1RK8A

Structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
87
Chain Sequence
PQRSVGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG8781-PA protein
publication title Molecular insights into the interaction of PYM with the Mago-Y14 core of the exon junction complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Translation
total genus 18
structure length 87
sequence length 88
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rk8A00
5GADU 3L3CA 3UCGA 1KOOA 3UE2A 3UD3P 2DGVA 1YJWS 3P6YC 2EK6A 4CQ1A 2DNQA 3VAHA 1YHQS 2AYBA 1FHTA 1YJ9S 2DNRA 3MD1A 1CVJA 2LXIA 3CCJS 2E5IA 3G8TA 3BO2A 5EN1A 3SDEB 2I2YA 3VAIA 2DIUA 4WF9Q 3G71S 4V19X 2MZ1A 2VOOA 1QVFR 4TU7A 3OW2R 2KRBA 2DHXA 2OJ3A 1UAWA 3SMZA 3VF0B 2CQPA 3VAFA 1B7FA 2CPDA 1HA1A 2KU7A 3MXHP 1X5PA 4FXVA 3CCSS 1X5OA 1YJNS 4QU7A 1N88A 1VQ8S 2KM8B 3J7YU 1U1KA 2KYXA 1U6BA 2O3DA 4J5OA 3CMAS 1OWXA 5LXRA 1A9NB 2CQCA 3IWNC 5DDOC 2KXFA 2B0GA 2M0GB 1FJCA 2MJNA 3TYTA 5FJ4A 3P49B 4TU8A 4PR6A 4YB1P 2SXLA 3IRWP 1URNA 2FY1A 4IOCQ 1WEXA 2LECA 1WF1A 2MZTA 4W90B 2DB1A 4CIOA 2LA4A 1DBDA 1D8ZA 1NU4A 1X5TA 2CPEA 3CMES 1M5OC 2RS2A 2XS5A 1K9MT 3R27A 3MUMP 1HD1A 4Y00A 2M8HA 3H2UB 3SDEA 5DDQC 2CPYA 2NZ4A 2Q79A 2VONA 4Y0FA 5D77A 2X1BA 1UW4A 2MYFA 3CTRA 1KOHA 1WHVA 4C0OC 5MLCV 5JVGQ 2MKIA 3VAGA 2WBRA 1Q7YT 2JRSA 5GAGU 1SJ3P 2RNEA 1DHMA 2LKZA 2ZJQQ 5LJ5Y 1PO6A 2YKAA 2J76E 5GAEU 1M5KC 5CA5A 1FJEB 1VQOS 2MGZB 3PIOQ 2BOPA 1X4GA 2J0SD 2HGNA 3MUVP 1RKJA 1X4FA 4LIRA 3N9UC 5DETA 3CC4S 1WEZA 2HVZA 4WKRA 2LEAA 1JJ2R 1X4BA 1WHWA 4ERDA 1VBYA 1JMTA 1VQLS 1ZZFA 3MD3A 2AYGA 1U6FA 3P3DA 1X4EA 1UP1A 2UP1A 1VQ5S 2DHSA 3P5TL 3RW7A 2CQ3A 4UY8T 2RQ4A 2X1AA 1PGZA 3SXLA 5DM6Q 2LYVA 1WF0A 2DNOA 2ZJPQ 1U1QA 1S79A 2KFYA 1U2FA 2DNNA 2L9WA 3G4SS 5JVHQ 1F9FA 2AYMA 1VQ4S 2RU3A 2KG0A 3US5A 3CCQS 3CCLS 2MQPA 4IUFA 1YITS 1WHXA 2MKCA 4QU6A 2MXYA 1FO1A 1YWXA 2CQHA 4OZ1A 3G9CA 2HGLA 2DGUA 3UCZP 2MGZA 2GO9A 2MQMA 3CXCR 2QEXS 3I55S 3MUTP 2DHAA 4PRFA 2RS8A 5GAHU 1K8AT 1SJ4P 5IM0B 2E5GA 1U1PA 4TLQA 2OTLS 2A3JA 2CPZA 1X5SA 2K8GA 2DGQA 5ITHA 2LEBA 2QA4S 3R1LA 1FJ7A 3FEXB 1K73T 1DRZA 2D9OA 3CPWR 1KQSR 1U1MA 2PEHA 3S6EA 3BO3A 2DNPA 3UCUP 2N7CA 2NLWA 4P6QA 3UD4P 5DDRC 3G6ES 2CPFA 3NMRA 4EGLA 2CPJA 2DNGA 1RK8A 1WWHA 2DIVA 4F26A 1NO8A 2XB2D 2XSFA 2DNZA 3S01A 1Q82T 5GVQA 4IOAQ 2CQIA 1YI2S 1WEYA 1VQKS 3LQVA 1X4CA 2LQ5A 2MSTA 2MQNA 5D78A 3CCES 1VQNS 3ZZYA 3MOJB 2L41A 1WHYA 2DGWA 2CQBA 3DXBA 2KHCA 1VQ9S 1IQTA 3THPA 2F9DA 2XS2A 1H2VZ 1U1LA 2JWNA 3Q2SC 1OIAA 1JJHA 2RQCA 1X0FA 4YOEA 2U2FA 2CQ1A 2KG1A 2KI2A 2QFJA 3K0JA 2DK2A 5IM0A 1WG1A 2OSRA 2DO0A 2DGSA 1W2BR 1VQMS 2CQ2A 5HO4A 4QPTA 3G96A 1N52B 3BEGB 3MI7X 1FNXH 1D9AA 2L08A 1WF2A 2BZ2A 1WELA 5HL7Q 2LMIA 3TO8A 2MMYA 2XNQA 4Z2XA 2M88A 3VALA 3RW6A 1SJQA 2DH7A 3JB9k 3D2WA 1M5PC 1U1RA 2U1AA 3CCUS 2MZJA 4WFAQ 1M1KT 1S72S 2MQLA 1VQPS 2VODA 1SJFA 2MKHA 1M5VC 2MKSA 2MB0B 3CD6S 1U1OA 2DISA 2AD9A 5CXTA 2FHOB 5GMKa 2G0CA 2D3OR 4WCEQ 2MHNA 3HI9A 2MQOA 1VC5A 3V4MA 4RU2A 2V94A 2CQDA 2FPHX 1OO0B 1ZH5A 4LJMA 2YH1A 2MY7A 1XN9A 5DDPC 3H2VE 2DNKA 2M2BA 5LSLA 2M8DB 1Q86T 4W92B 2M70A 2HYIB 2XS7A 2YH0A 1SXLA 3S7RA 2N3LA 3U1LA 2E5JA 3HHNB 2G1DA 1Q81T 2YTCA 3MDFA 3NNCA 2DH8A 4WIIA 4CH1A 1H2UX 3NNAA 2RUGA 1KD1T 2KH9A 4YUDA 3EX7B 1X4DA 2N3OA 2KT5A 2DH9A 4U67Q 2YWKA 2KXHA 2E5HA 4WFBQ 2JVRA 1VBZA 2CQGA 3THTA 2OTJS 2RVJA 1OPIA 4ZKAA 2KVIA 1NJIT 2ADBA 1QM9A 2K3KA 3CCVS 4F02A 3VAJA 3B4DA 4PKDB 1VQ7S 3TP2A 4OZ0A 5LXYA 5DM7Q 1KC8T 3B4MA 3EGZA 3U1MA 1WI6A 2LA6A 2DHGA 2DO4A 2DNHA 2GHPA 2MZSA 1P27B 2G4BA 1FXLA 1H2TZ 1L3KA 2DNYA 1WG5A 3LPYA 2LCWA 2LXUA 1HL6A 4IO9Q 4TU9A 3PIPQ 1YIJS 1FT8A 2D9PA 3CC7S 4QQBA 3VAMA 3J7ZT 2XNRA 2MSSA 2MQQA 1VC6A 1VQ6S 1O0PA 2PE8A 4C4WA 2J0QD 3BS9A 2HZCA 4LMZA 2M9KA 5IFMA 5CYJA 3CCMS 4ED5A 1G2EA 2CQ0A 1R8HA 2CJKA 2HGMA 1P1TA 3FEYB 5H1SV 2KRRA 3G8SA 1VBXA 3MURP 4A8XA 3UWTA 3ZZZA 1ZZNA 2MZQA 3S8SA 2OSQA 2MZRA 1QVGR 2VOPA 2JVOA 4WFNQ 1WI8A 4BS2A 1N8RT 1YTYA 1X4AA 2DGOA 3CULA 1N54B 3BO4A 1BY9A 1M90T 2N82B 4C7QA 3I56S 2KM8C 2X1GA 2FC8A 2M52A 2EK1A 1SJRA 3DLLQ 2DNMA 2EVZA 3NS5A 1AUDA 1DZ5A 2ADCA 1VC0A 2MKJA 3Q2TC 3ULHA 2J8AA 2RRAA 1H6KX 5IQQA 2MPUA 1WG4A 2DITA 2I38A 2MKKA 2F3JA 1U1NA 2E44A 2OIHA 2AYEA 2JX2A 2MJUA 4M5DB 2M4MA 1X4HA 2M7SA 2CPIA 2FC9A 1JJ4A 5BJRA 2ERRA 2CPXA 3NS6A 2RRBA 2RT3A 1WTBA 4F25A 4FXWA 3VAKA 2F9JA 2CPHA 2CQ4A 2ZJRQ 2KXNB 2DGTA 3EGNA 2DNLA 3R1HA 3NNHA 1UFWA 1HD0A 3CCRS 3CC2S 3CUNA 1R8PA 3CF5Q 2DGXA 5LJ3Y 2X1FA 2MY8A 1A7GE 5LSOA 4CH0S 4UQTA 2KN4A
chains in the Genus database with same CATH superfamily
1N5TA 3GFYA 2DCLA 3DLKB 5KG0A 4OJHA 4LQ9A 2DR9A 1FHTA 3OJUA 2DYAA 4R0EA 2FVPA 2I2YA 4KPCA 3KK1A 3IO1A 2MZ1A 1KR4A 4TU7A 4JI0J 2CPDA 3C19A 3MPVA 2C2MB 4I68A 2RH3A 1CULA 1Q1KA 1U6BA 1VRTA 1KQFB 5KT6A 1HR0F 4X65F 1NDLA 1TAQA 2VKRA 4PYDA 7FD1A 1J27A 2CNLB 1RWKB 3P49B 1URNA 2ZBQA 4DCOB 1N34J 4USMA 3CJKB 1C1BA 1SV5A 4LSLB 3BM7A 2VPZB 4OZ2A 3NG8A 4ZA1A 5CD4H 4DUTA 4MK8A 2Q79A 2GVZB 1HNWJ 2AX1A 3HVRA 2X1BA 1Q8KA 2XMJA 3MTJA 2IFXA 5K8NA 4ED3A 2UUBF 3MPYA 2LQBA 1RWWB 1HMVA 4DEZA 5CA5A 2GMLA 2N4DA 3KYLA 3EVMA 1X4GA 1NLKL 2FTRA 4LIRA 1WEZA 2FLOA 1GMVA 1F60B 2CFXA 3IM9A 3SQOP 4NASA 1JMTA 3H90A 4RPFA 3LANA 2VA3A 5DRKA 3GB0A 5J2MB 1TMMA 1UEUA 3KWMA 1T3NA 4TY8A 3FVYA 3DHXA 3MEDB 4C8OA 2PA8D 3ADAC 3V5RA 3QFWA 3LO3A 4CM2A 4FYWB 2HG4A 3HHDA 4USTA 3DOLA 3BQ0A 3FMBA 4K2XA 3D5MA 4LSNB 1SJ4P 1C0TB 2C3UA 3FRZA 2AZ1A 1DRZA 2PEHA 2HNDB 2FVSA 4PXEA 2MHEA 4ETXA 1JLQA 2XHWA 2FHKA 4J9UE 4KGXB 1QJHA 2BRLA 1NCLA 3S01A 4K4XA 5IQ6A 1XNRF 1WHYA 4YEAA 3AHPA 4NLPA 1NMEB 4R5PA 2AJ0A 3C66A 3HDSA 3ZZOA 4DV3F 1CJTB 2MQ8A 3DMJA 3I4PA 2IRYA 4HHHA 4ICLA 4URQU 4MH8A 2NSBA 2OSRA 2DGSA 2DTJA 4FVCA 4I4BA 4DSIA 5THWA 5L1LA 1FI4A 4H4KA 3MM7B 2QT7A 1OJ4A 1S72S 5GMDA 4DCJB 1U1OA 5L38A 2Y1LB 5KOWA 4L72B 4A47A 1CG2A 4ZDNA 4TVAB 3HT3A 2V94A 3JS9A 2B5JA 4L74A 1OQ3A 1EAYC 1SL0A 3CGIA 2HPUA 4JV0A 3MMAB 4I2PB 3DLEB 2H4WB 4U8VA 5GAEI 2YPYA 1NEEA 1JLFB 2ACYA 1X4DA 3CCWA 4DUZJ 5KFDA 4ILLA 3PYDA 4MK7A 2ALYB 2VL1A 5D0EA 5KG4A 3BGLA 2ASDA 3GV8B 4CLZA 3NAIA 1D09B 4MIAA 5H9EK 2AGOA 4AUKA 4ZPVR 2PA3A 4QR0A 2ZH4A 3V6DA 4B9MA 5K8MA 3PIPQ 4EZ9A 1UVKA 2KB2A 3OR1B 3CJTA 4K0KJ 2QYCA 2CYYA 1LWCA 3PRBA 1YZ6A 3K57A 3ZTOA 5H1SV 3W2WA 2VICA 1H0HB 3ZZUA 4QYZK 4A8XA 4GKJJ 1WDDA 4DSLA 2WTFA 1LWFA 4LF4J 1S1TB 2YPZA 1YJVA 3KJNB 2FC8A 1H3DA 4DPOA 4OHZA 3HULA 3O8WA 5E3CA 4XIUA 3UN5A 1AUDA 5KFLA 2XM3A 4FKXA 1MU2A 1XR7A 5IQQA 2DRDA 3W66A 1X8DA 5J1NA 3CWJA 3IN5A 4M5DB 2HHHF 2RHSB 5BJRA 4TQRA 1NH7A 3FBCA 1BGXT 1CC8A 4LFCJ 2XY6A 3D4JA 2QV6A 3WDOA 4Q5VA 2L48A 5KG3A 1X7VA 3TZZA 3UD3P 4UOHA 5L1IA 2BEFA 3CCJS 2E5IA 3G8TA 4LF5F 4RW7B 2XLKA 1C2PA 4GMKA 2JOQA 3KXDA 1R8AA 5HBMB 2Z58B 5KG5A 2JHEA 1X5OA 4FPRA 3H25A 2GVDA 3BSAA 4DL2A 1FJCA 3GTYX 5FJ4A 1SC1B 3D0GE 3DKDA 2GJFA 1WEXA 1HWIA 1S1UA 3HSGA 3W5YA 2WVEA 2VG5B 1TL1B 3OR2B 3H59A 5B0DA 4B3TJ 2WVFA 3H2UB 1U0SA 2W1BA 1ZTWA 1LV5A 1F9HA 2IIHA 4RNOA 4ITSA 5BYQA 1BQMB 2FZGB 1IKVB 2OPPA 1SJ3P 3LOUA 3HFZB 4LRDA 4O23A 4ZJQA 3SQGB 5AE1A 2ZVIA 1Y0HA 1DLOB 1PC4A 3I0RB 1FNOA 3BZQA 2E66A 4C9DA 4YDDB 2BR0A 2RILA 1YRUA 4EWTA 4KO0A 1FRMA 4EFAC 4DV4F 4A4JA 2VBZA 4ID8A 3TAMB 3SFGA 1TKZB 2W25A 1PIEA 2R7UA 5DM6Q 2QYGA 4B9NA 3QRRA 3SCLE 3BR9A 1RHRB 3LF0A 4LFAJ 4ECZA 5LOQA 2FJXA 3W2VA 4MIBA 2IHR1 3I55S 3FQLA 1JLBB 3SSQA 1K0TA 4X4TA 2WW8A 3RB4A 4B3SF 2D9OA 1S1VB 1T95A 5DDRC 3G6ES 2CPFA 1FVQA 4OX9J 1VISA 3MM9B 2XI3A 2DIVA 2KO1A 4ZVRB 4TYBA 5FDLA 3ENQA 1RT1A 4U96A 2DGWA 2DXFA 4J90A 2JWNA 5LMNJ 4H4OB 3B6BA 5AJ3J 2W8KA 5I42A 3K0JA 3IXQA 2DO0A 4PWUA 4NRUA 5HJYA 5AE3A 1WNEA 4V19J 3BEGB 2D3ZA 3QRPA 3CJ4A 1KONA 4ECVA 3QAEA 1ZS6A 1S9GB 3QSIA 1VBKA 3H5XA 4O4RA 2MKHA 2Y0BB 2W01A 3T1YF 1YBUA 4TKTA 3HI9A 3UW1A 4ED2A 4B17A 2IDLA 2V2QA 1CQMA 2ZD1B 3E01B 1RT4B 3HLUA 2M2BA 4CP5A 1LW2A 2EBGA 4OYOA 1TL5A 1ZTTA 1T11A 1N36J 2IC3B 1X9SA 1NNDA 3DRPB 3MDFA 4IH7A 4CO1A 1U25A 3ITHA 4F0KA 2RUGA 1RA7A 3GQCA 4GO5X 2J9CA 2RVJA 4OYPA 3W5XA 2GJ2A 4F02A 3OTOF 2ZH7A 1VJWA 1S0OA 2EC0A 3AY0A 3BR8A 1HBOA 5B09A 2DO4A 4PG5A 4DR4J 3WQPA 4M1KA 1XEZA 4NLOA 4IG3A 2ROEA 3CMQA 2GHWA 2HAIA 1JLGB 5E3AA 4ZITA 2ZH6A 2MSSA 2J0QD 2J8SA 2XLJA 3PX6A 2M9KA 4AL5A 2QSWA 3Q86A 5AXKA 2YY3A 3J81U 1LKZA 2QO3A 3IAS9 3MCSA 4DFPA 5DG8A 1RAJA 2BA9A 2HLTA 3FK4A 3KLHA 4UUXA 2EK1A 4ELVA 5G0RA 1NK7A 4J7CA 3JXOA 2CJAA 2VQEF 4WZMA 1S9EB 2W24A 1S7IA 1JLAA 1WG4A 1XMQF 3LGHA 2HVEA 2AQ4A 1JJ4A 1IR2A 3NS6A 1DQ8A 3IGVA 1WTBA 2QFIA 3NCQA 3H42A 2QA2A 5ETOA 5F8NA 2Z8QA 2DEIA 4FYXB 4O3RA 2R2SA 4IYQA 1X31C 1R8PA 4CT9A 4I6AA 3UCGA 4HVZA 2DVIA 4WXOA 4OX8A 2AYBA 1GK8A 3PXGa 3PR4A 3SDEB 4UZCA 1MNEA 3H5UA 2ZZNA 2ZWPA 3M32A 1QVFR 3QJLA 4YMEA 2CQPA 2H48B 1N88A 3R6GB 4FDFA 2O3DA 3C14B 1GMUA 4HT7A 1TU0B 1RBAA 1WSVA 2VQFJ 1TKTA 3TOQA 3FNNA 3HHLC 4CO5A 2LECA 2B4UA 4AQYJ 2UZAA 5L1KA 4DSFA 4ANEA 2ZDPA 4KT0C 4RBVA 4K59A 4DF8A 4XK8C 1MMNA 1KS2A 1R89A 2UUAJ 1JLCB 1Z2ZA 3Q22A 2HK2A 2VPYB 2OPQB 4YY3F 2AJ1A 4BWJA 4WE1B 2HLUA 2P6TA 4CNYA 2D74B 3TEGA 1OY9A 3FRYA 1EETA 2E5LJ 1K1SA 2ZNYA 5ETPA 2BUNA 3CJQA 2ILYA 1CBKA 4WKRA 2LEAA 1VR6A 2OELA 3T41A 5KFSA 2R8GA 2HRTA 4C11B 4MJKA 2H5IB 1U6FA 2X1AA 3BQ1A 5HQMA 3JQJA 2ZJPQ 4YDXA 1XC9A 2HQCA 3NRBA 2DNNA 2BW7A 3G4SS 3H40A 3KNAA 1YITS 4KHRA 2YQ0A 2OLWA 1OY8A 5HLFB 3GZ7A 4ID5B 1AZSA 1Y11A 2B56A 1FKAF 3D0HE 2HZAA 2HQGA 1NHUA 2AJQA 1EHWA 4U7UD 1W25A 1SH3A 3QMQA 4P6QA 2HS3A 3KNGA 1SH2A 3HFVA 3RYLA 1SQGA 1NPRA 4IO1A 4OV6A 5B0CA 3T3FA 3AQOA 2MSTA 3D3BJ 2BJDA 3ZZYA 5LMUJ 2EFOA 4ECWA 1IUJA 3HSZA 1NSQA 1HBNB 3F56A 2F9DA 3JTOA 2D1CA 3B78A 2V69A 2ZDOA 4TXSA 4DSJA 4Q0BB 2B51A 2CQ1A 2QFJA 3ELHA 1RA6A 2BDPA 3OL9A 2NUUG 4DLEA 4HTIA 4NXMJ 5HL7Q 4ALZA 4WYLA 2QN6B 5J2QA 3EDQB 1S77D 2MQLA 2AF6A 4O0IA 3NOCA 2KDOA 3HPOA 2AD9A 2KT3A 2IVYA 3N28A 1VC5A 2R8KA 3KLEA 4HEA9 3WX8A 6FD1A 4A8YA 3H2VE 3UNGC 3LWMA 4ZHRB 2M70A 3POTA 3P5BP 3NP5A 3NNCA 3NXZA 3MF5A 2HHWA 2JVRA 4OYWA 2I5JB 3MEKA 2K3KA 1C1CB 3U7JA 2YNGB 3PX4A 1NRKA 2QTWA 3DRYA 1R8BA 1P9QC 4J9NA 1RAFB 2JEFA 2RDDA 1P27B 2G4BA 2ALZA 3JYTB 4URGA 3MR2A 2DNYA 5IWAF 1IBMF 2R7OA 4ZVGA 2L9DA 3NGKA 4IO9Q 2JC1A 1UJ4A 1ZM4A 3GPAA 4QQBA 4B08A 1FX4A 1NHVA 1UJ5A 4L6V3 1SJ1A 1O0PA 2F8EX 4ZPWR 2XULA 3BS9A 1NH8A 1BWVA 4W4MA 4ZVFA 2F4VJ 4JI2F 4YB7A 1F0XA 4P2FA 2PDAA 5ETRA 1G1XA 1X4AA 3N79A 2CJ9A 3MAAA 4EO6A 2NYHA 2RQKA 2MKJA 5AT1B 3Q2TC 1JKHA 3KK1B 2AW0A 4IFYA 4NA2A 4QJVA 1N33J 4MKYA 1Q78A 3GIIA 1CSJA 3A3OB 2CPHA 1CULB 1VRTB 1HW9A 3HVTA 3TAQA 2AJ4A 5DQHA 2FGOA 4KRWA 3I5CA 5LJ3Y 1A7GE 3GFHA 2IMOA 4QWEA 5GADU 5EHHA 4F7VA 1KOOA 3C2PA 3NAHA 2N4CA 3RRGA 1C1BB 2R42A 1SV5B 1YHQS 4ZVEA 2DNRA 4WFZA 1PYSB 4KAIA 4JV1A 2VDHA 3RUBL 3W5ZA 1T05A 3HD1A 4CT8A 3DRXA 3PFOA 2R7WA 2NQPA 2FVCA 4N7TA 3IS9A 3RGIA 1QAXA 1YJNS 2HHXA 1HMVB 2R3VA 1A9NB 3TZYA 3QPIA 1PSDA 1VS3A 3M6WA 3GJSB 1WF1A 3DOKA 2AEMA 4KV8A 2OGUA 3A8IA 1Q8BA 4LR8A 1K9MT 2Z4PA 3W9IA 4C8YA 3PNIA 4TY8B 5D77A 2OO4A 4FF3A 2MYFA 3M1VA 3LWLA 2YXLA 2B6AA 2VFUA 1BWEA 2VFTA 3PRVA 3DOLB 5AE2A 3F44A 1NKBA 4RNFA 1XJWB 4X4QA 4ED6A 1UP1A 2PD1A 2V0NA 1SC4B 1JLQB 3J80U 1WC5A 4C6AA 2V4RA 2KFYA 2L9WA 2WSCC 1VQ4S 1T9XA 2BJ8A 1B4SA 2EW9A 2HNYA 2MKCA 3QGGA 2BW2A 2XYGB 2QL7B 2DGUA 3KHHA 3DC2A 9ATCB 4ZIVA 4R5PB 1F1BB 3DMJB 3GFXA 4DV5J 1IWGA 4O3OA 4ICLB 4AYBD 2P9GA 1EARA 3BQ2A 4RW9A 3VGVA 1N32J 3RJMB 1IBLJ 4JI6J 2W7PA 2Y9HA 3TI0A 1XNQF 2UXCJ 2E9RX 1T9VA 3DRRA 3KUHA 2DEJA 3RZAA 4B9SA 2WONA 5BR8J 4N8NA 2ZOMA 4RUBA 2B5JB 5EX3A 1EQMA 5F8HA 1QSLA 2PMZD 4YOEA 1SC3B 2KG1A 3FC9A 5IM0A 4LF9F 3LP0A 1RE1B 4DWIA 4U8YA 1Q4RA 4NPOA 1WOSA 1D9AA 4TLRA 2AZ3A 3QGIA 2IY5B 4DFKA 3FSYA 4KGVB 1MWYA 1KVJA 2KVQE 3W9HA 2R7XA 4IRCA 1S76D 3QATA 4IDKA 4FXDA 3K5LA 5CXTA 3H5YA 3U02A 4JI8J 4RU2A 2NXJA 1RT2A 2IVMA 1LXNA 1XN9A 3ENWA 2YNHA 3V6DB 4XDDA 2C22A 3O3LA 2K1RA 2VG6A 3QT7A 1ZETA 3IAM9 2YTCA 1GNKA 4WIIA 4KB7A 1I51B 1LWCB 4O3PA 4Y2AA 4YUDA 4MT1A 3Q8RB 4WFBQ 5ETKA 3W2WB 1CS4A 3PG9A 3VAJA 2CWKA 3EVOA 3U1MA 3DLGA 2PMWA 5B7WA 2FHMA 2POKA 1LWFB 2UV8A 1TAUA 2D3O1 3M2RA 4QBUA 4H54A 4OI4A 3C3LA 2RKIA 1L3SA 1DQ9A 3OFFA 4TU9A 1MU2B 3B54A 3HP6A 5D6GA 1K0VA 4J9KA 2CQ0A 2RIJA 2UVWA 1RWMB 2CJKA 1RT5A 1RACB 2KRRA 1I5OB 4JI5F 5DZ6A 1SC6A 4PG7A 4WU3A 4ANDA 1S48A 3KOAA 4DR2J 2XEXA 4HTJA 2EVZA 1AW0A 1S0VA 3LALA 1GXTA 2MPUA 2DBBA 1U1NA 3VR1A 3KDNA 3OLBA 4DQQA 1CLFA 2VD3A 3F73A 4F25A 4CZCA 1S7HA 4U7UK 3PJ9A 2GVDB 4KQZA 3EGNA 3R1HA 4FF1A 4RNMA 4DV0J 2GVZA 3BPSP 4E8UA 1S1UB 4RKUC 2FY8A 2DNQA 4USVA 3TUIC 3H20A 2XY7A 2H9ZA 3MM5A 1F6TA 2OPPB 3R3TA 4DR6F 4USIA 2BANA 3CCSS 4DPYA 1NM2A 2KYXA 1AYEA 3DOMA 2FVQA 2H1YA 1FRKA 5C2GA 4RNNA 3R5AA 1UPMB 3H0PA 3PO5A 3GSIA 3JSYA 1RHKB 3NGSA 4KO0B 3GFZA 2CPEA 2LDYA 3RG6A 2H65B 3EZUA 1C0UA 4MYTA 5IC4B 4AD6A 4WK3A 2NZ4A 3M8ZA 3M2UA 4RLEA 4ZPBA 1WHVA 5MLCV 3AA8A 4FF2A 4LRCA 2W4DA 2VV5A 1DHMA 3M8QA 5LJ5Y 2YKAA 3UO0A 1U4BA 3DDKA 3AQPA 1CPZA 4M5GA 3C6UA 3W2VB 4CTAA 5KG2A 1HHQA 4MIWA 3R5JB 3MR5A 5IT9U 1CQNA 3QWUA 5I3QA 1QE1A 5A8RA 1KTVA 1X4EA 4A8QA 5D0RA 3RW7A 1U48A 3QRQA 1WF0A 1PKUA 1S9FA 3OFGA 5FDLB 5F8MA 5H9FK 2I9SA 1RT1B 2Z56B 3MCMA 2HFVA 5KFHA 3FCHA 2O5DA 3QJPA 2IJNA 3KJFB 5GAHU 4LT6A 5I42B 2E5GA 3UR0A 3EMTA 3OUYB 5FLXU 3KLVA 3FEXB 1NB2A 2JEIA 1XWLA 1GMWA 1T94A 1WWHA 4F26A 1NO8A 1GX6A 4H4MA 5GADI 2B9XA 4F2RA 2BM0A 5CZXA 1GMWD 3RAXA 2KHCA 1R6VA 1WC3A 2Y0SD 4FN5A 1F5BA 4ZCLA 1V9OA 3ZZRA 5C2CA 1LW2B 5F9NA 2DK2A 1S97A 1X0PA 3AXMA 4DX6A 5IV3A 2LMIA 3ITHB 3PTWA 3MFIA 3WIUA 5HK4A 3PEJA 4IH5A 3IC1A 1Y10A 2GQCA 1M1KT 1KQKA 1RHMB 3MR3A 3CD6S 1HQUB 1HBMA 3A8JA 2MHNA 3IWLA 2AEFA 1HBOB 3V4MA 3F41A 4AE5A 5FIIA 4IG3B 1H7XA 5A6WA 2H4YB 2NCKL 3D1HA 2CG8A 3K59A 5F3ZA 1SKWA 1FRXA 1P8GA 2G1DA 1Q95G 4ECSA 5K5MA 3NNAA 2RMLA 2ZHAA 3A12A 1YBAA 3T1HF 5D4NA 2IBKA 4HDGA 4PWWA 2OD4A 1VQ7S 3EICA 4WJBA 1D9FA 3N5FA 1LW0A 5ETTA 1KEKA 4ZVHA 1Y3JA 5KT3A 3KLHB 5KFFA 1H2TZ 4RWXA 5G0RB 4LFBJ 2JFDA 1C4AA 3HHLA 5KTQA 1JXLA 4X64J 3QJJA 1JLAB 3J7ZT 3DDIA 2XNRA 4Q43A 1IJEB 4X4NA 2J9DE 4M8LA 2XZDB 2HBQB 1P1TA 1HNXJ 3AD7C 3HHLD 2VJUA 1KBRA 4E0DA 2MDAA 4P9SA 3SFUA 1S0NA 4C7QA 3I56S 2X1GA 1VDHA 1BE4A 1RAOA 3KJQB 1IXKA 2R2TA 4DF4A 3PCOB 2V6AA 1U6ZA 1WKJA 2PGCA 4O44A 3L7UA 4DV1J 5ETVA 3AA9A 4DUYF 3HKWA 1SKUB 3M32B 2LQJA 1X4HA 2M7SA 2XLIA 3TJAA 2ERRA 4UY85 3HHEA 3E51A 2RUSA 2IRXA 2FYXA 2CADA 4NLWA 3M8RA 4B9TA 4R8UA 2KHDA 3FDSA 2C2NA 1TKTB 5C42A 1R0AA 5E3PA 1TL7B 4OV1A 1P1LA 1QY7A 1S1XB 1IBKJ 3CW2C 2CZ4A 3VAHA 4LUBA 2GFFA 4DR5F 1JX4A 4F67A 3VAIA 3AAWB 3H5SA 4Y2KA 1HHSA 2KRBA 3UDCA 5J2NA 1FDAA 3SMZA 3IM8A 3C6TA 3AJ1A 2DPIA 1RKIA 1VQ8S 4J5OA 5CABA 3MPUB 2YWHA 1EETB 5EUHA 3TYTA 3RTVA 2SXLA 4LIWA 1LK5A 3AD8C 4NYPA 3JSMA 1BMQB 4DX5A 4CIOA 3I0SA 4LBHA 3EZOA 1QAIA 1AT1B 4F3QA 4U7CA 4NZ7A 2PI5A 3TAPA 5KFMA 1DQAA 4KHPJ 1UKUA 2LKZA 4PG4A 4ELUA 1FNMA 2BE7D 5KT4A 2B9WA 3HF5A 1YZ7A 2UUTA 3MWBA 5KFKA 2J0SD 2B3TB 3QT8A 4UOFA 1AZSB 4WTOB 4TN2A 2V2VA 1RAIB 4X84A 4DMZA 1LWXA 4OYMA 5BYRA 1X9WA 2OHDA 1VQYA 1A6LA 2HQ3A 1SL1A 4UZBA 1Z2LA 4LR7A 1S79A 3CO9A 2AX0A 5T14A 5DGAA 3VZIA 2RU3A 4DPUA 1AROP 1PJ6A 3FCWA 5KG1A 4ZIWA 4F3MA 4OI6A 3BKFA 5LMNF 1NBEB 2PSZA 3TQ1A 2GO9A 2PN6A 3IBWA 3DU6A 3RB6A 4KPYA 2RS8A 3DCAA 2BKNA 3RRHA 4YQWA 3W65A 4O3NA 2H54B 2LEBA 2HW3A 2DJWA 5D4PA 3DDNA 4P7VA 5J2QB 2ROGA 4GKKF 2B9YA 3BBCA 1ZAXA 2HFSA 4AL7A 2MLYA 3T5LA 4DFJA 4IOAQ 5K20B 1S12A 3KLEB 4M5MA 2BQUA 2A0FB 3H7HB 4B3RF 4D3GA 1ACMB 3B8HA 1NDCA 1U0HA 4WP8A 5A6PA 1HR0J 2M88A 5I3PA 3T5JA 4IR1A 2O67A 2QL9B 3OL6A 4LF6F 1LWEA 1T9YA 4K8RA 3MMJA 2HHVA 3ZTRA 3EM1A 4K4WA 2DNKA 3W7BA 2M8DB 3JAMU 2UUBJ 2Q43A 1SXLA 1O8BA 4B3MF 1Q81T 4CH1A 1FTRA 3ILOA 3KUGA 2KT5A 3BGRA 2KZMA 4A8SA 1F2GA 3TP2A 1SIWB 2QJ3A 3FGVA 2JJ4D 5C7PA 2V50A 1D9DA 4N5SA 4G1IA 3P96A 3MAAB 3A3PB 2UU9F 1L3KA 4KIAA 3LPYA 5E33A 5KFBA 1JKHB 1SUQA 1FT8A 2XSJA 4QR2A 2XO6A 4IFYB 4P71A 4XAKA 5L39A 2PE8A 3KG1A 2JLGA 4BHQA 3HKZD 1N5QA 1GEHA 2YWFA 2HGMA 3L4BC 5GAHI 3M7VA 4X62F 3HVTB 1ZZNA 2A2CA 1XR5A 1ZAVA 3BBFA 2HBRB 3TW0A 3K58A 1IKWA 4X4UA 5K8PA 5CZVA 4HACA 2FZKB 2ZZMA 1SJRA 1OSCA 1KHVA 1KDNA 3DLLQ 2RSQA 3RBEA 4DL0C 2MLXA 3ULHA 4RJVA 1T05B 1S6UA 5G4DA 1XNRJ 1CJKA 4M5KA 3R7SB 3PVXA 2MKKA 1HARA 3MR6A 1QD1A 3CJ2A 2MJUA 1CJVA 3IS9B 4XO0A 2VZ9A 5HQLA 4DV3J 4DR7F 1E6YA 4MKVA 2Z0GA 5M2RA 2BQ3A 4P52A 1T0TV 1F2HA 3QIDA 1ZM2A 3OJSA 3LTOA 1NDKA 4ZVQB 4M63A 4OMFG 4DDFA 1AUSL 1N5YA 3DOKB 4UW2A 4KV8B 1B99A 2HBYB 4CQ1A 4U6PA 2FJDB 2JZ5A 1D8YA 4RW8A 3QGHA 5EN1A 1VI7A 3TZXA 5CH7B 4CLFA 3SV3A 2BOAA 3G71S 3IMQJ 3M1VB 1GT8A 2B6AB 5KFIA 1B7FA 2QLJB 2HFUA 4FXVA 1VQSA 4QU7A 1HNZF 3MM8B 5KFUA 3PYGA 1RI7A 2ATCB 4LVOP 2OH2A 4IFVA 3W8PA 3D28A 3J7Z5 1FVSA 1UVNA 1GTEA 1D8ZA 1M5OC 3WZ0A 2IDEA 1PYOB 4Y00A 3W61A 2YX7A 1LEOA 4PABA 2RDIA 4R0JA 3VAGA 3V81A 1Q8IA 1HBUA 2HNYB 1EIYB 2YWWA 4NEYA 3DM2B 3K7RA 1HPZA 5B0EA 3GIMA 4OYAA 4AT1B 1IKYA 5DETA 5KFRA 4C8MA 2RQMA 1FE4A 2BJEA 4ES1A 3M6VA 5LL6d 5I3UA 2HWIA 2PEBA 4RW9B 4CO0A 2ZKTA 1TR0A 4ED7A 5KFNA 2NYIA 4JI4F 4ED4A 3DRRB 3QFHA 5EGYA 1FA0A 3DRSA 2RU9A 2WONB 5LMUF 1R8CA 4L3NA 2BABA 4ED1A 2NPIA 2HGLA 2ZBCA 3NWGA 3KFWX 2GV1A 4DQPA 4DPWA 2N7YA 5L9NA 3HHKA 3GWCA 5IM0B 3LP0B 4TLQA 2HHHJ 2B7BB 2K8GA 3EPIA 5F0UA 3QZ7A 5T7LA 5IXUA 4N47A 4IDKB 3MEGA 2CQIA 3NEKA 4JYAF 1WKLA 3OD2A 1RT2B 1VYAA 4TQSA 4ATNA 2GAGC 3TVZA 4LF5J 1Y5IB 4IOBA 2YNHB 2KI2A 2K1RB 2VG6B 1F3VA 3IGNA 1AFIA 1BHNA 4NA1A 4QPTA 3G96A 4LBPA 3JB9k 1VGYA 3EYZA 2U1AA 3FSXA 5KFZA 2MZJA 2ZBPA 1CS4B 4NMXA 4YN3B 2VODA 1N0UA 1VHIA 4UF4A 4ELTA 1TL4A 4FNHA 3DLGB 4R25A 5DZ7A 1H73A 1W7WA 1VRUA 3M2RB 1XERA 4ECRA 1RUSA 4C98A 4Y34A 2HZVA 2JC0A 2RKIB 3SCJE 3X3UA 4I0WA 2FDNA 2RF2B 1S49A 2E5JA 3OPKA 1ZA1B 3BN7A 5HAOA 4NA3A 2W8LA 4ZCMA 2YNIA 3N0VA 3K2YA 2DH9A 3HZGA 2EFGA 1RT5B 3BKTA 4MFBA 3MECA 4Q45A 3JSBA 4DV4J 3EGZA 2CJQA 1HIYA 1IWAA 1OSDA 2W2NP 4OHVA 4KSEB 3RR8A 1R31A 3KMQA 1VK8A 4GC6A 2EKNA 4LR9A 3CDWA 3BSNA 3M9NB 2R7TA 1IR0A 1VLOA 3ZZZA 1MG7A 1QVGR 2KYZA 4B3SJ 4N76A 3H98A 3CJRA 2R8JA 1TELA 2CG4A 3EXYA 2PFDA 2YKMA 3DGPA 3W63A 4ZCKA 4RBUA 3TJ8A 4BDPA 4DL5A 3BF4A 1VMBA 2UUCJ 3TR5A 3MM5B 1H6KX 2DY9A 4FYVB 3KHRA 1R0BG 2FC9A 2HFNA 1I1GA 2BANB 3FMWA 2CPXA 2ZC3A 3VGTA 2GCFA 2AJ2A 3DOMB 2ZJRQ 1I94F 3BDPA 4OYIA 2DXDA 4QWDA 3EWGA 1O6XA 2ZH3A 4NYZA 2X1FA 3CJ0A 1ZM9A 3M9OB 4JV5F 1PO6A 4DLGA 3L3CA 1YJWS 1TQLA 1OMSA 1DJ0A 4RZRA 3WBZA 3MD1A 5KT5A 1Z4UA 1C0UB 2OFGX 1FK9A 4Z7YA 2FQQB 3T1YJ 4ANCA 3M2UB 1FD2A 3OW2R 2C2ZB 4NWBA 4WTYA 3M8QB 1U2CA 1WDTA 4CYUA 1L5UA 3BREA 1OWXA 5DDOC 2QMXA 3C6UB 3O2IA 5KFVA 4Y3CA 3PYEA 4RL1A 5DS7A 4CTAB 5JMNA 1WSRA 2K2PA 3NGUA 1HWKA 1RWNB 2MZTA 4W90B 1QE1B 3CMES 5A8RB 3GIKA 5HJXA 3OTOJ 4PYAA 1RP5A 1VK3A 3ICLA 4DXLA 3FQKA 3CVKA 4C0OC 4CLSA 2RNEA 4NCGA 1O5JA 2J76E 1JNRB 1VIXA 4H4KC 2RE1A 3AB4B 1V5VA 1X4FA 3VTIA 3TX8A 4ZN1A 4ERDA 2FJEB 3MHYA 1N32F 2QE5A 4ZP6A 2RQ4A 4ECUA 3V6JA 4JI1F 3T5HA 3RBDA 1L3UA 3VZHA 4PG6A 1PBUA 1HQEA 4H4MB 4K4ZA 3CCLS 2MQPA 3MGJA 2P9CA 5LT5A 1RTZA 1OYDA 2MXYA 1FO1A 4ZVUB 3G9CA 2VQEJ 2XTJP 3UCZP 4JOUA 4ES3A 1XMQJ 2QC3A 4G65A 4UT4A 2HKEA 2WB1D 1OPZA 3R1LA 2WOMA 1JIHA 1XMOF 2UVRA 4ZVOB 1SL2A 5I4MA 3WHIA 1A0OB 4JI3J 3TA1A 2MEWA 3HD2A 2HQFA 2EEYA 2XSFA 2DY1A 3MMCA 2VB6A 3LH2S 1Q82T 4QIFA 4CH7A 1HBMB 3ZO7A 3UPFA 2LQ5A 1VQNS 2AT1B 2GA7A 2XYHB 1S1WA 3M8SA 3HK2A 3V6KA 3ZZTA 1VCTA 3NGRA 5D3GA 2QSFA 4DPXA 3RB3A 3PV8A 1N0VC 3P4UB 4ILRA 4DN9A 4QIEA 4A8FA 4FVMA 1ULRA 2CQ2A 1S99A 3HJVA 1VIOA 3AB2B 1N52B 4C8ZA 1WF2A 2ZEJA 1JLEA 4RUAA 1SJQA 1RDRA 4EI2A 3IR5B 2BJ9A 2BE2A 3OFEA 6FDRA 3KUEA 2F63A 4ZMMA 4JP8A 2HWHA 3CJSA 4M5HA 1LW0B 3UI3A 3TEHB 2VA2A 4J9VA 1IM4A 2OKQA 5KFEA 5LSLA 2DRBA 1M5HA 5SUHA 3HHLB 2HBZB 4I2QA 1SI9A 3ISNC 2XMKA 4PQAA 2LVWA 3ZC4A 4ZN3A 5D0GA 3OXGA 4WFYA 2KH9A 4G1QA 5E2QA 2N3OA 2E5HA 4FZVA 3SYZA 2XG8A 4YFUA 2C2DA 4RU9A 3HX9A 1ICEB 1JXVA 5LXYA 4DR2F 2GHPA 2V4JA 4GC7A 2XI2A 3NGDA 2HHPA 2LFVA 4U95A 2R8HA 1SB6A 2LXUA 1HL6A 1RQ0A 4O44B 1VJQA 3LGMA 3A8KA 4ZPTR 3IR7B 1NXIA 3RAMA 1DTTA 3OQ2A 1UEKA 1R8HA 2DXEA 1DARA 1UJ6A 4DCPB 4C0BA 5DG7A 4R8UB 2NUHA 2HHQA 4DV0F 3I82A 5C42B 1MSWD 3BO4A 1R0AB 4OHXA 2Z2YB 1U47A 3OHAA 4NI2B 2M52A 3A3NB 4OQJA 1IR1A 4ZPDA 3NS5A 2EFVA 3GMGA 2RRAA 3J7A1 3MEEA 1IJFB 2I38A 2OIHA 5J2NB 2C3OA 4K4YA 4DR3F 3C6TB 5CHCB 1RCXB 2J5AA 3GIJA 4DSEA 4NLYA 2W7AA 3CCRS 2GMJA 3JSMB 2CNKB 2WHOA 3VCDA 2HURA 1WKKA 3R97A 2XO7A 3I0SB 1Y9OA 4I64A 2RHQB 4F0HA 3OVAA 1FCAA 3BO2A 3Q0AA 2A6OA 4B9LA 2DIUA 4ENOA 1NJWA 4C3MA 4CLPA 3UFCX 4Q8EA 2R2RA 3VF0B 3AJ2A 1HA1A 1D0EA 3QIPA 3TRGA 3M8WA 1B0VA 3J7YU 1RLDA 2C2KB 1FX2A 3OFHA 1TUVA 1TK5A 4TU8A 3IRWP 3FFIA 2NREA 2E9ZA 2HQIA 1KFSA 2C1EB 5DJBA 2B8PA 4W98A 2ZOFA 5J2PA 4F04B 2E29A 5DDQC 4YHHF 2VONA 1HI8A 5JVGQ 4BC9A 3LP1A 2BJ1A 4EUVA 3ZTSA 5GAGU 1R43A 1MROA 3IFEA 3JTPA 5IWAJ 3OUYA 2QA4G 1IBMJ 3GYNA 1MLAA 5U47A 3PX0A 2HGNA 2HRYA 2BBEA 3MUVP 3K8VA 3N9UC 2QRRA 2QX0A 1TK0A 4DS4A 5EWEA 4DZDA 3Q8YA 2AYGA 3K89A 2YWGA 1VQ5S 2DR6A 3P5TL 3W60A 1NKEA 3HJFA 3B82A 2D41A 3SXLA 5CAAA 1NK6A 1FRLA 3A13A 1X9MA 5JVHQ 3CCQS 2PFFB 1TVRA 1RSCA 2JNJA 2XC9A 4QU6A 4AFFA 1IM6A 1RAGB 4QW8A 2LU1A 4FP9A 4DJBA 2R7VA 1Q5YA 3DI6A 1V3SA 1X5SA 1Q7LB 1U0HB 2EG2A 3SEOA 1HQUA 4ZVPB 4ER8A 1QTMA 5IC6B 3FCVA 2F40A 3NMRA 1RK8A 3QLHA 2VIHA 4A46A 5ETLA 2F1FA 4CO4A 1LFPA 1LWEB 3DLBA 2L41A 2PC6A 3DXBA 3E8OA 1H2VZ 3I6PA 2GGPA 2UXDF 2YQ1A 3FJ2A 3QYYA 4O4GA 5A8KA 4KFBA 1JNZB 2RRNA 3S1TA 5HANA 2L08A 2RD5C 4Z2XA 4RO0A 4OLPA 3THVA 4B3OA 3FUYA 3BGRB 2W7OA 5H9EJ 3V4IA 4K4VA 4L3KA 1FD8A 2DISA 2WK4A 2GW8A 1ZYQA 3OL7A 1MN9A 1S4EA 2AEJA 4ZLJA 1ZH5A 8RUCA 1MW7A 2MY7A 2P2CB 4NCBA 2XMAA 4DV6F 2V9WA 2K7KA 4I69A 1SUQB 2XSJB 2Q6BA 1KQGB 4QYZJ 2GMHA 2H5EA 2DH8A 2NXEA 2G0JA 4U67Q 2KXHA 2HFOA 2CQGA 2OTJS 1QUPA 1T9UA 1SBRA 2ADBA 2HVHA 1UTAA 4OHWA 3N6MA 4BC7A 5AXNA 5DM7Q 1IKWB 2EKYA 9RUBA 1LQ9A 4HACB 4MAKA 2YX4A 3Q8QB 1LFWA 3QSYB 3PACA 5HQ8A 1ROFA 1F9EB 2IAJA 2ZNZA 1CJKB 4NLSA 3AH6A 4DL4A 1HWUA 1CJVB 2E7WA 1V6HA 1TL7A 2R7QA 1NSAA 3W64A 3CCMS 1O51A 2XWYA 3ZTQA 2BKPA 1S1XA 3V6HA 1H7WA 4B9UA 4N41A 2XMTA 1E6YB 1PJ5A 4QIVA 1NK0A 2AWZA 3KG4A 1N5YB 4P75A 3QT6A 1M90T 1WOPA 1NDPA 3PDNA 2KZZA 2CUYA 2DNMA 1XNQJ 2OPSA 4RW8B 2K06A 1J2VA 4Z37A 5DQGA 4PXDA 3N5BA 2E44A 1HI0P 4JI7F 2XMMA 2KT2A 3OLAA 2V8GA 1RU1A 2RT3A 3T9NA 4J37A 3PW5A 3VAKA 2F9JA 2PMHA 1YVFA 4UOGA 4LF9J 2F5GA 3AJDA 3T5KA 1KVKA 3CC2S 3CUNA 4IFVB 2BJ3A 3P6YC 2EK6A 2E7XA 3HSJA 4ZPAA 1NUEA 4NLQA 5IT4A 2ASYA 2HRUA 1M1GA 1S0MA 3D3CJ 4WF9Q 1GFWB 2G2ZA 3DYAA 3R6LB 4V19X 5L1JA 2DCUB 3V81B 1HBUB 3VAFA 2M5YA 2KU7A 3MXHP 1X5PA 2VPWB 1HPZB 2V5HG 3ZFVA 4WWSA 2V67A 5LXRA 2KXFA 2B0GA 2QLXA 4F4WA 1IKYB 2BVZA 3I9V9 1F3FA 3TVKA 2IM2A 5I3UB 3HSDA 4ILMA 2HFZA 2J7KA 3ZTPA 4NXNF 2CPYA 1FWKA 3MCOA 2LXFA 2HIYA 2RB7A 4G3IA 3VVUA 2WBRA 1FJGF 3W1YC 3DRSB 3R7BB 1FF2A 4WP9A 3NL0A 5EDWA 3OBIA 2EXUA 3M2VA 3OTEA 3H8YA 4HI2A 3TUPA 3MPWA 1VBYA 3UNYA 4F4KA 1JK9B 4X4PA 1B0PA 1WORA 3FZ2A 1Y7PA 2FD2A 5T7LB 4JI5J 2ZUGA 2CNNB 2LYVA 4HH0A 2MTLA 2FJAB 3MEGB 2C2EA 2ZH9A 1ITPA 3DLHA 4NZ0A 4F0MA 2XCPA 2ZE2A 5HSPA 3R2DJ 3QAUA 3MCNA 2VG7A 3MR7A 2MGZA 4KY3A 2ZFHA 1TP7A 1NKCA 2ILZA 2CPZA 2H3EB 4FNIA 2GAHC 1K73T 3CPWR 1KQSR 2W4PA 1YG0A 2WBMA 2V34A 3I4HX 5BXIA 3DHWC 2CZVC 5HI7A 1F5CA 5F8IA 2GQ2A 2H51B 2Y3YA 2MQNA 5J1PA 4QIGA 4DR1F 1VRUB 1VQ9S 3GR1A 1UPPA 4NZ6A 2VHGA 4LF8F 2RQCA 1X0FA 2KFNA 2J0WA 1FDDA 4DR6J 1GXUA 4ZVTB 1VQMS 4DZ6A 5D0HA 3J7YI 1FNXH 2BZ2A 2OUGA 1R0CB 2YNIB 3CD0A 3D2WA 1U1RA 4X2BA 4OI3A 3UN2A 4ECYA 4MFBB 3MECB 1SJFA 2JH3A 2MKSA 2ZVSA 2R7RA 1TKXA 2D3OR 5KOXA 4WCEQ 4IKAA 4OHYA 4ZP8A 3M30A 4PXCA 3CJ5A 3BJYA 4L75A 5A2QY 3Q8SB 2ZKUA 2G2YA 1GQEA 2YH0A 1J5OA 3OTCA 5GAGI 5AXMA 4UQGA 2UXBF 1H2UX 1KD1T 2C42A 3THTA 2RJZA 4K4UA 1UVLA 3HT0A 1Q16B 1FRIA 3H4DA 3TARA 1HNVA 2ZHOA 3B4MA 3SCIE 3AOBA 2LA6A 4EMDA 4MTPA 1LOUA 2YKMB 3DGPB 4RR5A 3KJVA 8ATCB 4F4XA 3LP2A 2AKWB 3TQEA 3BDEA 1RT6A 2EC2A 2HHTA 2O66A 1VQ6S 4RX6A 1JWWA 1WC4A 1M0SA 3DLJA 3MURP 4DI6A 3OTBA 3MAQA 4C8KA 2VDIA 3IR6B 3HVAA 5KFPA 2N82B 3A1YG 3OXLA 1FKOA 1UFLA 4JUZA 4DG1A 1FFWB 2QLWA 3MM8A 1RBLA 3QO9A 1FK9B 2HNZA 2B4PA 2IM1A 4KGKA 4QW9A 2DITA 3V2UC 3TANA 5F9LA 2XY5A 2F4FA 2J7WA 3FEZA 1HWLA 5IZHA 4FXWA 4CYUB 2I0XA 3KHGA 3JQKA 3OVBA 4CI0B 2DNLA 1HD0A 5HMWA 4C2MA 1FKPA 5SZTA 2W9CA 1U1QA 2KN4A 4LMZA 3UE2A 2B43A 1XQIA 1RWOB 3DM2A 4NL5A 3KK3A 4EBCA 4USJC 4QOTA 4QR1A 4Y65A 3CB4A 3M6XA 1U49A 1Q79A 4Q7AA 4G1PA 4PUOA 3ENAA 2K7JA 2ZM6F 3I96A 4NCGB 5A0YA 3R7NB 3DFEA 5E7OB 2A10A 4NE9C 3HO1A 4IOCQ 4USWA 1T3OA 3NBPA 1KLNA 4K5SA 1BUXA 3T1HJ 2LA4A 4EYIB 3PW2A 2FHJA 2WSEC 1REVA 3I5AA 1H74A 4LRFA 3RBZA 2ZBRA 1FDNA 5KFXA 2HK3A 1NPKA 5KFWA 3SV4A 1HQEB 1XBWA 4NYOA 1TK8A 5DO2A 2GHVC 2J9DA 1N4LA 2FHJD 2ZJQQ 1FJEB 1DFDA 3PW4A 4IG0A 4Y2MA 1RWUA 4BLGA 4EK2A 2HVZA 1FE0A 3ZNUA 1RTHB 4I7FA 2AGPA 1WHWA 2OMLA 3GE9A 2WOMB 5BYSA 1TL3A 1ZZFA 2HHUA 2DHHA 1WUUA 3EGVA 4DV2J 3NCRA 2CQ3A 4UY8T 4P74A 2XMUA 4ED8A 4HHJA 3MMCB 1F9FA 1VFJA 1M1HA 1RTDA 2RAQA 1S1WB 4X66F 1S57A 1YQHA 1RWVB 1J5EF 5D3GB 3ISND 2R2UA 4NCAA 4USUA 4DUYJ 4NLVA 2IYGA 5ITHA 2NPFA 2NXNA 2AHOB 4RWWA 4J9RA 1Q0NA 1FJ7A 4ZVSB 3UCUP 1JLEB 3UD4P 2BE2B 2DNGA 3RRKA 4D3HA 3CIMA 4Y2IA 3UQSA 2FJBB 1NJYA 3PM9A 5GVQA 1U7LA 2RF2A 1WEYA 1YI2S 3OXFA 1X4CA 4NLRA 3G86A 1UWBA 3SI8A 4DR5J 3G82A 2C2OB 4PQUA 1K1QA 1RT7A 4CLYA 4I2QB 1NZ8A 2HS4A 1W2BR 3BPDA 5CYMA 3JTNA 1U45A 2AV5A 5L8RC 3TO8A 4G1QB 4DQSA 2BM1A 2P9EA 2DKOB 4J9QA 2UV8G 2WZ1A 1IKXA 1FXDA 4ZJLA 3TX0A 4HT5A 3L7PA 4OLOA 1H98A 2G0CA 5ETSA 3MFHA 4XPCA 1GXLA 4JI0F 2V4JB 1OO0B 4ZS6A 5EWFA 2NS1B 2YH1A 2PI4A 1B64A 2X51A 4ZLLA 2C3PA 4I56A 3QGPA 4WKYA 1C4CA 1RWPB 3CD5A 5HVFA 2CDQA 1DTTB 1KKHA 2GIRA 3SCKE 4J9MA 4YB6A 1N34F 3R9LA 3D1QA 1RABB 3ZXWA 1QM9A 1IVZA 2PIIA 3VQTA 2WRMA 3W62A 4XPEA 4OZ0A 4DX7A 1X60A 1KWMA 3PHEA 1HNWF 1UL3A 1WI6A 2VJVA 4I6WA 2DHGA 4DV7J 5M2UA 2ZITA 4RUCA 4WXWA 5CYQA 2UUCF 4OIXA 1KFDA 3NWRA 3MEEB 2V2ZA 2HHSA 4RW4A 5KFJA 1YDLA 2J6TA 1WJ9A 3UDVA 5CYJA 1I6JA 3UDLA 4UOCA 4E98A 3S8SA 5T41A 2AJFE 2LEPA 4BS2A 4ED0A 1DY3A 4MK9A 5ETQA 1HLWA 1YJUA 4GKKJ 3PJXA 4CLTA 3C15A 1DZ5A 2ADCA 1QAJA 3UVJA 3A4TA 2F3JA 4CLUA 1RT3A 1RZMA 1ZM3A 3M9MB 3L95X 3QIPB 5HMZA 1QDUB 4B3RJ 5A8WA 2DGTA 3W9JA 2AP6A 2OEMA 1UFWA 2APOA 1N48A 1NK5A 1RGVA 3FFIB 2MY8A 4CH0S 1YJTA 1GAOA 2AU0A 1SKSA 3VGSA 2BE9B 4LRAA 1HNIA 3I5BA 2LXIA 1FXRA 2Q3PA 3PO4A 3DN9A 5J2PB 4OJ1A 3VGUA 3E2EA 4LF6J 4OFZA 4V1Ak 2VOOA 3AODA 3BN4A 4F50A 1UAWA 3OSPA 4F2SA 4DU8A 3LP1B 3IBCB 1MROB 2KM8B 4K7QA 3CMAS 4DX8H 4NLGA 4GVBA 2VBXA 1U09A 1BLUA 4B3MJ 2FY1A 2B8QA 2WCXA 3CT9A 4ZPCA 4OZ5A 3TA0A 1DBDA 1S5ZA 5HVGA 2GZOA 2RS2A 2IJRA 3MUMP 2M8HA 3PHTA 4LF7J 1GH8A 2GQQA 3IWXA 2R7SA 4Y0FA 1UW4A 2CDRB 1RLCL 3ET6A 1ELOA 1TVRB 1M5SA 1Q7YT 3T1AA 2JRSA 2UU9J 3MMBA 4EEYA 4L76A 1M5KC 2BOPA 3PIOQ 5K14A 2VU5A 4DUZF 4IRKA 1EQ0A 1RKJA 3TUZC 1EKRA 4FS2A 3M6UA 3DI6B 1VHFA 3LAKA 1PBAA 4WFXA 4C3LA 2IPOB 3EJMA 3AT1B 4IH6A 4X62J 4JI3F 5L46A 1PGZA 2MLZA 5ETMA 4EZ6A 1MN7A 3QLHB 1U2RA 2AYMA 2EPIA 4O3QA 1TKDA 5C24A 4F4YA 1NK9A 1FWPA 1S10A 5CD4A 1GTHA 1N5SA 4K0KF 3KLIA 2EFNA 2MKYA 5HATA 1SPBP 4PXBA 1HWJA 2GGPB 2Q1LA 1XR6A 4DHVA 2DHAA 4PRFA 4O4GB 5A8KB 4KFBB 4GKJF 2A3JA 1T9WA 2LQ8A 3BYPA 4MYUA 4BWMA 5K9FA 1U1MA 3BO3A 4DR7J 2N7CA 4LF4F 2NLWA 5HP1A 4B3OB 3CDUA 3I9ZA 4FF4A 3BBBA 3V4IB 2XB2D 3GU0A 5KFTA 3KKFA 3TUJC 4DN0A 2BYCA 2DNZA 4F36A 2W9BA 5KT7A 1YJRA 3EDRB 3KHLA 1RAAB 4IQMA 1QSYA 3LGNA 4KBIA 1OIAA 1SCJB 2BQRA 4FBUA 4LFCF 2G13A 2G1HA 4USHA 1EZZB 2Z2MA 5GMEA 1UETA 1WG1A 1Y4ZB 2NXUA 4I1TA 2XQCA 5HO4A 1HNZJ 2J6UA 3MI7X 4P2MA 2C3YA 1HHTP 3TJ9A 2VF3A 4KH1B 1S59A 4PPZA 1G3OA 4MKAA 2B4OA 1T02A 1YSJA 4C0HA 4RBTA 3G8QA 1RYSA 2X7IA 4M94A 7FDRA 2AMCB 3DNCA 2GO8A 1OS5A 1EP4A 1PAEX 4DFMA 4Q44A 2CJYB 1RXOB 3HZEA 2B7CB 1Q86T 2IAJB 4HR2A 2XS7A 1TZ0A 1E6VA 2ASJA 2C3MA 1B7YB 1XIQA 2E9TA 4NI2A 4B3TF 2XMVA 2HMIA 4OX7A 4IRDA 3KLFA 4CWBA 1AA1B 1UVIA 1BQNB 2K3IA 2GJIA 2OPSB 4K4SA 4JI4J 2YKNA 3KK2A 2Z30B 5LSRA 1YIJS 1RB0A 3HVWA 4M5NA 1L3VA 3VAMA 3D6TB 1RYRA 4FKYA 4CLWA 3BH7B 4DBQA 1BD6A 2V8VA 5HMYA 4HI1A 4DOZA 5E5NA 2X3GA 4KKOA 2OPRA 3ZZ0A 2L3MA 2MZQA 2BJ7A 2MZRA 5MAOA 5B0GA 1Y5NB 1UFKA 2GIFA 4NLUA 1YLXA 4LFAF 2W2PP 2Y1JA 4ECQA 2OD6A 4OI2A 2E1PA 3CE8A 1BXNA 3NKYA 4K5RA 2ROPA 3KTQA 5L9XA 3PY8A 4JYAJ 3D1OA 3DYAB 1REGX 1FTCA 4QWAA 2CPIA 3GG0A 2QL5B 3I31A 3TVYA 1DAXA 3X1LB 3D7SB 3J81Y 4OX9F 3TZWA 2I6WA 3G6YA 4EBDA 2AIRB 4LSZB 5HVHA 4Y6IA 4JV2A 2CKWA 4HKQA 1CVJA 3G6XA 4A8KA 2IA0A 3CCZA 5AJ3F 4RW6A 5B0AA 3LW5C 1WD6A 3DXSX 1PJ7A 2CQCA 2OEKA 3R5GA 1T8EA 4LREA 2MJNA 1NAQA 3M2VB 3GJRB 2QMUB 5JUMA 3ENVA 4A8WA 2KJVA 2XS5A 4KYZA 5H9FJ 2Q6CA 1YRTA 2ZH2A 3M8PA 2ABYA 4FYDA 3JQMA 3HCXA 4OI0A 2HS0A 1KOHA 3UN3A 2MKIA 2ZE2B 1I3OB 3QT5A 2FLPA 2HQDA 2VFVA 1N36F 3ETMA 2VBYA 1N5VA 1EB0A 3Q23A 2VG7B 2MGZB 1WOOA 4X65J 2QLFB 4LQ3A 3D68A 3CC4S 3KLGA 4MMOA 4X4OA 4J9SA 3RAQA 3NMAA 1UA0A 1X4BA 5DQIA 3MD3A 1FFSB 3H2LA 2JDJA 2WB4A 3D6MB 4DR4F 5C5JA 2C28A 2LDIA 2O1PA 3MPDA 3CIZA 1IBCB 4AXIA 4LF2A 4ZK7M 2KG0A 3IG1A 4DQRA 2GNKA 2V68A 5IT0A 1JB0C 4Q2LA 2CQHA 1CJUA 2DR8A 4DU7A 3Q83A 4FS1A 3NCPA 2I1RA 2QA4S 1NSPA 4PZVA 1UMJA 1FRHA 4HYKA 1I94J 1YKWA 4P73A 3Q8VA 3O1LA 3N4WA 3K5NA 5AXLA 2FIUA 1DURA 4JV5J 1TKXB 5HROA 2Y8WA 3D54A 2DR7A 2GIQA 1TV6A 2O01C 3M30B 2E1MC 4PWDA 1HW8A 2GX8A 3LAMA 1KLMA 3NGTA 3CDAA 1RHQB 1T03A 1J5OB 2BXJA 3EXCX 5F41A 1KN6A 4DSKA 3D66A 4C3KA 4EU0A 1U02A 2MMYA 1N56A 1KVIA 3SBMA 2L9NA 3PKYA 4AL6A 3SSRA 2P8IA 1RTJA 2WSFC 5D4LA 1RJJA 1HNVB 5GMKa 2F7VA 2XCAA 5C25A 4AXJA 4Q2MA 3GR0A 2W9AA 3OHBA 3IBFB 4LJMA 2G9OA 4ETZA 5DDPC 2NR0A 3KJVB 2XGQA 2XWXA 3MTKA 4N56A 3KG0A 4CO2A 4W92B 5CCMA 2ZH1A 2EFQA 3LP2B 2N3LA 3U1LA 1SQFA 3D67A 2VQFF 1RT6B 4KGZB 3EGWB 4AQYF 1R6YA 3CJ3A 4CLKA 3J81j 3GJTB 2R4FA 3MOZA 3B4DA 2B4VA 3HM9A 4CM0A 1HYSA 2UUAF 1KC8T 2HVDA 3T6BA 4QWCA 3U27A 2MZSA 4X4SA 4JI1J 1FEHA 1Y5LB 1MWZA 4E2FB 1FKOB 4DG1B 1QUVA 4NLDA 3LPEA 4KH0B 2LCWA 3QO9B 2Y1IA 1RISA 2HNZB 3C16A 2LU2A 3CC7S 4QCLA 2E5LF 1R3NA 4LRBA 2GS8A 1RBOB 3P45B 1DTQA 3RBXA 4J9PA 2KKHA 3IRXA 3KDOA 3BGOP 1RTIA 1G2EA 5J1EA 4XDCA 5KFGA 2YNFA 3N6LA 1PILA 1NK8A 3AD9C 2VOPA 5KFCA 2JVOA 4U9RA 1YTYA 1FKPB 2YQ3A 2W9CB 1N54B 2HEKA 1XMOJ 1NB7A 1YGYA 1UA1A 1OQ6A 1ZBTA 5F8JA 4FYYB 3KK3B 4O3SA 2QZ8A 1GX5A 4HL9A 3G6VA 2EWHA 2W2OP 4PUOB 1YJ7A 2XZTB 1UW9A 2AYEA 2QGFB 2BKOA 3QNWB 5EX0A 1EX8A 1N6QA 1OY6A 2Y8YA 2KJWA 5A0YB 1JQGA 2UVUA 4DL6A 3LA0A 4I6YA 1K44A 1NPPA 1UEVA 1S6QA 3NBPB 2UUWA 3ILIA 3OL8A 3W3SA 1S6PA 5B0BA 1V3RA 1REVB 3OVSA 2QG9B 5KG7A 1V5IB 1XTZA 3FBEA 4Y28C 4KE5A 3MM6A 2DHXA 3OSNA 1NHKL 5E3RA 4P7TA 3D9BA 4NXMF 2F65A 3QZ8A 3IWNC 3RU0A 4IG0B 2F8HA 4OJGA 2A6MA 4YB1P 3Q8PB 3VWSA 4I7FB 1VRQC 4I67A 2FJWA 3CEDA 1TL3B 1S4FA 3CD7A 1X5TA 3DLKA 2E1CA 2BACA 1SIZA 1OYEA 1HD1A 2WW4A 2CRLA 4P72A 3MZIA 1CC7A 2AGQA 3HFKA 3CTRA 2M3DA 5KFOA 3PJWA 3PYFA 1G4CA 1RTDB 3O5TB 1T9TA 1CEZA 2A18A 2OAUA 4N77A 1JJ2R 4DPTA 3P3DA 3CJKA 2J0XA 3MAHA 4LSLA 2DD8S 4JB8B 5HN0A 2DNOA 2EFPA 2W2QP 1U2FA 3E3XA 3US5A 4IUFA 1W26A 4CO3A 2Z57B 1AXQA 1UWBB 3CDEA 3OV7A 1PCAA 2ZUAA 2IBOA 3G82B 1PG5B 3GJQB 4PQUB 3A8EA 1RT7B 2F4VF 4YB5A 1FEEA 3CO0P 2OTLS 2DGQA 5KT2A 2BV3A 4DR3J 5CYMB 4MKBA 4DS5A 3EVWA 4BCAA 5J2MA 1MWQA 4HLBA 1WACA 3WC2A 2CPJA 1NK4A 1MMLA 1IKXB 2CZ9A 1JXEA 3MEDA 3J80Y 1PAUB 2CIMA 2JLEA 3MOJB 1N33F 3AOCA 1P6TA 1U1LA 3J7AN 3Q2SC 4C8LA 4F8RA 4YP3A 1ZA2B 2P6SA 1TFWA 3HMJG 4LSNA 5B08A 1C0TA 2COLA 3N6NA 1FDBA 3T9ZA 3ETOA 2HNDA 2YWEA 5RUBA 2YKQA 2OMOA 2FLNA 3QBCA 3ZNJ1 1M5PC 4BBYA 3GIRA 2JSXA 4KJIA 1M5VC 2MB0B 4WIQA 5D15A 2YBVA 4NX9A 2FPHX 1G7CB 4YHHJ 3VHQA 3K17A 1CJTA 2FLLA 5CYQB 2A2DA 3GP9A 2YVSA 3BV8A 5KG6A 2G2OA 3Q8UA 3ZZPA 4RW4B 3KMSA 2ZC4A 1JJCB 5M2PA 4YR2A 2X3DA 2YWKA 3EUNA 3MM7A 2HSEB 3CCVS 5IV4A 4PKDB 2B9EA 4OYBA 1H72C 3GSDA 5EWGA 1FFGB 1FXLA 3DGVA 3C15B 5F3TA 5D8HB 3VQSA 4QZVB 2QA1A 5E0OA 2D9PA 3FKBA 3UVJB 3MMAA 4I2PA 4F4AA 1T7PA 1TMJA 3DLEA 3UR3C 2MQQA 1RT3B 2KTQA 1QTNB 3R5DA 1JLFA 5IFMA 2D69A 4PAAA 4X4RA 1HFEL 3FEYB 5A8WB 5DLFA 3G8SA 2IM3A 1VBXA 2F8MA 3Q89A 4HH1A 2FUG9 1AB8A 3CULA 1BY9A 4DQIA 4NMLA 4OZNA 1TUGB 1HNIB 1D3WA 2HAFA 4M5LA 1VC0A 1P9YA 2J8AA 2VC0A 3UD5A 4KGMA 3OR1A 2IVFB 4DV5F 2HWTA 1YK9A 2JX2A 7AT1B 3PRDA 1H38A 2R9LA 4K2JA 2RRBA 2UXDJ 1NJXA 4Q8FA 2CQ4A 2ZWOA 2JLFA 2VKZG 1D1UA 4X4VA 1KHWA 4GVBB 1IBLF 4B9VA 4JI6F 4CLLA 4ES2A 2V63A 2W2MP 1UVMA 4TY9A 2UXCF 1S1TA 5BR8F 1YJ9S 1KNZA 4WYWA 3R8YA 1QAYA 4O0NA 3BB5A 4OL8A 3ET6B 4M5DA 4ZP7A 2ZH5A 1RTHA 2CA9A 5IOLA 3MMBB 2XGPA 1U1KA 4ZP9A 4DV6J 4QWBA 5K14B 2M0GB 6AT1B 2IA6A 2FGCA 4PR6A 4LF1A 2FJVA 4ZJOA 4KTQA 2WVDA 2A1BA 1LK7A 4J9LA 4OYZA 5F8LA 4DV2F 4JI8F 2CNOB 5KFQA 4IR9A 4P2XA 4RW7A 5HBMA 2XMWA 3GLJA 4NLXA 3TWZA 1RWXB 5C24B 2YKOA 1YX2A 3M05A 4UUWA 3KLIB 1VQOS 3GONA 5CCLA 3PR5B 3C46A 4NLTA 2EBEA 4PG8A 1UZDA 1MMDA 1VLYA 2I8EA 4KHMA 4ZCIA 2CJBA 2OP5A 1VQLS 1HQ2A 4OZJA 2VG5A 3VV2B 1TL1A 1EKSA 2UP1A 4WK1A 2VC1A 2DHSA 3OR2A 5HP1B 3RR7A 1RAHB 4WPAA 2PO4A 1BQMA 1IKVA 2CAJA 2W9BB 1WHXA 4TNOA 3R2CJ 4FBTA 1YWXA 4YY3J 4G6VB 3BYRA 3SQGA 2ASLA 2MQMA 1DLOA 1FERA 3MUTP 3I0RA 2FB0A 3RB0A 1K8AT 1U1PA 4JI7J 2QMWA 1R27B 1SQEA 5IT9Y 4B02A 3TAMA 3S6EA 2DNPA 1U8WA 1TKZA 3BSOA 3SSSA 2FZCB 1NSKL 1ZAWA 2VASA 1Z1ZA 1B0TA 1VQKS 3LQVA 5D78A 4Z7CA 1R7IA 3CCES 1EP4B 2ZOGA 1IQTA 3THPA 3I32A 1URRA 2V8DA 2V9KA 2IRUA 1TUWA 1JJHA 2U2FA 1LNQA 1KRPA 3D6HB 4OX6A 1JLBA 2CVEA 4WP3A 1E6VB 1KP6A 1UZHA 1S1VA 5FLXY 3ILJA 2G0IA 3VALA 3RW6A 2DH7A 4UTGA 2ACMA 3MM9A 2KL8A 3OT9A 3TNVA 4OI1A 2HMIB 3SIPB 4NRTA 1SVDA 3KLFB 4DV7F 3AXKA 4QYRA 3LUYA 3QWPA 5ETNA 4NXNJ 4H4OA 1UVJA 2YKNB 3KK2B 1FJGJ 2HYIB 3S7RA 4S0MA 4YS2A 4EBEA 5K8OA 2LLZA 4NOHA 1FWLA 4HDHA 4KKOB 4OJ3A 2CXEA 1VBZA 1OPIA 2OPRB 1S9GA 4CCHA 2XHCA 1YBTA 4KC5A 4C97A 1AFJA 2Q66A 2ZHBA 3K5OA 1PYTA 3BSCA 2ZD1A 3E01A 4ECXA 1RT4A 1WG5A 5DGBA 1HI1A 2DR5A 4C48A 1APSA 2VFRA 2IC3A 5FD1A 3CJ8A 3DRPA 2XBPA 5DG9A 2P5VA 2RDJA 4ED5A 3K8WA 1LXJA 2ZZTA 3O44A 4PPDA 4CNZA 1WTFA 2JL9A 1FESA 2E7VA 3UWTA 3POTB 2OSQA 4QPXA 3PFEA 4WFNQ 1N8RT 3R5BA 4M5JA 1WC6A 3BKUA 4YR3A 4LVNP 1U26A 3GV7B 2V8PA 5DLGA 2KM8C 4C8NA 1QSSA 4IQXA 1L3TA 2JEJA 1JLGA 4WBFA 3L7OA 3CSKA 2WVCA 1NZAA 4RW6B 4DR1J 4OZ3A 4ZOSA 2V4QA 4LF8J 3BH6B 3AFGA 5KAKA 3G2XA 2VPXB 4JI2J 5JJBA 3NS7B 2NSCA 5D4OA 1IN0A 3PKMA 5LSOA 2WAQD 3H4BA 4UQTA 2HIQA 2YX1A 2DGVA 3OTDA 1G6BA 4KR0B 4RNHA 1VOMA 2YKPA 4FPIA 4LF7F 1Y00A 1S9EA 3NLCA 3M8PB 2Y1RI 3GV5B 2CVIA 1ZPVA 2OJ3A 1HKAA 5IS2A 3IP0A 4WU2A 3GYGA 1Y3KA 2VFSA 3CDBA 1TTHB 2C2RA 2HVIA 2PT0A 3L09A 3DU5A 3C8YA 4P10A 2D3UA 4J91A 2XYPB 3KLGB 8AT1B 3BGUA 2UXBJ 3U1NA 1F5AA 2J6SA 2DB1A 3JSRA 1NU4A 2BX6A 4M95A 5E3QA 3R27A 4ECTA 2GC8A 2EG1A 3SDEA 3K5MA 3UDEA 4DL3A 3IG1B 5LM7E 5A76A 4YR0A 5GAEU 3C14A 1CJUB 2W4CA 2ZH8A 1BC6A 1B70B 3M4XA 1SKRA 1ZOTA 4GO7X 2ZBIA 3WIVA 2IYIA 3ONQA 4A8MP 3R5CA 1S6OA 5JXSA 4GRSA 1KSPA 2V2KA 4F4ZA 2IJFA 5KFYA 5E41A 4Y2CA 2NZCA 2OI2A 4A8OA 3WC0A 4J9OA 4LFBF 4M5IA 4PCQA 3EZ5A 1JLCA 2XZWA 1UCNA 3CCTA 4X64F 2E1RA 3T6JA 4CRJA 5HROB 3AOAA 2ATLA 2J9EA 2OPQA 5CQGA 3QQCD 1TV6B 4OZ1A 4WE1A 4PWDB 2DRAA 2D7SA 2WVBA 2QLBB 3CXCR 2QEXS 3FBBA 1RU2A 5ADZA 1HNXF 1TFYA 2LP4A 2Z2LA 1WC0A 1KLMB 3HXMA 1T03B 3TA2A 4C11A 4HHUA 3BGFA 3EPGA 4F3OA 4EGLA 3FZBA 2JEGA 2V8HA 1K47A 1RTJB 1EJ7L 1U8SA 4PEOA 4DV1F 2KFZA 3PW0A 4WZQA 5C25B 4NEZA 2CQBA 5HLFA 5A2QU 2XS2A 4EO8A 2LQ9A 1QLNA 3K5PA 2J7UA 3PZPA 1NJZA 2CJXB 4P2SA 1Q5VA 1SH0A 2VH7A 4ID5A 4ZLNA 2ZM6J 2BRKA 3Q24A 1RCOB 1WELA 2XNQA 3PEHA 2EI5A 3FSIA 2R8IA 4URSA 1XK8A 1IBKF 3CCUS 1BQNA 4LBIA 3ILLA 4WFAQ 3GG1A 3D0IE 3IA0A 1VQPS 2H5JB 1HYSB 3GILA 3W8GA 1FRJA 2CWXA 4OYXA 2FHOB 1RHJB 5F0WA 5KFAA 2MQOA 1PC5A 2JFKA 2CQDA 3F0NA 1HBNA 4L73A 3GCWP 3CNQP 3NOGA 2VBWA 5B0FA 4Q0BA 4ZLPA 3GYXB 2DPJA 2IM0A 3GCXP 1W2IA 3C16B 3HHNB 1DTQB 3IRXB 3EX7B 1RTIB 5J1EB 1XMBA 4GVLA 4ZKAA 2UVVA 2KVIA 1NJIT 4RUHA 2OFHX 4OZLA 2BMBA 2YNFB 4EYHB 3ISZA 1BQXA 3M8YA 3D6FB 3VVTA 4JBCA 2Z2ZA 1IQZA 4KHPF 2FVRA 2DNHA 4N8OA 3T19A 4A48A 1V3ZA 2DT9A 4ZHRA 1Q8LA 1U24A 2E1AA 3JAMY 4X66J 2NXCA 1VC6A 4QIWD 1Q53A 4XTTA 4C4WA 1J5EJ 1N6QB 2HZCA 4DL7A 2OEJA 1RADB 3WX4A 5HMXA 3G87A 2I5JA 2IMWP 1C1CA 3NY0A 2YNGA 2QIFA 4TYAA 1WI8A 3SZ2A 2DGOA 4CDIA 1KTQA 1S6QB 4K50A 3JYTA 1RHUB 1S6PB 3N01A 2VUGA 3FBFA 1WC1A 4K4TA 3I87A 3MM6B 2M4MA 1ZPWX 3P8BB 3EE3A 1YRXA 2KXNB 1UWAA 1B3TA 3NNHA 3PW7A 3O6QA 3CF5Q 1RAEB 2DGXA 5F8GA 3L9ZA 4USKA
chains in the Genus database with same CATH topology
1N5TA 3GFYA 2WHOA 2DCLA 3VCDA 4RKUC 4Y6IA 4JV2A 3DLKB 2CKWA 5KG0A 2XO7A 4OJHA 2DNQA 3I0SB 4LQ9A 2DR9A 4HKQA 3TUIC 3H20A 1FHTA 1Y9OA 1CVJA 3OJUA 2H9ZA 4I64A 3G6XA 2XY7A 4R0EA 3OVAA 1FCAA 3BO2A 4A8KA 3Q0AA 2FVPA 2I2YA 4B9LA 3KK1A 2DIUA 3MM5A 2IA0A 3IO1A 4C3MA 1KR4A 2MZ1A 1NJWA 4TU7A 3CCZA 3UFCX 5AJ3F 4RW6A 5B0AA 4Q8EA 2R2RA 3VF0B 2CPDA 2OPPB 3LW5C 3R3TA 4DR6F 3AJ2A 4USIA 1HA1A 2BANA 1D0EA 3QIPA 1WD6A 3CCSS 3TRGA 1B0VA 3DXSX 3MPVA 4I68A 3J7YU 2KYXA 2RH3A 1Q1KA 3DOMA 2FVQA 1U6BA 1VRTA 1KQFB 5KT6A 1HR0F 2CQCA 4X65F 1FRKA 1T8EA 1TAQA 2VKRA 7FD1A 4RNNA 3OFHA 2MJNA 1TUVA 1NAQA 1TK5A 3R5AA 3P49B 4TU8A 3M2VB 3IRWP 5JUMA 1URNA 3ENVA 3PO5A 3FFIA 2NREA 2E9ZA 3JSYA 2HQIA 1KFSA 4KO0B 4A8WA 3GFZA 2CPEA 2LDYA 2KJVA 3CJKB 5DJBA 1C1BA 1SV5A 4LSLB 3BM7A 2XS5A 3EZUA 2ZOFA 2VPZB 5H9FJ 1C0UA 2Q6CA 1YRTA 3NG8A 5J2PA 4MYTA 4WK3A 4ZA1A 2E29A 5DDQC 5CD4H 2ZH2A 3M8PA 4YHHF 4MK8A 2ABYA 2Q79A 2NZ4A 2VONA 4FYDA 3M2UA 2AX1A 4RLEA 3HVRA 2X1BA 2HS0A 4OI0A 4ZPBA 1HI8A 1KOHA 1WHVA 5MLCV 2XMJA 2MKIA 3AA8A 5JVGQ 3MTJA 2IFXA 5K8NA 4BC9A 4ED3A 2UUBF 4FF2A 2ZE2B 3LP1A 4EUVA 2FLPA 2W4DA 2VV5A 3MPYA 2LQBA 2VFVA 5GAGU 1R43A 1DHMA 3M8QA 1N36F 5LJ5Y 1MROA 2VBYA 3IFEA 3JTPA 1HMVA 3OUYA 2QA4G 2YKAA 1U4BA 4DEZA 3GYNA 1N5VA 3DDKA 3AQPA 5CA5A 3Q23A 2VG7B 5U47A 2GMLA 2N4DA 1CPZA 2MGZB 3KYLA 3C6UA 1X4GA 3PX0A 2HGNA 2HRYA 4LQ3A 3W2VB 2BBEA 3MUVP 2FTRA 4LIRA 3K8VA 3N9UC 4CTAA 5KG2A 3CC4S 4MIWA 1WEZA 2FLOA 2QRRA 3KLGA 4MMOA 4X4OA 4J9SA 3MR5A 3RAQA 1F60B 1TK0A 3NMAA 4DS4A 1X4BA 2CFXA 5EWEA 1UA0A 1CQNA 3QWUA 1JMTA 5I3QA 5DQIA 1QE1A 3MD3A 5A8RA 2AYGA 3H2LA 3LANA 2JDJA 1KTVA 1X4EA 2VA3A 2YWGA 2WB4A 5DRKA 4A8QA 3GB0A 1VQ5S 5J2MB 3P5TL 3RW7A 1U48A 4DR4F 5C5JA 1NKEA 2C28A 3HJFA 3B82A 2D41A 3SXLA 1NK6A 1UEUA 3KWMA 1WF0A 2LDIA 1T3NA 1FRLA 2O1PA 1S9FA 3OFGA 4TY8A 1X9MA 3CIZA 3FVYA 3DHXA 3MEDB 4AXIA 4ZK7M 5JVHQ 4C8OA 2PA8D 2KG0A 3IG1A 3V5RA 5FDLB 3CCQS 2PFFB 1TVRA 2GNKA 5F8MA 4DQRA 2I9SA 5IT0A 1RT1B 2XC9A 3LO3A 4QU6A 1JB0C 4AFFA 4Q2LA 5KFHA 2CQHA 2HG4A 4QW8A 2LU1A 3HHDA 3FCHA 2O5DA 4FP9A 3QJPA 3DOLA 4DJBA 2DR8A 2IJNA 3BQ0A 3FMBA 4K2XA 5GAHU 3D5MA 4LSNB 4LT6A 1SJ4P 2R7VA 5I42B 2E5GA 3DI6A 4FS1A 3UR0A 3NCPA 1V3SA 1X5SA 1Q7LB 1C0TB 2C3UA 2I1RA 3FRZA 2QA4S 3OUYB 2EG2A 3SEOA 1HQUA 3KLVA 1UMJA 3FEXB 1FRHA 1DRZA 2PEHA 1QTMA 2HNDB 2FVSA 4HYKA 4PXEA 2JEIA 1XWLA 2F40A 1T94A 3N4WA 3O1LA 2MHEA 3NMRA 3K5NA 5AXLA 2FIUA 4ETXA 1RK8A 1JLQA 1WWHA 4F26A 2XHWA 2FHKA 1NO8A 1QJHA 3QLHA 1DURA 2BRLA 4A46A 1GX6A 3S01A 4K4XA 1TKXB 4H4MA 5GADI 2B9XA 5IQ6A 2F1FA 4CO4A 1XNRF 1LFPA 4F2RA 2BM0A 1LWEB 5HROA 3DLBA 2L41A 1WHYA 4YEAA 2PC6A 5CZXA 3AHPA 3D54A 3RAXA 3DXBA 2KHCA 4NLPA 2DR7A 2GIQA 1TV6A 3E8OA 2O01C 2Y0SD 2E1MC 3M30B 4FN5A 1H2VZ 4PWDA 1HW8A 1F5BA 4R5PA 3I6PA 4ZCLA 2AJ0A 3C66A 2GGPA 1V9OA 2UXDF 3FJ2A 3HDSA 3QYYA 3ZZOA 4DV3F 3ZZRA 3DMJA 1LW2B 2GX8A 3LAMA 3I4PA 2IRYA 1KLMA 5F9NA 4ICLA 4URQU 4O4GA 3CDAA 2DK2A 5A8KA 4KFBA 1JNZB 4MH8A 2NSBA 2OSRA 2RRNA 1X0PA 1S97A 1T03A 1J5OB 2DGSA 3S1TA 2BXJA 3EXCX 5F41A 2DTJA 4FVCA 1KN6A 2L08A 2RD5C 4I4BA 4DSKA 4DSIA 2LMIA 5THWA 3ITHB 4C3KA 4EU0A 5L1LA 2MMYA 4Z2XA 1N56A 1KVIA 3MFIA 4OLPA 2L9NA 3THVA 3PEJA 4H4KA 3PKYA 4IH5A 4AL6A 3IC1A 4B3OA 3BGRB 3MM7B 2QT7A 3SSRA 2W7OA 5H9EJ 2GQCA 1M1KT 1S72S 1KQKA 3V4IA 1RTJA 4K4VA 3MR3A 3CD6S 2WSFC 5D4LA 1U1OA 1HQUB 1RJJA 1FD8A 2DISA 2WK4A 5KOWA 5L38A 1HBMA 1HNVB 2GW8A 5GMKa 4L72B 1ZYQA 2MHNA 4A47A 3IWLA 2F7VA 1HBOB 1CG2A 2XCAA 4ZDNA 3V4MA 5C25A 3HT3A 4AXJA 2V94A 3F41A 4Q2MA 4AE5A 3OL7A 3GR0A 2W9AA 3OHBA 5FIIA 1ZH5A 2B5JA 1OQ3A 1MW7A 2G9OA 4LJMA 2MY7A 4ETZA 4IG3B 5DDPC 2NR0A 3KJVB 1SL0A 3CGIA 2XGQA 1H7XA 5A6WA 2XWXA 4NCBA 3MTKA 4N56A 3KG0A 3D1HA 4DV6F 2V9WA 2K7KA 4CO2A 4W92B 4I69A 1SUQB 3K59A 5CCMA 2HPUA 5F3ZA 2ZH1A 1SKWA 1FRXA 4JV0A 2XSJB 2EFQA 3LP2B 2N3LA 1P8GA 3U1LA 3MMAB 4I2PB 2Q6BA 1KQGB 2VQFF 3DLEB 1RT6B 2G1DA 4QYZJ 4ECSA 2GMHA 2H5EA 5GAEI 2DH8A 5K5MA 3NNAA 2RMLA 1NEEA 2ZHAA 1JLFB 1YBAA 3EGWB 2ACYA 1X4DA 1R6YA 3CCWA 4U67Q 4AQYF 3T1HF 2KXHA 5KFDA 3CJ3A 2HFOA 2CQGA 4ILLA 2OTJS 1QUPA 5D4NA 1SBRA 2ADBA 2IBKA 4MK7A 2HVHA 4OHWA 2VL1A 2R4FA 3N6MA 3MOZA 3B4DA 2B4VA 4HDGA 4BC7A 3HM9A 2OD4A 1VQ7S 5KG4A 4WJBA 1D9FA 1HYSA 3N5FA 3BGLA 5AXNA 2ASDA 2UUAF 3GV8B 5DM7Q 1KC8T 1LW0A 1KEKA 3NAIA 3T6BA 4MIAA 4QWCA 1IKWB 2EKYA 2AGOA 3U27A 4ZVHA 1Y3JA 2MZSA 4AUKA 5KT3A 1LQ9A 4X4SA 4ZPVR 4MAKA 3KLHB 1FEHA 1Y5LB 2PA3A 1MWZA 2YX4A 1LFWA 5KFFA 3Q8QB 1FKOB 1H2TZ 4QR0A 4RWXA 5G0RB 4DG1B 1QUVA 4NLDA 2ZH4A 3V6DA 3PACA 2LCWA 2JFDA 5K8MA 3QO9B 4B9MA 2Y1IA 1RISA 5HQ8A 1C4AA 2HNZB 3HHLA 1ROFA 5KTQA 2IAJA 1JXLA 3PIPQ 2ZNZA 2LU2A 3CC7S 3QJJA 4NLSA 4EZ9A 1UVKA 3AH6A 2E5LF 2KB2A 4QCLA 1JLAB 3J7ZT 4DL4A 1R3NA 3OR1B 2XNRA 1HWUA