1RKBA

The structure of adrenal gland protein ad-004
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
LMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human adenylate kinase 6: An adenylate kinase localized to the cell nucleus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein AD-004
total genus 64
structure length 173
sequence length 173
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rkbA00
1CR1A 1N25A 4BZPA 1OFIA 3GLFB 2Z4SA 4KSBA 5EP1A 2O8CA 2ZE7A 3H4MA 4MKIA 2DWQA 3MJHA 5LD2C 4TQUS 1UADA 1P2SA 2OCPA 1NLYA 2PX0A 2CK3A 5GJWC 5F9FA 2G1KA 1Q1BA 5B58C 1XNJA 1XEWY 5K8UA 2RAPA 3X1DA 1DPFA 2CNWA 1F48A 1IAQA 1GZSA 4DLUA 1Z6AA 2AXPA 3UG7A 2JJ1D 4R71A 4FCWA 3QIAA 1SVSA 4LBYA 2GWHA 1JXMA 2B7BA 4D26A 3TLXA 1Z63A 5D3MB 1GL9B 3PXGA 5KSZA 1WF3A 3ECCA 3B7GA 4L5BA 3KJGA 1W4RA 3O8BA 4RFVA 4QKQA 3CRW1 2Q3FA 1E9RA 1YRAA 3IEUA 4IKEA 4B3GA 2G0NA 4LV6A 2WSMA 3LAWA 1J90A 1JPNA 2EFEB 3AKDA 4PC6A 1KI8A 3ZVNA 1P2UA 1Y3AA 2FFAA 3WYGA 2IUSA 3RRMA 4Q7JB 4Q9HA 2H16A 4JLNA 4NKRA 5K8LA 4LOAA 3SHFA 1TNDA 1KSGA 1XD8A 4KYUA 5BQ5A 3TH5A 1ZU5A 1KI7A 2GF0A 3KTAA 2AFIE 3LQQA 1JNYA 2ZM5A 3NHAA 4QFMA 5EE9A 4LYHA 3W5JA 2BBWA 5C1BA 1ZBDA 4JLMA 2CEAA 1EWRA 1GAJA 5JMTA 3QKRA 5KSOA 1II9A 2ATXA 3BH6A 2ZRKA 3QKUA 5JRJA 1XZQA 4N1AA 1SVIA 1GIAA 1U8AA 2NPFA 4HI0E 4IDNA 3WHLA 4DLTA 4IVPA 4D0LB 4OI4A 4C2TA 4IOMA 1H8EA 2V9PA 1CS4C 4URUR 3TW8B 3AGPA 4DLRA 1XPUA 2D62A 2JIZD 2A30A 3WNDA 3RS7A 4LHWA 3B1YA 1IJFA 1US8B 4TZ0A 2PMDA 3FYHA 4CDGA 4L9SA 4HZUA 5ANRB 3DMDA 3OIWA 1XBTA 4M9SA 3NVAA 1PVOA 3I92A 4RD2A 3JVVA 4FIDA 4P31A 5DO9A 3OE7A 2W2TA 4QHTA 4CVNA 3QKSA 2D4HA 3BIFA 4P4UA 4PPFA 4M1YA 2WV9A 1IOZA 1W0KA 1WQ1R 1KO8A 1VG8A 2O0KA 4GP7A 3SQWA 2FNAA 1ZM4A 4NCKA 2BHRA 5L3VA 4UJ3A 1J8MF 1VCOA 4HLUC 1SVOA 3FKSD 1YZUA 3MMPA 1JR6A 5F98A 2PT5A 1XFAA 4XWAA 2ONJA 5EXPA 1UF9A 3FOZA 1W36B 4KCGA 4TTQA 1CXZA 3RWOA 4W7SA 4Q4HB 3PG5A 2A7QA 4JVMA 3I8XA 2H57A 4HEJA 1OXTA 4YONB 1M7GA 1YJ5A 4TL8A 4MITA 2B21A 4NYIR 3CZQA 1X8LA 5DE3A 3KX2A 2PCLA 3VX3A 3DM9B 5KSYA 4DDWA 4OI2A 1N6RA 4DLSA 2GBLA 2OFWA 5KNCA 4U7DA 3M0EA 1AKEA 4PC7A 4D82A 1Q22A 2YOGA 1ZW6A 5L3RA 2J7KA 1PLKA 2QNRA 3TUIC 1E2KA 2JGNA 2OXRA 1D2MA 2ZI7A 2WOJA 3ASYA 4GI7A 5HCIA 1XMJA 3LX5A 4RZXA 4C0AC 3UANA 4EPXA 1ZUHA 3KKPA 2HCJB 4GT1A 3RC3A 1NBMD 3AF2A 1KO5A 1BH2A 5K8TA 1IN7A 3G82C 1E4VA 3F5FA 1GOTA 2AKAB 2W6IA 3KKMA 1X1SA 3A36A 2J87A 5JZVA 4LSGA 2GJSA 4RFSB 4WW0A 2V7QD 2FZ4A 2V1UA 3M6AA 1E2PA 3FKQA 3T35A 1A4RA 1SXJC 4I4LA 2ODBA 3R7WB 3FDIA 2D06A 2XEXA 2IK8A 4D25A 2P0EA 2WPDA 3CPJB 1G3RA 1NI3A 4UXJA 3GP8A 3EZ6A 2R6GA 4G5OA 4D4LA 2TMKA 1N0VC 2BJVA 2GF9A 2OHFA 4ZCIA 1EK0A 2CMKA 2W0SA 2DFLA 4C0LA 2KBFA 2HF9A 3H86A 2D3WA 1I4DD 4ITRC 4B43A 2ZYUX 1YHNA 2B8WA 2KI5A 5DYGA 3A37A 1P9RA 2FSGA 4H1VA 4UNQA 4A82A 5CITA 1XRJA 2A5JA 2EYUA 2Q0HA 3LY5A 2FG5A 4P3YA 4PAQA 2LWIA 4TMTA 4MUBA 4P4SB 3DHWC 3S1AA 4XVUA 1WA5A 1XXHA 4YMTA 3B9QA 2IWRA 4KJZA 4OHVA 3RS2A 4BGDA 2P3SA 1ZP6A 1E0JA 3L0IB 4Q7KA 4GRAA 4HSEA 1W47A 5ELXA 3QEJA 2VSOA 2D74A 1NBME 2G88A 1Q12A 2PEYA 2O0HA 3QKTA 4JJKA 1AGRA 1XJ0A 3VR6A 2J45A 2VSFA 1W46A 3C15C 2XJ9A 4S35A 4YMSA 5KUTA 3FMPB 1P75A 4HUQB 4XD7D 2WJHA 3PR1A 4MRRA 3ADKA 4JT2A 1U0HC 2OILA 1KI2A 1R8QA 2F1IA 1P2TA 1X3SA 3GJ8A 5FBWB 1Q3HA 2ZREA 3AF3A 4PHHA 1K5GA 1NY5A 2SHKA 4Q1EA 4W5HA 4ZKEA 3HYRA 1HEIA 2WICA 3GJ7A 5AJZA 5DI9A 1GNRA 4JVSB 4NYIQ 1AKYA 4Q1FA 5DN6A 1GRNA 1DTSA 2EYQA 2ZIAA 1WP9A 4LZZA 3B85A 4WZBE 3AVWA 3K1JA 1DOAA 2RGAA 3K53A 4YDSA 3U6BA 3AM1A 2ORWA 1JAIA 1YE8A 4LPSA 2BMEA 4I1OA 1G7CA 5FBLB 4CEIA 4HB2A 4XH9B 1C9KA 2BMFA 4IEIA 4PHFA 4IRUB 3U3MA 1SKYE 3LFUA 1UBFA 1QF9A 1JAHA 1KMQA 4XTRA 3GLIE 1ZMXA 3EASA 3D6TB 5JCPA 1DADA 4NP6A 3KKQA 1CF4A 5E95A 2FFHA 2PX3A 3TQCA 1LB1B 3Q7PA 3CWZA 4LK2A 3EPJA 1I4TD 3U3JA 5AK0A 3AVUA 3CPHA 6Q21A 4B71A 1WXQA 4CF7A 2ZUBA 4JJZA 3NC0C 4UNNA 2NZ8A 2ZJ5A 1T5IA 4N0EA 1VDZA 5BYKA 3ADBA 2CDNA 2NG1A 1SKYB 1P73A 3WNCA 1N6IA 2IYVA 5JEDA 3RLFA 5AJYA 1LY1A 2VF7A 1R0XA 2WJGA 4DB2A 2IUUA 2BM0A 5TB5A 2CVHA 1JR3E 4B6FA 1U90A 5A4JA 2GJ8A 4DDVA 1VYUA 2F55A 3QXJA 3GJ6A 5EE3A 3MWKA 1JJVA 3BD9A 4PC1A 4EFMA 4MGZR 1P60A 3OESA 4XVRA 5BW8A 4W5JA 3PEUA 5BWMA 3EIHA 2Z43A 2ZRLA 2BC9A 1S2MA 1K8RA 3THWB 3GFOA 1KY2A 2QL6A 2WSSA 1IXSB 5GADl 1TL7C 1P3JA 4F91B 4Q4HA 1EFTA 4EPTA 4B32A 1NN3A 3C7KA 3OIVA 3FHCB 3QXXA 3UMRA 2WVJA 4DSUA 4BRWA 3HP1A 2KJQA 3CO5A 2ZRPA 3EWAA 3GLGB 4LV8B 3K0CC 1U8ZA 1CJUC 4JZKA 2RGCA 3K09C 2VQSA 3JZMA 2JIZA 3O47A 4TYWA 5DH9A 2PT7A 3MGCA 5EUMA 2JJ8A 3SFZA 2DYKA 4KLNA 2VPPA 2VHCA 1MO4A 4NYMQ 1KI4A 3NBXX 5AR1A 2ZR7A 3AKEA 1W4CA 2J46A 2V54A 2VHQA 3KXLA 4FN5A 1N2CE 2REBA 4AC9A 2VHTA 1T5LA 3CRMA 1S3SA 2O8BA 2ZRFA 2GEUA 4AKIA 1AZSC 3BC1A 1SXJB 2GEDA 2B8TA 1J70A 1G21E 3TQFA 1KAOA 4V0ME 4D2IA 4YMUA 1XD2B 4TL6A 1NG1A 2GNOA 3SE0A 1ZIOA 3MWLA 1BIFA 3AV0B 4MRSA 4YLGA 3TBKA 1IM2A 2Q6TA 2HT1A 4KFUA 2VYFA 2WBLC 4B47A 3E1SA 1LV7A 5FOVA 2XITA 1KNXA 2VP5A 3IPYA 4PAMA 1UBCA 2W0MA 4B48A 1QHHA 4NYJQ 1Z22A 3GLGE 2WAXA 1HT1E 4Q18A 2CLCX 2HEIA 4RSGA 1T9HA 4PPNA 4BWYA 5FUWA 3T1QA 4M1SA 3CKLA 2CL7X 1KNQA 4Q1AA 4Q4AA 4JLAA 1DAMA 4Q7MB 5CB6A 4IEEA 4PZYA 4WVFA 3AVTA 2V8OA 2FPKA 221PA 4KSCA 2N1BA 1G7RA 1K5DA 3KFXA 4F92B 2JLWA 2O8FA 3E70C 2ZRCA 2ECKA 4JL5A 3T1OA 4P4SA 1OF1A 1G8GA 1SVLA 4E07A 2OBNA 3Q9LA 3RANA 1FUUA 2ZTSA 4GOKA 2YWHA 3ZS8A 5AUOB 2MSDB 3I1FA 2WIAA 4EJSC 1HTWA 1XTJA 2ZE5A 1HE1C 3W6NA 1V43A 3FWYA 3RS4A 2JJ1A 1LFDB 1GSIA 3FMOB 2QQEA 1Z0KA 2YVUA 5DISB 3QOFA 1YR6A 2GCOA 1OHHA 2GXUA 1HE8B 4M9QA 2IUTA 2C5LA 4NU0A 3P4XA 2FN4A 4OBEA 1AGPA 4I1VA 4KHZA 3CX6A 1E69A 1QZXA 5L3QB 1O3YA 2E1RA 1VCMA 2HJGA 1P9NA 3RDPA 4DUGD 4K46A 1A2KC 5JCZA 2X2EA 2FSHA 2GXQA 1RFLA 1RE0A 3W9YA 3BWDD 3VKGA 5AJXA 1BMFD 1P7CA 2ZAOA 4R7ZA 3PJRA 2JLVA 4LC0A 2Z0MA 4IDHA 1XWIA 2ZE8A 2GHIA 4A6PA 5JS7A 1NKSA 1OFTA 2BIFA 2Z4RA 3HU2A 1QHGA 4F38A 4NH0A 3M4YA 2ERXA 2ZPTX 1AS2A 2A78A 3QEOA 2PLRA 3CF2A 2DB3A 5KDOA 1KJZA 1OHHD 5EE0A 1SVWA 1Z47A 3GEEA 4LBWA 3A4MA 4BQSA 1E9SA 4L15A 1UFQA 1E2HA 1ELOA 4LUCA 4I1SA 1COWD 1LW7A 1QHNA 3LWNA 3SYNA 4E22A 3K8YA 1GKYA 3I5XA 4IDQA 4PXAA 1XMIA 2O8DB 1DS6A 2WKPA 3D3QA 3H2YA 3HDTA 3LXXA 2DR3A 1WMSA 2REOA 1ZIPA 3CUEF 2LKCA 1TU4A 1OYWA 2Y8EA 1EXMA 721PA 1TQ6A 1Q1QA 2QY9A 2W2VA 4LJAA 3QBVA 2ZROA 3O8RA 4DEYA 4Q48A 1Y63A 4AD8A 3I72A 3BAFA 3BGWA 3EC2A 1CJVC 1Z6XA 2KE5A 1D2EA 3EA0A 3CR7A 3E2IA 1ZCAA 1KAGA 4LJ4A 4BZXA 3AVYA 4LJ5A 3BFVA 1U94A 2ZRBA 4TMVA 4B35A 4LBZA 4RZUA 4Q9IA 1CBUA 1OSNA 2CJWB 5B30A 3RRZA 1CRQA 2QENA 2OLKA 1DAIA 1E9AA 3CONA 4UXIA 1D9ZA 1VG0B 5G3ZA 3WHKA 4D0GA 3U4QB 1CEEA 1NN0A 1OYYA 1ZCBA 2YWEA 3BRWD 2FE4A 2RGGA 1F2TA 3QVUA 1YQTA 1WB9A 1IQPA 5CDFA 1T0JB 3I4LA 1G8HA 3TSZA 1FMJA 1TQ2A 2OE2A 1T3SA 1ZC3A 3HPQA 4QGHA 4PZZA 2X1VA 2GZDA 4NYJR 5GJCA 2V1XA 1KI6B 4DCTA 2VEDA 4HB0A 2H1LA 2P5TB 4C4PA 1NVVQ 1BYIA 1OT3A 4XTCS 3WMEA 3TNFA 3W6PA 1R0YA 3A1SA 3LLMA 3QVVA 2G9NA 3UMSA 1GM5A 2O8EA 4ZI3A 3K9GA 3X1YA 3EG5A 3LD9A 3FB4A 3B1XA 4Q1CA 4YMWA 2ZITA 1ZNWA 2WWYA 3U60B 1XEWX 3EZ7A 4FWIB 1VYVA 1ZRHA 3HWSA 1U9IA 1S1MA 2OFOA 4TWZA 3TE6A 4F4JA 2W6ID 3WNBA 4ARZB 3OAAA 2FEOA 5FTKA 1R10A 2HYDA 4NPHA 4YXWD 1SXJA 4NYMR 2J1LA 1DEKA 4ASUD 5DLQC 2JDIA 3AKYA 1FL9A 3GD7A 5TY0A 3WBKA 1OKKA 2JATA 4IDPA 2ZYVX 3W5IA 2V7QA 2WWXA 4EQ6B 4OKSA 1VCNA 5F9HA 3KFVA 2F43A 5F2EA 2CNWD 1SVMA 4BEJA 4PSKA 2UZIR 2ZU0C 3LBHA 1QHHB 3SJBA 2ZR0A 3N2EA 3B82A 2O0JA 1JQJC 3DL0A 3G0HA 5L8VA 4DBLC 3ZQ6A 1R4AA 1XCGB 1VG9B 4YDHB 4BLRA 2DY1A 3Q3JB 4LJ7A 3K9HA 5HE9A 2W6JD 5TMPA 4M8NE 4ZCMA 2VP9A 3VQTA 1N0WA 4AKHA 2EFHB 4RKEA 4I1UA 1F2UB 5DSZA 4C0JA 1CKEA 3A8TA 2JA1A 3BBPA 3M1IA 3EW9A 1W2HA 4LJ6A 3CX8A 1M74A 1Z2CA 1G4UR 2FU5C 2A2ZA 3SHWA 2QMHA 2VRWA 1CIPA 1E9DA 4CT5A 3HU1A 1X6VA 1LVGA 2GJAA 3PCRB 3AH8A 1VTKA 2ZSFA 3RVBA 5SZKB 5G41A 3BXZA 2EWWA 2PZGA 3SJCA 4NBSA 4WXRA 2WZQA 4XWKA 4JBYA 2Q3HA 1E1QD 3WXMA 2WJIA 1TU3A 3C16C 4UNRA 4M1KA 3DZ8A 1W5SA 3BS4A 1U0JA 1KK3A 1KK2A 4HLCA 5FTMA 3VR3A 5FOXA 1E6CA 3CPEA 3PITA 4MRNA 4EJSB 2J0UA 2IS2A 1W2GA 2FF7A 2ZU6A 3SYLA 1H8HD 4QXAA 1EFUA 4B3BA 1A5TA 3KQHA 2FV8A 4CT4B 2CK3D 4GOXA 4LHXA 1EGAA 5H70A 1HQYE 5SZIA 3U3OA 4Q03A 1JR3A 3R9XA 1LF5A 2QAJA 5EXXA 3TW4A 1NVUQ 2FWRA 1W36C 4PQFA 2IF0A 4DSTA 3P4YA 2JLQA 1HY3A 4QJ4A 4QM6A 4C0QC 2DFKB 2BEJA 1G9XA 4D6PA 2J0QA 1GNPA 2LKDA 1QDEA 2N46A 3ZGXA 4C30A 1AS3A 3LVRE 2IX3A 4FMCB 1OXXK 1UM8A 1YVDA 1UEJA 2WKRA 2AHOA 4IXMA 1IJEA 4FWTA 2V3CC 4A0GA 4E09A 3AP1A 1J7KA 1YZNA 2O8DA 4B73A 3LQRA 2B6HA 5KNDA 2XB4A 821PA 4ZI2A 3ADCA 5TDHA 3ZS9A 4JT4A 2IHBA 5KPDA 3GLFA 2QPOA 2ZRIA 5DI3A 2WSSD 5FL7A 5J4LA 1N5LA 4FCVA 1VHTA 2D2FA 5B2ZA 1XB2A 4AKGA 4G1UC 1R6BX 4O25A 2V6JA 3UWOA 2W00A 2VO1A 4MYHA 4URXR 2C96A 3LNCA 3DKVA 4OYHA 4E03A 5FUYA 5CLLA 2J3EA 4URYR 4PC3A 1VMAA 2J5XA 4MYCA 3IGFA 1IBRA 3LH5A 4ILEA 4A0RA 2ZI6A 4LDJA 4AKEA 3RAPR 1ZNYA 3VR2A 2AWOA 4A0HA 1E0SA 1E32A 4IVQA 4H9GA 2GVZC 4NMMA 5JHGB 2CXXA 1KDRA 2IYTA 3IIJA 4O0MA 4MH0R 4AY2A 5FBQB 1Z6YA 2NO7A 2GXAA 2ZXUA 1K6MA 1WCV1 2FSIA 4PC2A 4A9AA 1KI6A 2ERYA 1J2JA 5BXQC 1AQYA 3AVVA 4M1MA 1LTQA 4IOKA 2AN9A 3THXB 1N6NA 1T8UA 2O8EB 1LS1A 5DYIA 4QL3A 4RD0A 1RPZA 3VNUA 3ZD6A 4TLEA 2G83A 1DAKA 2AD1A 4AK9A 2BCGY 1NP6A 2C03A 1ONBA 3AP2A 2ZRDA 2YV5A 3PEVA 1G5RA 3BB1A 3Q5EA 5HKKA 1W0KD 3SBEA 1E99A 1NN5A 4ARZA 4XIGS 2OT3B 1YU9A 2RGBA 3U2QA 4O3MA 2FGJA 4PPGA 2C8VA 3OE7D 3QKRB 5HZHA 4PO8A 2R6AA 1S1CA 4AURA 2ODNA 3B6EA 4WOPA 1G7TA 3ICQB 3GJ0A 1D5CA 4ASUA 4JIMA 3WYAA 1P62B 5IK2D 5JWOA 1E2MA 1IY1A 1JR3D 1R7RA 2H92A 5FTNA 4EAQA 2HJVA 3JZAA 1N6PA 5F3WB 4HAZA 4DXAA 3BH7A 3VR1A 1T91A 2QORA 3T61A 1SHKA 1UKYA 2ZI3A 2ZUDA 3PFIA 5AWFC 3SC3A 2VP2A 1QHIA 1US8A 4M22A 2FFQA 4TQ9A 3NBYC 1DAFA 4IVRA 3TR5A 2QI9C 3EAQA 5DHAA 3IQXA 2HYIC 4LC1A 2LCFA 1GL6A 4KO8A 4OL0A 3V9PA 2QTHA 2YZ2A 3QQ5A 3RWMB 4B2LA 1KKLA 1R5BA 1YRBA 5H8WA 3X1ZA 4G5QA 4MKFA 1E9BA 1SGWA 1SKQA 2EW1A 2XNDD 1JJ7A 5CLQA 4NHOA 1AA9A 4A8JC 5L3SB 3OIUA 3ICEA 4IDOA 2ZRAA 3FHOA 2BJWA 2XGJA 1U8YA 1FP6A 2FH5B 2YOHA 2ZRGA 4O2RA 1XTKA 5CJ2A 5FOTA 1GUAA 3DVLA 2JLYA 4EPYA 3VTKA 4DCSA 1P5ZB 4Q9LA 2ZJOA 3VU9B 3VNVA 4FMBB 2DCUA 5G40A 4BUJA 4BEBA 3FMIA 3KJIA 1FX0B 1XMVA 3BH0A 3WRXC 1M8PA 2J0UB 1BS1A 1OJLA 1TADA 2ZI5A 4OHWA 3GLHB 3ZZTA 2EWVA 4LPKA 4MA4A 2JLXA 4LGMA 4GL2A 3SJAA 4JLPA 2V6IA 3EPKA 3OEHA 4D0NA 1NMXA 3SBDA 2OBMA 3CNLA 3GJ5A 2IYRA 3C5CA 1JQLB 4BZQA 2OUKA 2NOAA 4RJLA 1G18A 4NCIA 1ZNZA 3BK7A 5JEEA 3OFND 4DZZA 5JFGA 1HH4A 4CEJB 2XX3A 2GCNA 4Y0VA 1U99A 1XZPA 3QG1A 4NCJA 4BE7B 4A15A 2CBZA 4AIIA 2A5GA 1OH5A 1NVVR 1NG9A 5TVKA 4DCNA 2R8RA 2FPLA 2C98A 2RHDA 2X2FA 3PUZA 2P6NA 3SJZA 5J4VA 3WP0A 2JJ2A 2EU8A 1NLFA 421PA 5P21A 2ZSBA 4EDHA 2QTFA 2VH5R 1FUKA 3ASZA 2ODEA 1ANKA 2OCYC 1XEXA 4DLYA 3RRNA 2JLUA 2F7SA 4LX0A 4DRZA 1Z0JA 1LS6A 5FR2A 1TUIA 1S96A 2JCSA 3VFDA 1T8TA 2YC2C 1IN6A 3S1AB 4AG6A 1YZLA 3RYTC 4DSNA 4B76A 1OH6A 1E2FA 1CJMA 3FFAA 1P2VA 3UXMA 1VKJA 3UWKA 5C18A 3A1TA 3EIQA 1XP8A 3EZ9A 1VIYA 5FPTA 4G3XA 3R8CA 2RH5A 4Q1BA 3H0KA 1DAGA 3ND8A 1C1YA 4CEHA 2B92A 1KSHA 2PZEA 2ZUCA 4G01B 1OIWA 2AKYA 3AF0A 2GILA 2IT1A 4MDEA 4N0DA 3LBIA 2RB4A 1UKZA 1X86B 2JDID 1EG7A 1VYTA 2X19A 5DHFA 1FTSA 4JYCA 3Q72A 3NG1A 2WJVA 4L9WA 4HUQA 4HAYA 3K70C 1MR3F 1VHLA 2CLDX 1G6OA 3Q85A 3I62A 3P32A 4FINA 3NHBA 3NIBA 4ERNA 2GTPA 3THXA 3W3ZB 1E0AA 5JS8A 1RRGA 3R8FA 4IHQA 4A2WA 3EX7C 1GNQA 4V0OA 2C04A 5FH9A 1EWQA 2NPIA 1E9CA 1FNMA 2H7VA 3DZDA 1N5IA 1X8KA 3NH9A 2PLFA 2XZLA 4JSYA 4QJ3A 3DPUA 1FZQA 2QMUA 2BKUA 1TQDA 3V4FA 2YWGA 4KODA 1T3HA 2NQ2C 4MKGA 1E2QA 1SHZA 1SVKA 1WRBA 2O5VA 2MMGA 3QF4B 4CEIB 2GBLC 4P32A 4OK6A 5CJPA 1ZJ6A 3H1TA 3B9PA 1CU1A 4M4SA 1G8YA 2PBRA 1IN5A 3UATA 3KL4A 2GEVA 1G64A 2BKEA 4OK5A 3TKLA 4Z54A 2JASA 3Q7QA 3VKWA 1VPLA 4RD6A 2QGZA 3EARA 1ESMA 1RJ9A 2NZJA 3AF1A 3VR4A 1GTVA 1UPTA 3K0FA 3KXKA 2FFBA 3TJZA 2F1HA 2IA5A 4GZLA 5A0FA 1O87A 4HLUA 4D4MA 4CZ2A 2WWIA 2PJRA 1Z0FA 1FPMA 2WJYA 2AR7A 3IIKA 1IN8A 1BYUA 4URZR 5FI1B 3AKCA 2FX3A 3LO5A 4KVAA 2ZVQX 4HDCA 3NDPA 3ZDQA 4MGIR 5CB8A 3DMNA 4W9MC 3CLVA 2JJ2D 5CM8B 3T12A 1I2DA 2QP4A 3NKVA 2J0VA 4OJKA 4ZDJA 5KYKA 3TR0A 1XCPA 3C8UA 5FL3A 4I81A 4MDFA 4DC9A 4B74A 3LA6A 4C0SA 3ZVLA 1M7BA 4JL8A 1ZM2A 5L3SA 1GVNB 2QAGB 1N6KA 4RZ3A 1NN1A 3X2SA 2HV8A 5M04A 5HTKA 3ETLA 2HXSA 3A4NA 1P9WA 3V4RA 3K9NA 1QHXA 4B75A 4TYPA 2DFTA 5EXSA 4HAUA 3I32A 3QJYA 3IIMA 1ZUIA 2OCBA 2IW3A 4BLOA 2PZFA 2P6UA 3LDAA 2A5DA 1GFIA 4V03A 3GLGA 1G3QA 5BN4A 3U5ZB 1FX0A 1W36D 2GXSA 1JALA 2EQBA 4EPVA 2AK2A 5JI2E 2GK6A 3BORA 1ZAKA 3V00A 2F9LA 4KFSA 2BVNA 3PUVA 5EQTA 3LXRA 1E0KA 2N42A 3VAAA 2JLRA 2ZJAA 2O8BB 1IXRC 3D8BA 1R0ZA 2QG6A 1KI1A 2RGEA 2FZLA 1U2RA 4PZLA 3NH6A 4C9BA 1XD9A 2ZJYA 4TQAA 4U5XA 1DBSA 3CM0A 4HB4A 1XU4A 3WY9A 2HLDD 3T5GA 2ZRNA 2ZS9A 3LX8A 1CR2A 3EA5A 4B33A 4D4KA 5E7MA 4KBGA 1L4YA 1MABA 2ODWA 1G41A 3X1XA 2ZANA 2QZ4A 2XNDA 4KAXA 4XOIA 3B1ZA 3WRYC 3NXSA 4CGZA 3HR8A 2WHXA 1FMLA 1N5JA 3U6KA 4KFRA 1PUJA 2ZS7A 4FI3C 1W0JD 2G3YA 4L16A 1W4AA 2PJZA 1KDTA 2GAOA 4K81B 3A58B 1RC8A 4V0MA 4C3ZA 3ZLJA 5CIWA 2WAYA 4Q4AB 5FPHA 3RS5A 4R9UC 1RRCA 4IW3B 1CRPA 1XEXB 2L0XA 3AUYA 3FVQA 1QVRA 1TX4B 3IDQA 4R2HA 4BFSA 1OH7A 2GKSA 3TRFA 4LHYA 3TAHA 1Q44A 3KB2A 2H5EA 2Q21A 2WTUA 4DIEA 5EJEA 2F1RA 4JLOA 4LI0A 3B60A 3ZIAA 4DVGA 2OAP1 2CHGA 2OCAA 4EKDA 3U7HB 3C14C 4CYMA 4Q66C 4QBGB 4QGFA 5AJVB 1NVXQ 3KUCA 4CEHB 1G3IA 2I3BA 1E2GA 1FP7A 2IXEA 1XX6A 3GJXC 4QGGA 1QVAA 2NO1A 2D7DA 1P6XA 1HV8A 2GCOB 5AJWA 4MGKR 5DIFA 4LHVA 5CIQA 3PV0A 1G1MA 2BEKA 1E98A 1QBKC 3O8DA 5FOWA 3U44A 5JJIA 4DT1B 2IYSA 3K09A 1IXZA 3REGA 3K0CA 3F0TA 4LJYA 3DOFA 3Q8XB 1IY0A 1RKBA 1W5TA 4TT3D 4IOJA 4FMDF 4B6EA 1LF0A 4Z51A 4JKYA 3L8YA 4Q4JA 3NTUA 5CK5A 2WWHA 3PUYA 3KXIA 3MUFA 3OAAD 4AYTA 4TMWA 1S3GA 5IRCD 1ZD8A 2WMNB 3VHXA 3NEYA 3AQ4A 1WE2A 4LWZA 1KY3A 1RYHA 2BMDA 3ND9A 3KJHA 1E1QA 4UNPA 1DAHA 4PSAA 1TEVA 2XOKA 4FD2A 1A2BA 4V0LA 3O8CA 4F4IA 1PUIA 2DWOA 2WOOA 2QE7A 1ZD1A 3A1UA 3CBQA 2H18A 2A3RA 3W34A 4EFLA 4Q9KA 3SNHA 2XB2A 4JBWA 3GCGA 5TARA 5LDDC 1RJ9B 5FOSA 3K0FB 3REFA 2OV2A 1CR0A 4US0R 4UXHA 3P1JA 2DPXA 3A4LA 1AS0A 3H84A 4TT3A 1RIFA 2NMVA 4M9ZA 3GLHE 1R8SA 2F6RA 3QPUA 3B1VA 1OXUA 2VHJA 5JJLA 3TSOA 2QGNA 2GRJA 1MV5A 1B0UA 1G4AE 1SULA 1ZM9A 2G6BA 1RRPA 2NGRA 2OFXA 2XTMA 2XXAB 3ZVMA 3NC1C 4KFTA 2CJWA 4FW9A 1YR8A 4TZ6A 3VKHA 2V55B 3CF0A 4HYYA 2OXCA 3HU3A 1S8FA 1ZUNB 1F2TB 1FQJA 1OW3B 2BBOA 3MAAC 2QAGA 5EXTA 4XWOA 3P26A 1OXVA 2CCJA 5HPYB 4ZV4A 1MO6A 2QEQA 1W49A 2VP6A 1MH1A 3L82B 1FOEB 4TMKA 1F6BA 1GWNA 3A1WA 3CNNA 3QF7A 4QBIA 5G3YA 2OBLA 3OEEA 3QG5A 4NCHA 4BFXA 3GEIA 3GLIA 3BFXA 5HZKA 3KJEA 4PX9A 2PCJA 2UKDA 3VX4A 5EZ6B 3EZFA 4ACBA 2I1QA 4YXWA 2J41A 3N5CA 5C46F 1C4OA 4PAOA 3ADDA 5J4KA 4Q4LA 4C7OB 5EZ5A 2HUPA 3RS3A 3B1WA 3FGNA 5GJVC 2PL3A 3L0OA 2QN6A 4GBMA 2RGDA 2R2AA 4Q19A 2YC4C 2XOKD 1M6NA 1GDDA 2CHVA 1OV4A 5FL7D 1E9EA 1Z0IA 1X8JA 3CWQA 2VBCA 4Q1DA 3EC1A 2HCBA 3QPVA 2QM7A 5FOUA 2HLDA 5FPYA 3RSOA 5KHOC 3FE2A 1GKIA 2ZJ2A 5JECA 3RS0A 1KO7A 5TV2A 2WWWA 1N5KA 3I61A 2OO7A 3SFVA 8OHMA 4TMZA 4EQ6A 4RZ2A 3MFYA 1KDPA 4D80A 3EPHA 1ETUA 1KJWA 3QY0A 3AF4A 3SZRA 2Z5FA 1XJQA 1KKMA 2PH1A 3QBTA 4OQLA 1KO1A 5J47A 1TQ4A 2BCJQ 4TYQA 2P65A 2B7CA 1WBDA 1KDOA 4RKFA 4RVCA 4GDFA 1Z2AA 1AZTA 2FEMA 4L4UA 1OXSC 1OLOA 3MRSA 4KLZA 2P2LA 2IHYA 2X77A 4JKIA 3TUZC 3TSWA 1F2UA 3D7MA 2FPMA 4US2R 4MRPA 5D3MA 2WMOB 1DVRA 3TGPA 4KI0A 4MKHA 1H8HA 2IWHA 2J7PD 2WPDD 4L8GA 4X8LA 2NO9A 1Q3TA 4ZIRA 2REXB 1COWA 4YMVA 5JI3E 4TLBA 1XPRA 4MYTA 3GFTA 4RD4A 3EPLA 1HQCA 4NZYA 5GVSA 3U3KA 2ZR9A 2VF8A 2WM9B 1VIAA 2QU8A 1QRAA 4HLQB 3AUXA 3MJRA 4JL6A 4J0QA 1G3UA 4XSGA 2ZYWX 3A1VA 1QG4A 4US1R 5LD2B 2FJUA 5JLJA 1YZKA 4DT1A 3CIOA 4JLDA 5FI0B 1YR9A 4ACAA 4PANA 5JWRA 5IHPA 3KTAB 1T6NA 1L4UA 2MMCA 3ZZ0A 1W0JA 3P27A 2ANCA 3OEED 3HPRA 3LVQE 1EFRA 2ASEA 4YC7A 2XZPA 2ZRHA 3GEHA 3GLFE 3X1WA 2GA8A 5HCNA 1OE0A 4M1WA 3THYA 1Z29A 3B13B 4Q4JB 4P4TA 5FPSA 3T5DA 4G5SA 3T1TA 1IN4A 1UBGA 3KB1A 2X8AA 3NBFA 2OM2A 4EPRA 5FTJA 3EZ2A 3MWYW 2ZI9A 4NL4H 5CK4A 3RABA 2IXGA 2QSZA 2VTKA 4W5WA 4LYJA 2CE2X 2C78A 1L8QA 1ZINA 3IPXA 4Y0AA 2E87A 3KQNA 4JBXA 2ZETA 4OHYA 1XCMA 4X8HA 4A2PA 5IDVA 2VP0A 2WWGA 1Z07A 4DDTA 1TEXA 4CIDA 3MWJA 4V02A 2VLIA 5B64A 3K0EA 1EFRD 2C9OA 4HZUB 1ZVQA 1E3MA 3BB4A 3R9WA 2D7CA 2NIPA 1I2MA 1R0WA 1KSFX 1Z0DA 1Z5ZA 1T3LA 4Q00A 4UJ5A 4DHEA 2NO0A 3SR0A 1E2IA 5DI3B 4WZ6A 1NJGA 4DB4A 2JLZA 1D2NA 1KZGB 2PEZA 2QSYA 1CJKC 4OQMA 1KI9A 4MUAA 2R6CA 1E4YA 1NMZA 3K0AA 2AK3A 2ZQ5A 2P67A 3SYKA 4OHXA 5JBQA 5HE8A 2QT0A 2JEOA 3F8TA 1PZNA 2HDNB 2P5SA 4PPQA 4DLWA 2J7PA 1BMFA 2R6DA 1G8FA 1EFCA 1UEIA 1Q1ZA 4M2LA 2HF8A 4EIWA 1UDWA 1RRFA 4TSFA 1NMYA 2QQ0A 4LYAA 3IQWA 4QNMA 1RVDA 2QBYB 2BBSA 1T4GA 621PA 3I3SR 1MO5A 4LJ8A 4WIAA 2W83A 1AJEA 1P61B 4MRVA 4OQNA 1YZQA 2BBTA 2ZJ8A 3DOEA 4HDOB 2K5UA 1L2TA 3CNOA 4IFBA 5CM9C 3KKOA 1EX6A 1U0LA 3C41J 4PHTA 1R5NA 4UKDA 2GAAA 3WMFA 1HT2E 1Z83A 4ZDIA 4GZMA 5BYJA 4NE2A 3UIEA 1N6LA 1ZC4A 1PLJA 2J59A 5CYPA 4BLTA 4C7OA 3HR7A 1QHYA 3U7EB 1PV4A 2IYYA 4TLCA 2IF2A 1SXJD 3PENA 2XAUA 4XJXA 1P72A 3DM5A 2C9YA 5LBIA 2RMKA 3AVOA 2R6FA 3R7WA 4DLZA 5JJKA 3VHLB 3K70B 4Z1MD 3MLEA 4ZKDA 2IEYA 2OG2A 3HJNA 3KQKA 2EFDB 4A2QA 1G20E 1AQUA 1Z08A 4C0BA 1ZM3A 2AWNA 3CX7A 3CF6R 5C4GB 4RD1A 4NONA 1XXHE 2QA5A 5DNYB 2ZJZA 5AUNB 3PVSA 2ATVA 4OJQA 1G3MA 1QHSA 1ZM7A 1UBEA 4IJMA 1YZGA 1DE0A 4PSVA 2JLSA 5SZHB 4BASA 1Q20A 4DJTA 4QM7A 1UJ2A 5UKDA 1JI0A 5CDFE 1M2OB 1Q0UA 1NSTA 4WA7A 2C2HA 3J81k 4C2UA 2VIIA 3GJ3A 4RCZA 3ZJYA 1XXHB 4BLQA 1ODFA 4NTZA 3T06B 2YKGA 1CLUA 3RRYA 1NL3A 1E79D 1EX7A 3RHFA 4B3XA 4HAWA 1DO0A 4DWJA 2I1VB 2CL0X 3IBGA 1OB5A 2KBEA 1WDTA 2RKOA 1G7SA 2I4IA 1DG3A 3CRRA 1N6OA 1ZU4A 3EIEA 1XTQA 3SI7A 1G291 5IT5A 4C0KA 3Q5DA 3SQXA 1OB2A 4TTPA 1GG2A 1E96A 1NF3A 4TYYA 2BV3A 1SXJE 2G1JA 3CRQA 3GQBA 4C0HA 4ZIRB 5FTLA 4JLJA 3AVXA 1NKTA 1OFHA 3LV8A 2NO6A 1EESA 2HXYA 3I8SA 4BFTA 1S9DA 4A1FA 2WJJA 3BE4A 1EFHA 3VU9A 2XTZA 1KJYA 3NBZC 3NEJA 3VMFA 4ESHA 3QNUA 4WBSA 1MKYA 1OKKD 4AYXA 1E2NA 4AG5A 5E3HA 3AVQA 1UKVY 1F5NA 1G5TA 2IYQA 3IHWA 1DARA 4A4DA 1B23P 2FMXA 1F3OA 3GLHA 1RW4A 1JXOA 1V5WA 4RCYA 4BPBA 121PA 4QG7A 3THYB 4LHZA 3W6OA 1D9XA 1ZYUA 1IHUA 2ORIA 3PUXA 4JSTA 2QRZA 2CE7A 1TF7A 2D2EA 1DAEA 2YNMA 2BOVA 5IK2A 1NNEA 4URWR 2KSQA 2A5YB 4OK3A 1Q57A 3N2IA 4QHSA 5JSZB 4CEJA 4UNSA 2QP9X 1XF9A 3CR8A 3IHLA 2C9CA 2F3RA 4LY6A 2XZOA 4BFVA 4XD7A 4TMXA 4FMCF 5HKKD 2ZSEA 3ZQJA 3LW8A 1E1RA 3CRVA 2CL6X 2MSCB 1E2EA 4P33A 4Z8YA 4DCVA 4LJ9A 4JVNA 4QGAA 1TTTA 4TN1A 2DFNA 4OQXA 3DKPA 3ZH9B 2P6RA 2Q9CA 4PQRA 2GJKA 4BLPA 2ZAMA 5BN3A 4PHGA 5LPNA 1KMHB 2IC5A 2IYZA 4GFDA 1NSFA 4MQBA 5FUVA 5KTYA 1JEDA 3W3AA 3CH5A 2RGNA 3W8RA 3BFKA 2ONKA 1Q1EA 1G5PA 4QC2A 5KDLA 1E79A 3QXCA 2QM8A 3EXAA 2GJ9A 1CR4A 4D81A 3GJ4A 3U7FB 1FQKA 1A1VA 5KU1A 1OPXA 3C4JA 4HAVA 1TF5A 3K0AB 5FUXA 1W4BA 1Z0AA 2R44A 2YOFA 3THWA 3B8HA 1A7JA 3THOA 2IYUA 1G16A 1NJFA 1OIVA 4H1UA 5HR5A 5JHHB 2XTNA 4LCBA 2DWPA 1CJTC 3IUYA 1R2QA 2ANBA 4Z8XA 1FW6A 2UZ3A 2G77B 4R98A 3OHMA 2BM1A 4RY2A 3UK6A 1PJRA 5E4FA 2EFCB 2XNSA 2OSBA 4DLVA 3K70D 1F60A 1IONA 3KQUA 1TAGA 4HZIA 1JB1A 4O2LA 3QXSA 5DGXA 2FSFA 2QBYA 3IEVA 2C77A 1GRRA 4ZCLA 3KQLA 3L0PA 3ONWA 1II8B 4R2IA 3SS8A 3OEHD 3UPUA 2GDJA 4U02A 1W1WA 4DIDA 5D3QA 5IF9A 1ZNXA 1L7VC 1YZTA 2XJ4A 4Q47A 4TTRA 1XTSA 4Q5IA 4F93B 1MRSA 4G0NA 1VCIA 2ZEJA 1GRQA 1MOZA 3FHTA 2OAQ1 1Z28A 2F9MA 1KOFA 4LV5B 2JAQA 1RYFA 4KITB 4NCNA 4KV9A 1E9FA 1G6HA 1I4LD 3IO3A 4S2EA 2QPTA 1DG1G 2R9VA 4QHYA 1XD2A 4Q01A 4EPWA 4AI6A 2EFGA 1XJCA 3PEWA 2F1JA 1Q21A 1MRNA 1N3BA 1TUEA 3QF4A 2KB0A 3L8ZA 2YJTD 1ZD9A 2QUZA 4ZDWA 1E2JA 1X1RA 3QPWA 4BRUA 3QI2A 4WAUA 4QNRA 2GCPA 1E2LA 4B2PA 2DHRA 1G19A 3OF5A 4QBHA 3GPLA 3I5YA 3VR5A 3SDZA 3U3RA 4B3FX 4PR0A 5LB2A 1U98A 2NTYC 1SZPA 3RNLA 3P20A 1GILA 4TSFD 1T0HB 4KXFB 3L43A 2O8FB 1GKUB 5E7JA 4MGYR 4DDUA 5FBRB 4A6XA 4TYNA 4A0FA 1W48A 1N6HA 1P4SA 4DCUA 4AYWA 3TUJC 5FPKA 4A8JB 4JLVA 4Q02A 4DSOA 4DEXA 4M21A 4MYUA 5DN6D 3OZXA 1Z8FA 4KVGA 4Q7LA 1ESNA 1HUQA 5EP2A 4B2IA 2O52A 1CTQA 1LNZA 4PFSA 4QBFA 4U00A 4X8MA 3WMGA 2J0SA 1RZ3A 4IOLA 3RSLA 2FOLA 2YHSA 3IO5A 1BKDR 3I73A 2RHMA 3WP1B 5FBVB 4OI0A 1KIMA 1H8ED 1TMKA 2QPAA 2Q9AA 3CH4B 4JLBA 2EVWX 1W44A 5B57C 3DEFA 3BJIC 1CP2A 3LRPA 2FDCA 2IS1A 1XPOA 2ZJBA 1VG1A 2YYZA 2Z6VA 2IBMA 2QTVB 3K0SA 2PMKA 3KKNA 5L3QA 1AK2A 3FPAA 1KK0A 1UKEA 2RGXA 3FMFA 5H68A 3BB3A 4GSYA 3AEZA 4OQFA 3PEYA 2ZS8A 1G8PA 1XTRA 1D8TA 3U61B 2IEZA 4WZAE 2BWJA 4K8OA 3KDSE 3NDBB 1JEEA 4HB3A 1JPJA 4NDZA 5AUQA 1VECA 4ABYA 4CW7A 1MT0A 1E1RD 3JVUA 3K9LA 4BLSA 1CULC 1KSJA 4X8OA 2R65A 3DO6A 4G5RA 4N3NA 1KYIA 2ZYTX 2AL7A 2MSEB 3BERA 3KZ1E 2FA9A 4QJ5A 4CRWB 2Q9BA 3E5HA 4GP6A 4YQFA 2WIBA 5BN5A 2QMEA 1PLLA 5KSPA 5JSZA 3MSXA 3QXHA 4WXPA 3A6PC 1TPZA 2XSZA 4ZPXA 1HYQA 3B78A 1IY2A 4B34A 2OZEA 3TK1A 1SQ5A 1GL7A 1MABB 3PQCA 3PUWA 2YWFA 5GJBA 1FNNA 2GVDC 3ZIAD 5EUQB 4JLKA 4ZDKA 4EUNA 4HLDA 3U7GA 2O8CB 2IYLD 3WBJA 4A92A 2ORVA 5K8IA 3LW7A 3MG9A 3IKJA 4FCTA 3R9IA 2J9RA 1BO6A 2ZRMA 2IS4A 4IXNA 4OHZA 1M1YE 1Z3IX 1KMHA 1U9IC 4BFWA 4V0KA 2G0TA 3ZD7A 1GITA 3LLUA 2RCNA 4D4JA 3AB3A 3U4QA 3FFBA 4JVLA 3CZPA 5C2JB 5G53C 5AUPB 4IFEA 3TIFA 3N70A 2A5FA 1AIPA 4F7WA 1XTIA 2VSXA 5KDDA 2KWIA 4M1OA 2AD5A 5JRZA 1KK1A 1KO4A 1JBKA 1E94E 3CW2A 1D6JA 1Z6TA 1UDXA 5KOYA 1QG2A 4DKXA 4ON9A 4B3DA 3QENA 5C4MA 2AFHE 2VA8A 1R5OA 5JWHA 1W7AA 5CYOA 3W90A 2GESA 3ZZUA 3U44B 1II8A 4PO9A 4AWXA 3D31A 2ZSAA 2WWFA 4LBVA 3AVPA 2QP3A 1NLZA 2C99A 5J40A 1FFHA 4QOSA 4HUTA 4DLXA 3TMKA 4XSHA 3HYTA 2A9KA 3F3YA 3IBYA 4LYFA 4XVQA 2GK7A 4JYBA 3SU8A 2HT6A 1OFUX 4I99A 3T1VA 3B5JA 4HATA 1YKSA 5A5GA 3TVTA 4B44A 4TLAA 3KUDA 2OEPA 2BDTA 4Q21A 1NBMA 1BOFA 2QROA 2XSZD 4M0LA 1E2DA 1S4QA 2IXFA 4Z1MA 1XMSA 4QRHA 2OLJA 3OFNA 2IS6A 5EP4A 5GVRA 2F43B 2QAGC 2UVQA 2RGNC 3ZYCA 2CVFA 2VHUA 2ZSDA 3QUSA 4G5GA 1AN0A 4TLDA 1GP2A 3FTQA 5TXGA 4ESVA 2W6JA 5J5CA 2Q3MA 1M7HA 1DELA 4M1TA 2CCKA 2H8KA 2QMOA 3MCAA 3T15A 1N0UA 2GZHA 4PO1A 5J4YA 4A36A 4TL9A 5EE1A 3RC8A 4DUGA 2V4ZA 1TF2A 3R20A 3DDCA 3QKSB 4P0TA 4URVR 3L0SA 3LBNA 1II0A 3FKSA 3UG6A 4F4CA 2IL1A 2H17A 4BFYA 1AM4D 3NWJA 2ZVPX 2GZAA 4POAA 4KBFA 2IYWA 4GMXA 4LRWA 4A8JA 1H65A 1MO3A 1S0UA 2XXAA 1DO2A 5SZJA 5EP3A 4BECA 1UAAA 2DBYA 2E9SA 1XDBA 5LB4A 1KGDA 4HDQB 2FGKA 4EFNA 5KPJA 3L2OB 2ZE6A 1S9HA 3OIYA 3QE0A 4KYIB 1NIPA 5H1YA 2AXNA 5E7IA 1OH8A 1FTNA 4E5UA 4II7A 1NIJA 1NRJB 521PA 3PIRA 1J99A 3GFPA 1JECA 1Z06A 2VP4A 1XEFA 3TAUA 4FMDB 1KTVA 2GETA 1HURA 1KHTA 2YINC 4PQYA 4B3CA 5FR1A 4ZO4A 3CB4A 3G5UA 2QE7D 1G17A 4EJSA 5KNBA 2CHQA 2VL7A 1M34E 3GLIB 3C5HA 1HA3A 2R62A 2AX4A 4TL7A 1KI3A 4OI1A 4GPTA 1YR7A 4RD3A 4PTLA 3T34A 4M9XA 2W58A 4GNKA 3BOSA 4GOJA 3AGQA 2CCGA 3IILA 3SN6A 2QT1A 1A82A 4UQOA 4Q9JA 3QSYA 2C95A 1WBBA 2BMJA 1NVWQ 4M53A 3AP3A 1OIXA 4RFSA 5FFMA 3SEAA 3TVDA 4HAXA 4JS0A 2ZI4A 3WYFA 2W2XA 4GMDA 2F3TA 4FXPA 3W8NA 2Z83A 1U81A 1J8YF 4V0NA 3MD0A 2QRNA 5J4HA 5KO2A 2CLSA 3UKDA 4BFUA 4KU4A 1NY6A 3EWSA 3UMFA 2IYXA 3SOPA 5EE5B 3GMTA 4JMPA 3ZVRA 1KZ7B 1Z6GA 3B2EA 2WKQA 2ZRJA 2OESA 4BFZA
chains in the Genus database with same CATH superfamily
2GZ1A 5HQ3B 5CNKA 2A86A 2GZSA 3GJSA 4KSBA 2O8CA 2Q2VA 2ZE7A 1NATA 4DXHA 2DWQA 2RAFA 3MJHA 4QELA 3CGGA 5LQUA 1JVNA 4MMZB 4RF5A 4ILKA 4K9LA 2CK3A 3I2HA 2UZAA 2BZ0A 3NDIA 4O4JB 3RKUA 3ZEAA 1UFRA 5B58C 5K8UA 2RAPA 5HFNA 2YXBA 4QXMA 5FV7A 2VDUE 4PYKA 4DSZA 1IAQA 4N0MA 3UAXA 4JYMA 4D44A 2X1HA 5I51A 3UG7A 2PX8A 3NZEA 4JJFA 3SJUA 4R71A 5A5EA 1X9GA 5ADVA 5BVHA 4FFWA 2H4WA 3A9WA 1I5RA 1JXMA 2B7BA 4KO1S 3GDOA 1RWBA 2E4YA 1GL9B 1ZEMA 4XE5A 3HO6A 2O0MA 2WWVD 4EY6A 4CTOA 1W4RA 1C7EA 5B7PA 4DDHA 1E9RA 1MH9A 1YRAA 4X1YA 1FVXA 1TU0A 1AHPA 3RVMA 1CY4A 2WSMA 3LJKA 3M7IA 4KE7A 3UKOA 1D2AA 5IT4A 2HMTA 2EFEB 2D5CA 4PC6A 4YLYA 1KI8A 3AR5A 1VJTA 2FFAA 3WYGA 3GMDA 2BFEA 2IUSA 3QPCA 3RRMA 1ZUD1 4Q7JB 3TB4A 4JLNA 3SC2A 2HMVA 5BMVA 3NUQA 5ALRA 3C7CB 3EMBA 2X8BA 4HQ6A 4NKRA 5E6UB 4YRSA 2R6JA 1AGNA 1SUCA 3IH5A 4LOAA 4MQ6A 1TNDA 1ZGCA 4LRXA 1OZFA 4OBXA 4OQZA 3TH5A 1ZU5A 3ETCA 2CZQA 4X97A 2GF0A 4LFBB 2ZTLA 1Q16A 2PD6A 3H17A 4X93A 2VHWA 2IUEA 1RI3A 1U7TA 1X7WA 3GL9A 3KQTA 4UDYX 7MHTA 1E0DA 2IH2A 3CQ9A 1X38A 4HNRA 3E05A 3T9FA 4LYHA 5E9JA 2BBWA 4HH4A 1TVCA 5FFFA 4JLMA 2JHGA 2M6LA 1EWRA 3LPAA 3W2TA 2P68A 1GV1A 1II9A 2PQ0A 2WIDA 1XTUA 3OY2A 2ATIA 3OTQA 2C5HA 3PHJA 2H1RA 1GCIA 2LRHA 4LYDA 5C5CA 3HZRA 4KGZA 3EFEA 3CLTD 1VKNA 4UFPA 1U8AA 1PGPA 4I5EA 4DLTA 1Y3HA 4IDNA 4F1KA 4E2YA 2C2MA 1M66A 5LKRA 4C2TA 2Z04A 3DJFA 5LJIA 1ZX1A 2G4CA 5B2EA 4URUR 3AGPA 2K87A 3FCYA 4RYLA 1UJMA 1N5OX 4IIYA 1U2SA 1YJCA 3MJFA 4X91A 3WNDA 1LBIA 1IJFA 3HYCA 1DXHA 3PC3A 3BDAA 1SUFA 1BZYA 1US8B 4MB6A 4MI9A 5AVYA 4L9SA 5DEOA 4HZUA 5ERYA 4K6CA 4M9CA 5FHQA 1L4KA 1XJWA 2C5AA 4KQIA 1FUYB 3K9CA 4U7WA 1VXRA 1JI3A 5CFNA 4C05A 4DPLA 3O5AA 3AZPA 4QHTA 5T67A 5CT4A 4J7CA 3HJTA 5KYYA 4CMJA 6REQB 1EH5A 2FFRA 3BGVA 1CNEA 4ZQBA 3K2BA 3KETA 1HQDA 1KO8A 1J2RA 2ZSUA 3TM4A 1O0BA 4G89A 5ALNA 2FNAA 1ZM4A 2XOXA 4BNDB 1J8MF 3SBOA 1P3DA 1Q95A 1SVOA 2VQ6A 3FKSD 3MMPA 4OREX 4DSAA 1OLUB 2ONJA 5HUQA 2CNNA 1QYRA 1OZHA 3WK9A 3TEFA 1AVTA 3U3XA 1H1LA 2QRUA 4DJEC 5KNDD 3UAYA 4HEJA 1R64A 4RIFA 2XA2A 4Y9TA 2HWXA 1UJ4A 1YJ5A 4MITA 3TF5A 2JF0A 4UVGA 3A9VA 3BRWA 2CC2A 2AHRA 1I8TA 2IPAB 3GHYA 2PCLA 3AOGA 5DE3A 4X7PA 5IC6A 2DECA 2GTHA 2O2EA 4HGPA 1GGVA 4GLJA 4L95C 4X61A 4XYBA 1H66A 3OOYA 4N39A 1J25A 2AB0A 4H4DA 5KNCA 4QREA 3W7VA 5HK9A 1Q22A 1QU2A 4U2FA 1L7EA 1ZW6A 2W11A 1M8GA 2QNRA 3JWIA 2PGOA 1RBQA 3QYJA 4GVPA 2OXRA 1KYVA 2ZI7A 1NUHA 2WOJA 3KLMX 4KAJA 4YHHB 1XMJA 3QWBA 4RZXA 3S99A 5BOVA 2HDWA 2UZ1B 1GFWA 1EDZA 1FU7A 2HCJB 1FRNA 4LXHA 3HKDA 4O3FA 1KO5A 3HJBA 3ZWDA 2I54A 2H29A 3W06A 4Q15A 1QJ4A 1E4VA 2DR0A 5CVCA 1GOTA 4YMIA 2GPBA 4CCSA 4J6EA 5F9MA 3WBFA 3VDNB 3CJQA 4CIBA 2QY6A 4RDIA 2VA9A 4RFSB 3W4KA 2V7QD 1UWKA 4N48A 1J23A 4IH1A 2AFVA 2ENWA 3EUEA 1KC3A 2AJCA 3H2IA 3K8ZA 3VKFA 4UOZA 2H2AA 4CNBA 1H42A 2FR1A 1ZQ9A 2ZCUA 2QVZX 4D8VA 2P0EA 2VJKA 4EG4A 4UXJA 4EYOA 2W6CX 1G0NA 3RC8A 3N8GA 5KWVA 5AI9A 3EZ6A 3W3AH 4D4LA 3R7FA 5CCEA 4RZSA 2AN5A 5D5PA 4BNXA 2GF9A 3FWZA 4WNYA 3FNIA 2O19A 1HL3A 4DMRA 4P38A 4ZP1A 2DFLA 2A7XA 2KBFA 4C0LA 3JALA 5HQ3A 1Q50A 1GQOA 1JA1A 1YFLA 2Y1GA 3WJ2A 4B43A 2X6TA 1YSCA 4OEHA 4YCBA 4ENTA 1J39A 4ATNA 5IUNC 1I3CA 1JIVA 1ZD3A 4LF4B 1D03A 1U6IA 1DX9A 4P3YA 4TMTA 1Y1SA 1T8YA 2R25B 4OHMA 5CYFA 5GAJA 2QF7A 3UJAA 5BNZA 3QELB 2E85A 2VQDA 3TXYA 1NJ8A 2D5AA 2Q8PA 2FPGB 3OHPA 4LDPA 3DT9A 4OHVA 1TIPA 4MEJA 4P4NA 3T7JA 3EUAA 2GOYA 2IP2A 3PDJA 5CNMA 4YRCA 5KYGA 3ZHTA 3LC1O 2AMJA 3WO0A 4I55B 5ELXA 1T9KA 4ZGWA 5EHGA 3X44A 4D9NA 2ZYAA 2PEYA 1NBHA 2O0HA 5IU6A 1XJ0A 1NQTA 1V47A 1MHTA 3R3VA 4S35A 4JXXA 1YQGA 4NZ9A 2IHUA 4AMGA 5KUTA 2GQ0A 3O4GA 1XU7A 5JXWA 1Z38A 3QWAA 5KC9A 2QG9A 3PR1A 5B36A 3O2JA 3WQQA 3NT5A 1DT3A 3DDSA 1R8QA 2PIDA 3COYA 3D2LA 3C5EA 3RC2A 3GJ8A 2FLKA 3K5IA 1M0SA 2FR8C 2I5PO 1NY5A 4PHHA 4W5HA 5HDQA 5B1SA 3RUEA 3HYRA 3RSHA 2WICA 1YF3A 4IF4A 1K5HA 1JH9A 3B36A 3D6NB 3LHDA 3AKZA 3ICCA 1AKYA 2PYZA 1GRNA 4FLMA 2ZIAA 4WZBE 1WP9A 4LZZA 1UXIA 3B85A 5C3UA 1TRKA 2JD1A 2PZKA 2RGAA 3K1JA 4X41A 4YDSA 4ZO7A 3AM1A 1ZONA 2E55A 2ORWA 4R2LA 1JAIA 1RLMA 1YE8A 2Z4TA 4MVJF 5GOTA 1Y7LA 2P0AA 4LWPA 3WWPA 5IF3A 2XCIA 4RCVA 3EY4A 4UCWA 5EMLA 2QMQA 1T6XA 1Z7YA 4IRUB 5FA5A 3U3MA 4RY9A 4CKEA 1ZZGA 4KLCA 3O90A 5JMPA 3GLIE 1ZMXA 3EASA 5JCPA 1DADA 1H2YA 5EZYF 4WV3A 1QE3A 2BFNA 5E95A 1AT1A 2FFHA 4QULA 4UUBA 5E0KB 3SZGA 3AIKA 4IQ4A 1HBJA 1I4TD 3HBLA 5FF9A 3DBIA 3OLZA 4RAQA 3EJ6A 4QFCA 5AK0A 3U3JA 2PKXA 2BGWA 1SCUB 2O23A 3F5QA 4BB0A 2NTVA 3PU6A 2Z5GA 3DHNA 2ZKLA 2J9FA 3KZVA 4RE6A 4MTCA 3UH1A 4JJZA 3GFFA 4O4IF 2NZ8A 2ZJ5A 3WWZA 1VDZA 3A10A 3G5MA 2CDNA 2ASVA 4HVLA 3GZJA 3PIIA 1N6IA 4LS3A 3IUJA 4IWYA 4GI1A 1R0XA 2FRXA 2WJGA 2BM0A 2O8VA 1BNCA 4Z9YA 4ZYXA 5DN9A 1H0SA 3C24A 4ZZ3A 5FV4A 1CCWA 1L5MA 2N0SA 2GJ8A 4YV7A 3GJ6A 2EJCA 4E32A 2D6FA 1FNCA 3ROKA 3BD9A 2XDYA 2HRQA 3OESA 2P9EA 4OMFG 5IAJA 4GMHA 4FILA 3PEUA 3U9LA 2F59A 2OCXA 2Z43A 2ZRLA 3ZIDA 1GLNA 1S2MA 1J8FA 1TAQA 3EEYA 4R8KA 1ZSNA 3WLIA 3AHDA 2QL6A 5HUJA 2YQZA 4R05A 3WYNA 1KVQA 2IX9A 1JDJA 1TL7C 4U7JA 1P3JA 1DOHA 3TTUA 2C31A 3JYQA 5J2TA 1TQ8A 2GR9A 3AB8A 3OZRA 1PNRA 2H5JA 3FHCB 4TV9B 1PQ4A 3IERA 4KO2S 2NU6B 2P3QA 3GCDA 2WVJA 4KQ9A 4DQUA 2EJBA 4NU8X 5I7HA 3OPYA 3CO5A 4F5WA 2NXCA 4YRNA 4OOFA 2RGCA 3K09C 2E5WA 2GT1A 3H4IA 1FU4A 1OZAA 3B1JA 5CH3A 4YI5A 3IXMA 3T0IA 4TYWA 3MGCA 2Q6KA 4IWNA 4N5NA 5EUMA 4JLUA 3M89A 3SFZA 3U37A 4KLNA 2A33A 2VPPA 4NYMQ 1KI4A 1E1CA 3AKEA 4QBKA 2V54A 2C8KA 2P2ZA 2H48A 2VHQA 1N2CE 2REBA 3O4JA 2VHTA 4AC9A 4AKIA 2XF2A 1AD2A 2ZRFA 3SHTA 3VVLA 4CIVA 1GAXA 2ZIXB 3BC1A 4NJEB 3MOIA 1GGFA 4D41A 1WIWA 3HBAA 3OFVA 1DHRA 1J70A 3L6RA 4OUKX 4QUIA 1T0UA 1KAOA 1HTTA 1OXBB 4FDMA 1XD2B 5JJBA 3QM1A 3TR6A 5CH5A 3VPAA 3ZOKA 1I5OA 3MWLA 3V7FA 1FP4B 4LDZA 1EHYA 3G0DA 1QQAA 4JJ4A 4YLGA 3SZMA 4B40A 1U2ZA 3PL5A 1NUQA 3ROEA 1Z6PA 3QFHA 3E1SA 1QYWA 3HKEB 9ABPA 2YXEA 3JD0A 1N8TA 1KNXA 2PL9A 2BEWB 2VP5A 3A3NA 2VG8A 4PAMA 6YASA 1UBCA 2CSUA 4XLLA 5JNUA 5EJ5A 2Z3WA 2O3SA 1C0LA 1RAEA 1A9TA 3H2GA 3KSMA 4BWYA 4UFNA 1L3BA 4M1SA 1J20A 3K94A 3MPUA 4HTFA 4KE8A 2OGUA 3GGDA 4KMRA 4Q1AA 3BXGA 4KR3A 1EINA 1DAMA 4YCDA 4IG4A 4IEEA 4CODB 4XDYA 2AQHA 3BDVA 4CMEA 3ZGZA 1GN9A 3L6OO 4MV0A 4F92B 4ALJA 1U3DA 1UWVA 4F71A 3FTPA 1A77A 2RC6A 2ZRCA 3G2NA 4WI1A 4JL5A 5CCBA 1V4BA 3VR4H 1JWBB 1LPAB 3RSCA 3I5MA 4CMBA 3O8LA 1MVLA 3MINA 2LP4Y 2ZAIA 2IYEA 1FFEA 2OBNA 2VN8A 2Y99A 1FUUA 3PK0A 5G0TA 3SKYA 4WBNA 3GEDA 4F96A 3GJYA 2YWHA 4GOKA 3ZS8A 5DSTA 4C3VA 5AUOB 1DIAA 1XZBA 2WIAA 3ZNPA 5KYWA 1BXKA 3H4VA 1HL7A 3FOAA 3H97A 4YP0A 4TZTA 3LP8A 4OJMX 4HC4A 3RS4A 5EHZA 3QWIA 4BE9A 4HWTA 2FN3A 2DPGA 1Q2UA 3G2PA 1YV9A 3QOFA 4YP1A 1ZOOA 4R1OA 4BRSA 1OHHA 1HE8B 3B52X 2VJAA 1UQRA 5JSQA 5JTTA 4KUGA 3K9QO 4XCVA 3BTVA 5AXBA 4OBEA 4BKPA 5HKBA 4KHZA 5IWAB 4D3XA 4WD3A 1P0IA 3CSUA 5L3QB 3GRKA 2E82A 4MQLA 3DE7X 1P9NA 3RDPA 4H0FA 4K46A 4P53A 4DUGD 3OMWA 5K3OA 2GXQA 4QYWA 1SKUA 2BFBA 1WMAA 1N4DA 3W9YA 1PW5A 3WWOA 3TPFA 1Z88A 5IBPA 1TYDE 1JMYA 3AWIA 2FW7A 3EVFA 4R7ZA 2Z8YA 5FKJA 3RYIA 3PJRA 2NZ2A 4A6PA 4F3TA 4GDMA 4D99A 2YMLA 1OFTA 3ZI0A 2BIFA 3W9BA 3WIVA 2QUJA 2VZLA 1YDWA 1TCVA 4MOWA 3FSRA 4NH0A 3TBHA 4YT5A 5BSEA 1JBQA 4LNUB 3UK0A 2PLRA 3ZUPA 2BFDA 2P9QA 2TMYA 1JDVA 1ZCZA 2H54A 2XB6A 3GG2A 3MRTA 1OHHD 1BD4A 5KDOA 1L1EA 2WB2A 1J2YA 2ODPA 1VE3A 2JVIA 3GEEA 4LCEA 4XKJA 3FPLA 5EIHA 3UA4A 1UFQA 3NRCA 1E2HA 1J97A 2GDZA 3W2GA 3WYBA 2PVPA 3E7PA 3DEIA 2YIVX 3UMCA 1QHNA 1LW7A 1VFNA 3M9XA 2C2YA 4IGEA 4KR2A 3SYNA 4B6OA 3K8YA 1GKYA 2C42A 4M3NA 1GQYA 4IDQA 4PXAA 4DPKA 1DUSA 1T5HX 4O4JF 1DS6A 3L01A 4FUQA 1UBUS 3DH0A 3KYBA 3HDTA 3IPLA 5HIIA 1SQ6A 1FE8A 5DCWA 3NBQA 2XKJE 3G2QA 3G9ZA 1CHNA 1TU4A 1DCTA 3V8BA 2QPLA 1WMEA 4I55F 3SZOA 721PA 4E11A 1RXIA 1KPGA 4NMWA 1Q1QA 2QY9A 1UMDA 3RVQA 3BKXA 3DPSA 1E4OA 2CNKA 3A1CA 4L73A 1LJLA 1GZ7A 3O8RA 3WLJA 4DEYA 2Z8XA 3MA0A 2PGDA 2R1TB 4I5FA 3IX7A 5ENDA 1FPQA 3I72A 4GYKA 3BSSA 1XZEA 1CJVC 3D3EA 3CR7A 4YK7A 2AQKA 5T8KC 3RM3A 2L2QA 2ZRBA 4MI1A 4DFDA 5KYVA 2X76A 4GRIA 4Q6BA 4FK8A 1Z3CA 1Q0SA 3IJRA 1RBMA 5MF6A 1T10A 1TD9A 2QRGA 2XNKA 3DS8A 1DAIA 2ZUFA 4G8JA 4D0GA 1T1GA 1JDTA 4KNVA 1CEEA 1DKLA 1NN0A 1OYYA 2WIKA 3GGSA 3SEQA 5CA0B 5HYVA 1F2TA 2BISA 4NECA 1KY5A 3SAJA 4CM3A 2QW1A 3BGSA 5CDFA 3OE1A 4IKPA 3TCNA 1KAHA 3T7DA 3M4ZA 4A23A 1G8HA 2FRDC 3TSZA 1NDUA 3HPQA 1T3SA 1Y42X 4PZZA 2X1VA 3H11A 1CY7A 3D8NA 3D59A 3DL2A 1H69A 1Y3CE 4R0VA 4E46A 4C4PA 1ID8A 1OT3A 1ZXLA 4XTCS 3TNFA 3UMSA 1H3NA 1SHLA 1VLLA 2G9NA 1C1DB 5ALGA 5DLDA 4I1YA 4DR7B 5JH7F 3A9TA 4TROA 4IQ0A 2AQIA 4NMHA 1W9HA 2CB9A 1K8YB 3EG5A 3OLVA 2IITA 3IQHX 2BJHA 3FB4A 4IJVA 2HMYB 5CG2A 1CC1S 5EPUA 3EZ7A 2WWYA 4E13A 5KI6A 4DQDA 1VRWA 2V7WA 2A35A 2YXNA 3EEBA 2VCYA 1JIIA 1NVKA 1S1MA 2I6TA 2VJMA 1X1AA 1NE7A 2W6ID 4GH5A 2QUIA 2CXOA 4PF1A 1GSOA 4YAGA 4YXWD 1SXJA 4KE6A 3WLMA 1LLDA 4B3JA 1UJBA 3EXHB 4ASUD 5LXTA 4BX0A 2BR3A 4LXGA 1FL9A 2HAEA 1ZWLA 4CI9A 1DU4A 4X1KA 4DWVA 2ZCJA 1OKKA 4XLZA 4IDPA 2D0OB 2I33A 2ZYVX 3TTSA 5JSUA 2F67A 3SBXA 2FX2A 4NK5A 5GONB 2IH4A 4EUSA 1VCNA 3ZWXA 2HK6A 3E9EA 4PSKA 4PLGA 4F6RB 1B0AA 3CXUA 4MS1A 1AMNA 4N5HX 3CXRA 3B82A 4E14A 1NAIA 2CZCA 1XALA 1XJ5A 3PD0A 3E48A 1WW2A 4IVNA 4N18A 4KLAA 4HTFB 4ED9A 4UEWA 3B8EA 1R4AA 2ES4A 3PWKA 4K1LA 4LJSA 4R0MA 5KWSA 2Q5LA 3INNA 3Q3JB 1VMKA 1XA0A 4JBHA 1M34A 2UYOA 3SX2A 3ZOZA 2ILTA 3P9KA 4P7GA 1PN3A 2W6JD 4CKBA 2PRIA 1BHQ1 1WVGA 4N3AA 2VP9A 3VQTA 5A62A 5I4KA 1N0WA 1XT6A 2JJMA 4CLOB 1PG5A 3MWDB 1T13A 4ODIA 1IBSA 1LPBB 4RL4A 1JBEA 1PUXA 1CKEA 3MINB 3EH1A 2JA1A 2QRMA 3FKJA 3BBPA 2P9YA 1LU9A 3KU4A 4B8YA 4QGSA 3G0OA 4GI5A 1KQGA 2PXAA 1MQ9A 3OKAA 5HKAA 1Z2CA 5LDHA 2FU5C 2A2ZA 1FW8A 3BEOA 3EF1A 3T7IA 4PGMA 2VRWA 1CIPA 1E9DA 1C3OB 1K7FB 2OGZA 5JVDB 4CT5A 2GJAA 2VPQA 1GG8A 2W9XA 4D3SA 5C0OE 1EVKA 1VTKA 3N3AC 2C9BA 2R751 5G41A 4EHKA 2EWWA 3IP6A 2HJSA 2VJYA 4ZJPA 1SCIA 2WZQA 2IKQA 3LRTA 5AVZA 3ZKWA 5EEGA 4UNRA 4ZXFA 2ZJ0A 1ENZA 4YS6A 3VR3A 4HLCA 4ZCRA 1O1YA 2WFLB 4UE2A 1I6MA 3CPEA 3TLJA 4BKRA 1ODCA 1W2GA 5F12A 3ELYA 1L7RA 4Y6OA 2QL7A 1AQJA 1K06A 2NT3A 3VNQA 1Q0HA 1PG0A 1ZBQA 3QU2A 1F8GA 3KU1A 4RTLA 5HP4A 4GOXA 4XUCA 4LHXA 1EGAA 4MS4A 1R9JA 4K9DA 1JR3A 1MXFA 4FYIA 2W5UA 3CZAA 5EXXA 5TJ9A 3TW4A 1NVUQ 2GN2A 3AL3A 4V3BA 1ZMOA 1W36C 4MI6A 1YQUA 3BFPA 4GMKA 4YRTA 3T3DA 1HY3A 4QJ4A 2UAGA 5EZSA 1S2DA 3M6MD 1JQ3A 3HY6A 1GD1O 2C92A 3E9RA 4HTAA 1U3TA 4TN5A 4AX4A 2J0QA 2WYUA 2N46A 1D8AA 1MAUA 1ZK1A 3FDZB 3SQNA 3W79A 1Z26A 1L5OA 1OXXK 1UBHS 5GONF 1UM8A 5A05A 3V6MA 4TS1A 2J3JA 2BHLA 2DQ4A 5FQNA 2DJ5A 3UZUA 4ER5A 1NW3A 4IXMA 3I58A 4FWTA 4CN9A 4E09A 1K0FA 5HZMA 2Y1XA 2QG4A 3M3HA 4HXEB 3ZGYA 2V7EA 1KZYC 4D8YA 2PUCA 3ZS9A 2IHBA 2N47A 3GLFA 3VDMA 4EI9A 1TEZA 3E84A 1D2GA 1WM1A 3UJPA 1JU3A 1X42A 3EYAA 3OFKA 5FL7A 1KQ3A 1MAAA 3QWFA 4D9HA 5CLIA 1DV2A 3G49A 1UK6A 2EJWA 5B2ZA 3HLTA 1CDEA 5JT1A 4YJ3F 2QV7A 1L7PA 2V6JA 4WSOA 1V9SA 2NV0A 1I10A 1RYBA 2C96A 2BFFA 3IVMA 1PWEA 2IBTA 1PZHA 2C00A 1RFGE 1GSHA 4J2HA 2E89A 4OYHA 4QQKA 4E03A 5KHLB 2G9VA 3NTRA 1VMAA 4MYCA 1V7CA 4MVJI 2YFQA 1IBRA 3IGFA 1U3VA 1OZGA 4TLMB 4C01A 2Q4RA 2D0PB 3QH4A 3K73O 4JEHA 2HX1A 1CQPA 3K20A 3VR2A 4UUNA 2R0QC 1TYZA 3B3QA 2Z8ZA 1T3GA 2VNIA 2H2DA 2GA9A 3F2IA 3HP7A 4NMMA 2DH6A 5IJZA 2VYVD 4X66B 2QXYA 1V8OA 3CCBA 4MH0R 4E3WA 4K6MA 2P4EA 2VYQA 1CDZA 2O8NA 5FBQB 2NO7A 4YJDA 1QQBA 2JAHA 3OQHA 2ZXUA 3VOAA 5ALOA 3UEOA 1E3SA 2IQ5A 3ZE6A 1AMOA 3MTJA 3AVVA 4LRTB 1VP9A 4ALKA 4RYDA 4NEHB 3A4YA 2IEGA 1R4ZA 3FZQA 3V4ZA 2UVDA 3GRVA 1AO0A 3D4LA 2O2DA 4DG8A 4MAMA 3I30X 3BSFA 3NYWA 4HDRA 1RPZA 2JCBA 1G6Q1 3TNDA 1W85A 3LDGA 2FMIA 2XWJI 5HIJA 2BCGY 1P1JA 2C03A 4LXXA 4ZAZA 2VKQA 2JK1A 3PEVA 1L7DA 4J76A 1QMPA 2H9IA 4JOCA 2VJMB 2EATA 2RGUA 1W0KD 3C3JA 3RBAA 5HKKA 3FX2A 1E99A 1ESEA 1I33A 1R4MA 1QGOA 1Z68A 2D5IA 3ELUA 1YU9A 2RGBA 3H1EA 4Y7CA 5F5NA 1E3JA 3KEQA 3KXDA 3SDBA 4B5KA 2FGJA 3ZU3A 1GAWA 4ETMA 2P79A 5HZHA 1TE2A 3DE2X 1SEPA 2VTDA 1S1CA 3DZBA 3OZSA 2ODNA 4FZ5A 3TVYA 3V8EA 3ZU4A 3B6EA 5FPPA 4WOPA 1U0FA 1XFDA 2JKZA 3TGWA 4ASUA 5IK2D 4G4GA 1E2MA 1UK7A 1IY1A 4LOIA 3KQQA 1OMOA 4MK4A 5FTNA 4G1MB 1Y1TA 5G0SA 2H2HA 4L27A 1N6PA 1SVUA 4R01A 3BL5A 5G4KB 1HDIA 1QZ3A 2C1EA 1V4NA 3MCWA 3NI2A 3OWOA 4OSPA 3TW8A 2QORA 5ECWA 3O4FA 1SHKA 3E58A 2BZ1A 2ZI3A 1AHHA 1WVMA 2HRZA 5AWFC 1DQNA 5GIPE 2VP2A 1YOBA 1PGNA 1QHIA 3LYLA 2HQ1A 1YIOA 1US8A 2I2BA 5EJ7A 1UQTA 3Q0TA 4M22A 1DAFA 5JFOA 4OP1A 3HDGA 2AJDA 1FVFA 3TR5A 5DHAA 3EAQA 3OSZA 1Z5OA 3IQXA 4ZMBA 1ABFA 3GFBA 4XYMA 3H5VA 5BSHA 3W5BA 1NGSA 2BKAA 3N6VA 2B5VA 4MXDA 4BO2A 1IC6A 1LDBA 1XHEA 2EGHA 2NT4A 4KQWA 5EIWA 4B4UA 3RWMB 4E30A 4CM9D 2W8ZA 4MQEB 4D96A 1P7YA 1R5BA 4R0NA 5ALYA 3UHFA 4B6QA 5JH7B 1NRWA 1TJYA 4G5QA 4BNDA 1E9BA 1SGWA 2XNDD 4KXWA 4A8JC 2HSZA 4WZAB 1TT7A 4EELA 2NU7B 1V3VA 2WJ6A 4C4TA 3OIUA 2FDCA 2BJWA 2C4NA 1PQUA 4P5EA 5ICMA 1C3JA 4PYRA 4G5HA 1N0HA 1NBWB 1O95A 1XAGA 4XQ0A 2YOHA 4DA8A 5KEIA 2F4NA 2RGYA 4RLHA 3DVLA 3UN1A 3R5HA 2JLYA 2IZ1A 2OGTA 4KHPB 3N28A 4DCSA 4NWIA 1DC8A 1TO2E 4QTYA 5EYPA 4P34A 5MFZA 3VNVA 4FMBB 4FHEA 1HX7A 3OPQA 1T1SA 3K72B 4TKUB 5G40A 2HQOA 3DYVA 4Q3KA 1WX1A 2H4YA 3FMIA 3FUXA 4AROA 4BVFA 4BEBA 2VZEA 3OJOA 4PR3A 3RU3A 1FX0B 1UJ5A 3WKBA 2PT9A 4G8BA 4G9EA 4OHWA 1N8NA 3AW8A 3AFNA 2BSQA 4DDKA 4LPKA 2JI4A 4LGMA 3UH0A 3SJAA 3U31A 5KKCA 4JLPA 4KC0A 2GYYA 2ZXEA 2B35A 4G65A 1K08A 3G6KA 4D45A 2A67A 4D0NA 1WO8A 5DX1A 4BN0A 2A1TR 3ODPA 2DCMA 4RHCA 3C5CA 3HACA 3FUCA 3CA8A 2VYND 1G18A 2OA0A 2C0PA 2OVFA 4AZWA 5ILOA 1FBTA 4CEJB 3T3NA 1EJ2A 1V9CA 2X5KO 1NJSA 2JGDB 3HABA 4J03A 4KN6A 4PW0A 3V8QA 4NXNB 3SS7X 4J91A 1DWUA 4H17A 2VHYA 1U99A 1XZPA 3ESYA 3TG8A 1I3MA 2I2FA 1Z34A 1G8MA 4CETA 2BAGA 4BGEA 3ER8A 2FPLA 4R7GA 1WDLA 3VSCA 2RHDA 4KI7A 5DZSA 4RGQA 3SJZA 1GPNA 5IKEA 1B1CA 3USES 3DTTA 1FP1D 3FFXA 3MEQA 4UHEA 1NLFA 4P92A 1FSFA 1U28A 2OV3A 4IRMA 4MVWA 3K6SA 1AE1A 3DBRA 5EHIA 4EJ0A 4R3WA 1ANKA 1EP9A 2YY5A 3V8RA 2WIGA 2Z1MA 1PR3A 3WISA 4AMZA 1DKQA 4DLYA 3FNQA 3UJDA 1EFDN 5GTDA 1Z0JA 3F3KA 2HA6A 5IT0A 4HH3C 1S96A 4XX0B 2I3GA 3H18A 2FQ1A 1GRCA 1KU6A 3R44A 2XCRB 1R12A 13PKA 1WXGA 3S1AB 4IKOA 2OCDA 3CTPA 2VT6A 4DSNA 1UH5A 5C5DA 3GLQA 1OH6A 1CR6A 4P84A 3UXMA 3UWKA 4BNGA 5C18A 4UTNA 1XP8A 3EZ9A 1VHWA 1VIYA 3I9NA 1SMKA 4ZZ2A 1QIDA 3ZWWA 2PANA 1KSHA 3LQ2A 5C8YF 4MDEA 1AC5A 3ZY2A 1AMUA 1ZJYA 4V1CA 4F2WA 4ZOQI 1NJ1A 3LBIA 3OZAA 3P9QA 4JYZA 1IBMB 2RB4A 3OM1A 5FADA 3TWOA 4EM6A 4F5DA 1EG7A 1VYTA 3KK0A 2PO5A 4ROSA 2X19A 3KC2A 3C6QA 5D3KA 4S1TA 1FTSA 1LDGA 2JBAB 3DA8A 3NG1A 4JK3A 2EEZA 4GW3A 2WJVA 3OLYA 4V2UA 3T3PB 5CD9A 4CLRA 1UXKA 5JANA 3LUDA 4J16A 2WLTA 4FINA 3TDMA 2V98A 4AFNA 1KH3A 1ND6A 4LTMA 4XGRA 4E1AA 4OM8A 5A4AA 3AF6A 3W3ZB 4FZJA 1RRGA 3DUFA 1X1TA 4XQEA 1WXXA 3DB2A 1P33A 3EZYA 4DCMA 4NATA 5TQ0B 4V0OA 5FH9A 2YJZA 1E9CA 1FNMA 1OGIA 1X8KA 3E18A 1P8JA 2KQUA 4RY8A 1XQVA 4B83A 4TVKA 2WKSA 5C53B 1Z4QA 4R8VA 1V5IA 3LQ4A 4OXQA 3V1TC 2F8LA 1E7YA 4WK2B 1DIGA 4RK0A 5KVVA 1GGHA 3FSJX 4LYEA 4D97A 2NQ2C 5BT8A 3U9TA 1E2QA 3QF4B 3EK2A 4DIMA 4D92A 2Y68A 1JDSA 1U3GA 3KJFA 5GINE 2GBLC 2C5SA 1RS0A 5FLYA 4PX5A 4E5YA 1I32A 3H1TA 2WJWA 3B9PA 3UY4A 1JR2A 4OQEA 3FYUC 1IN5A 1CQWA 2PQ6A 5ECDA 4BVGA 2GEVA 1SHUX 3TKLA 3VV2A 4DL9A 4DMKA 4KN8A 2JASA 2JLBA 3Q7QA 5K7SA 5EUCA 4RD6A 5EVJA 1F0PA 3D7SA 3EARA 2HPAA 3AF1A 1G5FA 4BB5A 3WOVA 4C20A 4JGIA 4YAIA 5IFLA 1N1MA 3B51X 3KYCA 3KXKA 1PZXA 4JFAA 1H0HA 1RWWA 2B4YA 2IA5A 3TIIA 1O87A 2IEAA 4FEYA 4QDOA 3TI7A 4CZ2A 2FPSA 2VPTA 2WWIA 3AI3A 3DO8A 1KEZA 2YFYA 4Y0NA 5M34A 4FR5A 1Z0FA 3AEKA 3CZRA 3ZQ4A 1FPMA 1L4BA 1M6VA 2AR7A 2ZSHA 3AEUA 3AESA 2DLNA 4KKXB 2FX3A 2CNBA 5L45A 2CVQA 3B3AA 4YCAA 4KVAA 1U5BA 3N3BC 1MB0A 4LOHA 3T1NA 1RQGA 3ZDQA 4QG3A 2KX7A 1JFSA 3CLVA 1RCUA 4DIBA 5KYKA 1I2DA 4MUNA 1C30A 4DB2A 5EQDA 5IZ4A 1TTQB 2NYRA 3HNOA 4GPZA 2FOIA 2WI8A 4MDFA 5CPFA 2VDRB 2R8XA 3LA6A 2X0EA 4BEVA 4C0SA 4CDNA 2CKMA 3U26A 5C51B 1YVRA 3LX6A 4YX9A 3R23A 4F5YA 2HBRA 1GVNB 3DP7A 5AOBA 4EGSA 4RZ3A 3X2SA 5M04A 4X65B 1N32B 4LGCA 2GM9A 5M5BA 3GZNA 5KOJB 3V4RA 3K9NA 4KPYA 1G2QA 1QHXA 4UZEA 4B75A 2GPAA 1FEZA 4TYPA 4WLUA 4FC7A 5J2TB 3I6YA 1JG6A 1D4AA 2X0FA 4HWRA 1M75A 4CE6A 2GUGA 3I32A 1C9DB 2VOJA 1ZUIA 3HMQA 3IIMA 2OCBA 3O9MA 5DCYA 4AN4A 2XD4A 4MCJA 5EYPB 5AIBA 2Y4OA 2WC1A 3TFWA 2ROQA 1GUFA 2XDAA 1JU4A 3K1ZA 3NHYA 1NVMB 4YRJA 1YACA 2C5BA 1GFIA 1Z82A 2JIBA 2QKYA 2VI5A 1RXEA 2WYWA 2AR0A 2WINI 3R2JA 3ZBTA 4IWXA 2VXCA 5BN4A 5C8DA 1WLSA 1IWOA 3ENNA 3HJCA 1NSYA 5JI2E 4IMIB 2YV1A 3KWMA 2GK6A 16PKA 1IY9A 3QVWA 1ZAKA 3V00A 1JLRA 2DHQA 1IOWA 5GV7A 4Y6LA 1Z17A 3PFHA 4HX5A 4COOA 5JXHA 3IAEA 1XQ9A 4C21A 2I9PA 3G8BA 4QTXA 1KI1A 5AHOA 4QPNA 1F8XA 3P52A 5JNVA 3RTCA 3PX2A 4U5XA 1EVLA 4AO6A 4C0WA 2RB5A 1CE8B 3LT5A 1R18A 4UHJA 2ZRNA 5CB4A 3LX8A 3OBIA 4P2GA 3RTBA 4Y6GB 1XL0A 4KBGA 3LOQA 1J0CA 3U49A 4B33A 5CD1A 1MABA 1QHFA 2CDCA 4B0PA 4KAXA 2DULA 3E2PA 1I0IA 2HI0A 3H13A 3LQFA 1V11A 3HR8A 4QPCA 2BEWA 1X77A 2ZS7A 4FI3C 3BMQB 4HRVA 1W0JD 3DMRA 4L16A 1RZRD 3IELA 5IPFA 1KDTA 2VK4A 1Q7BA 1IY8A 2GZ2A 2WHQA 3A58B 3HDHA 4BFCA 2QN1A 3K6SB 3DBRB 3FN4A 5A06A 5BR8B 1DGQA 1S4MA 5CIWA 3JQQA 1PGOA 2WY2D 3CMMA 4RK4A 2R6ZA 1Y1QA 2ZFUA 4YT8A 3AUYA 3IDQA 1XKLA 3G2OA 4R2HA 2X40A 4QU8A 3PGKA 2YIJA 3TAHA 5DLEA 2AOWA 2IXDA 3HTXA 2Q21A 3ONDA 3ZIUA 3JAWB 3RJ5A 5C8YB 1ZFNA 2P30A 2WK1A 2FY8A 5GMOA 3FDJA 2CHGA 4P7BA 3RBZA 3QX3A 1XWWA 1PQWA 4TVSA 2HCTA 5DM70 3R3XA 2H7YA 4MB2A 4QGFA 5U4QA 5IDWA 3B1KA 1G20A 3GGPA 3H5LA 4GL4A 3UNXA 4U8GA 2XBUA 2BELA 2NADA 2G9UA 5IKPA 3ZX5A 4AUNA 1SHTX 2IXEA 2JNWA 3Q6NA 1V6CA 4Y2UA 5AW3A 3PUHA 4KR6A 3Q3GE 4QGGA 1QVAA 4NDAA 5DM0A 1SKBA 4AO8A 2GCOB 3AJ9A 4UMVA 3FOFC 2K2QB 3NHRA 3HC7A 4GWGA 4R51A 4RJTA 5HM6A 2PVCA 2Z08A 3ESRA 1EGQA 2O2XA 4H1TA 4KN9S 1TIBA 1K7CA 1U02A 2CXRA 4IX9A 1ORWA 1YO6A 3FCAA 2ST1A 4LSZA 3DOFA 3Q8XB 4DOMA 3LPNA 4ZT3A 1IQ0A 3IULA 1J0XO 3CTMA 5DV9A 1FYVA 1RXCA 1O8BA 3C8DA 4FFLA 4ZREA 1OI4A 4Z51A 4MPPA 2BHNA 2NUAB 2NP6A 1OTHA 1DIHA 4MW1A 5KU7A 4C78A 1R9MA 2V7VA 2VYCA 5CBKA 3D3JA 3BAZA 4B3TB 4LTNA 2VXYA 1D1TA 2BLNA 1S3GA 1HOTA 2HMWA 4TMWA 4G84A<