 1U24A 3FBEA 4OMFG 1NPPA 1VQPS 2QMUB 2O1PA 5HP1B 4DV0J 5KFBA 1YRUA 3T1HJ 5LXYA 2P8IA 1URNA 4KH0B 3FK4A 4TY8B 4RW7A 4KY3A 2MJUA 5AXKA 2XM3A 4W98A 3I4PA 2E29A 3TX0A 3H2LA 3FSXA 7AT1B 4OYZA 1T02A 2VDHA 1S4FA 3OR2B 1U1PA 4HDHA 2D3O1 1K1SA 2P9GA 4HDGA 2P6TA 4TU8A 3HKZD 4ED2A 2R2RA 1IBLF 3C14B 3A1YG 4UTGA 4B3OB 3OXFA 3UCGA 5BYQA 4L72B 1WF0A 2HKEA 2G2YA 2GJIA 2YQ0A 4DCOB 5E41A 4O3RA 2CNOB 1L5UA 3SDEA 5JVHQ 2AW0A 3BV8A 1UP1A 4P10A 4NRTA 1RT2B 1RT1B 2BZ2A 2ALYB 2CWXA 4NL5A 1FEEA 2R7SA 4EI2A 4WXOA 4F04B 4JV1A 3KDNA 2DGTA 4YB7A 2MHNA 3OFFA 1SVDA 1TKXB 3T5HA 3EXCX 1NH7A 1M5VC 1RSCA 2DNMA 1HQUA 1U6FA 3AFGA 4IG3B 4K4VA 5CABA 3H25A 4DI6A 2ROPA 4TLQA 3CCMS 4DR4F 3LP1A 4IOBA 3FFIB 2QG9B 4HHHA 2GGPA 1YZ7A 3FC9A 2Z8QA 4OJ1A 3KTQA 4I2QB 1Y3JA 3ZTQA 3W9JA 3ET6B 4QOTA 3EE3A 1VLYA 3RYLA 5GADU 3QFWA 2YWHA 3UCUP 4UF4A 1S7IA 2FC9A 1HYSB 3SQOP 4DPOA 1N36J 3R1HA 2OPQB 1V5IB 4RUCA 4M5LA 4CT8A 4RNNA 2M3DA 4PG6A 1JNRB 4U8VA 3DDNA 3QIDA 3HVTA 4O4GA 2H5JB 3V81B 3GJQB 3D5MA 4EYIB 3EGWB 1D9FA 2LLZA 5B0GA 3RRKA 1VQMS 3N5FA 5LSOA 4WYWA 3L3CA 3CCUS 4CO3A 1SKRA 3PEHA 5F8MA 2D74B 2QSFA 4CO1A 2XLJA 4Q8FA 4MKYA 4C11B 3WBZA 5HANA 3MFHA 1NSPA 3CCRS 5U47A 4NZ0A 3DOKB 3DRSA 3QAEA 4HVZA 2FB0A 5IC6B 4ZLLA 4GVBA 1F3FA 3MEEB 4AFFA 1S6QA 3RZAA 2VQFJ 2RUGA 1L3TA 1MMDA 4DX7A 3RB3A 4M95A 4UY8T 2AJFE 3BO3A 1F2HA 3CWJA 4UW2A 4KV8B 4WP9A 2Y0SD 3A8IA 1ZAXA 4U96A 4ZIWA 1FTCA 2I5JA 4OYIA 3NRBA 3IGNA 1OO0B 2H54B 3CPWR 4USWA 2HS4A 4X64F 1OWXA 1R8PA 1VCTA 3CDUA 5L46A 4OZ5A 2OEJA 3PR5B 3ZZ0A 4Y00A 1WC6A 3GB0A 3L09A 1VQ8S 3AXKA 3KJQB 5J2PB 4ZA1A 5KTQA 2IA0A 3MMBA 1U8WA 1ZETA 4E2FB 4RLEA 3MEDB 4NCGA 4IOCQ 2AEJA 1Q7LB 4I56A 3AB4B 2EFVA 1KTQA 2OUGA 1S72S 2MZJA 3I0SA 1VMBA 3BDEA 3H7HB 4FVMA 3FDSA 2K3IA 4PG4A 5I3UA 2I0XA 4DS5A 1UVJA 4CTAB 2YNFB 3HFKA 4DSJA 2KTQA 1NBEB 3QT6A 1FFSB 3MECA 1KHWA 1BC6A 1SKUB 2ZC3A 2YWKA 2B56A 1VHIA 2WVCA 2EFGA 1XERA 4N8OA 3EVOA 2CRLA 3GCWP 3MAQA 4J90A 4F2SA 3N5BA 3HVRA 3D66A 3R5AA 1FK9A 3HHKA 3IN5A 2JNJA 2OPPB 1PILA 4URQU 1X4DA 1CJTA 3GCXP 1UPMB 2CQ0A 1RT6A 3QIPB 5KT6A 1U1NA 2MMYA 3M8QA 1AZSA 5A8RB 4A8MP 3IFEA 4F7VA 1UVNA 3NLCA 3B6BA 4W92B 1ZTWA 1UETA 5B0BA 2VFUA 2KG1A 3DRPA 3KK2A 3HSJA 4RU9A 3MR5A 1Q0NA 3OL7A 4Y2AA 5LL6d 2QLJB 3BYRA 2VFSA 2O01C 2RAQA 3C6TB 2KXFA 2DRAA 3R6LB 2X51A 3IBWA 3BO2A 3I56S 5FLXY 2B9EA 4HT5A 4QIVA 4OX9J 1CULB 5AE2A 1UEVA 1GH8A 2UXDJ 4NX9A 3T41A 1ZZNA 3PTWA 3W7BA 2XHCA 4DZDA 3Q83A 3IRXA 1PJ7A 2GQCA 1N5QA 2O67A 2DH7A 3CCVS 1S9GB 1HI0P 2WB4A 1IWAA 5A8WA 4RNMA 1RHKB 4IH5A 5AE1A 4X62J 1D8YA 3C46A 4NOHA 2ZE2B 3DOMA 2ATCB 4TN2A 3H2VE 4V1Ak 1WC3A 1WSVA 5B0CA 5EGYA 1NRKA 3CJKA 1FWLA 1SXLA 2H4YB 4QZVB 4LF4J 1ZAWA 3CMQA 1O5JA 4XIUA 2LQBA 4OV6A 1OY6A 3AD9C 2BR0A 3AXMA 4QBUA 1F0XA 1S1TA 4USUA 4NXMJ 4FF4A 3FQKA 3PRDA 3MHYA 4BS2A 2LVWA 4QPTA 2YQ1A 4NLOA 1UW9A 1YJRA 1REVA 2MPUA 2OP5A 4LSZB 2RU3A 1SJ1A 2E7VA 1MW7A 2BJEA 5DLGA 4KFBA 2CA9A 1E6YB 2OHDA 2PMHA 3EYZA 1TFYA 1EETA 3WQPA 4QWCA 2E5LF 2QA4G 1HWLA 3D68A 4DSKA 1XBWA 2R7QA 3OLAA 3VCDA 1FD2A 1FWKA 4R0EA 4Q2MA 1U1OA 3T9NA 4PR6A 5E0OA 4CLWA 3ZNUA 2YX7A 1FJEB 5D4NA 1RT7B 2APOA 1W7WA 1BLUA 1UTAA 4MK7A 1VK8A 3IAS9 3HVWA 3M8PA 4GMKA 2W24A 2GCFA 2W4PA 1I51B 4DR6F 1CJKA 4IH7A 2QFIA 4OQJA 4GKKF 2QMWA 4CH1A 4IO1A 3QYYA 2C2OB 1X4FA 2X1GA 4YUDA 2FZKB 1RYSA 2D3UA 5CH7B 3UN2A 4WCEQ 3G2XA 1EB0A 3R7SB 4PABA 5HJXA 3NGKA 2BACA 5F9LA 3T1YJ 4R5PA 1EQ0A 5L39A 1KQFB 1FNXH 1GEHA 2ZNYA 4IFVA 5F8NA 3OUYA 3KJFB 1RAIB 1K44A 2ATLA 4GO5X 4EO6A 5E2QA 2H5IB 2ZD1B 2C2MB 4A48A 1PGZA 1QJHA 5L1JA 1KVIA 5GAEI 2UVUA 2CQ3A 1XNQJ 2J9DA 4KE5A 3BM7A 2WB1D 4DV0F 1F5BA 4PG5A 2J8SA 3AT1B 3GIIA 1HBOA 1RWVB 4JI4J 1YVFA 4FYWB 1WG1A 2OMOA 2XMJA 4MFBA 2MZQA 2R7TA 3LAMA 1RAFB 2HMIA 3PKMA 2D7SA 3W8PA 5HVFA 3R2CJ 3B54A 2P9CA 2B9YA 4PWDA 1FKOA 1VBKA 1FRHA 5JMNA 2IM2A 2VV5A 1HIYA 3NP5A 2NLWA 2M5YA 4ZLNA 1WKKA 4BC9A 1NSKL 2R7OA 4JOUA 1R0AB 2HWTA 1PO6A 2G13A 3V6DB 2VUGA 5LXRA 1JKHA 4UY85 3K5MA 4CLPA 4NCBA 1JWWA 2XCPA 2R8KA 3O5TB 4UOFA 1YJTA 3NBPA 3R1LA 3KLFA 1ZTTA 3EDRB 1UVKA 3NOCA 2D1CA 4I2PA 2IY5B 2LA6A 4RW9A 3LWLA 3ENVA 2UVWA 2B0GA 1QE1B 3M2UB 3GQCA 4ES2A 3SQGA 3NMRA 2KFZA 1RT3A 1U45A 3OLBA 1WORA 3MOJB 3D0IE 2QEXS 4WTOB 1RTZA 2BKPA 5ETTA 5B0DA 4M8LA 1WTFA 3UWTA 2FDNA 3OVAA 2UV8A 2LQ8A 3SSRA 1TV6A 1RTDB 2E1PA 3CDEA 3TX8A 4DV2J 3N6LA 4LF7J 3UDLA 4RW7B 2BMBA 1LWCA 2V4JA 2KFYA 3IC1A 2DHGA 4YDDB 4PPZA 2XMMA 3GTYX 1TTHB 1DQ9A 3RW7A 3VGTA 3QGHA 3IS9A 2IC3B 1Z4UA 5LMNF 1NAQA 2K8GA 1OIAA 2B4VA 3M6UA 4B08A 4KKOA 3SIPB 1X4BA 1LFWA 3BGLA 3KJVB 2DB1A 1CJVA 1REGX 2ZBPA 3FEZA 4OYMA 5AXLA 2R8GA 2V68A 4MKBA 4NYOA 1HD0A 1WG4A 4NLGA 3DLGA 2BJ3A 2B5JB 1WKJA 4OYAA 1QD1A 1SJ3P 3BB5A 3W5XA 3SDEB 1MU2A 1R89A 2HFNA 2RDDA 3L9ZA 1CC8A 4EO8A 1I3OB 3FRZA 2CUYA 4DMZA 2Q6BA 1VBXA 1Q1KA 1RADB 4MIAA 2VQFF 2DO4A 5THWA 2XULA 3RRGA 1RA7A 3ZZPA 5DGAA 3TVKA 1FFGB 2LCWA 4V19J 4OI4A 1RLDA 2GMJA 2FUG9 1RISA 3B4DA 2MQMA 2V9WA 4J9UE 1FDNA 2V69A 1TMMA 4TKTA 3LP1B 2ZBQA 5IFMA 4OZ1A 3Q0AA 2GGPB 1JLQB 1RDRA 4B3TJ 4ID8A 1VQ5S 1SJFA 4F3QA 3LP2A 2Q3PA 2R7RA 3UNYA 5HQ8A 3CDBA 3MUTP 2MLYA 5KG2A 1Y0HA 3AD7C 2DGXA 5G4DA 3GFZA 3N0VA 3KLEA 4L6V3 3U1LA 2FJAB 2BE2A 2XS2A 2ZH5A 2FVCA 3TEHB 1ELOA 3NKYA 2L48A 2ZM6J 1M90T 1KQGB 1EKSA 1KVJA 5BYSA 4GC6A 3HVTB 4O4GB 1NHUA 1SB6A 3UD5A 5HVGA 2YKAA 2CPXA 2CQGA 1KQSR 1JLCA 2XMKA 5D8HB 1XR6A 2CNLB 2VPYB 1LW2A 2AJ1A 1JJCB 1NJIT 8ATCB 3P96A 2OFGX 3HSGA 1WNEA 4KT0C 4IUFA 3DRSB 2X3DA 2V2KA 4DFMA 4GVBB 2FJWA 2LXFA 4L3KA 1S6QB 1HW9A 4LSNB 2G2OA 3UR3C 3LF0A 1X5SA 4ANEA 3RR7A 1RU1A 2GHWA 2CYYA 4NI2A 4P71A 5ETNA 1I1GA 3NCQA 2I5JB 3OVSA 1F1BB 1UJ5A 4JI6J 2WK4A 3T6BA 1VRUA 4O44A 1HWJA 2HHPA 3D0GE 2DHXA 2GIQA 1OYEA 1UKUA 2DEIA 2CQDA 2UVRA 2WSCC 2GQQA 4NMLA 5KG3A 5LSLA 3NCPA 2DXFA 3HHLA 5KFRA 4DPXA 4ECVA 4K2XA 4LUBA 4YQWA 2PT0A 2FVSA 1H2VZ 3PX0A 1HI8A 3IRWP 2OO4A 4J9QA 4FS2A 2V2QA 3MMBB 2ASDA 3S6EA 3QJPA 2ZJPQ 1IN0A 3AJ2A 4WKRA 4NCGB 4JI1J 5IT0A 2XO6A 2BXJA 2OPSA 2YNGA 4USIA 1S1VA 3WX4A 4CLYA 4K2JA 3NCRA 5KG4A 4OX9F 4OLOA 5HL7Q 3I0SB 3ZTSA 3ICLA 2YWFA 5LSRA 2UXDF 3AAWB 4ZK7M 1CC7A 5ITHA 3J7ZT 2XLIA 2LEPA 3HMJG 5I3UB 2BANB 1LXJA 5A0YA 1UMJA 2CJBA 2PI5A 2IYGA 5EDWA 2KT3A 4ZVQB 4C9DA 4OV1A 5D4LA 3I5AA 4K4YA 4H4KC 3MM8A 4NLPA 4X62F 3AJDA 3PACA 2DHSA 2W2QP 2NSBA 5F41A 3R97A 3HFVA 5J1NA 2R2TA 4RW8B 4DFKA 2OH2A 1XMBA 3IR6B 5T41A 1CJTB 2DY9A 1C0TA 3F41A 3F56A 3R5DA 1RT6B 5GMDA 4EBDA 4DU8A 1XQIA 3M8QB 1AZSB 4R8UB 5CQGA 3G6VA 4NXMF 4K5SA 3ADAC 3E3XA 5IT9Y 1HR0J 1WC5A 4M1KA 4QW9A 2QA1A 3M4XA 5HROA 3GLJA 1BD6A 3UW1A 3RBXA 3CCLS 1CJUA 2BKOA 3EX7B 1YJNS 3PJXA 2FQQB 5ETKA 3CD0A 3DMJA 2HNZA 5IXUA 5HSPA 5J2QB 3OVBA 3PZPA 4Y0FA 3GJTB 3IR7B 2JL9A 5H9FK 3HT0A 5F0UA 5HVHA 2RQ4A 1TL3A 1KLMB 3TQ1A 2KB2A 3FMWA 1IBMF 2NXNA 3VR1A 2PEHA 4F50A 4ZPAA 2GVZA 4AE5A 1I6JA 3K58A 1Z2LA 4OLPA 2W2NP 3BYPA 5A8WB 1HL6A 5JUMA 3OJUA 4C7QA 3DOMB 4QYZK 3UVJA 3V4MA 3TZYA 1SC1B 3CW2C 3T1YF 4A8WA 2RT3A 2XCAA 4FXWA 5AT1B 2HFOA 4CLFA 4X4UA 5KG1A 2E1MC 3BGFA 2HRYA 1M5KC 2XQCA 1D9DA 1Y11A 2ZKTA 2UUBF 5CHCB 3GV8B 4HTJA 4LRCA 1OSCA 2W7AA 4DUZJ 2MLXA 2POKA 1XNQF 2VG6B 1XWLA 2AT1B 2FHJA 4JUZA 3A3OB 4DX6A 1AUDA 4JI4F 4KBIA 5L1LA 2OELA 4UZCA 1REVB 5FD1A 2WW8A 1QSSA 2XZDB 2C2KB 2L9WA 1YG0A 1VC5A 3VAGA 4NYZA 2N4DA 1NZ8A 1RBAA 4HL9A 1LOUA 3PYDA 4HACA 2HLUA 1TUGB 2QRRA 4EEYA 3PFOA 1BQMA 2ZH4A 2V34A 2UUAJ 5ETVA 3QRQA 2XBPA 3L4BC 1AFIA 2E7XA 2XO7A 2OKQA 3PV8A 3R2DJ 3PIPQ 3M8PB 3HVAA 1SKSA 2BV3A 1IR2A 5KFFA 1CJKB 3MZIA 1GK8A 3BKFA 4C48A 3MPDA 1DJ0A 1K9MT 1S76D 1NEEA 4Q0BA 1SQEA 2D9PA 2XHWA 2E5GA 2GS8A 2HWHA 3KLGA 1NK5A 3RRHA 4NEZA 3V6KA 1I94F 5DDOC 4F2RA 4R5PB 4BWJA 1U4BA 4IFVB 3ILJA 4WE1A 3NGDA 3OUYB 4DR5J 2J6UA 4CO4A 4J91A 4DOZA 2JEIA 2X3GA 2H4WB 4RUBA 3PXGa 3U27A 2W7PA 2EPIA 1JB0C 5EN1A 3HI9A 1ZH5A 4DV2F 3DXBA 2EKNA 3M9OB 5HMXA 3D6TB 4ED6A 4ECZA 2FC8A 4J9RA 5A2QU 3PYFA 1HBOB 3JSBA 2FTRA 4LF7F 3IM9A 4PXEA 4JB8B 3JS9A 3ENAA 2NZ4A 2W9AA 4M63A 4MFBB 3BSCA 2FJDB 1IVZA 5T14A 2VBZA 2F5GA 1YBUA 2JRSA 1R8HA 1SKWA 2GQ2A 4OZNA 3JTNA 4USHA 1XNRJ 1W2BR 4PWDB 1FKOB 1FKPB 4LBHA 2UUTA 4ZOSA 5LM7E 1U0HA 3IA0A 2DBBA 2EEYA 5DRKA 2EG2A 2ZUAA 2MGZA 2B6AA 5IS2A 1QSLA 1P1TA 4JV0A 3KLIB 5IV4A 1JKHB 2DPJA 1UJ6A 5CD4H 1FI4A 1C2PA 3PHEA 3NBPB 3H2UB 3KLHA 4DLGA 1C4AA 3N6NA 2KHCA 3KLFB 3AHPA 4GRSA 2NREA 2ZH2A 4I2PB 3IM8A 4TVAB 4RW9B 2BE7D 3CJ4A 1RKJA 3RB0A 1TQLA 1VK3A 2ZZTA 1UZHA 1CPZA 3W64A 1WSRA 3IGVA 2LQJA 1RT3B 2VG5A 5IM0A 2W2PP 4RUAA 4ELTA 1N5YA 1RAGB 4PYAA 2QLXA 2B7BB 4U7UD 4I68A 1T9VA 2FY1A 2HS3A 4DN0A 1TV6B 1TU0B 1HLWA 1PYSB 4LRAA 5KFUA 2AU0A 2DNLA 2MKJA 1LQ9A 3IO1A 3BGUA 3PW5A 4DU7A 2R2SA 2VG7B 2CZ9A 3VALA 1IBKJ 3H98A 1K47A 1NHVA 1LWCB 1IKVB 2W4DA 2V4JB 2AF6A 1Y3KA 2I9SA 3MDFA 2VL1A 4NLXA 3G82A 4ANDA 3KYLA 3J7Z5 2BM1A 3IS9B 2ZM6F 1HBUA 3M8YA 4TU7A 1SL0A 1RTIB 4KKOB 4UT4A 1CJVB 2E5HA 2IAJA 2HHWA 4O3PA 2IVFB 4I6YA 2V2VA 4C0HA 3AA9A 4G3IA 5DS7A 2VKRA 4MIBA 2VONA 3DLGB 3TOQA 1S7HA 1ZOTA 3Q8SB 2NXUA 2AYMA 3GJSB 3UN5A 5KFWA 3L7UA 4WZMA 3U02A 1S0MA 3BKTA 3VHQA 1CQNA 2MZSA 4YB6A 3I96A 3Q8VA 3I9V9 3P4UB 2V8DA 4EMDA 4Z37A 3JTPA 3D54A 2RJZA 1X9SA 4TYBA 3DFEA 4Z7CA 3SI8A 4RW4B 1MWQA 2LEBA 4JI6F 3AD8C 3F44A 1HW8A 3EICA 1NK9A 4EBEA 1JJHA 2V8VA 3UR0A 4LJMA 3KHHA 2J7WA 4ZLPA 1SBRA 1YSJA 4N47A 1ZZFA 5CYJA 4F0MA 3LP2B 1FD8A 2RNEA 4KO0B 4Y2KA 2BRKA 2RKIA 3W5ZA 2WSEC 3M32A 2G0JA 2F63A 4YY3J 1S0OA 2DR9A 1PAUB 3MOZA 2MYFA 2A2DA 2PEBA 4IO9Q 1KS2A 4K5RA 2IMWP 5JJBA 3KLEB 2DRBA 4JI1F 2BE2B 5KFOA 1ZS6A 2W8KA 1UWAA 3Q89A 1PC5A 4I7FB 2QMXA 1IR1A 3VV2B 2XSFA 4ZDNA 4ILLA 2J6TA 4MKVA 4IRDA 2VJUA 5KFEA 4BC7A 2IMOA 2BM0A 2KU7A 4WF9Q 1JLCB 1Q78A 4Q45A 3PJ9A 4F4AA 5GAGI 2ZH3A 3QPIA 2CJYB 3EUNA 4UQGA 2MJNA 3DHWC 2AJQA 3DN9A 2UVVA 3WC0A 3MM5A 3T9ZA 1HBMA 2NSCA 3M6XA 2DGSA 2AD9A 4NI2B 4F67A 4KR0B 1RWXB 2HFUA 1GQEA 1XN9A 4R25A 1VRUB 1TUVA 2J5AA 2WBMA 3PO4A 1F9FA 1HR0F 4ITSA 1N5TA 3POTA 2YXLA 1H74A 3R3TA 2KZMA 3A4TA 2ZZNA 4IR1A 3HHLB 2DPIA 1D09B 3ZO7A 1S5ZA 1KSPA 4OI0A 1MROA 3QFHA 1T11A 4ECWA 1KDNA 2BQRA 2G9OA 2F3JA 3VAFA 1S10A 1HQEB 1XR7A 1NHKL 1IBLJ 2BOPA 4C8MA 4C98A 3P5BP 4ER8A 2YNGB 3GFHA 4QYZJ 1S1VB 4FXVA 4FZVA 2E7WA 1U1MA 3CIMA 3EXYA 1X5PA 5DG7A 5FLXU 4YB1P 1TVRB 1ICEB 2G1DA 1Q5YA 3SSQA 3H5XA 1TK5A 2IIHA 4C3KA 2QE5A 5A0YB 3SSSA 4CLUA 4OIXA 3TZXA 1PCAA 3NY0A 2AKWB 3T1AA 3MAAB 2OPRA 4DFJA 1C0UA 3K8WA 3W5YA 2YKMA 1F60B 3EDQB 2F1FA 4OYXA 1SI9A 1U25A 3DYAB 4LMZA 2CPFA 2HQIA 2WVDA 1C0TB 3TAQA 4M5KA 4DUZF 3ZTOA 4M5IA 3X3UA 1OMSA 2ZH8A 3EPGA 2E5JA 2DCUB 2QL9B 2VPWB 4ETZA 4CNYA 1JLAA 1NSAA 2ZWPA 3OFGA 2AJ4A 4WKYA 1DRZA 5HJYA 3K59A 2NQPA 1P9QC 3V4IA 5HROB 2R7WA 2Q66A 5C42A 3PM9A 2CNNB 1H7XA 3RBEA 3R7NB 2NYHA 3PW7A 1CJUB 3AY0A 3HZGA 3DMJB 4H4MA 4B17A 4FYXB 4ES3A 2ZH6A 4MYUA 2I8EA 3AOCA 2DVIA 3NL0A 1YK9A 4ZP6A 3QZ7A 2C2ZB 3FZBA 1OSDA 1FT8A 2AYGA 3VGUA 1XIQA 1O0PA 2W7OA 4FP9A 4ICLA 2QLBB 4DV3J 3A8JA 3DGVA 2LFVA 3ETMA 2MQPA 4CM2A 2GVZB 4FPRA 3WC2A 1R7IA 4QR2A 3RAQA 3HZEA 3LGHA 3VWSA 4PQAA 2ASYA 3VAKA 1P1LA 3M2RB 4ZMMA 4NLRA 2YVSA 3FQLA 2VODA 2BX6A 2DKOB 1U1KA 1EKRA 4KHMA 2F4VF 1UVIA 2D41A 1NK4A 4LVOP 2QTWA 4DUYF 2B8PA 5KFKA 2HFVA 1G6BA 5HATA 1ZM9A 5K8PA 1MN9A 2QA2A 2ZEJA 4X64J 1VLOA 4OZ0A 4LR9A 2WOMA 3BN7A 3MD3A 4I1TA 4URGA 2X1AA 1NPRA 3R5CA 2QYGA 4RX6A 2B7CB 2C2EA 2HVZA 2CVEA 2VQEF 2LXUA 2HVEA 2O3DA 2HNDB 2RQKA 4LF5F 1KP6A 1SPBP 4GC7A 1KTVA 4ZVFA 4FNIA 3PX4A 3DCAA 1VQ4S 3I82A 2AWZA 4B9NA 4HACB 3J7AN 1DTTA 4C6AA 1A6LA 1NJWA 3MWBA 2QIFA 1BQMB 4P73A 2RU9A 2OTJS 2PI4A 1MMNA 3KXDA 3OV7A 3NAHA 4LFAF 4JI7J 2XMUA 4QU6A 4KIAA 2BJ8A 1VC0A 3C6UB 2KHDA 4K8RA 4RNOA 3RW6A 3HM9A 4F3MA 4RBTA 2BEFA 4Q0BB 4O0NA 2VD3A 3KLGB 1U48A 4ELUA 4ED5A 3UI3A 3H5SA 4LFCJ 4NLDA 5K14B 4G1IA 1WI8A 5I4MA 1I5OB 1JK9B 4USJC 3VZHA 4WE1B 5ETPA 3TAMA 3R8YA 5C25B 3W61A 2LQ5A 2EW9A 4CIOA 1UZDA 2CQBA 4MAKA 2WHOA 2ZUGA 3CDAA 1FRMA 5DLFA 1B70B 2CQHA 3TP2A 4PRFA 1RBLA 4O3OA 4ECUA 1GMWD 3ZXWA 2Q79A 4H4KA 2M2BA 1X5OA 4P2SA 2HG4A 2J0XA 1Q53A 1IBKF 5D0RA 2XG8A 4AYBD 1XMOF 4ZPDA 2LYVA 3CULA 1P8GA 3CVKA 2IM3A 3M2VA 2CJQA 1SH0A 3EJMA 3AJ1A 4CYUA 1WKLA 4QIEA 4Y65A 3J80Y 2C42A 1CLFA 1WEYA 3MD1A 3RAXA 3TNVA 1VDHA 2RUSA 4RL1A 1K73T 2JVOA 4B3RJ 2WVEA 1RWPB 2B6AB 2MGZB 3B8HA 2LA4A 4KTQA 1U1QA 2GX8A 2IHR1 4GKJJ 3MTKA 5DG9A 1IKWB 2EG1A 4O4RA 3LANA 1HWKA 3I55S 1N52B 1QAYA 2BRLA 3CD6S 3KLHB 5E7OB 4M5JA 1IKYA 1LWXA 1S12A 5D3GA 3DLEB 3U1NA 1RU2A 1G3OA 4B9SA 1HQ2A 3O6QA 2IA6A 2CG4A 5RUBA 2VIHA 2L9NA 2V63A 4QW8A 1JJ4A 5F8LA 1RTHA 2VG5B 5IM0B 3L7PA 1RABB 1NKCA 3UN3A 3QSIA 1C1BA 3KNGA 1S59A 3FCVA 3RTVA 5CCLA 3QLHA 1LWFA 1DLOA 3PY8A 1R8CA 2UZAA 4ED0A 3R6GB 3NG8A 2GHVC 2HAIA 2RF2A 3C66A 1Q4RA 5CZXA 1RT5A 5GAHI 2JLEA 1TZ0A 2YKNA 4FVCA 2JH3A 1FDDA 5IWAJ 2HWIA 4PG8A 4AQYJ 5HK4A 2E5LJ 1NNDA 3DLBA 4YY3F 3CMAS 1AB8A 2CPDA 2W9CB 1AT1B 1N48A 5KFGA 2MY8A 4P75A 5DZ7A 4LQ9A 4ECSA 3G82B 5BJRA 1NUEA 2FY8A 1KKHA 3EM1A 3J81Y 2UUWA 3OTCA 1QLNA 2GA7A 3D3BJ 4OJHA 3A8EA 4DR6J 3V6JA 4MMOA 1U09A 1JLGA 2XSJA 3FMBA 1FX2A 1M1GA 4GKKJ 4CP5A 4ED8A 2ALZA 3BJYA 3AOAA 2HFSA 4BBYA 1MLAA 2DGVA 4X2BA 2HQ3A 1WHYA 2RILA 2ABYA 4X4PA 4H4OA 2UUCJ 1U8SA 4IFYA 3GFYA 1F9HA 1MMLA 4G1QA 3W8GA 5AXNA 4QWDA 2HSEB 2CQ4A 1RP5A 2QL5B 4UUXA 3QWPA 3J81j 3P49B 2JLFA 5H9EK 2A1BA 2KH9A 1FESA 4LFBF 1A7GE 1DTQB 3DU5A 2QLFB 4A8KA 1M5SA 2GV1A 4ZVPB 5K9FA 2M7SA 1TUWA 2KM8C 3CJQA 2DITA 1Y5IB 2DXEA 1GNKA 1Q5VA 2J9DE 3ZZTA 1JXEA 2Q1LA 3LH2S 1SC3B 3TEGA 3G6XA 3OTOJ 2HGLA 4WFBQ 4DV5J 1HWUA 1VBZA 4I67A 4A4JA 1YJ7A 3M32B 2GW8A 3W2VB 1GMVA 1EIYB 1U0SA 4OHVA 1WG5A 2ZH9A 3HHNB 2IRUA 1FXRA 3NEKA 3OBIA 2AGQA 3H40A 1RT4A 3K5PA 5L8RC 5J1PA 3H5UA 6AT1B 2DNQA 2EBGA 4P7VA 3NNAA 4A8XA 2HGNA 3GWCA 3FCHA 5GAGU 1T03A 2Z2YB 3KJNB 4CDIA 2CZVC 1OS5A 5KFVA 3IWLA 2DGWA 2ZOMA 1Q7YT 5KFZA 2KO1A 3CT9A 4ZN1A 1N56A 4C3LA 1GAOA 3DRRA 3IR5B 1AYEA 2K3KA 3TZZA 4OX6A 1VQ7S 1P9YA 4A8YA 5EX0A 4K0KF 1QVFR 3GR0A 5L1IA 1YKWA 2CQPA 5C2GA 2HBYB 2O66A 3D6FB 3MM5B 1HBMB 4TXSA 3NMAA 2OGUA 3U1MA 3UNGC 4J9KA 3LW5C 4KHPJ 4AXIA 1VC6A 1R43A 2F4FA 2ASLA 1SUQA 4X4TA 2V5HG 1U2CA 3POTB 3SFGA 4LSLA 1NJYA 3H4DA 4CI0B 2F9JA 4JI0J 5IT9U 5DDPC 2RB7A 3F0NA 1MROB 4K4WA 3HKWA 5LMNJ 3PX6A 1GMUA 2ILYA 1Y7PA 4RNHA 3JXOA 4KGZB 2H51B 1ZYQA 3HFZB 1FRLA 1FE0A 5HP1A 1S1XB 3RBZA 1SH2A 2KRRA 2DR7A 1FDBA 1ZPVA 4P7TA 1U6ZA 1S4EA 2CIMA 3RU0A 1G2EA 4DV3F 1CS4A 1NDKA 2MZ1A 3MEGA 5J1EA 1R31A 3QWUA 3PRBA 1BQXA 4ECTA 3IWNC 4DL6A 2E44A 1V5VA 3C16B 1TMJA 4E8UA 4QWBA 3C2PA 2HPUA 3TA1A 3CB4A 1WF2A 4HH1A 1N54B 4OYWA 1H98A 4DF8A 5F0WA 1S9FA 1Q82T 1P27B 2OPRB 4YN3B 2J0QD 1UFLA 2KXHA 3QJJA 3W60A 1ZM4A 4MT1A 4PUOA 1APSA 9ATCB 2V2ZA 4FYDA 4XDCA 2ZDOA 2DNHA 4P6QA 3AQOA 4DZ6A 4L76A 1RT1A 2GZOA 2QSWA 5E5NA 2GAGC 5B0AA 4WIQA 2AEMA 3D7SB 4CLTA 3U7JA 3CE8A 1JLAB 1GXLA 4WFXA 2FPHX 2NS1B 2M4MA 2XGPA 3CC7S 3D6MB 1T05A 1T9WA 3MCMA 4ZCMA 5C42B 1G7CB 3H8YA 2E9ZA 2VZ9A 2VDIA 3KUGA 4H4MB 3PRVA 4BWMA 1RAJA 3EZOA 3HSDA 1N32J 3VQTA 3ZZRA 2L08A 1SL2A 2ASJA 2U2FA 1WC4A 2DHAA 3PIOQ 4JI7F 1HYSA 2NUUG 5D15A 1TKZA 4Y34A 1TK0A 3MM6A 2F8MA 3G8SA 4MJKA 5DQHA 4OFZA 1IQTA 3GP9A 4O3QA 4CH7A 3UD4P 1TFWA 2VFVA 3AOBA 3D1HA 3LQVA 1YWXA 1RWMB 2CQ2A 4NEYA 3GIJA 3V81A 1PJ6A 3Q8UA 3RAMA 3DI6A 1TKDA 1U2FA 3IAM9 3TUIC 4HYKA 4LFCF 4DQPA 1YRXA 3ENWA 4DL0C 4OI3A 4C11A 4YHHJ 1Q86T 4BLGA 3KLVA 3HT3A 1FDAA 2WOMB 2AGOA 5D78A 3SV4A 2A2CA 2GAHC 3MM9A 1TAUA 2BJ7A 2DGQA 4DSFA 2VKZG 2JEFA 6FDRA 4K4SA 2EC0A 1X4CA 4ZIVA 3MCNA 3CO0P 4N77A 3RG6A 5A8KB 1T0TV 5KG5A 2HIYA 3VGVA 2PC6A 2MTLA 2JVRA 2ZOFA 3VF0B 2VH7A 1WJ9A 1PG5B 4M5HA 4IH6A 3L7OA 1N6QA 3CC2S 2XI2A 2X1BA 4EUVA 4C8OA 8AT1B 4Y6IA 4WFYA 2XS7A 4DX5A 2WTFA 4DV1J 2EFPA 4MH8A 2HQFA 4TQSA 2XMVA 2FJXA 5F3TA 3O44A 3OSNA 5AE3A 4J9SA 1WOSA 4QYRA 1V9OA 1YX2A 3W9HA 4B3RF 4QQBA 1M5HA 4GKJF 2DH9A 2J0SD 1IUJA 3SZ2A 3WHIA 5KT4A 3AQPA 3W2WA 2UP1A 1WHXA 3P3DA 1F9EB 1X7VA 1F3VA 2JC1A 4TNOA 4ZJLA 2DD8S 2G2ZA 2FLNA 4CTAA 1PBAA 1RHMB 1LV5A 2FIUA 3JTOA 4ZP9A 2WAQD 2KYXA 5HLFB 3MM7A 2OAUA 3OSPA 4OI1A 3ONQA 1WEXA 2IM0A 1SV5A 3O8WA 2YPZA 3BQ1A 4ERDA 2OLWA 4G65A 3FZ2A 3M30A 2K7JA 1RTJB 3LOUA 3G8QA 1EQMA 2B9XA 1IWGA 2Y0BB 4C8NA 5A6PA 5IWAF 4A47A 2GMHA 4AQYF 3T3FA 2EK1A
chains in the Genus database with same CATH topology
5E41A 4RUAA 3SMZA 4O3RA 4HI2A 5C5JA 4ELTA 5E3RA 2ROGA 1L5UA 2JZ5A 3SDEA 5J2MB 1N5YA 1HFEL 3OTEA 5KFIA 3S8SA 5JVHQ 2MDAA 1AXQA 3IXQA 2H9ZA 2AW0A 1UP1A 1UVLA 1UW4A 4NRTA 4MK8A 2QLXA 1RT2B 1RT1B 2B7BB 2BZ2A 2OFHX 1HQEA 3EZ5A 4W90B 2HW3A 3M1VA 4I68A 4NL5A 1FEEA 2FY1A 2MY7A 2R7SA 1YJVA 2HS3A 2J0WA 2Q43A 4DN0A 5C24B 3M2VB 1TV6B 4WXOA 1VQOS 4CQ1A 2NPIA 4JV1A 1R8BA 2VFTA 2DGTA 4YB7A 3B82A 2MHNA 4IKAA 3OFFA 1J5OB 3CCTA 1TKXB 3KOAA 5KFUA 3T5HA 3EXCX 2J7KA 4DL5A 4I69A 1NH7A 4DV4F 2AU0A 2DNLA 1M5VC 2YNHA 2MKJA 4JI8F 3BSNA 1LQ9A 2ZVSA 3DHXA 3IO1A 4IDKB 3BGUA 4B9TA 3PW5A 2DNMA 2N3LA 1HQUA 2R2SA 1U6FA 2VG7B 3AB2B 4X4SA 1TVRA 5H9EJ 1QSYA 3VALA 2KFNA 3BO4A 1JLEB 1LW0A 4IG3B 1WD6A 3H98A 2XEXA 4EU0A 1NHVA 1LWCB 1IKVB 2W4DA 3KNAA 4K4VA 2V4JB 3C6TA 2COLA 5EX3A 5KFSA 3H25A 3DXSX 2AF6A 3KHLA 1Y3KA 2ROPA 4MKAA 2I9SA 4TLQA 1K8AT 3CCMS 5ADZA 2FVRA 3LP1A 4DR4F 3OJSA 3MDFA 4ZKAA 3JYTB 4IOBA 2VL1A 3FFIB 2LDIA 2YY3A 4NLXA 2GGPA 2UUCF 4FN5A 1VBYA 4IOAQ 3KYLA 1NJXA 3J7Z5 2BM1A 1YRTA 4ED1A 3N79A 3ZC4A 1QUVA 2ZBCA 3IS9B 2ZBIA 2Z8QA 4OJ1A 2ZM6F 4DL3A 1HBUA 1HNIA 1NJZA 1FRIA 3KTQA 4I2QB 4TU7A 1Y3JA 1SL0A 1RTIB 1CVJA 4KKOB 4TU9A 3GYNA 4QOTA 2A10A 5D3GB 1VLYA 3RYLA 3LGMA 5GADU 1HMVB 4KHRA 2YH1A 4I4BA 1B64A 2V8GA 1XTZA 2E5HA 1M1KT 2IAJA 2YWHA 3UCUP 2HHWA 4X66F 2YX4A 4F25A 3ENQA 1B0PA 4YOEA 2FC9A 4O3PA 2IVFB 1HYSB 1H3DA 4I6YA 1SL1A 1S77D 3UE2A 4DPOA 4EYHB 5D6GA 4C0HA 3AA8A 3AA9A 4G3IA 3R1HA 1KD1T 2OPQB 2HZCA 3W3SA 5DS7A 4YR2A 3DYAA 4HEA9 4RUCA 4OHXA 3UD3P 2VKRA 2Y1IA 3MURP 1NZAA 4MIWA 2QLWA 4MIBA 2VONA 3DLGB 1LK7A 3TOQA 3BR9A 4CT8A 4RNNA 2ZH7A 1S7HA 1ZOTA 4LF4F 2M3DA 1S9GA 4ELVA 1VS3A 2VBXA 1TL4A 2XWYA 4PG6A 3Q8SB 5GAHU 1JNRB 2AYMA 2NXUA 1N33F 4Y2CA 3DDNA 1VQ6S 3DU6A 1X4AA 2YH0A 3G8TA 1R27B 4DV6F 3QIDA 5KFWA 2AV5A 2IJNA 3HVTA 4O4GA 4WZMA 5HBMA 5CYQB 1LWFB 3BGRB 3U02A 1IR0A 3V81B 1IKXB 1S0MA 3D5MA 4ZPWR 4EYIB 3EGWB 1D9FA 1CQNA 2RDJA 2LLZA 5B0GA 1FCAA 5EHHA 2MZSA 1KFDA 4YB6A 3I96A 3RRKA 1VQMS 3N5FA 5LSOA 3I9V9 2RF2B 4WYWA 2LKZA 4Y28C 2V8DA 4WU2A 3L3CA 3CCUS 1DHMA 1RT5B 3KMSA 4CO3A 4LIWA 4Z37A 1SKRA 3OTOF 3QMQA 2YKNB 3JTPA 3PEHA 1CQMA 1H7WA 3D54A 2D74B 2QSFA 2RJZA 4PXBA 4CO1A 5F8MA 2XLJA 4DV5F 1X9SA 4Q8FA 2B43A 4ATNA 4MKYA 4C11B 2OJ3A 2ILZA 4FNHA 4TYBA 2JEJA 2K1RB 3DFEA 3WBZA 3SI8A 3MFHA 4RW4B 2LEBA 4WXWA 3CCRS 1UWBA 5B0EA 4JI6F 4QIGA 3F44A 1HW8A 3E01B 5U47A 4RZRA 1NK9A 4NZ0A 3DOKB 3DRSA 4EBEA 3QAEA 4HVZA 3SCLE 2FB0A 2AYBA 3N28A 1JJHA 1KONA 2V8VA 2P5VA 1WI6A 3MEEB 3UR0A 4DSLA 4LJMA 3FEXB 3DLHA 4K4TA 3KHHA 4AFFA 1S6QA 2MSTA 2PFFB 2J7WA 3RZAA 2I2YA 2RUGA 5LMUF 1L3TA 1MMDA 4ZLPA 1D0EA 1MWYA 1SBRA 3RB3A 1YSJA 4M95A 4UY8T 3RBDA 1AROP 4N47A 2AJFE 1ZZFA 2DNPA 2IFXA 5CYJA 3BO3A 5DM6Q 5E3PA 3LP2B 3CWJA 4UW2A 2ERRA 1FD8A 2RNEA 2EWHA 4KO0B 1KOHA 4KV8B 4Y2KA 2BRKA 2CPHA 3OR1A 2RKIA 4J37A 1SC6A 2Y0SD 2WSEC 4WYLA 4CZCA 3M32A 4XK8C 1E6YA 3QO9B 1ZAXA 4YB5A 5D4PA 1YJ9S 1JLGB 2XSJB 1FTCA 2I5JA 1S0OA 2E1AA 1SH3A 2V8HA 4F26A 2DR9A 2B3TB 4PXDA 3MOZA 2IVYA 2MYFA 3NRBA 2A2DA 4DDFA 3IGNA 1OO0B 4IO9Q 3CPWR 1KS2A 4K5RA 3J7YI 3BF4A 2NR0A 2IMWP 5JJBA 3CO9A 3KLEB 2XY6A 2HS4A 2M8HA 2DRBA 2HHSA 3IG1B 4JI1F 1VRTA 4X64F 1OWXA 4EWTA 1R8PA 2BE2B 4E98A 5KFOA 4H4OB 1VQ9S 2HHXA 3CDUA 1GXTA 1ZM2A 4OZ5A 3PR5B 4ECQA 2VOOA 2W8KA 2HIQA 3ZZ0A 3D1OA 1NK8A 4IFYB 2DK2A 3M2RA 3G6ES 4Y00A 3N01A 1FXLA 4CO2A 1PC5A 4I7FB 3CXCR 2QMXA 2RMLA 3GG0A 3GB0A 5DETA 4G1QB 3KFWX 3L09A 2E66A 2XSFA 4ZDNA 2XC9A 4ILLA 1S0VA 1VQ8S 3G86A 2FVQA 3P6YC 4C97A 2J6TA 2XNQA 4IRDA 1SJQA 5J2PB 1L3KA 4ZA1A 4N5SA 5KFEA 4ZVGA 4TYAA 5KTQA 1HARA 1XR5A 2IA0A 2Z2MA 3MMBA 2VBYA 4BC7A 2IMOA 1S1WB 3KMQA 4NWBA 2BM0A 2KU7A 3BS9A 1ZETA 4WF9Q 1JLCB 1Q78A 4RLEA 4Q45A 3Q8PB 3MEDB 4F4WA 4NCGA 1SJRA 3HX9A 5K8OA 4F4XA 4IOCQ 2MHEA 3VTIA 4M5DB 2WCXA 5DDQC 4JV5F 1HHSA 1Q7LB 4I56A 5GAGI 3AB4B 2ZH3A 3QPIA 2EFVA 3EUNA 1KTQA 4UQGA 4FF3A 4KHPF 1S72S 3CJ2A 5FDLB 2MZJA 1NKEA 4N56A 1QY7A 2PSZA 2MJNA 3I0SA 3DHWC 4CCHA 4C8ZA 1VMBA 4NLQA 2AJQA 3DN9A 3BDEA 2DIVA 4FVMA 1BQNB 3FDSA 2D3OR 2K3IA 1SIZA 5EWFA 4PG4A 5I3UA 2I0XA 4JI0F 2UVVA 4DS5A 5I3PA 5IQQA 3WC0A 2XY5A 1UVJA 3MM5A 4CTAB 2D3ZA 3T9ZA 2HNDA 4NLUA 1HBMA 1Q16B 2NSCA 2YNFB 3HFKA 4I6AA 3M6XA 3Q2TC 2DR5A 2HRUA 4DSJA 4O3SA 2DGSA 2KTQA 2YTCA 2AD9A 2NUHA 2LQ9A 3KK1A 4EZ6A 4F67A 2ZD1A 4KR0B 3MECA 1KHWA 3MPYA 1BC6A 1GQEA 1XN9A 2NYIA 4R25A 2ZC3A 2YWKA 1OQ3A 2B56A 3MMCA 1VRUB 1TUVA 2MSSA 2J5AA 5DO2A 3ZFVA 2JWNA 1U49A 2WBMA 1FVQA 1WELA 1RT4B 2EFGA 2W8LA 1R8AA 4EZ9A 1XERA 3PO4A 4KJIA 4K4ZA 1F9FA 4N8OA 2CRLA 1HR0F 4ITSA 3MAQA 1N5TA 2QFJA 4F2SA 3N5BA 3POTA 3HVRA 2R2UA 3R3TA 3R5AA 1FXDA 2KZMA 4DHVA 3DDKA 1FK9A 3FSYA 3HHKA 2ZZNA 3IN5A 1RK8A 2OPPB 5B09A 1PILA 3CCZA 4IR1A 3HHLB 4URQU