1RK8A

Structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
87
Chain Sequence
PQRSVGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into the interaction of PYM with the Mago-Y14 core of the exon junction complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Translation
molecule keywords CG8781-PA protein
total genus 18
structure length 87
sequence length 88
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rk8A00
3JB9k 2Q79A 2M88A 3G71S 3VAIA 2AD9A 3PIPQ 2E5JA 2M8DB 5H1SV 1XN9A 3Q2TC 1VBZA 3H2VE 1CVJA 1SJRA 2CQ2A 2AYBA 3VAGA 4PR6A 3TO8A 3J7ZT 1SJFA 1SXLA 3MUTP 2KN4A 1N52B 3CCSS 3CCUS 3P6YC 5HL7Q 1VQMS 3VAJA 2DIVA 3EX7B 2RQ4A 2AYGA 1W2BR 2MZTA 5GVQA 5CA5A 1YIJS 2MQOA 1X5SA 3VALA 3SDEA 3S8SA 3VAMA 1D9AA 5JVHQ 1VQ5S 1FJEB 1SJ3P 1L3KA 3CCMS 1VC6A 2KFYA 5EN1A 2DK2A 2U2FA 1VQ6S 1NO8A 3S01A 4TU9A 1RK8A 2LA6A 2DIUA 1VQ7S 2DNKA 2ADBA 4LIRA 1QVGR 1A7GE 2MZQA 3UWTA 4F02A 2KG0A 2KXNB 2CPHA 1M5PC 3HI9A 1U1QA 3THTA 1H2TZ 1HD1A 3I56S 2DO4A 1X4HA 2NLWA 1D8ZA 3G8TA 2DITA 3MI7X 4WFAQ 1VQKS 1UW4A 2AYMA 1X5OA 2MZ1A 2QEXS 2MZSA 3BO2A 1WG4A 2M0GB 2CQGA 5MLCV 3CC4S 1FHTA 2J76E 1UFWA 1FNXH 2HGMA 2MSTA 3CMAS 2YTCA 2JRSA 2MHNA 4F25A 2MQPA 3IRWP 3U1MA 2CPXA 5LJ5Y 2BZ2A 2OTLS 3UD3P 1OPIA 1KOOA 5D77A 2AYEA 2MGZB 1X4GA 2ZJQQ 1VQNS 1FXLA 3MD1A 4CH0S 3G6ES 3BS9A 4CH1A 1R8PA 3B4MA 1HA1A 2DH9A 2KH9A 2HVZA 4U67Q 2RUGA 3S6EA 3J7YU 1ZZNA 1YI2S 1VC5A 2KU7A 5IFMA 2SXLA 5GAEU 3MDFA 1PGZA 3CCLS 3UCZP 1VQPS 4WFNQ 3R27A 2JVOA 3CCRS 4IOCQ 2CJKA 2DGVA 1WI6A 4UY8T 3V4MA 2OSQA 3U1LA 3EGZA 1H2VZ 4J5OA 5LSLA 2QFJA 4FXVA 2EK1A 3TYTA 2U1AA 1B7FA 1IQTA 2DH8A 3VF0B 4IO9Q 2HGLA 2N82B 2HYIB 2VOOA 4Y00A 3BO3A 2RNEA 2MJNA 2LYVA 3HHNB 4TU7A 4QU7A 3S7RA 2DB1A 2MKKA 2DHSA 1X4DA 1DZ5A 3Q2SC 3UCUP 3CCJS 2LKZA 2J0SD 2CPFA 3MXHP 2CQ4A 2CQPA 4C4WA 1X4CA 1U6FA 2RVJA 2DHXA 1WHWA 2G0CA 3LQVA 2XS5A 3L3CA 4YUDA 4P6QA 2DGUA 4Z2XA 1OWXA 5FJ4A 2J8AA 2VONA 2CQ1A 2DHGA 2FY1A 2OSRA 1KQSR 4ERDA 1U2FA 1YHQS 1AUDA 3MUMP 2DNZA 2A3JA 5DETA 1PO6A 3PIOQ 3UE2A 3MURP 3SXLA 2DNOA 2FC8A 2DNGA 1U1LA 1VQ4S 2M9KA 2CQHA 5IM0A 1KC8T 2CQ0A 2RT3A 2FC9A 3SDEB 5LXYA 1WEXA 1QM9A 2E5HA 4IOAQ 2I2YA 5LXRA 2CQIA 5IM0B 3MUVP 2XS7A 5JVGQ 5LSOA 2RS2A 1ZZFA 2NZ4A 1WG1A 1U1MA 2MKCA 2B0GA 3H2UB 5DM6Q 1HD0A 1JMTA 2OJ3A 2KHCA 2KXHA 5DM7Q 3OW2R 3D2WA 1A9NB 1K9MT 2ZJPQ 1G2EA 1X4FA 2YH1A 4CQ1A 2LXUA 2DNQA 4F26A 3R1HA 1K73T 2CQBA 1KD1T 5ITHA 1Q81T 3N9UC 3ULHA 3R1LA 4FXWA 5GADU 1UAWA 3RW7A 1URNA 2XNQA 4W90B 1X4EA 1WHYA 1P27B 2JVRA 2D9OA 1OIAA 1WELA 1WHXA 2MPUA 2KYXA 3CC7S 2G1DA 3TP2A 3UCGA 2MY7A 1WF1A 3K0JA 2YH0A 1VBXA 2DNPA 3CMES 2CQDA 2DNHA 3MD3A 2KT5A 5DDQC 2L9WA 1WTBA 2MZJA 1FT8A 3P5TL 2MQQA 1U1PA 2LA4A 2DGWA 4A8XA 2HGNA 5GMKa 2L41A 1UP1A 4QU6A 2MB0B 4EGLA 2ADCA 1JJ2R 3CULA 2X1FA 4WIIA 2M4MA 2OIHA 5DDRC 2F9JA 2KM8B 2LXIA 4TLQA 1X5TA 1WF2A 1KOHA 1H2UX 1YJNS 2CPZA 1H6KX 3CC2S 3CCVS 2X1AA 2RRBA 1FJ7A 2XB2D 2CPDA 2EVZA 2V94A 1U1NA 4M5DB 5D78A 4OZ0A 3UD4P 3LPYA 1M1KT 2ZJRQ 3IWNC 1QVFR 3CXCR 4TU8A 3G8SA 3CF5Q 1WF0A 5CXTA 1U1RA 2DGQA 3ZZZA 2DNNA 5DDPC 3CD6S 4Y0FA 1X5PA 4CIOA 1NU4A 2QA4S 2KXFA 2LEBA 4YB1P 2CPEA 2FHOB 2KRBA 1M5OC 1WEZA 2EK6A 2K8GA 2CPJA 5GAHU 1K8AT 3BEGB 2X1GA 1YJWS 2JWNA 2LECA 1WG5A 1X0FA 4QQBA 3US5A 3SMZA 2DNRA 2UP1A 1U6BA 2M2BA 2FPHX 1S79A 1S72S 4LJMA 1X4AA 2HZCA 3EGNA 2ERRA 2E5GA 1BY9A 2O3DA 4WF9Q 2M52A 3I55S 3NNCA 3CTRA 2DNLA 5HO4A 2MQLA 3BO4A 1X4BA 3B4DA 1YTYA 2JX2A 1DBDA 3P3DA 2OTJS 2WBRA 3FEYB 2PEHA 1N8RT 5IQQA 2DGTA 2M8HA 3CCES 1JJHA 5CYJA 1U1KA 1NJIT 2I38A 2BOPA 2M7SA 2CQCA 4OZ1A 1ZH5A 2D3OR 2K3KA 2KG1A 2DGXA 4W92B 4V19X 2XNRA 2KM8C 1VQLS 4UQTA 1DRZA 1Q86T 2CPYA 2VODA 2MKHA 2MXYA 1O0PA 2CQ3A 2DGSA 4QPTA 2RU3A 1SJ4P 1Q7YT 2DHAA 1DHMA 1F9FA 1P1TA 5BJRA 4ED5A 2DH7A 2MKIA 2KVIA 2GO9A 2LQ5A 2MQNA 3DLLQ 4BS2A 2F9DA 2MGZA 3P49B 1M5KC 3RW6A 2G4BA 1VBYA 1FO1A 1VC0A 1WI8A 4YOEA 3NS6A 1N54B 2MYFA 3FEXB 1HL6A 3G9CA 3VAFA 4C7QA 2LMIA 3G96A 2LCWA 2M70A 2F3JA 2MKJA 5DDOC 2MY8A 4WCEQ 2N3OA 2MSSA 1FJCA 3VAKA 5LJ3Y 2MJUA 2E5IA 2YWKA 4PKDB 2LEAA 3NMRA 1WHVA 3CCQS 1YJ9S 1SJQA 3NS5A 3NNAA 2MQMA 2KI2A 2MZRA 1YITS 2VOPA 3G4SS 2DO0A 3CPWR 2GHPA 2E44A 2RS8A 2XSFA 5GAGU 1U1OA 2J0QD 4C0OC 1VQOS 1JJ4A 4PRFA 4LMZA 4IUFA 2DNMA 2N7CA 2N3LA 1N88A 2D9PA 2PE8A 1M5VC 3ZZYA 1R8HA 1YWXA 4RU2A 2MMYA 2DISA 1OO0B 1Q82T 1M90T 2CPIA 2DGOA 1WWHA 4ZKAA 2RRAA 2X1BA 2XS2A 4WKRA 3CUNA 2KRRA 2YKAA 1RKJA 1VQ9S 4WFBQ 1VQ8S 2DNYA 2RQCA 1WEYA 3DXBA 3VAHA 3MOJB 2MKSA 3THPA 2L08A 3NNHA
chains in the Genus database with same CATH superfamily
3KJNB 1ZOTA 3ILIA 2AT1B 2FVQA 4KKOB 4I64A 3GIRA 4ECVA 4WTYA 4DR4J 1R8AA 4CNZA 2ROEA 3OTOJ 1RBLA 3KXDA 5D0HA 1XN9A 2XHWA 5HROB 2OO4A 3MM6B 5M2RA 1M1GA 1IN0A 1ZM9A 4FXDA 4I2PA 2NSBA 4LRFA 2YWWA 1HNZJ 1O51A 2AYBA 2AIRB 3CO9A 1JWWA 2AKWB 3BN7A 3TO8A 2XTJP 1YQHA 4CCHA 1N52B 5B08A 3CCSS 1IKVA 1PSDA 1U45A 5HL7Q 2E7XA 2K7JA 2F63A 3VAJA 1NZAA 2DIVA 4MK7A 3KK3A 2W25A 3EX7B 4PQUB 1TUVA 2CFXA 4AD6A 3PHTA 1J5OB 5CA5A 1TQLA 4FYVB 2J6UA 1YIJS 3D9BA 3IM9A 3M8PB 1VHIA 3CD0A 3VAMA 2LEPA 4QOTA 3UN2A 1VRTB 1NPKA 3Q83A 2VB6A 3E8OA 4FF3A 4K50A 3ZZRA 2VHGA 1TK0A 1AUSL 1RISA 2RSQA 1JLBB 2MLYA 4YHHJ 3RBZA 2DK2A 2EW9A 2U2FA 5I4MA 1RT7B 2ALYB 3M30B 2I6WA 2UXCF 4QJVA 3S01A 1MWZA 1URRA 1BMQB 3DC2A 4XK8C 2VU5A 3EZ5A 8RUCA 3T5JA 5GAGI 1N48A 4Q43A 5D6GA 2CG4A 1RU2A 1Y3KA 2HZAA 1A0OB 3PHEA 2R8JA 5KFQA 1FRMA 1VBKA 2UUTA 3PW7A 1HR0F 3GU0A 2KXNB 4DR7J 1HHTP 1UA1A 1J5EJ 4IO1A 3SYZA 1U1QA 2QGFB 2HMIA 1TAQA 4KPYA 4JI2J 3I56S 4G1QA 2RRNA 2Q1LA 1D8ZA 2ZUAA 3ENAA 4DZDA 4F50A 1VQKS 1QAYA 3GFYA 2C3MA 1RHRB 2L9DA 1X9SA 1X5OA 2HLUA 3AB4B 3AFGA 2XO7A 2ZH8A 3V4IB 3LGHA 4ELVA 2RF2A 4F4KA 3V4IA 1ACMB 3D66A 5KFNA 4OI0A 4FNHA 4QWCA 3JSBA 2KT2A 3A1YG 1HBOA 4KGZB 1IM4A 3QMQA 3CMAS 4AL5A 2YY3A 4UOFA 3W3SA 2G9OA 1VLYA 1Z2LA 2FHMA 2YKNA 4Z7CA 3T5LA 3TEHB 4N5SA 4P2MA 4QWDA 2MHNA 3L9ZA 3IRWP 1GXLA 3SIPB 3DLGB 4FDFA 4PXCA 5HK4A 2BZ2A 2QA2A 3UD3P 1RACB 3W61A 2IRXA 1OPIA 2JFDA 3LAKA 5D77A 3CDUA 4ECSA 4X64J 2ZJQQ 1FA0A 3BPDA 1VQNS 4ZCKA 2V34A 2IFXA 4PG5A 1U2CA 3MD1A 5K8OA 2GZOA 5KFRA 2AZ3A 1R8PA 1VISA 2BACA 4GO5X 5FDLB 4ZN3A 5A8RB 1HA1A 3N5FA 4DV1F 4I56A 2HVZA 2UVUA 3CCTA 4MKAA 3S6EA 1WSVA 1ZZNA 1P6TA 1K0TA 4LVNP 4A8FA 2AP6A 2XWXA 3QQCD 4I6AA 4DV7J 4LF9F 5IFMA 4LSNB 1XR5A 4RNNA 1QLNA 3Q8PB 3MWBA 1DY3A 1VQSA 4MYUA 4PXDA 3CCLS 1P9YA 1S1WB 1YSJA 1XMBA 3UCZP 1VFJA 1TZ0A 1JKHA 2GMLA 1GMVA 2JVOA 2CJQA 3GB0A 4ATNA 3CCRS 4IOCQ 1JKHB 5AXLA 3V6DA 4WU2A 2J9EA 3FNNA 2CJKA 3D0HE 3MEKA 5EX0A 2V8PA 3KK3B 1NK0A 1LWCB 2AMCB 4UY8T 5KG7A 2J9DE 2EC2A 2OSQA 2QN6B 4KH1B 1WKLA 4X84A 4P10A 2Z57B 1DQAA 1UVIA 2WRMA 4QIWD 4I68A 2XMTA 5BYRA 1ZBTA 3ET6A 3U1LA 3EGZA 3MEDB 2EFNA 4F4YA 3W8GA 3DOLB 4V1Ak 4GKKJ 3TA1A 2PFDA 4FXVA 3TYTA 2UUCJ 2WONB 4X66F 1IQTA 5L9XA 4OLPA 1GTHA 4D3HA 3OHBA 4L76A 4DLGA 4QR2A 1G4CA 1V3ZA 2JLGA 2VOOA 5KG6A 3BO3A 3EUNA 2VG7B 1KLMB 1RHUB 2QLFB 1M0SA 2KHDA 3T1YJ 1WOSA 2QYCA 2XMWA 3M8RA 1UPMB 5AT1B 1BQNB 1F2GA 3S7RA 5L1JA 2DB1A 4DF8A 3NY0A 4DFJA 4JYAJ 2BABA 1U26A 3D6TB 3PDNA 1HNWF 2DHSA 3KNAA 2Y0BB 2ZH4A 4CT9A 3LP0A 4IOBA 3OR1A 5KFAA 2LKZA 3CB4A 3VGTA 3ETOA 1C4AA 1FDAA 1H3DA 2CQ4A 3TR5A 4EO6A 2CQPA 4I2QB 2BJ8A 1KTQA 5KFWA 1KVIA 1U6FA 1SH3A 2C2MB 3FCHA 5HLFA 2FJDB 1VI7A 1S7IA 3PYEA 2EXUA 3LQVA 3U7JA 4IR1A 2GFFA 1XMOJ 3KLIA 1TL3A 2IIHA 4H4KA 1OWXA 2D74B 3E01B 3WX8A 6FDRA 1YBAA 1QAIA 2CQ1A 2IM2A 2AJ1A 2LFVA 4YDXA 5A8WB 2UXDF 1AZSA 1FDDA 3WIVA 4FYWB 1IVZA 3JSMA 4DPWA 4RW9B 4FS1A 4IRCA 1WTFA 3LGMA 3I5AA 4P74A 2DNZA 2A3JA 3D0GE 5DETA 5KOWA 2JL9A 1PO6A 4CLSA 3W9IA 4Q0BA 3MURP 1NHVA 3DMJB 4IDKB 4LRAA 2DNOA 2DNGA 3LGNA 3OL8A 1ZYQA 5KFUA 5E3RA 4DUZF 1L3VA 4RJVA 5L8RC 2CDQA 3OBIA 4EI2A 2QSFA 1CULA 3T1HJ 4C8YA 1CQMA 3H2LA 3SV3A 1H98A 5IM0A 1N5YA 3DNCA 1QSSA 6FD1A 4S0MA 3Q8RB 3OL7A 1REGX 3UO0A 1BWEA 3SDEB 3VV2B 5LXYA 1WEXA 4NLDA 2HNZB 4LT6A 3TX0A 1QDUB 1BQMB 4I67A 2I2YA 1I1GA 3R5JB 1QAJA 3ILLA 3M1VB 4DI6A 5LXRA 2W9AA 4NEZA 1N5YB 2XS7A 1FE0A 1KR4A 3W60A 2RDJA 3BZQA 4C8MA 5A0YA 5JVGQ 2RS2A 3I96A 3LOUA 3AJ1A 3ISZA 2KJVA 3CIMA 3DMJA 2I1RA 2MKCA 3LW5C 2BANA 1UKUA 2IA0A 4HTJA 3TZWA 3UN3A 2KO1A 3KJFB 4UTGA 4DCJB 1JMTA 2FQQB 5C2GA 3DLKB 5DM6Q 3MAQA 2QSWA 3X3UA 5AE2A 1KLNA 1TKTA 4YB7A 3KHRA 2UUAF 3QPIA 3QT6A 4G3IA 3HPOA 4LR9A 2Y1IA 3I0RB 4ENOA 3OW2R 2EEYA 1OQ6A 4WK3A 1XJWB 4JI8F 1RHJB 3BSOA 2RIJA 2ZJPQ 2BE9B 1G2EA 3LP2A 2XCPA 2BKPA 1ZTTA 2LXUA 4KGXB 2DNQA 4F26A 1K73T 4W98A 3PRDA 4J9MA 3JQKA 1ZETA 4LBHA 1N0UA 4RWWA 4DOZA 1U2RA 2VIHA 1KD1T 3OVBA 1N33J 4B3RJ 3ULHA 3I9V9 2ZBIA 4FXWA 3OLBA 3T3FA 2WVEA 2YWHA 2VPZB 3CD5A 2WCXA 3UNGC 2F4VJ 2OPRB 3HO1A 3HULA 4DR1F 4W90B 1IR0A 3MM5B 3BH6B 3L95X 1H72C 4N41A 5ETPA 9ATCB 4CLWA 3PVXA 3EZUA 4GC6A 3HXMA 1JLFA 1J2VA 2C1EB 2JVRA 4IG3B 2MPUA 1RA6A 2WOMA 4DV6F 3CC7S 3UDVA 1LK5A 4ZPAA 1VK8A 3BBCA 5J2QA 5M2UA 3A3NB 1S6UA 1YRUA 4FP9A 4LSLA 3K0JA 4B3OA 1KLMA 3CMES 1AA1B 3NGUA 1TL7B 4C9DA 1HNVA 4AT1B 1S48A 3AA8A 3H42A 1HKAA 2J0WA 3IMQJ 3N79A 5B09A 5HBMB 4DFMA 4OX9F 1U8SA 2FUG9 2YNHB 1FJGJ 4WXOA 2R8KA 1TR0A 2LA4A 3AY0A 1CJKA 4A8XA 1MMLA 1GQEA 1Y00A 4X2BA 5C5JA 1UP1A 1CJTB 4OJGA 5AXKA 3WIUA 3GSIA 2A1BA 1P1LA 3MMAA 4M5JA 1MNEA 2BANB 2PI5A 2K1RB 4B9UA 4DV2J 1FNMA 3HFVA 1HQEB 1D09B 3DOKA 3HK2A 4HH0A 3GIKA 1CS4B 4EZ9A 2Z2ZA 1KP6A 3AJDA 4KC5A 4C2MA 1U09A 5HMZA 5KG4A 3VWSA 1SKWA 2J7KA 2RHSB 3Q22A 1WACA 1T95A 4DL3A 1NKCA 1H6KX 3CC2S 2OPPB 5J2MB 4R8UB 3T6BA 1FJ7A 1CULB 3DDKA 2CPDA 2EVZA 2V94A 4ETXA 1MMNA 5CCLA 4ECXA 3F44A 1RT6A 2W4PA 3HJVA 4B02A 3OHAA 3T9NA 5C24A 3IWNC 3BPSP 3J7AN 2FHJA 4PABA 3CXCR 4DUYJ 2FLPA 4P52A 2C42A 2JEFA 2GVZB 2J9DA 2ZHOA 2RILA 4MK8A 2J5AA 1WC0A 1S6PA 3VGVA 5A8WA 1U1RA 2WHOA 4H54A 4ZVGA 1R0AA 2DGQA 1L3TA 4J9KA 5J2NA 1RUSA 2W2NP 3KLFB 5A6PA 1OY9A 3J81U 3DLGA 1D8YA 1X5PA 1RT6B 3JQMA 3TOQA 2KXFA 2LEBA 2Y3YA 5F3ZA 1S1TB 5AJ3J 4YB1P 1KQFB 4K4XA 2AWZA 4P71A 1N32F 1VGYA 4JI2F 1SPBP 2EK6A 2RU9A 2K8GA 3F73A 1G3OA 2CPJA 1K8AT 3FZBA 2X1GA 4LFAF 2HBQB 2OMLA 3WDOA 2D69A 4ZHRB 3PFEA 3EXCX 1SC6A 1YX2A 2RF2B 6AT1B 4QYRA 5AXMA 3US5A 1RSCA 2F65A 4HDHA 4DG1A 2DNRA 2BKOA 1HNZF 3BYPA 4LF4F 1U6BA 2Z2MA 2ZE2B 4DL4A 2FPHX 3QT8A 1S72S 4OYWA 4DCOB 2CNLB 3OUYA 3EGNA 3RRHA 4ZCLA 2E5GA 4K7QA 3BSAA 4JI3J 1B99A 2C3PA 3DU5A 3NNAA 2Y8WA 8AT1B 2XQCA 3VQTA 1YZ6A 2G2YA 2P9CA 1YTYA 2DR7A 3HVTA 4RW4A 3W2VB 3IAS9 1N56A 1FRJA 1RABB 2A0FB 2MTLA 4LIWA 4RW4B 3W2VA 5HQMA 4HDGA 2C2EA 3HHLC 4ILLA 3QJPA 4AFFA 4RW8A 3BKFA 1TKZB 3G86A 5F9LA 3FKBA 4ZP8A 3EVWA 3MR2A 2ZVSA 4IRKA 2M8HA 4Y2AA 4YHHF 3CCES 4FF2A 3PW0A 1N0VC 3CSKA 3IR7B 4NE9C 1R6VA 3MMBB 4EBDA 1QY7A 4K2XA 1IR2A 2M7SA 3PR4A 4NYZA 3GR0A 1HI8A 2H5IB 2B5JA 3DRSA 1TV6B 1NPPA 3ZTOA 4WP8A 2GGPB 1WD6A 4Q8FA 1L3SA 3V6DB 4W92B 2LXFA 2ZWPA 5HVGA 1J5OA 4U8YA 1UWBA 4MTPA 1N5TA 3FBEA 2CJAA 5FD1A 1FNOA 4UQTA 1J5EF 2ASJA 4R0JA 1KNZA 4WWSA 2YNIB 3EYZA 1R7IA 2IY5B 1GK8A 1YLXA 4OZ2A 1MN9A 3LP2B 1SJ4P 2IHR1 1S1TA 2DHAA 1P1TA 4B3TJ 1PC5A 3M7VA 3OTCA 1S9GA 2NS1B 2MKIA 3RB6A 2K2PA 4KFBA 2MQNA 2PEBA 4O3NA 3AT1B 4ANEA 1XIQA 2JLEA 2QIFA 2MGZA 4DV4F 3NLCA 2PD1A 1VIXA 3L7OA 1RHQB 1FKOB 1WI8A 4YOEA 2J7UA 1RT4A 2MYFA 2ZOFA 2ZWOA 2XO6A 2HFOA 3RG6A 5KFLA 2LDIA 2ZOGA 3C15A 2IRUA 1UWAA 2QV6A 2P8IA 3O44A 2HWIA 2FVCA 4R8UA 4Q44A 5H9EJ 4N47A 2LCWA 2XSJA 1HBOB 2HQIA 2HS3A 3CJTA 2MQ8A 4WCEQ 1BQMA 2N3OA 3I82A 3VAKA 4LR8A 3RBEA 5C25B 2ZH7A 1VHFA 2MJUA 3TJ8A 2HG4A 3V81A 2BQRA 2VZ9A 4DFKA 4LF7F 2E5IA 4ED2A 2N4DA 4K5SA 1QUVA 4QZVB 3EVOA 1ROFA 2BRLA 1HWLA 2D41A 1RCXB 3OT9A 4NLWA 5L46A 5IS2A 4G1QB 4B17A 1EAYC 2MZRA 2ATCB 4H4OA 3PR5B 1KDNA 3K7RA 5F8MA 2A2DA 3G4SS 3V6JA 3VHQA 1OPZA 1JNRB 1HBNB 4UZCA 3Q8UA 3CPWR 2GHPA 2F8MA 1Q8KA 2E44A 1R6YA 2RS8A 3H8YA 4QIVA 3TWZA 2HHQA 1B64A 1MMDA 1YJVA 2B4VA 4PRFA 4PXBA 1HHSA 4OYPA 5LM7E 3DYAA 4C8ZA 3UDEA 2BOAA 3I5CA 3RRKA 1HI1A 3QLHA 2D9PA 4MFBB 4F4WA 4JV5F 3BR9A 4LF1A 1LWFA 2CJ9A 2E5LJ 3FQLA 1FDBA 4RU2A 5D0RA 1C1BA 3HM9A 1KVJA 1NB2A 3HSDA 1IBKF 1CEZA 1HIYA 3VVUA 4DU7A 3JAMU 1ZA2B 5CD4A 4DQRA 1JXLA 2GIFA 4EWTA 1WSRA 4KJIA 1WOOA 4X4NA 4GMKA 3AOAA 5KFZA 2W01A 2FJWA 4WKRA 2GC8A 1RAGB 2KRRA 1RKJA 1JLGA 2UZAA 3G82B 2W9CB 1VQ8S 2DNYA 3K5NA 2RQCA 4OI1A 2F1FA 1TELA 3HHDA 3KKFA 1IR1A 2BJDA 1IKVB 3I4PA 1FXDA 1U0HA 4JBCA 4DPOA 4LF6J 3TAPA 4ZS6A 1ZPWX 4HTIA 5CQGA 3CNQP 1SB6A 2XULA 3GCXP 2IVFB 2V2ZA 3RUBL 2VF3A 3FCWA 3THPA 4OHZA 4AXJA 3O8WA 4OX7A 4XPCA 1U48A 2E9ZA 4LVOP 4JI1F 2Q79A 4DL0C 1S9EA 3I0RA 3VAIA 4JI0F 1RTDA 1FESA 2BE2B 1OYDA 3ILOA 3NWRA 4H4KC 4P2XA 1PILA 2WONA 3QZ7A 4K4TA 2M8DB 1LV5A 3SCKE 2EFQA 1N5SA 1PBUA 1S1XA 3H2VE 1WDDA 4KR0B 4C3KA 3FSYA 1CBKA 2L9NA 2CQ2A 3DLKA 1HHQA 2JC1A 3VAGA 4Y28C 4NXNJ 2OLWA 5GMDA 4Q8EA 5DRKA 2BE7D 3DFEA 2BRKA 2V4JA 3DHXA 3QAEA 1E6YB 3FQKA 3J7ZT 1SJFA 3P6YC 2ZNYA 3K5PA 4Y2MA 1JLAA 1V3SA 2VV5A 5EGYA 2RQ4A 3RYLA 4G1PA 1B3TA 5E33A 4LF8F 1EP4B 4LUBA 4I7FB 4ZVTB 4F7VA 3GG1A 3HLUA 5IT9U 1TMMA 2MQOA 5L39A 4LF5F 2OEMA 3BKUA 4JI5F 1SKRA 4Q2MA 3S8SA 1EJ7L 1AROP 1D9AA 5LMUJ 3MEGA 2WZ1A 3DRRA 2VG5B 3A4TA 3SV4A 1U0SA 3A8JA 1FJEB 1L3KA 4USUA 1VC6A 1W2IA 1QTMA 2KZZA 2HK2A 4FVMA 2FLOA 3K2YA 5JUMA 4WP9A 3OV7A 2KFYA 5EN1A 3R8YA 2W4CA 1RDRA 4BC9A 3R7NB 2D1CA 3IG1B 1PYTA 2PN6A 3MPYA 1W7WA 3PACA 4ILRA 4KRWA 2ADBA 1CC7A 3D6MB 1QTNB 1A7GE 2MZQA 2Y0SD 3KJVA 3ZC4A 4IG0A 2KG0A 2I5JA 1NPRA 4DSFA 2O01C 1TL3B 2CPHA 3ZZ0A 4MIAA 2PFFB 3NAIA 3THTA 2PO4A 1HD1A 4PYDA 2DO4A 2V67A 1LOUA 2NLWA 1Y4ZB 1T9XA 3C6TA 2F8EX 2DITA 5DG8A 3OUYB 4FBTA 2AJ0A 2AYMA 3FSIA 1NLKL 4JI6F 4DPXA 2HKEA 2MZ1A 2QEXS 2HRUA 4ECUA 3FRZA 2CRLA 3BO2A 2VPXB 2M0GB 2MDAA 2W7OA 1RT1A 3DLJA 1JIHA 2J76E 4KQZA 1T9WA 9RUBA 1FNXH 4JI8J 3H5XA 2MSTA 2OMOA 3GR1A 2ALZA 2XLIA 2YQ3A 3NBPB 1WUUA 3PM9A 4PG6A 4P7TA 4OYOA 1BC6A 2JRSA 2K7KA 3M8YA 2B4UA 2H4WB 2MHEA 2YBVA 4F25A 2MQPA 2A6OA 1NB7A 2J9CA 1HFEL 2GMHA 2BYCA 4KHRA 4ES3A 2F4VF 4NWBA 2CPXA 3CJKB 3C6UA 4ZN1A 4RWXA 4URSA 1KOOA 2Z56B 3QWPA 4NCAA 1GH8A 4CLUA 1FXRA 2HVEA 1FXLA 5K8NA 3GFZA 5KFKA 1TUWA 2LQJA 5KFFA 1JQGA 3M30A 4DPUA 4ED1A 4OYXA 4CH0S 3TVYA 3BKTA 3MM9A 4ANCA 4CH1A 3GFXA 1G7CB 5KT3A 3GFHA 3FFIA 3RR8A 3KUHA 2DH9A 2HS4A 4LFCJ 1KONA 1QSLA 1LK7A 2RUGA 1XERA 2CVEA 1RTJA 1PCAA 1NSPA 1RQ0A 3ET6B 3G2XA 4TYBA 3G6YA 3K8VA 1VR6A 1N6QB 1SIZA 3QT7A 4FKXA 5AJ3F 1N32J 1IJFB 3MECB 4JP8A 5K14B 4GC7A 4EUVA 3I0SB 3CJQA 4LRBA 3BN4A 5KT7A 4U6PA 3UD5A 3K8WA 2GHWA 2MLZA 2WBMA 3DU6A 3OVAA 4OHWA 5KOXA 5F8GA 2DGVA 5HJYA 2GNKA 4RLEA 5L1IA 2HFVA 4UQGA 3EICA 1HR0J 4A8QA 3GJQB 3V4MA 4IDKA 2C2KB 4DDFA 3M6VA 2F5GA 4MIBA 3GILA 2O5DA 2H48B 4HHHA 3JS9A 2IM1A 1NZ8A 1N6QA 4P75A 2DEIA 2DY1A 3PYGA 4J5OA 3KOAA 2ZHBA 3BBBA 1S77D 2FGCA 4KGVB 1D9FA 4TLRA 2ZBQA 2EK1A 3R9LA 3RBDA 1B7FA 3MM9B 3PY8A 1JLQA 3I6PA 1KVKA 2BE2A 2BJEA 2DH8A 2OKQA 5KG2A 3Q23A 1NDCA 1FVSA 3M8QB 3MZIA 4IQMA 2N82B 5HBMA 2HYIB 4LQ9A 5ETNA 1NJYA 3IWXA 1NK5A 2RNEA 1NSKL 2MJNA 1TL5A 4KV8B 3J81Y 2VJVA 3LO3A 4RPFA 2VJUA 3I4HX 3IP0A 1HW9A 1H38A 1KS2A 3LTOA 2YQ0A 1U8WA 3T41A 2H51B 4QU7A 1JLGB 3JXOA 3CIZA 3R5AA 2XCAA 1S1UA 1XBWA 2HW3A 4HHUA 4FYDA 1S59A 1FDNA 3QFHA 5JJBA 3UCUP 1RAOA 2J0SD 3TUZC 1W26A 5ETVA 3MXHP 1JB0C 5HVFA 1HWIA 1TL4A 1YJTA 2ZDOA 1X4CA 3RR7A 2IJFA 2D3O1 1C1BB 2CUYA 3FRYA 1VDHA 4QW8A 3GP9A 2R7TA 3M2VB 1FE4A 3VGUA 1AFJA 2CJBA 2G0CA 4CO0A 2LP4A 2HMIB 4PG4A 1E6VA 4A48A 1WOPA 4ED6A 2A6MA 4RW7A 4TN2A 2AHOB 2HPUA 4M5HA 5L1LA 3FJ2A 1ZAVA 2XI3A 1SQGA 4M95A 2BVZA 4K2JA 1KQSR 2GVZA 2BKNA 5IC4B 1KRPA 5EWGA 4QR1A 1YHQS 1OY8A 5F3TA 1Q5VA 3FDSA 3PW2A 2OEJA 3TUJC 5DQHA 4JV2A 1X7VA 3GYGA 2B7BB 3EDQB 2NR0A 1SJ1A 1NNDA 2QFIA 1UJ4A 1HMVB 2CQ0A 1N5VA 2RT3A 3GJRB 5HSPA 5SZTA 1KQKA 4NI2B 2E5HA 2VPYB 4TKTA 1QE1A 2JHEA 1WDTA 1PG5B 2WSFC 1C1CA 3OVSA 2VFSA 2ZBCA 5IM0B 3MUVP 4O44B 4QIGA 5DGBA 4LF7J 1JJCB 2XGPA 2IM0A 1MG7A 2CDRB 1RA7A 1RE1B 1S49A 5CH7B 4O0IA 3W5ZA 4I6YA 4K0KJ 5B7WA 2UUBJ 4E0DA 3H2UB 5E5NA 4HEA9 1ZM4A 2R7RA 2XEXA 5KT2A 2RAQA 2R4FA 1IWAA 2DXFA 4AQYJ 3MPWA 2BW7A 2NYHA 4NX9A 3TA0A 5EWFA 2QLXA 4ZVPB 1DQ9A 1FRIA 2KKHA 2KXHA 3CD7A 4P9SA 4DX8H 5B0DA 3IGNA 3SFUA 5GMEA 4KFBB 4C3LA 5L1KA 2BMBA 4ECTA 4KHMA 3U27A 4ECYA 4NLTA 1X4FA 2NXJA 4MAKA 3SZ2A 1IBLF 4TY8B 4X62J 2PMZD 4B3TF 3ZTRA 1T3OA 1RLCL 1PKUA 2LQBA 3KHLA 2R9LA 1I3OB 3BR8A 2RHQB 2E5LF 1Q81T 3R1LA 4KH0B 4KTQA 1K1QA 4M1KA 2ILYA 3UVJA 2PGCA 5GADU 2HZVA 3HX9A 1JLFB 4ZIVA 2UU9J 1UAWA 3W64A 4OZ5A 4BHQA 1URNA 1J27A 2XNQA 2GQ2A 5KFYA 3UPFA 1GMWA 2CJYB 2B3TB 1R8CA 1RT2A 1RU1A 5IQ6A 3HHLD 4MK9A 2D9OA 5J2PB 1OIAA 4IH7A 4U7UK 4ZVUB 2FHKA 4KHPJ 3TP2A 3Q86A 5LL6d 1NUEA 1S4EA 2XZWA 3DI6A 3L09A 3UCGA 3VQSA 4N76A 1T8EA 2V8VA 3M9OB 2HQCA 1PIEA 3M6WA 4CO3A 1FKPB 2J6TA 1FRKA 1RAEB 2CQDA 2AJ2A 4WU3A 2DNHA 2NSCA 5E41A 2KT5A 4O3SA 2FVRA 4QIEA 2NUUG 5FLXU 3LPEA 3ZTSA 1KFDA 2QC3A 1F3FA 2B4PA 4WYWA 1IWGA 1EQMA 2RKIB 3I31A 4DR2F 4OHYA 2ZNZA 2DGWA 4WYLA 2RE1A 3DOLA 3ZNJ1 5HVHA 2IC3A 3T6JA 5I3UA 3KG0A 4QBUA 1T03A 1JLEB 4EGLA 1LFPA 2RB7A 1RAJA 4RNMA 1LWXA 2X1FA 1R8BA 2OHDA 3P4UB 1Y7PA 4OYMA 2AQ4A 2OIHA 2OH2A 3EM1A 3HKWA 1R0CB 2GIQA 1FD8A 3AA9A 3OFGA 2NXNA 4BBYA 2IBKA 3AXMA 1WC6A 3UDCA 1KOHA 3OTBA 2V9WA 1IBMJ 5A2QY 3LWMA 1UEVA 3C16B 4C8OA 1H2UX 1NSAA 1RHKB 2ZBPA 4XTTA 3S1TA 2WTFA 1YJ7A 2XSJB 4CLKA 3RB0A 1NK9A 4GKJJ 4JV5J 1ICEB 4C0BA 2XB2D 1F5CA 1U1NA 4M5DB 5E3PA 3X1LB 1DFDA 2Z0GA 4OZ0A 2KJWA 4CT8A 1SL1A 1WC5A 4KE5A 1RT4B 4A8OA 4J9OA 2COLA 2W2QP 4CTAB 3W63A 1WF0A 1BD6A 2AF6A 4RW9A 4X4UA 5DG9A 3CCWA 3M05A 2AEMA 3C8YA 3QIPA 2X3DA 3OTOF 4ECQA 3CJ5A 4ANDA 3JSYA 2H54B 2B6AA 2KTQA 2R8IA 2DNNA 4LF5J 5C24B 2OPQB 1XC9A 3CD6S 4HVZA 4Y0FA 2W9BA 3QATA 1NU4A 3SCIE 3IWLA 2Q43A 4ZP6A 5DJBA 1CJVB 4UOGA 4DV6J 5KFDA 1GMWD 4L75A 4ED3A 2FHOB 1V5IB 1Z2ZA 2AZ1A 3NP5A 4HL9A 1M5OC 3RRGA 2QTWA 2EG2A 3PCOB 5B0FA 4K4SA 1HWKA 2VC0A 4DQSA 3E2EA 3C16A 3HZEA 2JWNA 4R0EA 4DR6F 4M5MA 3MR6A 2YNFA 2M3DA 5D15A 2DXDA 5DLGA 2G2OA 4NLQA 1FJGF 3SMZA 5AE3A 1CS4A 1X8DA 3R5GA 1IXKA 4ZJOA 3FEZA 4YP3A 5I42A 4FF4A 4F2SA 2IYGA 2E7WA 2DPJA 3C6TB 4LJMA 1SBRA 2I9SA 2R2TA 5LOQA 2AJ4A 3MMBA 2HZCA 4U95A 1L5UA 1BY9A 1JLEA 2O3DA 2NXCA 3MCNA 2F4FA 4LF8J 4AL7A 1CJTA 2AEFA 1O6XA 2M52A 4DV2F 1KN6A 4OHVA 2R7UA 4M5NA 1VC5A 4N77A 1UCNA 4IG0B 4F8RA 4L3NA 2HHPA 1X4BA 1Q53A 1Y5LB 2JH3A 3NGTA 3D4JA 4C8NA 2JX2A 1DBDA 1SL2A 4TY9A 3M8QA 4X4TA 5KFBA 2OTJS 3NEKA 1MW7A 3NCPA 5FIIA 2RMLA 2WBRA 2HIYA 2YVSA 3FEYB 1NK4A 1N8RT 3RJMB 4A8YA 4IR9A 4GRSA 2B9WA 3D3BJ 4U8VA 4Q7AA 1DLOB 2OD6A 2XY7A 3MGJA 3RAQA 1ZPVA 4XPEA 4GVLA 2DR8A 2ZFHA 2PMWA 5LMNF 1ZH5A 1S1VB 3QAUA 3MCOA 3N6LA 4G1IA 4RL1A 1Q95G 1BGXT 2GQQA 3C46A 2AX0A 2FD2A 2FJAB 2DT9A 3M2UB 4I7FA 4FF1A 4J9RA 3QGHA 2R8HA 3T5KA 1S1WA 4ZLLA 1UZHA 3I0SA 1DRZA 2QRRA 5HP1B 3IRXA 4R5PB 3MECA 5K14A 2Q6CA 1EX8A 2W7AA 5KFOA 3GSDA 2CNKB 3KG4A 4ZPCA 1O0PA 3KLHA 4ELTA 3KMQA 2HVHA 2CQ3A 1UTAA 5I3PA 2Z2LA 5BR8J 4FNIA 1CJUA 1VJWA 2HAFA 2YKMA 4ED5A 2BJ9A 4AE5A 3PZPA 2LQ5A 4ZVRB 5T41A 5CHCB 3G6XA 2BR0A 1RADB 2OGUA 3EZOA 3POTB 2DCUB 4IH6A 4BS2A 2F9DA 3QWUA 1HNIA 5C42A 1M5KC 2GAHC 3T1AA 3KK1B 4QW9A 2G4BA 4LF4J 1VBYA 4ES1A 5A8KA 3NS6A 4OZ3A 2HQ3A 1I51B 3FEXB 3ENWA 1VQMS 1HL6A 3DRYA 3OL6A 2CG8A 3MAAA 4KSEB 5K8MA 4OFZA 5E3CA 3G9CA 5DQGA 3KLEB 4C7QA 4F67A 3OJUA 1YK9A 3J80U 3NAHA 4ZOSA 3G96A 2R3VA 2MKJA 5DDOC 2QL9B 4ECZA 2CYYA 2MSSA 4WZQA 2A2CA 1FJCA 3PV8A 3M32A 1O5JA 1ZA1B 5C2CA 2ZH3A 2VQFF 4CM0A 2YWKA 4PKDB 4NRTA 4PG8A 2LEAA 4D3GA 5T14A 3QZ8A 1YJRA 1HNWJ 5IV4A 5KFPA 4HT7A 1K1SA 4RBTA 3H5YA 3O3LA 1UFLA 4WP3A 4B9LA 3CDEA 1LWFB 4O4GA 3WBZA 4CI0B 2FYXA 2GMJA 4U7CA 5DZ6A 3NMAA 1V9OA 2VKZG 1YITS 3KK2A 1T05B 4PWDA 1LW2B 4QYZK 1SUQB 2XMVA 2UUCF 2IC3B 1S76D 2G1HA 1AZSB 2XSFA 2J0QD 2FTRA 1C4CA 3LA0A 7AT1B 1LKZA 1NDLA 4FVCA 1Y5IB 1NAQA 3BSCA 2NQPA 1NHKL 2E1RA 2BQUA 3W62A 2DNMA 4IUFA 2GW8A 1SUQA 1T02A 4YEAA 2ZDPA 2N3LA 2N7CA 3GV5B 4OI6A 1UFKA 1N88A 3AD7C 5H9FK 2YKOA 4U7UD 1RWXB 2OFHX 3QIDA 1M5VC 3HVRA 3ZZYA 2HFNA 2QMWA 5D4OA 1KKHA 1I94F 2ZHAA 1WKJA 4JYAF 4YDDB 1A6LA 2CZ9A 2MMYA 3VZHA 2DISA 1OO0B 3PTWA 4M5KA 1U25A 1VRTA 5U47A 5C25A 1VS3A 3LP0B 1X9MA 2CPIA 4RUCA 4ZVOB 3ZZPA 1WWHA 3W66A 2NPIA 4ZKAA 3CUNA 2OP5A 1S5ZA 1W25A 2LU1A 3JAMY 2W7PA 1FWLA 4USJC 1N4LA 3EE3A 3UR0A 2DRBA 4QCLA 2DD8S 2HRYA 2AJQA 3IBFB 4I6WA 4F4ZA 2R2SA 4RO0A 3C15B 3PEHA 3Q8YA 1P8GA 3DXBA 1E6YA 4WE1A 1XMOF 2L08A 3BYRA 3K5MA 2HEKA 2BJ3A 1G6BA 2APOA 5D3GA 2HVIA 3C14A 2PC6A 3D1HA 3K5OA 2IBOA 1HNIB 3JB9k 1EZZB 1S1XB 1X0PA 1WORA 2M88A 4NRUA 3G71S 2BDPA 2AD9A 4AQYF 3PIPQ 4O3PA 1OQ3A 4RR5A 1RWKB 2GJFA 1TKTB 3CJ0A 3PYFA 1VBZA 5DO2A 1NHUA 2EFVA 5GAHI 4URQU 2EC0A 3AXKA 3NOCA 5B0GA 4PR6A 1IKYB 1XWLA 1RZMA 4HKQA 2Q3PA 2XYPB 4L3KA 1IBLJ 2KN4A 2A10A 4CZCA 1LWCA 2DHHA 5KT6A 5HN0A 2GJIA 2AYGA 2HQFA 2MZTA 3G82A 3NGKA 3PRVA 1QJHA 5GVQA 1B70B 2Y8YA 2QLWA 3HJFA 3UR3C 5IC6B 2ZH6A 3ADAC 3GLJA 3VALA 1DQ8A 2HNZA 5E0OA 3WC0A 4CYUB 2VA2A 2A18A 3Q8QB 5IT9Y 3PX4A 3OFEA 4ITSA 1TK8A 1VQ5S 3JSRA 2XYGB 1SJ3P 4OZNA 2BXJA 3BJYA 4X4RA 1XNQF 2BA9A 2VBYA 4ZPDA 3ONQA 1VJQA 1XQIA 4NPOA 4MFBA 5KFEA 4DR5J 2VL1A 4O3RA 2ACYA 3QLHB 3QNWB 2HFSA 1VQ6S 4MKYA 3PW5A 4TU9A 2DIUA 3KJQB 3LALA 5EWEA 2AV5A 4Y2IA 1KHWA 2PT0A 2JOQA 1QVGR 4WTOB 4JI4F 3GE9A 4F02A 5F8JA 1SIWB 1FFSB 1RB0A 2HLTA 4EBCA 3PO5A 1XNRF 3SFGA 1M5PC 3HI9A 4PPZA 3ZZTA 1Q8IA 3ICLA 3N28A 4J9UE 1B0PA 1U4BA 3GPAA 4PPDA 3G8TA 4WFAQ 4B3RF 3QGGA 4IFYA 3NGDA 4BC7A 1PJ5A 1RAFB 1SV5A 3HSGA 4DPYA 3GV7B 2MZSA 3PFOA 5D4NA 5EDWA 2HBRB 1K0VA 1WG4A 3DM2B 2CNNB 4BCAA 1UFWA 3NCQA 2O66A 3BREA 1JK9B 3TJAA 4X62F 2OD4A 2X7IA 3QT5A 3WC2A 4B08A 2ZH9A 4NXNF 3GYNA 1CVJA 5F9NA 4A8KA 2YNGA 1RBAA 3HHEA 4TYAA 2O67A 1XMQF 2GS8A 2M5YA 4BWMA 3M8ZA 1CJVA 3DN9A 4RKUC 4ZPVR 2IAJA 4DBQA 3CVKA 3OTDA 2W9BB 3ZTPA 2HQDA 2WSCC 5A8KB 3U1MA 3KLFA 2OTLS 2BEFA 3KJVB 3TQ1A 1R89A 4NXMJ 2GIRA 4OYIA 2HK3A 1TKXA 1T9VA 1X4GA 2X51A 2KVQE 3WQPA 1WNEA 1Y0HA 2P6TA 1PYOB 1JLQB 1RT7A 2ZZTA 1GFWB 3BS9A 1FTCA 3CDAA 2MKYA 1IJEB 3EVMA 3B4MA 1S9GB 4DMZA 5LMUF 2KH9A 1GX5A 4OL8A 3IR5B 3R6GB 4M5DA 4YR2A 4XIUA 2KFNA 1T3NA 2VKRA 3WX4A 1DTQB 4ILMA 1S6OA 2XMAA 1EKSA 1F5BA 3HSJA 2YNIA 3MEGB 4F0KA 2IA6A 4X4PA 2EG1A 1RWUA 3MDFA 3SI8A 1PGZA 2E9TA 4ZP9A 1UPPA 2NCKL 2YXLA 4DS5A 1MWQA 4J9PA 2J6SA 1I5OB 4NA1A 4DR2J 1VQPS 3R27A 2C2RA 3D1OA 5B0AA 4HT5A 2C2ZB 1MLAA 5DGAA 1U24A 2HBYB 2Z30B 4C6AA 4X4QA 4PQUA 3QSIA 2XMUA 2ASYA 4FYYB 4ZPBA 1VK3A 3IS9B 3PRBA 1TK5A 2R7VA 3O1LA 1LQ9A 4HLBA 3ZTQA 3T5HA 2V4QA 3GIMA 3I5BA 3W9HA 3BQ2A 1F0XA 1H2VZ 2PA8D 3DGPA 4ZJQA 4H4MA 2ZM6F 3GZ7A 1KSPA 3ZXWA 5LSLA 3T19A 3QO9A 2U1AA 2RD5C 3Q24A 3A8EA 2KT3A 3G87A 3RZAA 2ASLA 3PJXA 1NDKA 1V5VA 2YNHA 4L74A 5CCMA 5LSRA 4IO9Q 3KDOA 3MCMA 3J81j 4F4XA 5KFJA 2VD3A 1QVFR 4P73A 4W4MA 1RWWB 3FGVA 4NZ7A 4Y00A 3JYTB 1FKPA 3H25A 4HI2A 2V8GA 4B9TA 4NLVA 3R5CA 2IVYA 1RT3A 3ELHA 4WFZA 1Y10A 4RZRA 1NXIA 2AGOA 4NMXA 2VPWB 4TU7A 3OSPA 3NCRA 1Y5NB 4LFAJ 4ZCIA 2VQEF 1N34F 2MKKA 1XR7A 5I42B 1U6ZA 1X4DA 4DN0A 4A8WA 4LRDA 1DZ5A 4GO7X 3Q2SC 4F04B 3GV8B 3R5DA 3TVKA 7FD1A 3CCJS 2CPFA 4CNYA 5ETSA 3OR2A 4PG7A 2JJ4D 1NDPA 3PEJA 2IDEA 3Q8SB 3F56A 2DHXA 3QRPA 4FKYA 4TY8A 1WHWA 2PSZA 4USIA 1C0TB 3K59A 4JI3F 1XTZA 2PDAA 1HWUA 4P6QA 1Q7LB 2CVIA 4R25A 4YUDA 3E51A 4DR6J 3MEEA 1JLCA 1T9TA 3CMQA 3ZO7A 3DOMB 2J8AA 2IMWP 5LT5A 1I6JA 1CPZA 2DHGA 2DJWA 2OSRA 2EI5A 4P2SA 3MUMP 3W65A 1T05A 4PWDB 3GJSB 4TNOA 4H4OB 3UE2A 1R0BG 2J7WA 3P96A 3PG9A 5KAKA 1LFWA 2B4OA 2FC8A 2V6AA 4OQJA 4TXSA 1F1BB 2GJ2A 2XHCA 3Q8VA 5A0YB 4OZLA 3Q0AA 2M9KA 1S97A 5J2MA 3FCVA 2OELA 4CYUA 1YRXA 1QD1A 4DL5A 1KC8T 3OPKA 1TFWA 2FC9A 1C1CB 3AOBA 1QM9A 4KAIA 4DU8A 3MMJA 1WJ9A 4IOAQ 3GQCA 2P6SA 5F0WA 3RB3A 1HMVA 3SCLE 4FS2A 3F41A 2QLBB 4IH5A 3AB2B 2V4RA 3VVTA 5LSOA 3H4DA 3R7BB 4DJBA 1FI4A 1HQEA 1WG1A 1FKAF 4DV3F 1U1MA 2NZ4A 3A13A 3TA2A 3F0NA 2B0GA 3HD2A 3I9ZA 4BWJA 1F5AA 5C42B 5I3UB 1R27B 2OAUA 2Y9HA 3MM6A 4OYBA 3SQGB 3ILJA 4V19J 1H74A 4WIQA 5JXSA 1S0MA 4OIXA 4G6VB 4CLPA 4DV4J 2FZGB 2JFKA 4CLYA 1D0EA 2QL5B 2C28A 1A9NB 1K9MT 2HHVA 2R7OA 1SC1B 3CJ3A 2YH1A 4CQ1A 2KL8A 4OV6A 4J9SA 1MWYA 4DWIA 3FBBA 2FZKB 1MSWD 3PX6A 5ITHA 4Q45A 3N9UC 4LFBF 4M5IA 2X3GA 4A46A 4O0NA 4IG3A 4DL2A 1M5SA 2C22A 4YFUA 1BE4A 2GGPA 3A12A 5HANA 4C98A 1X4EA 4F0MA 1WHYA 1KTVA 3HVAA 1P27B 4OV1A 5KFIA 1WELA 1WHXA 2KYXA 2XY5A 2FVPA 1MU2A 1SI9A 1TP7A 3IFEA 5HMYA 3UNYA 1SH2A 2BW2A 2XYHB 2W8KA 2E1PA 3DDNA 2HSEB 1RWNB 1RAHB 1S6QA 4LRCA 1FF2A 2CWKA 4USTA 4J9LA 1EETB 3KTQA 1FFGB 5GADI 1PBAA 2L9WA 4OX8A 2MZJA 1WKKA 3NL0A 2K3IA 2PI4A 5D4LA 2MQQA 3HT0A 1HWJA 3JTOA 4CO4A 1VRUB 4DZ6A 1RI7A 2Z2YB 3BBFA 1RWMB 4N7TA 3MMCA 5CZVA 5J1PA 3SQGA 1Q8BA 3D0IE 2L41A 1HBNA 3BH7B 3MEDA 5D0GA 5FLXY 1X31C 1T7PA 4QU6A 4OI2A 4DV1J 3P8BB 2EFPA 3A8IA 4AYBD 2ADCA 1JJ2R 4L6V3 2QA1A 4ZLJA 3IN5A 3CULA 5ETMA 5DDRC 2I0XA 4DR3J 4A8MP 2UUBF 2JSXA 3OXFA 3PW4A 4LF9J 2F9JA 2KM8B 1TVRA 5IOLA 4DHVA 1KWMA 4TLQA 4C0HA 3WZ0A 2HQGA 3W5YA 3K17A 1AYEA 3M1VA 2YNFB 1TMJA 4OX6A 2QT7A 3HCXA 5M2PA 1FCAA 2HFUA 1QE1B 1RJJA 3QSYB 4DLEA 4RBUA 3GONA 4USVA 4LF2A 4HACA 4B3MJ 4O23A 3KLEA 3H40A 3H98A 2H3EB 2G13A 2RRBA 4ID5A 3SSRA 5EHHA 5A2QU 1I94J 4LF6F 2D3ZA 4YN3B 1IM6A 3EGWB 3BDPA 2HHSA 4K8RA 4I69A 1M1KT 4KYZA 4C97A 1FKOA 3NRBA 3CWJA 2XMKA 3NXZA 4QR0A 4JI1J 3FBCA 3G8SA 4DR5F 4NCBA 4ED8A 1FK9B 4UW2A 1LNQA 3A3OB 3PXGa 1M1HA 3MM8A 4QWBA 3U1NA 3W2WA 4X66J 2AGQA 3MM8B 2NZCA 1FX4A 1Q79A 2YKPA 3PJWA 1C0UA 4DEZA 4ZCMA 1NK6A 5DDPC 4NLRA 4EBEA 1QUPA 4RW7B 3HHLB 1AXQA 4MYTA 3KLIB 2QA4S 1CJUB 2UUWA 1PJ7A 1SC4B 2CPEA 2YKNB 4M5GA 5HATA 1HARA 4U96A 5F8HA 2IJRA 2P9GA 3V6KA 3ZZUA 3KHHA 1KFSA 3IRXB 1GT8A 5HP1A 1RYRA 3VZIA 1YJWS 2YWFA 2YX7A 5K5MA 1UWBB 2DCLA 2ZKTA 4HHJA 3DM2A 1X0FA 1BLUA 1GXTA 5CYMA 2LU2A 4EZ6A 3D5MA 4NLGA 5HMXA 4OYZA 4X65J 5DS7A 2YKQA 2UP1A 7FDRA 3H4BA 1VYAA 2YWGA 3O5TB 2M2BA 1UVMA 1S79A 1WC1A 3PKMA 1T94A 1MN7A 3W1YC 2AGPA 3KYLA 2IVMA 3LH2S 4K4VA 2BV3A 4ZJLA 4P2FA 2ERRA 1T9UA 2B7CB 2JLFA 1S0OA 2FJXA 4WF9Q 4NLUA 1XMQJ 3I55S 3EDRB 3CTRA 4ZPTR 3M8WA 3FBFA 1L3UA 1CJKB 2YQ1A 2YWEA 4RW8B 3BO4A 2R42A 2WSEC 3BB5A 5KFTA 4B9MA 3RAXA 4I1TA 3IG1A 4BLGA 1DTTB 4J9QA 1U7LA 4ID8A 4JB8B 2GQCA 1HNVB 4ZVSB 1YJ9S 1IKWA 4A8SA 2RJZA 4YY3F 4GKJF 1VCTA 3AOCA 3MF5A 5IQQA 2V2VA 3GG0A 4CLZA 2V8DA 1JJHA 2FZCB 3N0VA 2C3YA 4DUYF 5CYJA 4QWEA 1FX2A 2VDIA 3LWLA 4WBFA 4ZA1A 5ETQA 3C66A 1U1KA 2BQ3A 1NJIT 1SVDA 2DRAA 2VG5A 3TZXA 4K4ZA 2BOPA 3T1HF 1H73A 3IS9A 2CQCA 4ZMMA 4IQXA 4JI6J 2KZMA 4C8LA 3M8PA 4EYHB 4JI4J 4MMOA 2G0IA 3MM5A 2WB4A 3CT9A 2K3KA 4RNFA 2IRYA 2KG1A 2D3OR 3HP6A 4XDDA 4NLXA 1SL0A 2DGXA 1NSQA 2QZ8A 1D9DA 2XNRA 1ITPA 1VQLS 3C2PA 1EP4A 3DLEB 5AE1A 1UVKA 1YKWA 2VODA 3AD8C 2MKHA 1GX6A 3ETMA 3P5BP 2MXYA 2V4JB 1F6TA 3BM7A 1DTQA 2DGSA 4QPTA 2RU3A 4F3OA 3DRXA 2HNYB 2DKOB 3D28A 3OFFA 1REVB 2GA7A 3N01A 3LANA 3RGIA 2DH7A 4M63A 3GWCA 3GIIA 3BGFA 5FDLA 2KVIA 3FSXA 3MFHA 5H9EK 2KFZA 3KG1A 1DAXA 3TX8A 3L4BC 1S9EB 4DXLA 3TUPA 3MR7A 2ZZMA 4RUHA 1FK9A 4OMFG 1F9EB 3W2WB 1UVLA 3RW6A 1EQ0A 3MTKA 3C6UB 4LFCF 1TL1A 3TAMB 3C3LA 5DQIA 1U0HB 3IGVA 4ZP7A 5MAOA 1XK8A 3DRPA 3EPIA 5A76A 2V5HG 3EJMA 3VAFA 1UVNA 4ID5B 3D54A 3DXSX 3O2IA 2FGOA 5KG3A 4WZMA 5F8NA 2FDNA 1RTHB 2XZDB 4AUKA 4HYKA 2J0XA 2VONA 4ZVQB 2MY8A 3QGPA 4X4SA 3BDEA 3N4WA 3IC1A 3MHYA 4HI1A 4MT1A 1Z1ZA 3BSNA 2F40A 4WFYA 3I32A 3J80Y 3TNVA 3J7A1 1ZS6A 4Y65A 4YB5A 2B8PA 2R8GA 2O1PA 1TVRB 1VLOA 4PUOB 2UXBF 3NMRA 1UL3A 1WHVA 1GXUA 3CJ4A 2ZH1A 2ROPA 3HHKA 3DCAA 1VRQC 2JC0A 3NS5A 3MPUB 4O3QA 2KI2A 3PKYA 1Q78A 5KFXA 3PO4A 1OYEA 4EFAC 4RW6B 2EWHA 2F7VA 1GNKA 5ETOA 2HHUA 2DO0A 5E3QA 2FJBB 2P5VA 2OI2A 1Z4UA 3NGSA 5EX3A 1C2PA 5T7LA 5GAGU 1FRLA 5LMNJ 2E29A 1U1OA 2RQMA 2CNOB 4OX9J 5JMNA 4LMZA 2B43A 1UJ6A 2W2PP 3K89A 3TW0A 3JQJA 4F3QA 4E98A 3MPVA 4TQRA 3H20A 4B9SA 1S12A 5B0EA 4YR0A 1S6QB 1H7WA 1OJ4A 2PE8A 3KDNA 4ICLA 4OZJA 1NRKA 4PYAA 1JNZB 2BUNA 4UT4A 1K44A 1YWXA 2G2ZA 4YQWA 3R2CJ 5BR8F 2ZOMA 3AD9C 3MTJA 4MH8A 4OI4A 4QIFA 1EB0A 2Z4PA 3OR2B 2UXCJ 3ZFVA 3OL9A 2CKWA 4DCPB 4DSKA 3M32B 2DGOA 1NEEA 2LDYA 4CWBA 2X1BA 2ZEJA 3UN5A 4DX6A 2XLKA 4XAKA 3M4XA 2QG9B 2YKAA 1LW0B 4WJBA 5F0UA 2H65B 3FVYA 5RUBA 4Y3CA 1WEYA 2FHJD 2HHHJ 3EMTA 4B3SF 4DV0J 3D3CJ 4CLLA 3B6BA 3VAHA 3HKZD 2AX1A 5B0CA 1S10A 3MOJB 2CADA 1N34J 3W8PA 4RUBA 4HH1A 4ZK7M 4DV3J 3NWGA 3JYTA 3NNHA 3KK1A 1HBUA 2VC1A 4CO1A 5J1EB 1WC4A 3GTYX 4I2PB 4DFPA 2XG8A 4PZVA 4WKYA 3V6HA 2QA4G 1NCLA 3W9JA 2E5JA 3OTEA 3QO9B 2WVCA 5H1SV 3Q2TC 1RTDB 2I8EA 4B9NA 1Q5YA 2WVFA 2GV1A 4MIWA 1SJRA 2ZC4A 2HNDA 1CLFA 4DL7A 1ZAXA 2FB0A 2DPIA 4KIAA 2WW4A 2B56A 3ZNUA 4DPTA 1SXLA 3MUTP 1FRXA 3IM8A 1RWVB 1SKUB 3SSQA 4R5PA 3CCUS 1EHWA 4NASA 4O4RA 3VCDA 4O44A 4DSLA 1W2BR 4OI3A 3QYYA 1LW0A 4NYOA 3NKYA 5BXIA 4J9VA 1X5SA 2BM1A 3B78A 3BQ0A 4NI2A 1S1VA 3SDEA 1ZTWA 2UVWA 1RAAB 2QJ3A 2B9XA 3FK4A 4LSNA 1HYSA 5JVHQ 1B4SA 4DN9A 4KO0B 1U47A 4ED4A 3CCMS 2DVIA 1RTJB 2XWYA 3H0PA 3D7SB 4DV7F 1Y9OA 1JXVA 2Y1LB 4OLOA 4ZPWR 2PIIA 5G4DA 1D3WA 1NKBA 5HMWA 4EYIB 1ELOA 1EIYB 1NO8A 2BM0A 3JSMB 1UZDA 3CCZA 4YMEA 1RK8A 2LA6A 2MLXA 3DYAB 1VQ7S 2DNKA 4LR7A 2HIQA 4LIRA 3DLBA 3UWTA 1ZM2A 5G0RA 4PCQA 3DOMA 3E3XA 4CM2A 3E01A 4QPXA 3KFWX 3NS7B 3R3TA 2P2CB 5T7LB 2NREA 1NM2A 4Y6IA 3CJSA 5HQ8A 1S99A 3UDLA 3EWGA 4FBUA 1H2TZ 2DY9A 2FJVA 2YNGB 4CH7A 4DV5J 2FVSA 1WC3A 4F0HA 1PC4A 1H7XA 1X4HA 4O4GB 3MI7X 4YS2A 3EPGA 4GKKF 1UW4A 4BDPA 2B9YA 2UU9F 3OFHA 2W1BA 4I2QA 2IMOA 3TANA 5KG5A 2ZD1B 3GJTB 4Y2CA 1HW8A 3V81B 1N5QA 2CQGA 5MLCV 2QL7B 1UMJA 3CC4S 1FHTA 1HBMB 1SV5B 2LVWA 4ETZA 3OLAA 1FVQA 2AJFE 1T0TV 2HGMA 2V68A 3D6HB 3MOZA 1RTIA 4IFYB 4M8LA 4WFXA 5D0EA 4KHPF 2YTCA 3T1YF 2NUHA 3DKDA 3BGOP 1OMSA 3MR3A 4Y34A 3MAAB 2VA3A 1RKIA 2EFGA 4B3MF 4LFBJ 1HPZB 3UFCX 3MR5A 1KHVA 2V63A 3TAQA 3HHLA 4UOCA 4ZITA 3J7YI 2XI2A 4ZIWA 1TL1B 3C19A 2OPQA 2YX4A 3DGVA 3TAMA 5I3QA 5LJ5Y 1TUGB 2EKNA 5G0RB 2B6AB 2D3UA 1OS5A 1C0UB 2XM3A 4AL6A 2ATLA 1S6PB 1R0AB 2AYEA 2MGZB 1Q86T 4JV1A 3I87A 5CZXA 1BXNA 3G6ES 2VBZA 3FZ2A 3OQ2A 2JEGA 3QFWA 2XLJA 1EARA 5KT4A 2EPIA 4H4MB 1FEHA 5SUHA 2HWTA 3IXQA 4J91A 1REVA 4NOHA 4U67Q 3J7YU 1JXEA 5F8IA 5K8PA 3IO1A 1YI2S 2XMMA 3IBWA 3AQOA 1XNQJ 1B0TA 2OPPA 2KU7A 2VBWA 2Z58B 3LP1A 4HACB 2SXLA 3SBMA 4CO2A 5GAEU 3KLHB 1YDLA 4DL6A 3PJ9A 2LLZA 2CZ4A 4RUAA 1UETA 4M94A 4WFNQ 1EKRA 2HVDA 3PNIA 1M5HA 1IBMF 3AQPA 4C11A 3MCSA 2Z8QA 3OJSA 2QMXA 2RDDA 1TV6A 2KB2A 4ZVEA 1WI6A 3N5BA 1JLAB 4IYQA 4L72B 4P72A 4UOHA 4EO8A 3NG8A 4JI7J 4X65F 2QO3A 3LP1B 4ED7A 5IWAJ 1VIOA 2K1RA 4DR3F 2BJ1A 1IKYA 5GAEI 1Q1KA 1T03B 3T9ZA 2HNDB 4K4WA 1R3NA 4EMDA 4U9RA 2V69A 3OXLA 4J37A 5HROA 2QFJA 3TARA 1R31A 1V6HA 2FIUA 4F4AA 4NEYA 3VF0B 3D68A 4C3MA 2B9EA 3ISNC 5A6WA 2HGLA 3RBXA 4EEYA 2Y1JA 2AU0A 1F9HA 2H1YA 2UVRA 1B0VA 3HVWA 2XBPA 3R6LB 1B7YB 4URGA 2W2MP 2IYIA 2CXEA 2UVVA 3QJJA 1N36F 2LYVA 4YY3J 2IAJB 2ROGA 3LUYA 3HHNB 3TI0A 2AW0A 3K58A 2H4YB 2W9CA 5BYSA 1T11A 2DXEA 1RT2B 1RAIB 2ZE2A 4TQSA 3AAWB 5HAOA 1IBKJ 2UUAJ 4ERDA 2HS0A 4J7CA 3N6MA 1TKDA 3IR6B 3JTNA 5CYMB 2HURA 2MEWA 5THWA 2VBXA 1AFIA 2UV8A 3UVJB 4ZHRA 3J7Z5 4IFVA 8ATCB 2E1CA 2C2NA 4C4WA 4CO5A 1QAXA 2XY6A 3Q89A 2RVJA 2L48A 1KBRA 1RP5A 4ZLPA 5KFMA 1NMEB 2VFRA 3M9NB 1OY6A 1FERA 1RT5B 4OJ1A 2XS5A 1ZAWA 3L3CA 2DGUA 4Z2XA 1Q8LA 1V3RA 4AXIA 1HQUA 3QBCA 1LXNA 2W24A 2WW8A 5FJ4A 5J2NB 4CLTA 4DR1J 1YGYA 2JEIA 1S4FA 2EBEA 4PAAA 3GCWP 5E2QA 3TZYA 3UQSA 2FY1A 1CSJA 3BV8A 4HR2A 2NYIA 4KGMA 3QIPB 5IZHA 3KLGA 4LREA 3KNGA 3TVZA 1U2FA 3UW1A 1AUDA 1LW2A 4X4VA 1FRHA 3PIOQ 4LQ3A 3SXLA 5DM7Q 1S0VA 2CWXA 1VQYA 4RU9A 4DUZJ 1U1LA 3MFIA 4NCGA 3TZZA 4PXEA 3G8QA 2VFVA 1VQ4S 2CQHA 4Z7YA 4USHA 4ZVHA 4Z37A 4XO0A 5IT4A 3DRRB 2QX0A 4NL5A 5ETRA 3PYDA 4X4OA 2ZM6J 1GEHA 1HNXF 1RCOB 1HYSB 3CDBA 5IV3A 1ULRA 4DQPA 3N6NA 5HI7A 4F36A 4QWAA 4DSJA 1UEUA 4C8KA 3A3PB 2UV8G 4DS4A 2W2OP 3M6UA 4JI5J 3H7HB 1U49A 2CQIA 2E66A 4RBVA 2VICA 2FJEB 1RLDA 3RU0A 1Q0NA 1UJ5A 3VTIA 2IPOB 4KY3A 2POKA 3DRPB 4KT0C 2RQKA 4P7VA 1ZZFA 3DOKB 2W8LA 4JOUA 2C2DA 1FWPA 3B54A 5IXUA 2UXBJ 1IUJA 3EGVA 4Q0BB 2B8QA 5DLFA 3MMAB 4L73A 2HHXA 1VMBA 1HD0A 4ZLNA 2ZZNA 2OJ3A 3ZZOA 3AODA 4K59A 1S57A 2GAGC 2VH7A 3RTVA 3BGRA 2KHCA 4CDIA 3POTA 2ZH2A 1FTRA 1SC3B 1TAUA 3KWMA 3WHIA 1HQUB 4OYAA 2KDOA 3HFKA 3D2WA 2C2OB 2HAIA 2VDHA 3C14B 1HBUB 4USWA 1RWPB 5HJXA 5J1EA 3OSNA 4K4YA 5D3GB 2DRDA 1BQXA 4J9NA 2DYAA 5EUHA 4WE1B 3M2VA 3R1HA 3R2DJ 5HLFB 4K4UA 2R2UA 2CQBA 3M2RA 1YBUA 3DI6B 4I0WA 3DLHA 3QRQA 2ASDA 2ILZA 2EBGA 4KGKA 4IFVB 1XR6A 2OUGA 2GVDA 3DLEA 3QJLA 2WOMB 3AJ2A 3H59A 2ZH5A 3M2UA 1F60B 5J2PA 1UA0A 3RW7A 4UY85 1AW0A 5KFVA 3HT3A 2CIMA 2YX1A 5ETLA 2JNJA 1NH7A 2VASA 1FEEA 2H5JB 2XC9A 1DURA 3HSZA 2VQFJ 2OPRA 2GX8A 2LQ9A 4CRJA 5IT0A 1Q4RA 3L7PA 3QGIA 2GVDB 2G1DA 1DLOA 2G0JA 1BQNA 1Y3JA 2E7VA 3FMWA 1UEKA 2ACMA 4X64F 4NMLA 1RT3B 2MY7A 1WF1A 3HDSA 3LAMA 3GIJA 4DV0F 4KV8A 2HHHF 2YH0A 1VBXA 2DNPA 1YZ7A 4MKVA 1IQZA 1LXJA 2EKYA 2VG7A 3TJ9A 5D4PA 4USMA 3MD3A 3KHGA 2PA3A 1FD2A 4JV0A 5DDQC 1WTBA 4RX6A 1FT8A 2N7YA 1NK8A 2DR9A 1MROB 2QLJB 2QMUB 3P5TL 1O8BA 3W7BA 5ADZA 5L9NA 2V2KA 1U1PA 3CJRA 2RDIA 2XGQA 3HFZB 4MJKA 4DR7F 5KFGA 3V2UC 1KEKA 1PYSB 1PAUB 2BJ7A 2EFOA 2HGNA 5GMKa 4B9VA 2L3MA 3OD2A 2XZTB 2CAJA 2DEJA 4ES2A 3KK2B 5DG7A 1AB8A 3NGRA 4RW6A 4YB6A 5L38A 2FLLA 2MB0B 4N56A 1NJXA 4E8UA 4WIIA 2M4MA 3IBCB 2WK4A 5AXNA 4ELUA 1YRTA 3CO0P 4PUOA 3IAM9 3ISND 2LXIA 2NXEA 4ECRA 1XEZA 4IKAA 5KT5A 3DDIA 1X5TA 1KQGB 1WF2A 4MKBA 1AT1B 1SCJB 3GYXB 3TRGA 1IKXB 2RH3A 4OHXA 3VR1A 5CYQA 4ZDNA 2OFGX 4E2FB 2HRTA 2CPZA 5KFHA 1YJNS 2GO8A 1RTHA 3FMBA 2WAQD 3K57A 2LQ8A 3CCVS 2X1AA 2Y1RI 2ZUGA 3EXYA 1D1UA 3BGUA 5KFCA 3CE8A 5D78A 3V5RA 3M8SA 2Q66A 4OJ3A 3UD4P 1NJZA 3LPYA 3MM7A 4UUWA 5BYQA 1U02A 2VUGA 3D1QA 5A8RA 2ZJRQ 3H5UA 4TU8A 3TEGA 3BQ1A 4GVBA 2N4CA 1DJ0A 4K5RA 4NLSA 5J1NA 1LWEA 1T9YA 3CF5Q 1JX4A 5CXTA 3B8HA 1QSYA 3CDWA 1LWEB 3KLGB 5KTQA 3FC9A 2IM3A 3ZZZA 3L7UA 4B3SJ 4OJHA 3CJKA 4PWUA 4CP5A 1JLCB 1TU0B 4A47A 4CIOA 3MM7B 3AHPA 1E6VB 1HPZA 2VFUA 2YKMB 4DQIA 2HNYA 1PAEX 2ZC3A 1C0TA 4NA3A 2F8HA 2KRBA 5KG1A 1WEZA 5KG0A 1Y11A 3M9MB 4DV5F 3CJ8A 4LSZB 5GAHU 3BEGB 2Q6BA 3AH6A 1RTZA 3DHWC 5CYQB 1HBMA 2LECA 3LF0A 2P9EA 1RT1B 4ALZA 1WG5A 5CAAA 2BX6A 1YBTA 2E1MC 3OR1B 4QQBA 4Q5VA 2R2RA 4YR3A 3ENQA 1IBCB 3CEDA 4FPRA 5E3AA 3UI3A 1UVJA 4IRDA 1CC8A 2B5JB 3DRSB 3KMSA 5ETTA 3R5BA 1R43A 2UXDJ 2JZ5A 4RNHA 4EU0A 1F3VA 1X4AA 3PX0A 3CGIA 2E1AA 3U02A 1YJUA 4QYZJ 2NXUA 2W4DA 4NYPA 3NNCA 2C3UA 1HLWA 4F3MA 2I5JB 3BGLA 4DF4A 4WK1A 1RHMB 2DNLA 1TKZA 5HO4A 1GAOA 4USKA 2MQLA 1IKWB 4O3OA 1S0NA 3B4DA 1Q16B 1DTTA 2B51A 2HBZB 3ITHA 2KYZA 3TUIC 3P3DA 3ITHB 4NLPA 3HVTB 1ZM3A 2R7WA 1X60A 4J90A 1EETA 2DTJA 2C3OA 2V0NA 2DR6A 2PEHA 5H9FJ 2CZVC 3D6FB 1XNRJ 1NBEB 4LSLB 4B3OB 1RGVA 2DGTA 3DGPB 4NA2A 5KFSA 4NLOA 3RB4A 3HD1A 1SKSA 4DX5A 1TFYA 4N8NA 1UW9A 2I38A 3KUEA 1FWKA 3QRRA 2J8SA 1SQFA 4OZ1A 3THVA 5CD4H 2HWHA 1RXOB 3MAHA 4KPCA 4FPIA 4DG1B 4C11B 1HI0P 4V19X 2ZVIA 2KM8C 2HFZA 1HQ2A 4PWWA 1GMUA 4RNOA 2ZBRA 3W5XA 3K5LA 2CPYA 4NLYA 2V9KA 3SSSA 4JI7F 1N33F 1PJ6A 2ZITA 3A8KA 3HZGA 3JTPA 1Q7YT 4K0KF 1DHMA 1F9FA 5BJRA 4N8OA 2R7SA 2D7SA 2HHTA 3FFIB 4NXMF 2JDJA 2GO9A 2RUSA 3FUYA 2YPZA 4DX7A 2K06A 4CLFA 2FLNA 2YPYA 5K9FA 3BGRB 2JEJA 3DLLQ 4NZ6A 1G1XA 2IJNA 2HHWA 1TKXB 2R7XA 3P49B 2DBBA 4I4BA 4GVBB 4KKOA 3BF4A 4CTAA 5K20B 4TVAB 2BBEA 1FO1A 2ABYA 4DUTA 4JUZA 1VC0A 3KLVA 1N54B 4KBIA 2CA9A 4G65A 5CABA 1NK7A 4DR4F 2OPSA 1F2HA 2VG6A 3SCJE 1N36J 1VOMA 1P9QC 1RWOB 2AEJA 2GCFA 1APSA 2XMJA 4LBIA 2LMIA 1NKEA 1K47A 2M70A 3NBPA 1RTIB 2CJXB 2F3JA 4JI0J 3TQEA 1RYSA 1IKXA 4WPAA 4Y2KA 5LJ3Y 4WXWA 1S7HA 3HMJG 2ZD1A 3CW2C 4FZVA 4UZBA 4UUXA 1RBOB 5DZ7A 1NJWA 3IA0A 4FYXB 2DR5A 4ECWA 4NCGB 2H9ZA 4M5LA 1BUXA 2V8HA 2WB1D 3CCQS 4NZ0A 4ZVFA 2V50A 1SJQA 4ICLB 2V2QA 4LBPA 2MQMA 4KB7A 1CQNA 5E7OB 3R7SB 3M6XA 5B0BA 3G6VA 1BHNA 2QYGA 4F2RA 2VOPA 3H5SA 2E9RX 1BWVA 1TTHB 1OSCA 4Q2LA 4PEOA 5ETKA 3RAMA 1DARA 3MMCB 3OXGA 2ZKUA 4C0OC 4C48A 2RKIA 1VQOS 1JJ4A 1VRUA 1LEOA 1OSDA 1MROA 2QE5A 1NH8A 3MEEB 1FFWB 5IWAF 3R97A 2WVDA 3H90A 1TL7A 3SQOP 1RT5A 1SQEA 3NOGA 1YVFA 4XDCA 5HQLA 1S9FA 1JLBA 1R8HA 5F8LA 2R7QA 2NPFA 4A4JA 4DSEA 5J2QB 4FN5A 1MU2B 3SEOA 2VQEJ 1X9WA 3ENVA 2FY8A 2OEKA 3D67A 4KO0A 4PQAA 1Q82T 1CG2A 2IDLA 3O6QA 1M90T 3CJ2A 4ED0A 4ER8A 3GMGA 2WVBA 1HNXJ 2RRAA 2H5EA 2XS2A 1S1UB 4DQQA 1GTEA 1YG0A 5F41A 4WFBQ 3B82A 5C7PA 1VQ9S 2VFTA 3P45B 3MPDA 3VGSA 4EK2A 4UF4A 2PMHA 2OPSB 2VG6B 3KUGA 3M2RB 2GHVC 3HF5A 5D8HB 2MKSA 1SH0A 4DSIA 1H0HB
chains in the Genus database with same CATH topology
1ZOTA 2FVQA 4KKOB 4I64A 4ECVA 4WTYA 1R8AA 4CNZA 2ROEA 1XN9A 2XHWA 5HROB 2OO4A 3MM6B 5M2RA 1ZM9A 1IN0A 4FXDA 4I2PA 2NSBA 2AYBA 1O51A 1JWWA 3CO9A 3BN7A 3TO8A 1YQHA 4CCHA 1N52B 5B08A 3CCSS 1IKVA 1PSDA 1U45A 5HL7Q 2E7XA 2K7JA 1VQMS 3VAJA 1NZAA 2DIVA 4MK7A 3KK3A 2W25A 3EX7B 4PQUB 1TUVA 2CFXA 1J5OB 5CA5A 1TQLA 2J6UA 1YIJS 3M8PB 3CD0A 3VAMA 2LEPA 4QOTA 1VRTB 4FF3A 4K50A 2VB6A 3E8OA 3ZZRA 1TK0A 1RISA 2RSQA 1JLBB 2DK2A 2EW9A 2U2FA 5I4MA 1RT7B 3M30B 2UXCF 4QJVA 3S01A 1MWZA 1URRA 3DC2A 4XK8C 3EZ5A 1N48A 3T5JA 5GAGI 4Q43A 5D6GA 2CG4A 3PHEA 1Y3KA 2R8JA 5KFQA 1FRMA 2UUTA 3PW7A 1HR0F 2KXNB 1HHTP 1UA1A 4IO1A 3SYZA 1U1QA 2HMIA 1TAQA 4KPYA 3I56S 4G1QA 2RRNA 2Q1LA 1D8ZA 4F50A 1VQKS 1QAYA 3GFYA 2C3MA 2L9DA 1X9SA 1X5OA 2HLUA 3AB4B 2XO7A 2ZH8A 3V4IB 4ELVA 2RF2A 4F4KA 3V4IA 5KFNA 4OI0A 4FNHA 4QWCA 3JSBA 2KT2A 3A1YG 1HBOA 3CMAS 1IM4A 3QMQA 3W3SA 4AL5A 2YY3A 2G9OA 1VLYA 1Z2LA 2FHMA 2YKNA 3T5LA 4N5SA 4QWDA 2MHNA 3IRWP 1GXLA 3DLGB 4PXCA 2BZ2A 2QA2A 3UD3P 2IRXA 1OPIA 2JFDA 3LAKA 5D77A 3CDUA 4ECSA 2ZJQQ 1FA0A 1VQNS 4ZCKA 2IFXA 4PG5A 3MD1A 5K8OA 5KFRA 1R8PA 2BACA 4GO5X 5A8RB 5FDLB 1HA1A 3N5FA 4DV1F 4I56A 2HVZA 2UVUA 3CCTA 4MKAA 3S6EA 1ZZNA 1P6TA 1K0TA 4LVNP 4A8FA 2AP6A 2XWXA 4I6AA 4LF9F 5IFMA 4LSNB 1XR5A 4RNNA 1QLNA 3Q8PB 3MWBA 1VQSA 4MYUA 4PXDA 3CCLS 1S1WB 1YSJA 1XMBA 3UCZP 1VFJA 1TZ0A 1JKHA 2GMLA 2JVOA 2CJQA 3GB0A 4ATNA 3CCRS 4IOCQ 1JKHB 5AXLA 3V6DA 4WU2A 2J9EA 3FNNA 2CJKA 3D0HE 3MEKA 5EX0A 3KK3B 1NK0A 1LWCB 4UY8T 5KG7A 2J9DE 2OSQA 4X84A 1DQAA 1UVIA 2WRMA 4QIWD 4I68A 2XMTA 5BYRA 1ZBTA 3U1LA 3EGZA 3MEDB 2EFNA 4F4YA 3DOLB 3TA1A 4FXVA 3TYTA 2WONB 4X66F 1IQTA 5L9XA 4OLPA 1GTHA 4D3HA 3OHBA 4DLGA 4QR2A 1V3ZA 2JLGA 2VOOA 5KG6A 3BO3A 3EUNA 2VG7B 1KLMB 1M0SA 2KHDA 2QYCA 2XMWA 3M8RA 1BQNB 1F2GA 3S7RA 5L1JA 2DB1A 4DF8A 2BABA 1U26A 3PDNA 1HNWF 2DHSA 3KNAA 2ZH4A 4CT9A 3LP0A 4IOBA 3OR1A 5KFAA 2LKZA 3CB4A 3ETOA 1C4AA 1FDAA 1H3DA 2CQ4A 3TR5A 4EO6A 2CQPA 4I2QB 5KFWA 1KTQA 1KVIA 1U6FA 1SH3A 5HLFA 3FCHA 2FJDB 1VI7A 3LQVA 3U7JA 4IR1A 2GFFA 3KLIA 1TL3A 4H4KA 1OWXA 2D74B 3E01B 6FDRA 1YBAA 1QAIA 2CQ1A 2IM2A 2AJ1A 2UXDF 4YDXA 5A8WB 1FDDA 3JSMA 4IRCA 4RW9B 4FS1A 4ERDA 1WTFA 3LGMA 3I5AA 2DNZA 2A3JA 3D0GE 5DETA 5KOWA 2JL9A 1PO6A 4Q0BA 3MURP 1NHVA 3DMJB 4IDKB 2DNOA 2DNGA 3LGNA 3OL8A 1ZYQA 5KFUA 5E3RA 4DUZF 1L3VA 5L8RC 2CDQA 3OBIA 2QSFA 4C8YA 1CQMA 3H2LA 3SV3A 1H98A 5IM0A 1N5YA 3DNCA 6FD1A 3Q8RB 3OL7A 1BWEA 3SDEB 5LXYA 1WEXA 4NLDA 2HNZB 4LT6A 4I67A 1BQMB 2I2YA 1I1GA 1QAJA 3M1VB 5LXRA 2W9AA 1N5YB 2XS7A 1FE0A 1KR4A 5JVGQ 2RDJA 3BZQA 4C8MA 5A0YA 2RS2A 3I96A 3LOUA 3AJ1A 3ISZA 2KJVA 3CIMA 3DMJA 2I1RA 2MKCA 3LW5C 2BANA 1UKUA 2IA0A 4HTJA 4A8OA 2KO1A 5DM6Q 3MAQA 1JMTA 3DLKB 2QSWA 3X3UA 5AE2A 1KLNA 1TKTA 4YB7A 3KHRA 2UUAF 3QPIA 4G3IA 3HPOA 2Y1IA 3I0RB 3OW2R 1OQ6A 4WK3A 4JI8F 3BSOA 2RIJA 2ZJPQ 1G2EA 3LP2A 2XCPA 1ZTTA 2LXUA 2DNQA 4F26A 1K73T 4J9MA 3PRDA 1ZETA 1N0UA 4RWWA 4DOZA 1U2RA 1KD1T 3OVBA 3ULHA 3I9V9 2ZBIA 4FXWA 3OLBA 3T3FA 2YWHA 2VPZB 3CD5A 2WCXA 3UNGC 2OPRB 3HO1A 4DR1F 4W90B 1IR0A 3MM5B 3L95X 4N41A 3PVXA 3EZUA 3HXMA 1JLFA 1J2VA 2JVRA 4IG3B 2MPUA 1RA6A 2WOMA 4DV6F 3CC7S 1LK5A 4ZPAA 1VK8A 5J2QA 5M2UA 1S6UA 1YRUA 4FP9A 4LSLA 3K0JA 4B3OA 1KLMA 3CMES 4C9DA 1HNVA 5HBMB 1S48A 3AA8A 3N79A 5B09A 2J0WA 4DFMA 4OX9F 1U8SA 2FUG9 2YNHB 4WXOA 2R8KA 1TR0A 2LA4A 3AY0A 4A8XA 1MMLA 1GQEA 1Y00A 4X2BA 5C5JA 1UP1A 5AXKA 4OJGA 2A1BA 1P1LA 3MMAA 2PI5A 1MNEA 2BANB 2K1RB 4B9UA 1FNMA 1HQEB 3DOKA 3HK2A 4HH0A 3GIKA 4EZ9A 4C2MA 4KC5A 1U09A 5HMZA 5KG4A 3VWSA 1SKWA 2J7KA 3Q22A 1WACA 1T95A 4DL3A 1NKCA 1H6KX 3CC2S 2OPPB 5J2MB 4R8UB 3T6BA 1FJ7A 3DDKA 2CPDA 2EVZA 2V94A 4ETXA 1MMNA 5CCLA 4ECXA 3F44A 1RT6A 2W4PA 4B02A 3OHAA 3T9NA 5C24A 3IWNC 2FHJA 3CXCR 2FLPA 2C42A 2JEFA 2J9DA 2ZHOA 2RILA 4MK8A 2J5AA 5A8WA 1S6PA 1R0AA 1U1RA 2WHOA 4H54A 4ZVGA 2DGQA 4J9KA 5J2NA 3KLFB 5A6PA 1D8YA 3DLGA 1X5PA 1RT6B 3TOQA 2KXFA 2LEBA 5F3ZA 1S1TB 4K4XA 4YB1P 1KQFB 2AWZA 1N32F 1VGYA 4JI2F 2EK6A 2RU9A 2K8GA 3F73A 1G3OA 2CPJA 1K8AT 3FZBA 2X1GA 4LFAF 2OMLA 3WDOA 4ZHRB 3PFEA 3EXCX 1SC6A 2RF2B 4QYRA 5AXMA 3US5A 4DG1A 4HDHA 2DNRA 1HNZF 4LF4F 1U6BA 2Z2MA 2ZE2B 4DL4A 2FPHX 1S72S 3OUYA 3EGNA 3RRHA 4ZCLA 2E5GA 3BSAA 2C3PA 3DU5A 3VQTA 2P9CA 1YTYA 2DR7A 3HVTA 4RW4A 3W2VB 3IAS9 1N56A 1FRJA 4LIWA 4RW4B 3W2VA 2C2EA 4HDGA 4ILLA 3HHLC 3QJPA 4AFFA 4RW8A 3G86A 1TKZB 4EEYA 5F9LA 4ZP8A 3MR2A 4IRKA 2ZVSA 2M8HA 4Y2AA 4YHHF 3CCES 4FF2A 3PW0A 1N0VC 3CSKA 3IR7B 4EBDA 3MMBB 1QY7A 4K2XA 2M7SA 3PR4A 4NYZA 3GR0A 1HI8A 2B5JA 3DRSA 1TV6B 2GGPB 1WD6A 4Q8FA 1L3SA 3V6DB 4W92B 2LXFA 1J5OA 1UWBA 4MTPA 1N5TA 5FD1A 2CJAA 1J5EF 1FNOA 4UQTA 2ASJA 4R0JA 1KNZA 2YNIB 3EYZA 1R7IA 3LP2B 1SJ4P 1S1TA 2IHR1 2DHAA 1P1TA 1PC5A 3OTCA 2MKIA