1RKNA

Solution structure of 1-110 fragment of staphylococcal nuclease with g88w mutation
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
110
structure length
110
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRWLAYIYADGKMVNEALVRQGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease
pubmed doi rcsb
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
total genus 10
structure length 110
sequence length 110
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2003-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rknA00
5CV7A 4B9WA 5NUCA 5C3XA 4KHVA 2F0LA 4I65A 5IIFA 1F2YA 2PYKA 2QDBA 4K2KA 5DEHA 5CC4A 2KQ3A 1IHZA 2F0IA 2RDFA 3TMEA 1STAA 4WRDA 2EYMA 2SNMA 2EYPA 1SYBA 4DU9A 1KABA 3OMCA 5ISRA 5KEEA 5KRUA 2F0FA 5CV8A 2EYJA 4KD4A 4B9XA 4EVOA 1EY6A 5JOBA 1SNCA 2F3WA 1KAAA 4HTHA 1JORA 1SYCA 1EY9A 4KY7A 3SK6A 1SNMA 2M00A 4K6DA 3SK8A 2F0EA 2KHSA 2PZWA 3U9OA 2F0KA 2HQEA 4KD3A 5HURA 3EJIA 4F7XA 3H6MA 4OL7A 4KY6A 3TP5A 2EXZA 2SOBA 4IALA 4NDXA 3ITPA 5IODA 3T13A 1JOKA 1TQOA 3P75A 3PMFA 4K14A 4PMBA 5EKKA 5C5MA 5C5LA 5KIXA 5J39A 2LKVA 3NXWA 3OWFA 3P1HA 3C1EA 1NUCA 4LAAA 2F0VA 3OMGA 1RKNA 3D8GA 2F0OA 4YIJA 4EQOA 2F0UA 5K5PA 5CV9A 2F0SA 5I6YA 5I9OA 3TP8A 1EY0A 4K5XA 5C3WA 1EZ6A 4RKLA 2F0GA 3BDLA 5EKLA 3SR1A 5I9PA 4DFAA 2EYOA 4QMGA 5E3FA 3MZ5A 1SNQA 4J1MA 1JOOA 4KV6A 3S9WA 5CV6A 3D6CA 4KY5A 4N9PA 1JOQA 4KTAA 1SYDA 2WACA 2EY2A 3D4WA 4HMJA 1EY5A 3HZXA 4KJNA 1A2TA 5C6AA 5J1ZA 2F0DA 4NMZA 3HEJA 2PW5A 2F0MA 4K5VA 1KDAA 4MIUA 4PMCA 5I6WA 1A3UA 4K5WA 4N9TA 1II3A 3NQTA 1TR5A 2PZTA 5IGGA 3VA5A 4K2LA 2RKSA 2OEOA 1EYCA 3NP8A 3NK9A 1AEXA 4HMIA 3E5SA 3SXHA 5C4ZA 2RBMA 2PQEA 2EYFA 2F0TA 3ERQA 3QB3A 5CV5A 5EGTA 1F2MA 1NSNS 3MEHA 5F2DA 4ZUIA 4E6IA 4ODGA 1KDBA 5IOCA 1A3TA 2EY5A 2OF1A 3NHHA 3EROA 3V2TA 1SNPA 4G57A 1SNDA 3SHLA 4ZQ3A 5KYIA 1EY7A 4NP5A 1EZ8A 4NKLA 4QB4A 4ZUJA 5M9OA 2F0PA 4IZ8A 5KGUA 3NUCA 3R3OA 3EVQA 5C4HA 5IGDA 3LX0A 5DAUA 3MVVA 4KJOA 1SNOA 1EYAA 3OSOA 4DGZA 1STGA 3DMUA 3MXPA 5IGFA 1EY4A 3QOJA 2F0NA 3TP7A 4DF7A 5CGKA 2SNSA 5JAVA 1SYEA 3BDCA 3TP6A 4QF4A 1ENCA 3SK4A 1F2ZA 1EYDA 4IUNA 4R8NA 5KYLA 3QOLA 4EQNA 1TT2A 5E1FA 2EYLA 2F0JA 3MHBA 4K8IA 4RKBA 1EY8A 4K8JA 1STHA 5HGTA 1A2UA 2O4XA 2ENBA 2EY6A 4TRDA 3D4DA 2F0HA 1SYFA 2NUCA 2EY1A 2EYHA 2OXPA 3RUZA 2F0WA 1KDCA 4H7BA 1STBA 3C1FA 3DHQA 4WORA 4F8MA 5CV4A 4S3SA 4PNYA 5IGCA 5IGBA 1U9RA 4J6HA 2PW7A 2PZUA 5J22A 3T16A 1STYA 1ENAA 2F3VA 5CR3A 3SK5A 4EQPA 5IGEA 1SYGA 4ID6A 4ME5A 1STNA 1EQVA 1A3VA 2F0QA
chains in the Genus database with same CATH superfamily
2A19A 4RGOS 2LFNA 3WDNA 1PRTD 2MHVA 2N88A 3NBHB 1UE6A 5C44G 2F03A 1SRUA 2IY5B 4YWMA 1SYBA 1IW7D 4DU9A 3OMCA 2CW0D 1Q46A 4A3IB 1TY0A 4LW1A 1XMQL 3A7AB 5DNFA 1X65A 5FJ8G 2FHTA 3L3OC 2NB0A 4DAYB 1GVPA 1Z6HA 1HFGA 1HZAA 3H3VI 4KLKA 1MJCA 3ITPA 4DKAC 1I4PA 2GA4B 3N6RA 1N32Q 1JOKA 3IRBA 3E9IA 2E8GA 3TBIB 5JJLA 4DPGA 2AUJD 3NXWA 1PTOC 2E2HB 3S1RB 5A2QE 1BCPD 1U4RA 2WAQE 1G91A 3J81i 4LF9Q 4XQQA 2KCCA 1QB5D 1LLRD 1NBWA 4FO2A 2JJQA 3KYHC 3PF4A 1ET6A 1YJ9A 2R7DA 4NMZA 4XTCS 2QDLA 4K5WA 1KXLA 1RF2D 2GN5A 2RKSA 1L0XB 1UE5A 2UUAQ 4B3TL 2HDLA 3CPFA 3IAYA 2RBMA 2PQEA 4G4KA 4Z9CB 5IYBH 4JBMA 3FKIB 1F2MA 1NSNS 1S5FD 1Q82C 3RLFA 2CQOA 1IBLL 1K3RA 1D1IA 1EZ8A 1GHJA 4OWTB 3UDIA 3CCEA 3KF6A 4DA2A 2FJ2A 3CF5A 3S2HH 1B9MA 1NE3A 4Q5VA 4DV0L 5M5WH 5C4JB 3VYTA 4L6TB 2F4VQ 4IUNA 4DR6Q 4A3EG 4L5RC 1IBML 5CYUA 1M4VA 4PZ8A 1VS0A 2BDOA 3A5ZB 3EIVA 1X3QA 3STBD 1PFNA 5EAYA 4JI4Q 4ALPA 2J0TD 5IGBA 1N34Q 4GS3A 3HOYB 1CQVA 4QIWE 2PI2A 1C7YA 5FLMG 4RHSA 4JBJA 2G9DA 4H0LC 4MIUA 2WIIB 3TS2A 5LMNQ 4XYQA 5IIFA 1PXUA 5JPMC 1EIGA 4P2CB 3PSIA 2OCEA 2CWAA 3V96A 3A74A 2ZJRA 4DNIA 1Y14B 2VW9A 2CCZA 1TWAH 1YNND 2DY8A 1FYCA 4JYAL 1VQPA 1LT3D 2AWNA 1WFQA 4BY7G 3KLSX 3DM3A 2AQ2B 4KD3A 1TS3A 3H6MA 3HOWH 1F77A 4DR3L 1HRJA 4HJ5A 1EFID 4K14A 1I94Q 3OWFA 1DJRD 4B3SL 2K5WA 3UDXA 4JBKA 2A8VA 4X3UA 2K6AA 2F4IA 4H02A 2NVTH 1LABA 1PTOB 1EOTA 4C3JB 4L5QA 1JE5A 4U68A 5E3FA 4QGUA 1BKBA 1KL9A 2YTVA 2VZAA 3BYTB 5J1ZA 4A3JH 4JI0Q 2KENA 3JAML 2JA8H 2R61A 4A3MH 3GV6A 2Y0SB 5LL6X 4DR1L 3WOEA 3LWEA 4IO9A 1X55A 1YNJC 4HJ9A 3HG9A 1UEAB 1A3TA 3PQIA 4EQ5A 5JEAG 4FXDA 1ET9A 1WJJA 1EEFD 1SNDA 1SXTA 1LUZA 1ESFA 1W6JA 3KFUA 3HOUB 2UU9L 3NELA 4XYOA 3PIOA 2D9UA 5AJ3Q 1XNRL 1C0AA 5IP7G 4JI1L 4L5SA 1DCZA 1HPCA 1SR3A 4JCVE 2N3SA 2XTIA 3CMEA 2KUMA 3KF8A 4A3FH 4GKKL 4QF4A 1SE8A 1HQMC 1PTOF 3MC0B 1FVIA 3NWSA 3CCUA 1JE4A 4KHPL 4PNYA 1AN8A 4B3RL 1DYQA 4GKJQ 2B2WA 1WCMH 4KN7C 2K04A 2L55A 1NR2A 4DV4L 4RG1A 2EJMA 3CCRA 2N55A 5M3FH 4A3DB 2VXWA 3OYYA 3GTJH 3PUWA 4HJ8A 1I4GA 1S4ZA 2NVXH 2D0PA 5IP9H 2L4NA 3HOVH 4P73A 1SN8A 3HKZG 2EYPA 4RHRA 1YI2A 2CH4A 2WV6D 3J7YW 1EY6A 3HOZG 1SYCA 3NTIA 1BBWA 4HIKA 1K8OA 3F1ZA 4GN5A 3H0GG 2Q8RE 4IALA 1YIJA 1K83B 1AZPA 2SDFA 4P72A 1KLGD 1B53A 5IE8A 3K7AH 3P1HA 1ASYA 3ULJA 3W1GA 3K0XA 4HN7A 1V1OA 4CHTB 3HOXH 1QVFA 4DUZL 1XNQQ 2VUMG 3TRZA 3IKJA 4YCUA 1EY0A 5DLQE 1VQ8A 3NWTA 5I9PA 1OTCA 2JSOA 3PF5A 1SNQA 1J5EQ 4B3ML 4KY5A 5LHY1 4OX9Q 2UXCL 1RHPA 2WAQB 1I4XA 1HXYD 4HR7B 4JI5L 1X3PA 4IUTA 4OO1I 4Q0FA 1E24A 1PFMA 4HMIA 5KNBA 3ERQA 4A3BG 4ZUIA 2PQAA 5ELNA 4RCOA 4OELB 2WINB 1VMPA 3W1BA 1YVCA 2JA5H 2MP1A 3CD6A 3K5MA 4JBWA 3M85A 2I07B 2PMZE 3RLOA 3OTOQ 1PH5A 2EOTA 3MFGA 4A3KG 2F1MA 5IGFA 4V0BA 3S15H 4R8NA 4LF8Q 2XVSA 5E1FA 5IYDG 3KLWA 4RKBA 3KJPA 2MUYA 1A2UA 3W2DA 2ENBA 5COYA 5C0XH 3RUZA 1QCBD 1X56A 1E0BA 2R7ZH 1KHIA 4F8MA 4NPSA 3J7AF 2AQ3B 4HCEA 1YNXA 4YY3Q 4DV6Q 1PH3A 4JI8L 5GROA 3T1YQ 1XMOL 1B3QA 1AP0A 1RD9D 5CV7A 1BBUA 1AZQA 1QG7A 2IT1A 3KDFA 5C3XA 3I56A 1L1OB 3J80c 3M7GA 2Q2HA 2Z4IA 4JV5Q 4QIWB 1D5XC 1KAWA 2IJ0A 2JYOA 3SE0A 2EYMA 5TSSA 5I4DA 4PG3A 1K0SA 1OXUA 1CM9A 4P71A 4NB3A 1ML0D 3VYSA 4B9XA 4EVOA 2LS01 4HJAA 1T5EA 1A15A 2FINB 2DY7A 4YWLA 4FF4A 2BE5C 4LNQA 1MI2A 3PUXA 4KY6A 1AE2A 2NTTA 3QIAA 4F87A 3FPUB 3MAQA 3S2HB 2NYZD 1HNZQ 4X62Q 2KOLA 4X6AH 5I6YA 3CXCA 1G6ZA 1LACA 3A55A 4OXPA 4LFBL 4AH6A 5EKLA 4C2MH 5JVG3 3D6CA 3RLNA 4DNRB 2JA6H 3RD4A 3I4NG 1LT5D 1A62A 1TWGB 3BVGA 5C4JH 2MQHA 2K05A 2PW5A 3FMCA 3VDYA 3RN2A 4QJFA 5EBCA 4BA2I 5ELOA 1AEXA 1TWCH 3D31A 2XWBB 1VQKA 1EWHA 4BWGB 1V9PA 1FL0A 3CQZB 1IBKQ 3NHHA 2IL8A 2HDMA 1JMCA 1LTSD 4ZQ3A 3CPWA 4GN4B 3T51B 1IYJB 1TWAB 3TZDA 3NTKA 1EWCA 1Q1BA 2MO0A 3G48A 1CK1A 4LF9L 2R93H 1EY4A 5M5XH 3NBHA 1MSHA 3K6OA 4X66Q 1LT6D 3HOWB 2B2VA 5E7NA 4LF7Q 1NNXA 4GNXC 4A3GH 2JA7B 1C4QA 4CJ2C 1PRTC 1TT2A 5FO8B 1S5ED 2CKZB 2X6GA 2ZXRA 3R93A 3FEWX 4WFN3 1BNZA 2EY1A 5EQ0A 1LTRD 1KDCA 1RIPA 2UUAL 1IYVA 1IW7C 2K4KA 4OO1G 2DNEA 2CW0C 3GTQH 2PW7A 4XIGS 1I4HA 4C3IH 1BVSA 4DR4Q 3MXNA 4ID6A 1HQRD 3U4ZA 2RVLA 2RCNA 1UWVA 2PPBC 3LWUA 1GOZA 4G7OC 1WTQA 5A35A 2ZTDA 1F2YA 4K6LA 2Z4HA 4FXKC 1MHWC 5ELEA 2JA8B 2QKIC 4G7ZC 1V8QA 3A7LA 3A8KE 2F4VL 1BCPC 1EU4A 3OPOA 4DR6L 1KD1C 5IY0A 2E5LQ 1JORA 4MNOA 1NMFA 1H95A 1EY9A 3FKIG 5GAEC 3ERSX 2PZWA 4BBRH 2WKCA 1N9WA 1DOKA 4NW2A 4JI4L 2C9OA 3FDTA 2IW3A 3CCSA 1WYDA 1I3QB 1GUGA 1CSQA 2F0VA 1HTLD 2F0UA 5CV9A 2F0SA 3KOJA 2VL6A 1CZWA 1HFNA 1VF7A 2KEDA 5G3LD 3K0YA 1D8LA 2EDGA 4RKLA 5BN3A 2TMPA 1SROA 2IHFA 4HMJA 1VQMA 2R6GA 4JI2Q 1A2TA 1V43A 3RMHA 1QVGA 1TY2A 2ZT9C 1WCMB 2WB1G 2Z1CA 1Q81C 4BBSH 3M4OH 4DV5Q 3HOYG 1EYCA 1R4QB 3GTMH 1WOCA 5M3FB 3GTJB 4IURA 1VQDA 4JI6Q 3HOVB 4U673 4FF1A 1N33L 5I2XA 1WTRA 2VB3X 2VB2X 3VR6A 3STBC 2LXKA 4CDFC 3QJYA 2OTLA 2AKWB 3AFQA 4DGZA 4OONA 1SLJA 2KA7A 3SK4A 1R9TH 1NR4A 5K36G 3VR4A 2PMZB 1Q12A 3BDOA 4EQNA 3J80L 1XPRA 4K8IA 1OXTA 4A75A 1SYFA 1PRTB 3PGZA 1Y1VH 1YNNC 1Q1EA 1VQLA 1D1KA 1B4OA 2K5QA 5ELCA 3DXJC 1BR9A 3R2IA 3JAMc 1MBYA 4C3JG 3GD7A 4X3TA 1SBBB 4BY1H 4MHEA 4GOPC 1LV9A 1V1PB 1KIXA 1LTTD 4WJ3M 1STEA 2QILA 5AJ3L 2X6LA 3D6WA 4GZYC 4DR5Q 1E22A 2KBNA 1EFWA 3H09A 1PMRA 2Z6BA 3DWQA 1PFSA 2HHHL 1GKHA 1ICWA 3FPPA 4MZ9A 1PH4A 3S14H 1BCPB 1MD2D 2BA1A 3CW2C 1YJNA 3HOUG 4A3LG 4GKJL 4DUYQ 2XIWA 1GUSA 2YYZA 4JG2A 1F9RA 1BBXC 3C1EA 1S5BD 4O42A 1Y1WB 3S15B 1PRTF 4JK1C 1QNKA 3VR2A 1WD0A 1KC8C 5C4XH 1J8IA 4JVZA 3ER0A 1N36L 2R7ZB 2L12A 2L9HA 2F0DA 1SDFA 3HP3A 4A3CH 2ZXPA 4I7ZC 4ZYSA 2EXDA 1VMCA 3CCLA 3M4PA 3BU2A 1H9KA 3NP8A 1IL2A 1PZKD 5GADC 3BJUA 1B44D 3J80E 4NXMQ 2EPBA 4OEMB 3EBEA 4UP8A 3F2CA 4CGYB 4A3DG 3CKIB 5ELFA 3CCJA 1BCPF 4NKLA 5D3IB 1VQFA 3NUCA 1KRTA 5C4HA 1JQYD 1JB3A 4LFCQ 4DAVA 1PV4A 2B63H 1YBYA 3I4MG 2C35B 1SJHD 3F2BA 2KVMA 5D65A 3BDCA 3TP6A 3PIPA 4LF4Q 3A5UA 3DEOA 2OWOA 4C3HH 2F0JA 3MHBA 1DZ1A 2RSOA 1O7ZA 4YCWA 2PI2E 5IWAQ 2OQ0A 4RFBA 2D5DA 2DNCA 1WTOA 2DGYA 1PLFA 4GLXA 4C2MB 1VQIA 4IN3A 4X65Q 5JOBA 2PCFB 1HHVA 2JA6B 4IPCA 2UXDL 2D2CC 5CBEE 3OTOL 2WAQG 4GOPB 2K52A 1Q90A 3VYRA 1O7YA 1TWCB 2B8GA 4AYBG 2YU9H 1D5ZC 4LF8L 2L1BA 1EUJA 3PUZA 3CC2A 4CDCC 1E3PA 5FO9B 4KY7A 3SK6A 4AQYQ 1TWGH 1B2TA 2IX3A 2A73B 2L0CA 2NN6H 1WTXA 3EJIA 1CKNB 1GUTA 1JWMD 5IODA 2M2LA 1QOHA 4PMBA 3T1YL 2V4DA 5C5LA 2RDHA 4ZCKA 2R93B 3CQZH 5JJKA 5M5XB 3LGJA 2J7ZA 1FD7D 4A3GB 4XT3B 4O1NA 4O0AA 4DFAA 4IQZA 4DV1Q 2HUGA 2E74C 2QEJC 1D5MC 1W6KA 3GTQB 4XXEA 5C0XJ 1KDAA 3SEBA 4C3IB 1WI5A 2JA7H 3VA5A 2H4OA 1AE3A 1QUQB 4ME3A 4X64Q 2E2JB 5CV5A 5F2DA 2Z6KC 3I90A 5IOCA 1NAPA 1AFPA 3N52A 2WFWA 1SNPA 5KYIA 1HNZL 3IL8A 1YHAA 3CC7A 3HGBA 1Q8IA 3J7A5 5M9OA 2K5NA 4HIMA 1XX8A 1S40A 3MFYA 2A6ED 4IOCA 1TS4A 2MJ8A 3PCOB 5T1IA 5IYBG 1PZID 1L0WA 4BBRB 1JC7A 1C8CA 1P16A 4OIJA 1NTGA 4KN4C 1EY8A 2ALYB 1TXYA 1TWFH 2O4XA 1M1KC 2NVQH 1PYSB 1EU3A 3BZKA 4DV7Q 1JR0D 2LY7A 1F2LA 1ILPA 4QL5A 3T1HL 1WTVA 2B2TC 1HH2P 1PYBA 4FNFA 1I3QH 2F0LA 2A68D 1GXDC 3PO2B 3X3NA 1IHZA 1EYGA 1K73C 2K7VA 2RDFA 4BBSB 3M4OB 2R92G 1G291 1FJGL 3NE5B 2BDNA 3S2DH 3GTMB 3HKZE 2FFKB 4HIDA 1UE7A 2EYJA 3J81L 1GM5A 3NPPA 2F3WA 1QE6A 2E2IH 1JWUD 4H13C 2AWOA 4LUVA 2HQEA 1ZXTA 4B08A 1L1OC 1CKMA 1HZ9A 2UXBQ 2SOBA 3F2UA 2NZ1D 5FO7B 4DR4L 1HA5A 4LJZC 1S72A 1NUCA 4LAAA 1NCVA 2WP8J 5JJIA 1R9TB 1CZGA 1KNAA 3OHXC 1H9SA 2UUCQ 4J1MA 5EPKA 1YJWA 3QO2A 4DV3Q 1Y1VB 4HIOA 4KJNA 4ZAIA 2E5LL 4PMCA 1XXGA 2F0MA 2IHEA 2IPKD 1CKOA 3JAME 1II3A 1H9RA 4R4OA 4BY1B 5H1SE 2OTJA 1XMQQ 3BS1A 3E3XA 5E4WC 2LSSA 1ZYRD 5C0XI 2R7FA 2LXJA 4A3JG 4WJWA 2JA8G 4BXXH 4A3MG 4IZ8A 3RZOH 1B70B 3EVQA 3KF6B 2BCOA 3MVVA 2RDGA 3U58A 4LF5L 5M3MH 3S14B 4DF7A 1H9MA 3QOLA 1TKWB 1WTHA 3EA6A 4K8JA 3E6ZX 2HIXA 1VQGA 5KNCA 1IL8A 4DV5L 1PH6A 3VR5A 3C1FA 3J81E 5CV4A 3VYUA 1HTPA 4A3FG 4FVMA 4MN3A 3T16A 4B3TQ 1KNEA 4O2DA 4JI6L 3SK5A 5C4XB 2ASBA 1A8VA 4DR7Q 3KBXA 2NBFA 3ZYYX 1PH2A 2CH4W 2EZVA 1W3SA 1TWHH 1U4LA 4JI3Q 3Q24A 1IBLQ 1Y1WH 1JT8A 2K5HA 2B39A 1E1TA 2DJFC 1OXVA 3CP0A 4UP7A 1B50A 2KCTA 1BF4A 1Y8OB 3ICEA 1WCMG 1B1ZA 1SMXA 1RTNA 1V1QA 2TSSA 4OIKA 1SNCA 1G8ZD 1HNXL 3SVMA 4JOIC 3UE1A 3K59A 5IP9G 3HOVG 1B8AA 4ZKCB 1GD7A 1HR0Q 3P75A 4IJLA 3ULLA 2B29A 4L8JA 4FXGC 2B63B 2UUBL 4HEDA 2NZOA 1I6HB 1QZHA 4K5XA 1VQAA 4C3HB 3BDLA 4DR5L 3GTOH 2VS1A 3AYHB 5HGQA 2AHOB 4N9PA 2HD3A 1QVCA 4YHHL 3ND8A 4LMQD 4HJ7A 4ILWA 3Q23A 3HOXG 3HEJA 3EQLC 1JCKB 4PQXA 5D3DA 5C3EH 2NTSA 2DJGC 1TR5A 3MTSA 4YWKA 3H15A 4JYAQ 2OEOA 4M8AA 3W5OA 1GJXA 2A6HD 2EYFA 4GNXA 2KHIA 3W3AA 3NQIA 1HA6A 4HAEA 1LM0A 3B6YA 2EY5A 1SJED 3EROA 4DR3Q 1DD2A 2JXMB 1K8MA 1EL0A 2GVBA 4QB4A 3NBIA 1VQ4A 1MGSA 2YU9B 3R3OA 4R4QA 4XDXA 2RHSB 4B3SQ 2BH8A 2I46A 4IFDH 5DM63 4GLVB 2HIVA 3KF8B 3TS0A 4IPGA 1DGSA 3FHWA 2CVRA 2HCIA 4R4CA 5FLXL 2JA5G 5HGTA 3GDEA 1STHA 2B2UA 3PO3H 1N32L 3GTPH 3T4AC 3H91A 1UUPA 2A69D 1SE3A 2QEXA 3CCQA 5EKIA 1ENAA 4DR1Q 2LMCB 2AQ1B 3DUZA 2X69A 1GUOA 4A3IG 4J8QA 2ICEC 1Z7TA 2K33A 2RF4A 4UP9A 5C0XG 1SE2A 2R7ZG 2OQKA 2UU9Q 4LFCL 2ATWA 2PO4A 3U4VA 4V190 3BVZA 2L11A 5KRUA 2VQEQ 4LF4L 2O2LD 4UDUC 3RR5A 1KTKA 4PV1C 4GKKQ 5EPLA 1SNMA 3UI2A 4DAYA 2I5MX 5IWAL 5HURA 3HKZB 5BR8Q 2BH2A 1S3OA 2XNAC 3V05A 4LUZA 2E2JH 2LKVA 2A74C 4KHPQ 4X65L 2K03A 4UHVA 3DLLA 4B3RQ 4K0KQ 2VY3A 1E2VA 3H0GB 4KKSA 5CMDA 1ENFA 1TWFB 3MZ5A 4PMWA 2ZM6Q 3S9WA 2NVQB 1SEBD 1M8AA 3I73A 3D4WA 2EY2A 2K01A 3BZCA 1U5KA 3HZXA 1CFMA 5C6AA 1YHBA 1PHJA 5I6WA 3GQBA 5M5YH 3A54A 1A3UA 1DXMA 1N34L 1PZJD 1J9OA 2H1EA 2RA4A 2WB1E 3T56B 4IUPA 1HNWQ 1YEZA 3C3LA 3I8ZA 4DAMA 2K1BA 3ZJYC 2EJGC 2XN9C 3MEHA 5LMNL 2JA6G 1Z9FA 2PQAB 2G5DA 3CRLC 4I7AA 4M1UB 3A8JE 4TVAB 4C1NK 1DOMA 3MA2B 3S2DB 5G3LF 1SMYD 2E2IB 3MXGA 4AIMA 4DV1L 2M9VA 3PO2H 3MXPA 2F0NA 3D3RA 2QCPX 4GOPA 1YZ6A 3I4OA 3S1MH 4Y52H 1L0YB 1CHPD 4A93H 3CMAA 4B3MQ 1TS2A 1ZKOA 3K8AA 1CT1D 1G6PA 3QG1A 1I94L 3GTLH 3SDZA 5I2YA 2R93G 5C44H 4X3KA 4J6HA 1CI3M 1FGBD 4RMFA 1S5CD 4CKEA 4EQPA 2Z8LA 4A3GG 2I5HA 3CAMA 4B9WA 4C56C 5NUCA 3DWAA 1KQSA 2PYKA 4ULLA 1K0RA 5CC4A 4GLAC 5FJ8H 2ZTCA 4FF3A 3BZDB 1STAA 4NXNQ 2SNMA 1I6VC 4JI0L 3I4LA 4C3IG 1KABA 3S24A 5IYCG 4DNTB 1R4PB 3S17H 1KAAA 4HTHA 3S16H 2RQXA 2FMCA 3C2PA 2F0KA 3A0JA 4NDXA 3RZOB 1KLUD 4R9WA 2A1AA 4KMUC 1NJIC 1SE4A 5M3MB 5ELBA 3OMGA 1RKNA 3P20A 4KHZA 4IUUA 2KCNA 4JI8Q 4LF6Q 1XMOQ 3CC4A 4BBRG 1FR3A 1O78A 1SFOH 2ID0A 4ABNA 1HZCA 2PNHA 1BUVT 2Y0SG 1JOOA 1IZ6A 1JOQA 2XSCA 1LTBD 1AH9A 1PH7A 2OT2A 1QJOA 2A6EC 5T1GA 2C5CA 4DR2Q 3G6EA 3DWPA 4P75A 2KHJA 2O5IC 4BS9A 3NK9A 3E5SA 1TWHB 5FOBB 2DUDA 4QQBX 2UXBL 4OWWB 2O5JC 4APVA 1UEBA 2KCMA 2CWPA 3J81c 1LYLA 1CA6A 1QWYA 4G57A 1ILQA 4A3EH 4QY7A 4BBSG 3KJOA 5CBAE 2B2YC 3R8BA 5DAUA 3JAMi 1TVXA 3OSOA 1FNWA 2SNSA 3A8IE 4LFBQ 2YTXA 1UAPA 1X3EA 2QW7A 1HCZA 4OGQC 5FLMH 4DV3L 5KYLA 2A68C 1JJCB 1NMGA 3S1QH 2K75A 2EYHA 3KK7A 1K3BC 5L37A 1F9QA 3KUPA 3QR8A 3VR3A 1XNQL 3L0OA 1STYA 2K5VA 5CORA 4A93G 5IGEA 1SYGA 3GTOB 3MXNB 2I0QA 2NN6I 1VQ9A 4KHVA 4I65A 1Q7YC 1J5EL 4BY7H 2QDBA 4OX9L 1I6HH 1Y1VG 5C3EB 2IX0A 1EQQA 2IX1A 1Q3LA 4KKUA 1QNUA 4XQNA 2K50A 3FVQA 4AYBE 1T5XD 3WOFA 3GTKH 2ZTEA 4BY1G 4FP5D 1LT4D 4HSPA 2M00A 3SK8A 4K6DA 5ELDA 1PH9A 2KHSA 3BYYB 1I4RA 1L2FA 2ZJQA 4FF2A 1RCVD 3AFPA 5BN4A 1K8GA 4HSVA 4R1JA 3T13A 2MGSA 1GUWA 3D0FA 3PMFA 5C5MA 2HCCA 5LMNW 3J7ZC 4DR7L 4YIJA 2MPMA 3MXUA 5K5PA 4LWCA 4N8FA 2N8NA 2Z0SA 4IUQA 4G7HC 4JI3L 3TP8A 2Z6KA 4Y7NB 1BQQT 4LFAQ 4BA1I 1ZYRC 4CBVA 3PO3B 3GTPB 1QILA 4KV6A 1FNUA 2WACA 5JEAH 3I55A 3H3VH 3URYA 1U0LA 3S1NH 3OWEB 4XT1B 1EWIA 1EOVA 4YY3L 5LMUQ 2K5DA 4DV6L 2QA4A 5C4XG 2Q8TA 5IP7H 4HCSA 1VF5C 4MTKA 5IT9c 1X6OA 1HR0L 1MIUA 3I70A 4OWXB 3TREA 2OF1A 2FXQA 1M90C 4JV5L 2WB1B 1RODA 2D62A 1EQRA 4A3CG 2GVAA 4NP5A 2R92H 3OW2A 3PIO3 2B2TA 1SNOA 2MO1A 2P5ZX 3QOJA 3TP7A 5CGKA 2H5XA 3K5OA 1ENCA 4FDBA 2ZJPA 4L63B 1EYDA 1C48A 1U4MA 3U9SA 2K32A 3DEPA 3RZDH 4DV2Q 2EY6A 1VQNA 1Y69U 1W2BA 1LTGD 4X62L 4RH6A 3NEMA 4DAPA 2B63G 1U9RA 1BDOA 4J15A 2CHBD 4A4IA 4C1NI 4POGA 2VNUD 2RCFA 2YTYA 3QWNA 4ZK9B 4C3HG 1L1OA 1X3FA 2E75C 3HOZH 2VQFQ 1N33Q 2BOSA 5DEHA 4H44C 3KLRA 5M5YB 3H0GH 3ND9A 3TMEA 4WRDA 1A0IA 4GN3B 4CDDC 1PA6A 1O80A 1A6XA 2VUMH 4RGTA 3I3CA 1CQFA 1I4QA 2F0EA 1SSOA 1IBKL 4IUVA 2HT1A 2V1CC 4IJHA 1X3GA 1T9HA 5FLXc 1VQ5A 3M4YA 3X3MA 4JW0A 3GTGH 2J4XA 3NTHA 2JEAI 3L7ZC 2E2DC 5I9OA 4L5TA 4R8IA 2A6HC 2NN6G 4IFDJ 3UDGA 4X66L 3S1MB 2NVYB 4A93B 1X54A 1I50H 2F0GA 3K81C 4LF7L 1PYWD 4RWSC 4QUCA 1PH8A 4A3BH 4CKCA 5CV6A 2MFIA 3GTLB 3HKSA 4JC0A 2ES2A 4IPHA 2VQEL 5C44B 3FP9A 3G7LA 3EN2A 3I72A 5EJWA 3TQYA 1PTOD 3TEHB 5IGGA 1D2BA 4QCLA 1JICA 2HHHQ 3EFXD 5BR8L 1K8AC 2B3GA 1KRSA 3QB3A 1JJGA 4E6IA 4A3KH 4JI7Q 1XJVA 1KDBA 3V2TA 1DONA 3HOWG 2YV5A 3MEFA 3K5LA 3OW7A 5IYDH 1LTLA 2JA7G 2G9HD 1TS5A 2F0PA 4K0KL 4RCNA 2JA9A 2WKDA 2A69C 3S17B 3S16B 2XGTA 1STGA 3DMUA 2ZM6L 1IXRA 3K58A 3M7NA 3J81j 3MWYW 3U50C 1N36Q 3E9HA 4UY8C 2F0WA 1HNWL 3I4MB 4DXFA 3TSSA 3NENA 1DM0B 1SFOB 4IPDA 1U4PA 5J22A 4MTNA 1EQTA 3H3VC 2RHQB 4JOIA 4ME5A 3E0JA 1N8RC 2RSNA 4PZ6A 2FMMA 5DM73 1ONLA 3GP7A 2KQ3A 4R4TA 1F9SA 2D0OA 2EQSA 3P7JA 1OXXK 2KJXA 2F0IA 1CA5A 4JI2L 3OIQA 1Y8PB 1WTPA 5CV8A 1LTAD 4KD4A 2Q2UA 5D14A 2B2WC 4PZ7A 2E76C 3SGIA 1YITA 5GAHC 3TZUA 4A3EB 1B7YB 2EXZA 1EIFA 4LK1C 4AYBB 2IWHA 5J39A 4WJ4A 1HR0W 3AEVA 3I4NH 2JE6I 4EQOA 3D8GA 2F0OA 4DK1A 1PDQA 4JPBW 1E2WA 1HUMA 3Q8DA 3WWVA 3K80C 5JVH3 1P8LA 1CSPA 1RDPD 3M3YH 2MNAA 1XYIA 3SR1A 4ZKBB 4QMGA 5IT9L 3LNNA 1VQ7A 2F3IA 4NXNL 3S1QB 2UXDQ 3CCVA 4DV0Q 5M3FG 1BOSA 1ICFB 1J6QA 1SMYC 1WVLA 4TSSA 1IBMQ 1MSGA 3NQTA 4N9TA 4IFDI 4K2LA 3K57A 1AW7A 4A3IH 1TU2B 2N78A 4BY7B 1EEID 2B8FA 3K7UC 4CJ0B 4UPAA 4RA8A 4N8X1 1HJPA 4LF6L 3Q0AA 5LL6S 1CTMA 3CU7A 2ZXOA 1BO0A 4ZRZA 3GTKB 1B3AA 1K9MC 1Q86C 4OO1H 2L15A 2E2HH 2N49A 5FKAC 1K28A 3AB9A 3S1RH 5BN5A 3OIPA 1YNJD 1B9NA 1EIHA 4TQUS 1PFBA 1GO3E 4FYDA 4BXXG 1OXSC 2EYLA 4DR2L 3TDQA 4R4IA 3ONAB 1YHQA 3AU7A 4TRDA 3D4DA 4DUYL 1H9JA 2NUCA 1WTWA 1STBA 5M3MG 4EX5A 2EE1A 2EVBA 4DK3C 4CDEC 2PZUA 2PNRC 1G51A 4IOAA 3CCMA 2F3VA 1VCIA 2Z9HA 1CUKA 1STNA 5AFWA 4UAIA 1IYUA 2F0QA 3G4SA 1NY4A 1V1PA 5EPJA 2DN8A 3FKIH 5EBDA 4K2KA 3J80i 3S1NB 3NSWA 1G2SA 5M5WB 4DN4M 2EJFC 4Y7NH 3BG3A 3Q22A 5KEEA 2K14A 1RTOA 5IT9E 1Y8NB 2Q2TA 3JC66 4NXML 4KK7A 1VQCA 1LO5D 1SAPA 1Y1WG 1FGUA 4F7XA 3TP5A 4OL7A 2R92B 2Q2IA 1F9PA 4RAUC 3RN5A 4POFA 1X32A 5KIXA 2A5HA 5EKKA 3AMUA 5GQOA 2JK8A 3D4RA 3GO5A 2JQOA 2R3ZA 1PVOA 1A63A 3T1HQ 4ZLTF 1G2TA 1XNRQ 3HOYH 4JI1Q 1VQBA 3RZDB 2EYOA 1H9SB 1GUNA 1VQOA 3I2ZA 1RL2A 1EY5A 1RJTA 3L2PA 4K5VA 5HY6A 1FJGQ 2PZTA 1X9NA 3I7FA 4YCVA 4RGMA 1VQ6A 3CHBD 3HOZB 3SXHA 5C4ZA 5EGTA 3KLSA 2F0TA 4ODGA 1D6EC 3K5NA 5J3BA 3SHLA 4LUOA 5K36H 4DV4Q 3ULPA 2NVTB 5C3EG 1E2ZA 3IFDA 1QZGA 5KGUA 1XPOA 5IYCH 3LX0A 1FNVA 2VUMB 3CRKC 1JJ2A 4LFAL 2JN4A 1UE1A 5JAVA 4AQYL 4A3JB 1PTOH 1JB7A 2B2UC 4A3MB 1I5FA 3G6JB 5FLXE 4C3JH 5KNDA 1WD1A 5LMUL 2F0HA 2OXPA 3GTGB 4H7BA 1Z47A 4IFDG 5IGCA 1TIID 4X3SA 1LTID 3M4QA 3M9BA 3Q6SA 1Q8KA 3TN2A 1I50B 5CR3A 2F52A 4A3BB 3HS0C 3PV0A 2QF7A 2AUKA 4DUZQ 1ESRA 4EGVA 2B2VC 3KBGA 3PO3G 4A3FB 2XWJB 3F8TA 1GHKA 5JEAJ 2NVYH 3HOUH 4A3LH 1PH1A 1MKHA 5ISRA 2UXCQ 2F0FA 1XTCD 4RGNA 4LF5Q 4DK6C 4A3KB 5JJZA 3E0EA 4KI0A 4X64L 4JI5Q 1C9OA 4KKTA 4F88A 4DV2L 1ZEQX 3T53B 3U9OA 1CKNA 1XPUA 1IKLA 1UNSA 1ASZA 3H94A 3F2DA 1VQHA 3L9AX 1S5DD 3O13A 1TQOA 2QGQA 3IFTA 1O7LA 3KDFB 1D7QA 3BVMA 2SEBD 3J7AV 2NVXB 1OO9B 3DM1A 3G71A 3R2TA 4XQJA 1E1OA 2XRQD 2VQFL 5C3WA 1EZ6A 2JP1A 3UE0A 1BXTA 2K28A 2BE5D 1VQJA 3PUYA 1MJEA 4KTAA 1SYDA 1XTDA 2Y0SE 1XWEA 4A3DH 1E7ZA 1DOLA 5E4XA 2B2YA 1CHQD 4TKOB 2JEBI 4DV7L 1VDZA 2ICIA 1IKMA 2I5LX 3GV3A 1QUQA 2NWGA 3RNUA 2KECA 3C46A 2KEEA 3PUVA 1HNXQ 3I91A 2CQAA 1VQEA 2XRSD 3K7AB 4GNXB 5A2QL 3I4MH 4OHJA 4QUFA 4P74A 2CFMA 3HOXB 2L5TA 4A76A 1EY7A 4ZUJA 5GAGC 1K83H 3HFZB 5JPNC 3FRPB 1JWSD 2HQLA 5IGDA 3HRZC 1HUNA 4KJOA 2UUBQ 1EYAA 1SYEA 1HZBA 1F2ZA 3PIP3 4DXGA 3A56A 1O7IA 2AMCB 3I4NB 4YHHQ 2NZHA 2EIFA 4CKBA 3DHQA 4WORA 4DK0A 1EIYB 3UDFA 3PO2G 4S3SA 3AQQA 3M3YB 3OOCA 4CJ1B 5FK9C 4JI7L 2JA5B 3VA7A 2Q8IB 2BA0A 1EQVA 1A3VA 2UUCL
chains in the Genus database with same CATH topology
4RGOS 2LFNA 3WDNA 1PRTD 2MHVA 2N88A 2F03A 1SYBA 1IW7D 4DU9A 3OMCA 2CW0D 4A3IB 1TY0A 3A7AB 5DNFA 2FHTA 3L3OC 2NB0A 1Z6HA 1HFGA 3ITPA 1I4PA 2GA4B 3N6RA 1JOKA 3TBIB 2AUJD 3NXWA 1PTOC 2E2HB 3S1RB 5A2QE 1BCPD 1U4RA 1G91A 4XQQA 2KCCA 1QB5D 1LLRD 4FO2A 1ET6A 4NMZA 4XTCS 4K5WA 1RF2D 2RKSA 1L0XB 2HDLA 3IAYA 2RBMA 2PQEA 4G4KA 4Z9CB 3FKIB 1F2MA 1NSNS 1S5FD 3RLFA 1D1IA 1EZ8A 1GHJA 4DA2A 2FJ2A 1B9MA 4Q5VA 5C4JB 3VYTA 4L6TB 4IUNA 5CYUA 1M4VA 2BDOA 1X3QA 1PFNA 2J0TD 5IGBA 3HOYB 1CQVA 4RHSA 2G9DA 4H0LC 4MIUA 2WIIB 4XYQA 5IIFA 1PXUA 5JPMC 1EIGA 4P2CB 3V96A 1YNND 2DY8A 1FYCA 1LT3D 2AWNA 3KLSX 2AQ2B 4KD3A 1TS3A 3H6MA 1F77A 1HRJA 1EFID 4K14A 3OWFA 1DJRD 2K5WA 4X3UA 2K6AA 2F4IA 1LABA 1PTOB 1EOTA 4C3JB 4U68A 5E3FA 3BYTB 5J1ZA 3JAML 2R61A 3GV6A 2Y0SB 5LL6X 3WOEA 3LWEA 1YNJC 3HG9A 1UEAB 1A3TA 5JEAG 4FXDA 1ET9A 1EEFD 1SNDA 1SXTA 1ESFA 1W6JA 3HOUB 4XYOA 2D9UA 1DCZA 1HPCA 2KUMA 3KF8A 4QF4A 1HQMC 1PTOF 3MC0B 3NWSA 1JE4A 4PNYA 1AN8A 1DYQA 2B2WA 4KN7C 2K04A 2L55A 1NR2A 2EJMA 2N55A 4A3DB 2VXWA 3PUWA 1I4GA 1S4ZA 2L4NA 2EYPA 4RHRA 2WV6D 3J7YW 1EY6A 1SYCA 3NTIA 1K8OA 2Q8RE 4IALA 1K83B 1AZPA 2SDFA 1KLGD 1B53A 3P1HA 4HN7A 1V1OA 4CHTB 3IKJA 1EY0A 3NWTA 5I9PA 2JSOA 1SNQA 4KY5A 5LHY1 1RHPA 2WAQB 1I4XA 1HXYD 4HR7B 1X3PA 4IUTA 4OO1I 4Q0FA 4HMIA 1PFMA 5KNBA 3ERQA 4ZUIA 4RCOA 2WINB 1VMPA 2MP1A 3K5MA 4JBWA 3M85A 2I07B 2EOTA 3MFGA 2F1MA 5IGFA 4V0BA 4R8NA 2XVSA 5E1FA 4RKBA 2MUYA 1A2UA 3W2DA 2ENBA 5COYA 5C0XH 3RUZA 1QCBD 1E0BA 4F8MA 3J7AF 2AQ3B 4HCEA 1AP0A 1RD9D 5CV7A 1AZQA 1QG7A 2IT1A 5C3XA 3M7GA 2Z4IA 4QIWB 1D5XC 2IJ0A 2JYOA 3SE0A 2EYMA 5TSSA 5I4DA 1OXUA 1CM9A 1ML0D 3VYSA 4B9XA 4EVOA 2LS01 1T5EA 1A15A 2FINB 2DY7A 4FF4A 2BE5C 1MI2A 3PUXA 4KY6A 2NTTA 3QIAA 4F87A 3FPUB 3MAQA 3S2HB 2NYZD 2KOLA 5I6YA 1G6ZA 1LACA 3A55A 5EKLA 5JVG3 3D6CA 4DNRB 3RD4A 1LT5D 1TWGB 3BVGA 2K05A 2PW5A 3FMCA 4BA2I 5EBCA 1AEXA 3D31A 2XWBB 1EWHA 4BWGB 3CQZB 3NHHA 2IL8A 2HDMA 1LTSD 4ZQ3A 3T51B 1TWAB 3TZDA 3NTKA 1EWCA 1Q1BA 1CK1A 1EY4A 3NBHA 1MSHA 3K6OA 1LT6D 3HOWB 2B2VA 2JA7B 1C4QA 4CJ2C 1PRTC 1TT2A 5FO8B 1S5ED 2X6GA 2ZXRA 3R93A 3FEWX 4WFN3 1BNZA 2EY1A 5EQ0A 1LTRD 1KDCA 1IYVA 1IW7C 4OO1G 2DNEA 2CW0C 2PW7A 4XIGS 1I4HA 3MXNA 4ID6A 1HQRD 2RVLA 2PPBC 3LWUA 1GOZA 4G7OC 1WTQA 5A35A 1F2YA 4K6LA 2Z4HA 4FXKC 5ELEA 2JA8B 2QKIC 4G7ZC 1V8QA 3A7LA 3A8KE 1BCPC 1EU4A 3OPOA 1JORA 1EY9A 2PZWA 2WKCA 1DOKA 4NW2A 2C9OA 3FDTA 2IW3A 1I3QB 1GUGA 2F0VA 1HTLD 2F0UA 5CV9A 2F0SA 1CZWA 1HFNA 1VF7A 2KEDA 5G3LD 3K0YA 4RKLA 2EDGA 5BN3A 2TMPA 4HMJA 2R6GA 1A2TA 1V43A 3RMHA 1TY2A 2ZT9C 1WCMB 2Z1CA 1EYCA 1R4QB 5M3FB 3GTJB 4IURA 3HOVB 4U673 4FF1A 5I2XA 1WTRA 2VB3X 2VB2X 3VR6A 3QJYA 4DGZA 2KA7A 3SK4A 1NR4A 5K36G 3VR4A 2PMZB 1Q12A 3BDOA 4EQNA 3J80L 4K8IA 1OXTA 1SYFA 1PRTB 1YNNC 1Q1EA 1D1KA 1B4OA 2K5QA 5ELCA 3DXJC 1BR9A 3R2IA 1MBYA 4C3JG 3GD7A 4X3TA 1SBBB 4MHEA 1LV9A 1V1PB 1LTTD 1STEA 2QILA 2X6LA 3D6WA 4GZYC 3H09A 1PMRA 3DWQA 1ICWA 3FPPA 1BCPB 1MD2D 2BA1A 2XIWA 1GUSA 2YYZA 1BBXC 1F9RA 3C1EA 1S5BD 4O42A 1Y1WB 3S15B 1PRTF 4JK1C 1QNKA 3VR2A 1WD0A 1J8IA 2R7ZB 2L12A 2L9HA 2F0DA 1SDFA 3HP3A 2ZXPA 4I7ZC 4ZYSA 1VMCA 1H9KA 3NP8A 1PZKD 3J80E 1B44D 2EPBA 4CGYB 3CKIB 5ELFA 1BCPF 4NKLA 5D3IB 3NUCA 5C4HA 1JQYD 1JB3A 4DAVA 1SJHD 2KVMA 5D65A 3BDCA 3TP6A 3DEOA 2F0JA 3MHBA 1DZ1A 2RSOA 1O7ZA 4RFBA 2D5DA 2DNCA 1WTOA 1PLFA 4C2MB 4IN3A 5JOBA 2PCFB 1HHVA 2JA6B 2D2CC 5CBEE 1Q90A 3VYRA 1O7YA 1TWCB 2B8GA 1D5ZC 2L1BA 3PUZA 5FO9B 4KY7A 3SK6A 1B2TA 2IX3A 2A73B 2L0CA 2NN6H 1WTXA 3EJIA 1GUTA 1JWMD 5IODA 2M2LA 1QOHA 4PMBA 2V4DA 5C5LA 2RDHA 2R93B 5M5XB 2J7ZA 1FD7D 4A3GB 4XT3B 4O1NA 4DFAA 4IQZA 2HUGA 2E74C 2QEJC 1D5MC 1W6KA 3GTQB 4XXEA 5C0XJ 1KDAA 3SEBA 4C3IB 3VA5A 2H4OA 2E2JB 5CV5A 5F2DA 3I90A 5IOCA 1NAPA 1AFPA 3N52A 1SNPA 5KYIA 3IL8A 3HGBA 1Q8IA 5M9OA 1XX8A 3MFYA 2A6ED 1TS4A 2MJ8A 5T1IA 1PZID 4BBRB 1JC7A 1C8CA 4OIJA 4KN4C 1EY8A 2O4XA 1EU3A 1JR0D 2LY7A 1F2LA 1ILPA 1WTVA 2B2TC 4FNFA 2F0LA 2A68D 1GXDC 3PO2B 3X3NA 1IHZA 2K7VA 2RDFA 4BBSB 3M4OB 1G291 3NE5B 2BDNA 3GTMB 2FFKB 2EYJA 3J81L 3NPPA 2F3WA 1QE6A 1JWUD 4H13C 2AWOA 2HQEA 1ZXTA 4B08A 2SOBA 3F2UA 2NZ1D 5FO7B 1HA5A 4LJZC 1NUCA 4LAAA 1NCVA 2WP8J 1R9TB 1CZGA 1KNAA 3OHXC 1H9SA 4J1MA 5EPKA 3QO2A 1Y1VB 4KJNA 4ZAIA 4PMCA 1XXGA 2F0MA 2IPKD 3JAME 1II3A 1H9RA 4BY1B 3BS1A 5E4WC 1ZYRD 5C0XI 4WJWA 4IZ8A 3EVQA 2BCOA 3MVVA 2RDGA 3S14B 4DF7A 1H9MA 3QOLA 1TKWB 3EA6A 4K8JA 3E6ZX 5KNCA 1IL8A 3VR5A 3C1FA 3J81E 5CV4A 3VYUA 1HTPA 4FVMA 4MN3A 3T16A 1KNEA 5C4XB 3SK5A 3ZYYX 2NBFA 3KBXA 2EZVA 1U4LA 3Q24A 2B39A 1OXVA 1B50A 1BF4A 1Y8OB 1B1ZA 1RTNA 2TSSA 4OIKA 1SNCA 1G8ZD 3SVMA 3K59A 4ZKCB 3P75A 4L8JA 4FXGC 2B63B 4HEDA 1I6HB 4K5XA 4C3HB 3BDLA 4N9PA 3ND8A 4LMQD 4ILWA 3Q23A 3HEJA 3EQLC 1JCKB 4PQXA 5D3DA 2NTSA 1TR5A 3MTSA 2OEOA 4M8AA 1GJXA 2A6HD 2EYFA 3W3AA 3NQIA 1HA6A 4HAEA 2EY5A 1SJED 3EROA 1DD2A 2JXMB 1K8MA 1EL0A 4QB4A 3NBIA 1MGSA 2YU9B 3R3OA 4XDXA 2I46A 4IFDH 5DM63 2CVRA 2HCIA 5FLXL 5HGTA 1STHA 2B2UA 3T4AC 3H91A 1UUPA 2A69D 1SE3A 5EKIA 1ENAA 2LMCB 2AQ1B 3DUZA 2X69A 1GUOA 4J8QA 2ICEC 1Z7TA 2K33A 5C0XG 1SE2A 2PO4A 4V190 3BVZA 2L11A 5KRUA 2O2LD 4UDUC 1KTKA 4PV1C 5EPLA 1SNMA 3UI2A 4DAYA 5HURA 3HKZB 2XNAC 3V05A 2LKVA 2A74C 2K03A 1E2VA 3H0GB 4KKSA 5CMDA 1ENFA 1TWFB 3MZ5A 4PMWA 3S9WA 2NVQB 1SEBD 1M8AA 2EY2A 2K01A 3D4WA 3I73A 3HZXA 1CFMA 5C6AA 5I6WA 3GQBA 3A54A 1A3UA 1DXMA 1PZJD 1J9OA 2H1EA 2RA4A 3T56B 4IUPA 3C3LA 3I8ZA 2K1BA 2EJGC 2XN9C 3MEHA 3CRLC 4M1UB 3A8JE 4C1NK 1DOMA 3MA2B 3S2DB 5G3LF 1SMYD 2E2IB 3MXGA 2M9VA 3MXPA 2F0NA 3D3RA 2QCPX 1L0YB 1CHPD 1TS2A 1ZKOA 1CT1D 3QG1A 3SDZA 5I2YA 4X3KA 4J6HA 1CI3M 1FGBD 1S5CD 4CKEA 4EQPA 2Z8LA 4B9WA 4C56C 5NUCA 3DWAA 2PYKA 4ULLA 5CC4A 4FF3A 3BZDB 1STAA 2SNMA 1I6VC 3I4LA 4C3IG 1KABA 4DNTB 1R4PB 1KAAA 4HTHA 2RQXA 2FMCA 3C2PA 2F0KA 4NDXA 3RZOB 1KLUD 4R9WA 4KMUC 1SE4A 5M3MB 5ELBA 3OMGA 1RKNA 3P20A 4KHZA 4IUUA 2KCNA 1FR3A 1O78A 2ID0A 4ABNA 1BUVT 1JOOA 1JOQA 2XSCA 1LTBD 2OT2A 1QJOA 2A6EC 5T1GA 2C5CA 3DWPA 2O5IC 4BS9A 3NK9A 3E5SA 1TWHB 5FOBB 2O5JC 1CA6A 1QWYA 4G57A 1ILQA 5CBAE 2B2YC 3R8BA 5DAUA 1TVXA 3OSOA 1FNWA 2SNSA 3A8IE 1UAPA 4OGQC 1HCZA 5KYLA 2A68C 2EYHA 3KK7A 1F9QA 3KUPA 3VR3A 1STYA 5CORA 5IGEA 1SYGA 3GTOB 2NN6I 4KHVA 4I65A 2QDBA 5C3EB 2IX0A 2IX1A 1Q3LA 4KKUA 1QNUA 4XQNA 3FVQA 1T5XD 3WOFA 4FP5D 1LT4D 4HSPA 2M00A 3SK8A 5ELDA 4K6DA 2KHSA 3BYYB 1I4RA 4FF2A 1RCVD 5BN4A 4HSVA 3T13A 2MGSA 1GUWA 3PMFA 5C5MA 2HCCA 4YIJA 2MPMA 3MXUA 5K5PA 4IUQA 4G7HC 3TP8A 4Y7NB 1BQQT 4BA1I 1ZYRC 4CBVA 3PO3B 3GTPB 1QILA 4KV6A 1FNUA 2WACA 5JEAH 3URYA 3OWEB 4XT1B 2K5DA 2Q8TA 4HCSA 1VF5C 3I70A 2OF1A 2WB1B 1RODA 2D62A 4NP5A 3PIO3 2B2TA 1SNOA 3QOJA 3TP7A 5CGKA 3K5OA 1ENCA 4L63B 1EYDA 1C48A 1U4MA 3U9SA 2K32A 3DEPA 2EY6A 1Y69U 1LTGD 4RH6A 4DAPA 1U9RA 1BDOA 4C1NI 2CHBD 2VNUD 3QWNA 4ZK9B 4C3HG 2E75C 2BOSA 5DEHA 4H44C 3KLRA 5M5YB 3ND9A 3TMEA 4WRDA 1O80A 1A6XA 4RGTA 3I3CA 1CQFA 1I4QA 2F0EA 1SSOA 4IUVA 3M4YA 3X3MA 2J4XA 3NTHA 2JEAI 3L7ZC 2E2DC 5I9OA 4R8IA 2A6HC 2NN6G 4IFDJ 3S1MB 2NVYB 4A93B 2F0GA 1PYWD 4RWSC 4QUCA 4CKCA 5CV6A 3GTLB 5C44B 3G7LA 3I72A 5EJWA 1PTOD 5IGGA 1D2BA 4QCLA 1JICA 3EFXD 3QB3A 4E6IA 1KDBA 3V2TA 1DONA 3K5LA 3OW7A 2G9HD 1TS5A 2F0PA 4RCNA 2WKDA 2A69C 3S17B 3S16B 1STGA 3DMUA 3K58A 3M7NA 3MWYW 2F0WA 3I4MB 4DXFA 3TSSA 1DM0B 1SFOB 5J22A 1U4PA 1EQTA 3H3VC 4ME5A 3E0JA 2RSNA 2FMMA 5DM73 1ONLA 3GP7A 2KQ3A 1F9SA 3P7JA 1OXXK 2KJXA 2F0IA 1CA5A 3OIQA 1Y8PB 1WTPA 5CV8A 1LTAD 4KD4A 5D14A 2B2WC 2E76C 3TZUA 4A3EB 2EXZA 4LK1C 4AYBB 2IWHA 5J39A 2JE6I 4EQOA 3D8GA 2F0OA 4DK1A 1PDQA 1E2WA 1HUMA 5JVH3 1RDPD 1XYIA 3SR1A 4ZKBB 4QMGA 5IT9L 3LNNA 3S1QB 1BOSA 1SMYC 1WVLA 4TSSA 1MSGA 3NQTA 4N9TA 4IFDI 4K2LA 3K57A 1AW7A 1TU2B 4BY7B 1EEID 2B8FA 4CJ0B 4RA8A 3Q0AA 5LL6S 1CTMA 3CU7A 2ZXOA 1BO0A 4ZRZA 3GTKB 1B3AA 4OO1H 5FKAC 3AB9A 5BN5A 3OIPA 1YNJD 1B9NA 1EIHA 4TQUS 1PFBA 4FYDA 1OXSC 2EYLA 3TDQA 3ONAB 3AU7A 4TRDA 3D4DA 1WTWA 1H9JA 2NUCA 1STBA 2EE1A 2EVBA 2PZUA 2PNRC 2F3VA 1VCIA 1STNA 5AFWA 4UAIA 1IYUA 2F0QA 1V1PA 5EPJA 2DN8A 5EBDA 4K2KA 3S1NB 3NSWA 1G2SA 5M5WB 4DN4M 2EJFC 3BG3A 3Q22A 5KEEA 1RTOA 5IT9E 1Y8NB 4KK7A 1LO5D 1SAPA 4F7XA 3TP5A 4OL7A 2R92B 1F9PA 4RAUC 1X32A 5KIXA 2A5HA 5EKKA 3AMUA 3D4RA 3GO5A 2R3ZA 4ZLTF 1G2TA 3RZDB 2EYOA 1H9SB 1GUNA 1EY5A 1RJTA 4K5VA 2PZTA 4RGMA 3CHBD 3HOZB 3SXHA 5C4ZA 5EGTA 3KLSA 2F0TA 4ODGA 1D6EC 3K5NA 3SHLA 5K36H 2NVTB 1E2ZA 3IFDA 5KGUA 3LX0A 1FNVA 2VUMB 3CRKC 5JAVA 4A3JB 1PTOH 2B2UC 4A3MB 3G6JB 5FLXE 5KNDA 1WD1A 2F0HA 2OXPA 3GTGB 4H7BA 1Z47A 4IFDG 5IGCA 1TIID 4X3SA 1LTID 3Q6SA 3TN2A 1I50B 5CR3A 4A3BB 3HS0C 3PV0A 2QF7A 2AUKA 1ESRA 4EGVA 2B2VC 3KBGA 4A3FB 2XWJB 1GHKA 5JEAJ 5ISRA 2F0FA 1XTCD 4RGNA 4A3KB 5JJZA 4KI0A 4KKTA 4F88A 1ZEQX 3T53B 3U9OA 1IKLA 1UNSA 3H94A 3L9AX 1S5DD 3O13A 1TQOA 3IFTA 1O7LA 3BVMA 2SEBD 3J7AV 2NVXB 1OO9B 3DM1A 3R2TA 4XQJA 2XRQD 5C3WA 1EZ6A 2JP1A 1BXTA 2K28A 2BE5D 3PUYA 4KTAA 1SYDA 1XWEA 1DOLA 5E4XA 2B2YA 1CHQD 4TKOB 2JEBI 1VDZA 2ICIA 1IKMA 3GV3A 2NWGA 2KECA 3C46A 2KEEA 3PUVA 3I91A 2CQAA 2XRSD 3K7AB 5A2QL 4OHJA 4QUFA 3HOXB 2L5TA 1EY7A 4ZUJA 5JPNC 3FRPB 1JWSD 5IGDA 3HRZC 1HUNA 4KJOA 1EYAA 1SYEA 1F2ZA 3PIP3 4DXGA 3A56A 3I4NB 4CKBA 3DHQA 4WORA 4DK0A 4S3SA 3M3YB 3OOCA 4CJ1B 5FK9C 2JA5B 3VA7A 2Q8IB 2BA0A 1EQVA 1A3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV7 A;  4B9W A;  5NUC A;  5C3X A;  4KHV A;  2F0L A;  4I65 A;  5IIF A;  1F2Y A;  2PYK A;  2QDB A;  4K2K A;  5DEH A;  5CC4 A;  2KQ3 A;  1IHZ A;  2F0I A;  2RDF A;  3TME A;  1STA A;  4WRD A;  2EYM A;  2SNM A;  2EYP A;  1SYB A;  4DU9 A;  1KAB A;  3OMC A;  5ISR A;  5KEE A;  5KRU A;  2F0F A;  5CV8 A;  2EYJ A;  4KD4 A;  4B9X A;  4EVO A;  1EY6 A;  5JOB A;  1SNC A;  2F3W A;  1KAA A;  4HTH A;  1JOR A;  1SYC A;  1EY9 A;  4KY7 A;  3SK6 A;  1SNM A;  2M00 A;  4K6D A;  3SK8 A;  2F0E A;  2KHS A;  2PZW A;  3U9O A;  2F0K A;  2HQE A;  4KD3 A;  5HUR A;  3EJI A;  4F7X A;  3H6M A;  4OL7 A;  4KY6 A;  3TP5 A;  2EXZ A;  2SOB A;  4IAL A;  4NDX A;  3ITP A;  5IOD A;  3T13 A;  1JOK A;  1TQO A;  3P75 A;  3PMF A;  4K14 A;  4PMB A;  5EKK A;  5C5M A;  5C5L A;  5KIX A;  5J39 A;  2LKV A;  3NXW A;  3OWF A;  3P1H A;  3C1E A;  1NUC A;  4LAA A;  2F0V A;  3OMG A;  1RKN A;  3D8G A;  2F0O A;  4YIJ A;  4EQO A;  2F0U A;  5K5P A;  5CV9 A;  2F0S A;  5I6Y A;  5I9O A;  3TP8 A;  1EY0 A;  4K5X A;  5C3W A;  1EZ6 A;  4RKL A;  2F0G A;  3BDL A;  5EKL A;  3SR1 A;  5I9P A;  4DFA A;  2EYO A;  4QMG A;  5E3F A;  3MZ5 A;  1SNQ A;  4J1M A;  1JOO A;  4KV6 A;  3S9W A;  5CV6 A;  3D6C A;  4KY5 A;  4N9P A;  1JOQ A;  4KTA A;  1SYD A;  2WAC A;  2EY2 A;  3D4W A;  4HMJ A;  1EY5 A;  3HZX A;  4KJN A;  1A2T A;  5C6A A;  5J1Z A;  2F0D A;  4NMZ A;  3HEJ A;  2PW5 A;  2F0M A;  4K5V A;  1KDA A;  4MIU A;  4PMC A;  5I6W A;  1A3U A;  4K5W A;  4N9T A;  1II3 A;  3NQT A;  1TR5 A;  2PZT A;  5IGG A;  3VA5 A;  4K2L A;  2RKS A;  2OEO A;  1EYC A;  3NP8 A;  3NK9 A;  1AEX A;  4HMI A;  3E5S A;  3SXH A;  5C4Z A;  2RBM A;  2PQE A;  2EYF A;  2F0T A;  3ERQ A;  3QB3 A;  5CV5 A;  5EGT A;  1F2M A;  1NSN S;  3MEH A;  5F2D A;  4ZUI A;  4E6I A;  4ODG A;  1KDB A;  5IOC A;  1A3T A;  2EY5 A;  2OF1 A;  3NHH A;  3ERO A;  3V2T A;  1SNP A;  4G57 A;  1SND A;  3SHL A;  4ZQ3 A;  5KYI A;  1EY7 A;  4NP5 A;  1EZ8 A;  4NKL A;  4QB4 A;  4ZUJ A;  5M9O A;  2F0P A;  4IZ8 A;  5KGU A;  3NUC A;  3R3O A;  3EVQ A;  5C4H A;  5IGD A;  3LX0 A;  5DAU A;  3MVV A;  4KJO A;  1SNO A;  1EYA A;  3OSO A;  4DGZ A;  1STG A;  3DMU A;  3MXP A;  5IGF A;  1EY4 A;  3QOJ A;  2F0N A;  3TP7 A;  4DF7 A;  5CGK A;  2SNS A;  5JAV A;  1SYE A;  3BDC A;  3TP6 A;  4QF4 A;  1ENC A;  3SK4 A;  1F2Z A;  1EYD A;  4IUN A;  4R8N A;  5KYL A;  3QOL A;  4EQN A;  1TT2 A;  5E1F A;  2EYL A;  2F0J A;  3MHB A;  4K8I A;  4RKB A;  1EY8 A;  4K8J A;  1STH A;  5HGT A;  1A2U A;  2O4X A;  2ENB A;  2EY6 A;  4TRD A;  3D4D A;  2F0H A;  1SYF A;  2NUC A;  2EY1 A;  2EYH A;  2OXP A;  3RUZ A;  2F0W A;  1KDC A;  4H7B A;  1STB A;  3C1F A;  3DHQ A;  4WOR A;  4F8M A;  5CV4 A;  4S3S A;  4PNY A;  5IGC A;  5IGB A;  1U9R A;  4J6H A;  2PW7 A;  2PZU A;  5J22 A;  3T16 A;  1STY A;  1ENA A;  2F3V A;  5CR3 A;  3SK5 A;  4EQP A;  5IGE A;  1SYG A;  4ID6 A;  4ME5 A;  1STN A;  1EQV A;  1A3V A;  2F0Q A; 
#chains in the Genus database with same CATH topology
 2A19 A;  4RGO S;  2LFN A;  3WDN A;  1PRT D;  2MHV A;  2N88 A;  3NBH B;  1UE6 A;  5C44 G;  2F03 A;  1SRU A;  2IY5 B;  4YWM A;  1SYB A;  1IW7 D;  4DU9 A;  3OMC A;  2CW0 D;  1Q46 A;  4A3I B;  1TY0 A;  4LW1 A;  1XMQ L;  3A7A B;  5DNF A;  1X65 A;  5FJ8 G;  2FHT A;  3L3O C;  2NB0 A;  4DAY B;  1GVP A;  1Z6H A;  1HFG A;  1HZA A;  3H3V I;  4KLK A;  1MJC A;  3ITP A;  4DKA C;  1I4P A;  2GA4 B;  3N6R A;  1N32 Q;  1JOK A;  3IRB A;  3E9I A;  2E8G A;  3TBI B;  5JJL A;  4DPG A;  2AUJ D;  3NXW A;  1PTO C;  2E2H B;  3S1R B;  5A2Q E;  1BCP D;  1U4R A;  2WAQ E;  1G91 A;  3J81 i;  4LF9 Q;  4XQQ A;  2KCC A;  1QB5 D;  1LLR D;  1NBW A;  4FO2 A;  2JJQ A;  3KYH C;  3PF4 A;  1ET6 A;  1YJ9 A;  2R7D A;  4NMZ A;  4XTC S;  2QDL A;  4K5W A;  1KXL A;  1RF2 D;  2GN5 A;  2RKS A;  1L0X B;  1UE5 A;  2UUA Q;  4B3T L;  2HDL A;  3CPF A;  3IAY A;  2RBM A;  2PQE A;  4G4K A;  4Z9C B;  5IYB H;  4JBM A;  3FKI B;  1F2M A;  1NSN S;  1S5F D;  1Q82 C;  3RLF A;  2CQO A;  1IBL L;  1K3R A;  1D1I A;  1EZ8 A;  1GHJ A;  4OWT B;  3UDI A;  3CCE A;  3KF6 A;  4DA2 A;  2FJ2 A;  3CF5 A;  3S2H H;  1B9M A;  1NE3 A;  4Q5V A;  4DV0 L;  5M5W H;  5C4J B;  3VYT A;  4L6T B;  2F4V Q;  4IUN A;  4DR6 Q;  4A3E G;  4L5R C;  1IBM L;  5CYU A;  1M4V A;  4PZ8 A;  1VS0 A;  2BDO A;  3A5Z B;  3EIV A;  1X3Q A;  3STB D;  1PFN A;  5EAY A;  4JI4 Q;  4ALP A;  2J0T D;  5IGB A;  1N34 Q;  4GS3 A;  3HOY B;  1CQV A;  4QIW E;  2PI2 A;  1C7Y A;  5FLM G;  4RHS A;  4JBJ A;  2G9D A;  4H0L C;  4MIU A;  2WII B;  3TS2 A;  5LMN Q;  4XYQ A;  5IIF A;  1PXU A;  5JPM C;  1EIG A;  4P2C B;  3PSI A;  2OCE A;  2CWA A;  3V96 A;  3A74 A;  2ZJR A;  4DNI A;  1Y14 B;  2VW9 A;  2CCZ A;  1TWA H;  1YNN D;  2DY8 A;  1FYC A;  4JYA L;  1VQP A;  1LT3 D;  2AWN A;  1WFQ A;  4BY7 G;  3KLS X;  3DM3 A;  2AQ2 B;  4KD3 A;  1TS3 A;  3H6M A;  3HOW H;  1F77 A;  4DR3 L;  1HRJ A;  4HJ5 A;  1EFI D;  4K14 A;  1I94 Q;  3OWF A;  1DJR D;  4B3S L;  2K5W A;  3UDX A;  4JBK A;  2A8V A;  4X3U A;  2K6A A;  2F4I A;  4H02 A;  2NVT H;  1LAB A;  1PTO B;  1EOT A;  4C3J B;  4L5Q A;  1JE5 A;  4U68 A;  5E3F A;  4QGU A;  1BKB A;  1KL9 A;  2YTV A;  2VZA A;  3BYT B;  5J1Z A;  4A3J H;  4JI0 Q;  2KEN A;  3JAM L;  2JA8 H;  2R61 A;  4A3M H;  3GV6 A;  2Y0S B;  5LL6 X;  4DR1 L;  3WOE A;  3LWE A;  4IO9 A;  1X55 A;  1YNJ C;  4HJ9 A;  3HG9 A;  1UEA B;  1A3T A;  3PQI A;  4EQ5 A;  5JEA G;  4FXD A;  1ET9 A;  1WJJ A;  1EEF D;  1SND A;  1SXT A;  1LUZ A;  1ESF A;  1W6J A;  3KFU A;  3HOU B;  2UU9 L;  3NEL A;  4XYO A;  3PIO A;  2D9U A;  5AJ3 Q;  1XNR L;  1C0A A;  5IP7 G;  4JI1 L;  4L5S A;  1DCZ A;  1HPC A;  1SR3 A;  4JCV E;  2N3S A;  2XTI A;  3CME A;  2KUM A;  3KF8 A;  4A3F H;  4GKK L;  4QF4 A;  1SE8 A;  1HQM C;  1PTO F;  3MC0 B;  1FVI A;  3NWS A;  3CCU A;  1JE4 A;  4KHP L;  4PNY A;  1AN8 A;  4B3R L;  1DYQ A;  4GKJ Q;  2B2W A;  1WCM H;  4KN7 C;  2K04 A;  2L55 A;  1NR2 A;  4DV4 L;  4RG1 A;  2EJM A;  3CCR A;  2N55 A;  5M3F H;  4A3D B;  2VXW A;  3OYY A;  3GTJ H;  3PUW A;  4HJ8 A;  1I4G A;  1S4Z A;  2NVX H;  2D0P A;  5IP9 H;  2L4N A;  3HOV H;  4P73 A;  1SN8 A;  3HKZ G;  2EYP A;  4RHR A;  1YI2 A;  2CH4 A;  2WV6 D;  3J7Y W;  1EY6 A;  3HOZ G;  1SYC A;  3NTI A;  1BBW A;  4HIK A;  1K8O A;  3F1Z A;  4GN5 A;  3H0G G;  2Q8R E;  4IAL A;  1YIJ A;  1K83 B;  1AZP A;  2SDF A;  4P72 A;  1KLG D;  1B53 A;  5IE8 A;  3K7A H;  3P1H A;  1ASY A;  3ULJ A;  3W1G A;  3K0X A;  4HN7 A;  1V1O A;  4CHT B;  3HOX H;  1QVF A;  4DUZ L;  1XNQ Q;  2VUM G;  3TRZ A;  3IKJ A;  4YCU A;  1EY0 A;  5DLQ E;  1VQ8 A;  3NWT A;  5I9P A;  1OTC A;  2JSO A;  3PF5 A;  1SNQ A;  1J5E Q;  4B3M L;  4KY5 A;  5LHY 1;  4OX9 Q;  2UXC L;  1RHP A;  2WAQ B;  1I4X A;  1HXY D;  4HR7 B;  4JI5 L;  1X3P A;  4IUT A;  4OO1 I;  4Q0F A;  1E24 A;  1PFM A;  4HMI A;  5KNB A;  3ERQ A;  4A3B G;  4ZUI A;  2PQA A;  5ELN A;  4RCO A;  4OEL B;  2WIN B;  1VMP A;  3W1B A;  1YVC A;  2JA5 H;  2MP1 A;  3CD6 A;  3K5M A;  4JBW A;  3M85 A;  2I07 B;  2PMZ E;  3RLO A;  3OTO Q;  1PH5 A;  2EOT A;  3MFG A;  4A3K G;  2F1M A;  5IGF A;  4V0B A;  3S15 H;  4R8N A;  4LF8 Q;  2XVS A;  5E1F A;  5IYD G;  3KLW A;  4RKB A;  3KJP A;  2MUY A;  1A2U A;  3W2D A;  2ENB A;  5COY A;  5C0X H;  3RUZ A;  1QCB D;  1X56 A;  1E0B A;  2R7Z H;  1KHI A;  4F8M A;  4NPS A;  3J7A F;  2AQ3 B;  4HCE A;  1YNX A;  4YY3 Q;  4DV6 Q;  1PH3 A;  4JI8 L;  5GRO A;  3T1Y Q;  1XMO L;  1B3Q A;  1AP0 A;  1RD9 D;  5CV7 A;  1BBU A;  1AZQ A;  1QG7 A;  2IT1 A;  3KDF A;  5C3X A;  3I56 A;  1L1O B;  3J80 c;  3M7G A;  2Q2H A;  2Z4I A;  4JV5 Q;  4QIW B;  1D5X C;  1KAW A;  2IJ0 A;  2JYO A;  3SE0 A;  2EYM A;  5TSS A;  5I4D A;  4PG3 A;  1K0S A;  1OXU A;  1CM9 A;  4P71 A;  4NB3 A;  1ML0 D;  3VYS A;  4B9X A;  4EVO A;  2LS0 1;  4HJA A;  1T5E A;  1A15 A;  2FIN B;  2DY7 A;  4YWL A;  4FF4 A;  2BE5 C;  4LNQ A;  1MI2 A;  3PUX A;  4KY6 A;  1AE2 A;  2NTT A;  3QIA A;  4F87 A;  3FPU B;  3MAQ A;  3S2H B;  2NYZ D;  1HNZ Q;  4X62 Q;  2KOL A;  4X6A H;  5I6Y A;  3CXC A;  1G6Z A;  1LAC A;  3A55 A;  4OXP A;  4LFB L;  4AH6 A;  5EKL A;  4C2M H;  5JVG 3;  3D6C A;  3RLN A;  4DNR B;  2JA6 H;  3RD4 A;  3I4N G;  1LT5 D;  1A62 A;  1TWG B;  3BVG A;  5C4J H;  2MQH A;  2K05 A;  2PW5 A;  3FMC A;  3VDY A;  3RN2 A;  4QJF A;  5EBC A;  4BA2 I;  5ELO A;  1AEX A;  1TWC H;  3D31 A;  2XWB B;  1VQK A;  1EWH A;  4BWG B;  1V9P A;  1FL0 A;  3CQZ B;  1IBK Q;  3NHH A;  2IL8 A;  2HDM A;  1JMC A;  1LTS D;  4ZQ3 A;  3CPW A;  4GN4 B;  3T51 B;  1IYJ B;  1TWA B;  3TZD A;  3NTK A;  1EWC A;  1Q1B A;  2MO0 A;  3G48 A;  1CK1 A;  4LF9 L;  2R93 H;  1EY4 A;  5M5X H;  3NBH A;  1MSH A;  3K6O A;  4X66 Q;  1LT6 D;  3HOW B;  2B2V A;  5E7N A;  4LF7 Q;  1NNX A;  4GNX C;  4A3G H;  2JA7 B;  1C4Q A;  4CJ2 C;  1PRT C;  1TT2 A;  5FO8 B;  1S5E D;  2CKZ B;  2X6G A;  2ZXR A;  3R93 A;  3FEW X;  4WFN 3;  1BNZ A;  2EY1 A;  5EQ0 A;  1LTR D;  1KDC A;  1RIP A;  2UUA L;  1IYV A;  1IW7 C;  2K4K A;  4OO1 G;  2DNE A;  2CW0 C;  3GTQ H;  2PW7 A;  4XIG S;  1I4H A;  4C3I H;  1BVS A;  4DR4 Q;  3MXN A;  4ID6 A;  1HQR D;  3U4Z A;  2RVL A;  2RCN A;  1UWV A;  2PPB C;  3LWU A;  1GOZ A;  4G7O C;  1WTQ A;  5A35 A;  2ZTD A;  1F2Y A;  4K6L A;  2Z4H A;  4FXK C;  1MHW C;  5ELE A;  2JA8 B;  2QKI C;  4G7Z C;  1V8Q A;  3A7L A;  3A8K E;  2F4V L;  1BCP C;  1EU4 A;  3OPO A;  4DR6 L;  1KD1 C;  5IY0 A;  2E5L Q;  1JOR A;  4MNO A;  1NMF A;  1H95 A;  1EY9 A;  3FKI G;  5GAE C;  3ERS X;  2PZW A;  4BBR H;  2WKC A;  1N9W A;  1DOK A;  4NW2 A;  4JI4 L;  2C9O A;  3FDT A;  2IW3 A;  3CCS A;  1WYD A;  1I3Q B;  1GUG A;  1CSQ A;  2F0V A;  1HTL D;  2F0U A;  5CV9 A;  2F0S A;  3KOJ A;  2VL6 A;  1CZW A;  1HFN A;  1VF7 A;  2KED A;  5G3L D;  3K0Y A;  1D8L A;  2EDG A;  4RKL A;  5BN3 A;  2TMP A;  1SRO A;  2IHF A;  4HMJ A;  1VQM A;  2R6G A;  4JI2 Q;  1A2T A;  1V43 A;  3RMH A;  1QVG A;  1TY2 A;  2ZT9 C;  1WCM B;  2WB1 G;  2Z1C A;  1Q81 C;  4BBS H;  3M4O H;  4DV5 Q;  3HOY G;  1EYC A;  1R4Q B;  3GTM H;  1WOC A;  5M3F B;  3GTJ B;  4IUR A;  1VQD A;  4JI6 Q;  3HOV B;  4U67 3;  4FF1 A;  1N33 L;  5I2X A;  1WTR A;  2VB3 X;  2VB2 X;  3VR6 A;  3STB C;  2LXK A;  4CDF C;  3QJY A;  2OTL A;  2AKW B;  3AFQ A;  4DGZ A;  4OON A;  1SLJ A;  2KA7 A;  3SK4 A;  1R9T H;  1NR4 A;  5K36 G;  3VR4 A;  2PMZ B;  1Q12 A;  3BDO A;  4EQN A;  3J80 L;  1XPR A;  4K8I A;  1OXT A;  4A75 A;  1SYF A;  1PRT B;  3PGZ A;  1Y1V H;  1YNN C;  1Q1E A;  1VQL A;  1D1K A;  1B4O A;  2K5Q A;  5ELC A;  3DXJ C;  1BR9 A;  3R2I A;  3JAM c;  1MBY A;  4C3J G;  3GD7 A;  4X3T A;  1SBB B;  4BY1 H;  4MHE A;  4GOP C;  1LV9 A;  1V1P B;  1KIX A;  1LTT D;  4WJ3 M;  1STE A;  2QIL A;  5AJ3 L;  2X6L A;  3D6W A;  4GZY C;  4DR5 Q;  1E22 A;  2KBN A;  1EFW A;  3H09 A;  1PMR A;  2Z6B A;  3DWQ A;  1PFS A;  2HHH L;  1GKH A;  1ICW A;  3FPP A;  4MZ9 A;  1PH4 A;  3S14 H;  1BCP B;  1MD2 D;  2BA1 A;  3CW2 C;  1YJN A;  3HOU G;  4A3L G;  4GKJ L;  4DUY Q;  2XIW A;  1GUS A;  2YYZ A;  4JG2 A;  1F9R A;  1BBX C;  3C1E A;  1S5B D;  4O42 A;  1Y1W B;  3S15 B;  1PRT F;  4JK1 C;  1QNK A;  3VR2 A;  1WD0 A;  1KC8 C;  5C4X H;  1J8I A;  4JVZ A;  3ER0 A;  1N36 L;  2R7Z B;  2L12 A;  2L9H A;  2F0D A;  1SDF A;  3HP3 A;  4A3C H;  2ZXP A;  4I7Z C;  4ZYS A;  2EXD A;  1VMC A;  3CCL A;  3M4P A;  3BU2 A;  1H9K A;  3NP8 A;  1IL2 A;  1PZK D;  5GAD C;  3BJU A;  1B44 D;  3J80 E;  4NXM Q;  2EPB A;  4OEM B;  3EBE A;  4UP8 A;  3F2C A;  4CGY B;  4A3D G;  3CKI B;  5ELF A;  3CCJ A;  1BCP F;  4NKL A;  5D3I B;  1VQF A;  3NUC A;  1KRT A;  5C4H A;  1JQY D;  1JB3 A;  4LFC Q;  4DAV A;  1PV4 A;  2B63 H;  1YBY A;  3I4M G;  2C35 B;  1SJH D;  3F2B A;  2KVM A;  5D65 A;  3BDC A;  3TP6 A;  3PIP A;  4LF4 Q;  3A5U A;  3DEO A;  2OWO A;  4C3H H;  2F0J A;  3MHB A;  1DZ1 A;  2RSO A;  1O7Z A;  4YCW A;  2PI2 E;  5IWA Q;  2OQ0 A;  4RFB A;  2D5D A;  2DNC A;  1WTO A;  2DGY A;  1PLF A;  4GLX A;  4C2M B;  1VQI A;  4IN3 A;  4X65 Q;  5JOB A;  2PCF B;  1HHV A;  2JA6 B;  4IPC A;  2UXD L;  2D2C C;  5CBE E;  3OTO L;  2WAQ G;  4GOP B;  2K52 A;  1Q90 A;  3VYR A;  1O7Y A;  1TWC B;  2B8G A;  4AYB G;  2YU9 H;  1D5Z C;  4LF8 L;  2L1B A;  1EUJ A;  3PUZ A;  3CC2 A;  4CDC C;  1E3P A;  5FO9 B;  4KY7 A;  3SK6 A;  4AQY Q;  1TWG H;  1B2T A;  2IX3 A;  2A73 B;  2L0C A;  2NN6 H;  1WTX A;  3EJI A;  1CKN B;  1GUT A;  1JWM D;  5IOD A;  2M2L A;  1QOH A;  4PMB A;  3T1Y L;  2V4D A;  5C5L A;  2RDH A;  4ZCK A;  2R93 B;  3CQZ H;  5JJK A;  5M5X B;  3LGJ A;  2J7Z A;  1FD7 D;  4A3G B;  4XT3 B;  4O1N A;  4O0A A;  4DFA A;  4IQZ A;  4DV1 Q;  2HUG A;  2E74 C;  2QEJ C;  1D5M C;  1W6K A;  3GTQ B;  4XXE A;  5C0X J;  1KDA A;  3SEB A;  4C3I B;  1WI5 A;  2JA7 H;  3VA5 A;  2H4O A;  1AE3 A;  1QUQ B;  4ME3 A;  4X64 Q;  2E2J B;  5CV5 A;  5F2D A;  2Z6K C;  3I90 A;  5IOC A;  1NAP A;  1AFP A;  3N52 A;  2WFW A;  1SNP A;  5KYI A;  1HNZ L;  3IL8 A;  1YHA A;  3CC7 A;  3HGB A;  1Q8I A;  3J7A 5;  5M9O A;  2K5N A;  4HIM A;  1XX8 A;  1S40 A;  3MFY A;  2A6E D;  4IOC A;  1TS4 A;  2MJ8 A;  3PCO B;  5T1I A;  5IYB G;  1PZI D;  1L0W A;  4BBR B;  1JC7 A;  1C8C A;  1P16 A;  4OIJ A;  1NTG A;  4KN4 C;  1EY8 A;  2ALY B;  1TXY A;  1TWF H;  2O4X A;  1M1K C;  2NVQ H;  1PYS B;  1EU3 A;  3BZK A;  4DV7 Q;  1JR0 D;  2LY7 A;  1F2L A;  1ILP A;  4QL5 A;  3T1H L;  1WTV A;  2B2T C;  1HH2 P;  1PYB A;  4FNF A;  1I3Q H;  2F0L A;  2A68 D;  1GXD C;  3PO2 B;  3X3N A;  1IHZ A;  1EYG A;  1K73 C;  2K7V A;  2RDF A;  4BBS B;  3M4O B;  2R92 G;  1G29 1;  1FJG L;  3NE5 B;  2BDN A;  3S2D H;  3GTM B;  3HKZ E;  2FFK B;  4HID A;  1UE7 A;  2EYJ A;  3J81 L;  1GM5 A;  3NPP A;  2F3W A;  1QE6 A;  2E2I H;  1JWU D;  4H13 C;  2AWO A;  4LUV A;  2HQE A;  1ZXT A;  4B08 A;  1L1O C;  1CKM A;  1HZ9 A;  2UXB Q;  2SOB A;  3F2U A;  2NZ1 D;  5FO7 B;  4DR4 L;  1HA5 A;  4LJZ C;  1S72 A;  1NUC A;  4LAA A;  1NCV A;  2WP8 J;  5JJI A;  1R9T B;  1CZG A;  1KNA A;  3OHX C;  1H9S A;  2UUC Q;  4J1M A;  5EPK A;  1YJW A;  3QO2 A;  4DV3 Q;  1Y1V B;  4HIO A;  4KJN A;  4ZAI A;  2E5L L;  4PMC A;  1XXG A;  2F0M A;  2IHE A;  2IPK D;  1CKO A;  3JAM E;  1II3 A;  1H9R A;  4R4O A;  4BY1 B;  5H1S E;  2OTJ A;  1XMQ Q;  3BS1 A;  3E3X A;  5E4W C;  2LSS A;  1ZYR D;  5C0X I;  2R7F A;  2LXJ A;  4A3J G;  4WJW A;  2JA8 G;  4BXX H;  4A3M G;  4IZ8 A;  3RZO H;  1B70 B;  3EVQ A;  3KF6 B;  2BCO A;  3MVV A;  2RDG A;  3U58 A;  4LF5 L;  5M3M H;  3S14 B;  4DF7 A;  1H9M A;  3QOL A;  1TKW B;  1WTH A;  3EA6 A;  4K8J A;  3E6Z X;  2HIX A;  1VQG A;  5KNC A;  1IL8 A;  4DV5 L;  1PH6 A;  3VR5 A;  3C1F A;  3J81 E;  5CV4 A;  3VYU A;  1HTP A;  4A3F G;  4FVM A;  4MN3 A;  3T16 A;  4B3T Q;  1KNE A;  4O2D A;  4JI6 L;  3SK5 A;  5C4X B;  2ASB A;  1A8V A;  4DR7 Q;  3KBX A;  2NBF A;  3ZYY X;  1PH2 A;  2CH4 W;  2EZV A;  1W3S A;  1TWH H;  1U4L A;  4JI3 Q;  3Q24 A;  1IBL Q;  1Y1W H;  1JT8 A;  2K5H A;  2B39 A;  1E1T A;  2DJF C;  1OXV A;  3CP0 A;  4UP7 A;  1B50 A;  2KCT A;  1BF4 A;  1Y8O B;  3ICE A;  1WCM G;  1B1Z A;  1SMX A;  1RTN A;  1V1Q A;  2TSS A;  4OIK A;  1SNC A;  1G8Z D;  1HNX L;  3SVM A;  4JOI C;  3UE1 A;  3K59 A;  5IP9 G;  3HOV G;  1B8A A;  4ZKC B;  1GD7 A;  1HR0 Q;  3P75 A;  4IJL A;  3ULL A;  2B29 A;  4L8J A;  4FXG C;  2B63 B;  2UUB L;  4HED A;  2NZO A;  1I6H B;  1QZH A;  4K5X A;  1VQA A;  4C3H B;  3BDL A;  4DR5 L;  3GTO H;  2VS1 A;  3AYH B;  5HGQ A;  2AHO B;  4N9P A;  2HD3 A;  1QVC A;  4YHH L;  3ND8 A;  4LMQ D;  4HJ7 A;  4ILW A;  3Q23 A;  3HOX G;  3HEJ A;  3EQL C;  1JCK B;  4PQX A;  5D3D A;  5C3E H;  2NTS A;  2DJG C;  1TR5 A;  3MTS A;  4YWK A;  3H15 A;  4JYA Q;  2OEO A;  4M8A A;  3W5O A;  1GJX A;  2A6H D;  2EYF A;  4GNX A;  2KHI A;  3W3A A;  3NQI A;  1HA6 A;  4HAE A;  1LM0 A;  3B6Y A;  2EY5 A;  1SJE D;  3ERO A;  4DR3 Q;  1DD2 A;  2JXM B;  1K8M A;  1EL0 A;  2GVB A;  4QB4 A;  3NBI A;  1VQ4 A;  1MGS A;  2YU9 B;  3R3O A;  4R4Q A;  4XDX A;  2RHS B;  4B3S Q;  2BH8 A;  2I46 A;  4IFD H;  5DM6 3;  4GLV B;  2HIV A;  3KF8 B;  3TS0 A;  4IPG A;  1DGS A;  3FHW A;  2CVR A;  2HCI A;  4R4C A;  5FLX L;  2JA5 G;  5HGT A;  3GDE A;  1STH A;  2B2U A;  3PO3 H;  1N32 L;  3GTP H;  3T4A C;  3H91 A;  1UUP A;  2A69 D;  1SE3 A;  2QEX A;  3CCQ A;  5EKI A;  1ENA A;  4DR1 Q;  2LMC B;  2AQ1 B;  3DUZ A;  2X69 A;  1GUO A;  4A3I G;  4J8Q A;  2ICE C;  1Z7T A;  2K33 A;  2RF4 A;  4UP9 A;  5C0X G;  1SE2 A;  2R7Z G;  2OQK A;  2UU9 Q;  4LFC L;  2ATW A;  2PO4 A;  3U4V A;  4V19 0;  3BVZ A;  2L11 A;  5KRU A;  2VQE Q;  4LF4 L;  2O2L D;  4UDU C;  3RR5 A;  1KTK A;  4PV1 C;  4GKK Q;  5EPL A;  1SNM A;  3UI2 A;  4DAY A;  2I5M X;  5IWA L;  5HUR A;  3HKZ B;  5BR8 Q;  2BH2 A;  1S3O A;  2XNA C;  3V05 A;  4LUZ A;  2E2J H;  2LKV A;  2A74 C;  4KHP Q;  4X65 L;  2K03 A;  4UHV A;  3DLL A;  4B3R Q;  4K0K Q;  2VY3 A;  1E2V A;  3H0G B;  4KKS A;  5CMD A;  1ENF A;  1TWF B;  3MZ5 A;  4PMW A;  2ZM6 Q;  3S9W A;  2NVQ B;  1SEB D;  1M8A A;  3I73 A;  3D4W A;  2EY2 A;  2K01 A;  3BZC A;  1U5K A;  3HZX A;  1CFM A;  5C6A A;  1YHB A;  1PHJ A;  5I6W A;  3GQB A;  5M5Y H;  3A54 A;  1A3U A;  1DXM A;  1N34 L;  1PZJ D;  1J9O A;  2H1E A;  2RA4 A;  2WB1 E;  3T56 B;  4IUP A;  1HNW Q;  1YEZ A;  3C3L A;  3I8Z A;  4DAM A;  2K1B A;  3ZJY C;  2EJG C;  2XN9 C;  3MEH A;  5LMN L;  2JA6 G;  1Z9F A;  2PQA B;  2G5D A;  3CRL C;  4I7A A;  4M1U B;  3A8J E;  4TVA B;  4C1N K;  1DOM A;  3MA2 B;  3S2D B;  5G3L F;  1SMY D;  2E2I B;  3MXG A;  4AIM A;  4DV1 L;  2M9V A;  3PO2 H;  3MXP A;  2F0N A;  3D3R A;  2QCP X;  4GOP A;  1YZ6 A;  3I4O A;  3S1M H;  4Y52 H;  1L0Y B;  1CHP D;  4A93 H;  3CMA A;  4B3M Q;  1TS2 A;  1ZKO A;  3K8A A;  1CT1 D;  1G6P A;  3QG1 A;  1I94 L;  3GTL H;  3SDZ A;  5I2Y A;  2R93 G;  5C44 H;  4X3K A;  4J6H A;  1CI3 M;  1FGB D;  4RMF A;  1S5C D;  4CKE A;  4EQP A;  2Z8L A;  4A3G G;  2I5H A;  3CAM A;  4B9W A;  4C56 C;  5NUC A;  3DWA A;  1KQS A;  2PYK A;  4ULL A;  1K0R A;  5CC4 A;  4GLA C;  5FJ8 H;  2ZTC A;  4FF3 A;  3BZD B;  1STA A;  4NXN Q;  2SNM A;  1I6V C;  4JI0 L;  3I4L A;  4C3I G;  1KAB A;  3S24 A;  5IYC G;  4DNT B;  1R4P B;  3S17 H;  1KAA A;  4HTH A;  3S16 H;  2RQX A;  2FMC A;  3C2P A;  2F0K A;  3A0J A;  4NDX A;  3RZO B;  1KLU D;  4R9W A;  2A1A A;  4KMU C;  1NJI C;  1SE4 A;  5M3M B;  5ELB A;  3OMG A;  1RKN A;  3P20 A;  4KHZ A;  4IUU A;  2KCN A;  4JI8 Q;  4LF6 Q;  1XMO Q;  3CC4 A;  4BBR G;  1FR3 A;  1O78 A;  1SFO H;  2ID0 A;  4ABN A;  1HZC A;  2PNH A;  1BUV T;  2Y0S G;  1JOO A;  1IZ6 A;  1JOQ A;  2XSC A;  1LTB D;  1AH9 A;  1PH7 A;  2OT2 A;  1QJO A;  2A6E C;  5T1G A;  2C5C A;  4DR2 Q;  3G6E A;  3DWP A;  4P75 A;  2KHJ A;  2O5I C;  4BS9 A;  3NK9 A;  3E5S A;  1TWH B;  5FOB B;  2DUD A;  4QQB X;  2UXB L;  4OWW B;  2O5J C;  4APV A;  1UEB A;  2KCM A;  2CWP A;  3J81 c;  1LYL A;  1CA6 A;  1QWY A;  4G57 A;  1ILQ A;  4A3E H;  4QY7 A;  4BBS G;  3KJO A;  5CBA E;  2B2Y C;  3R8B A;  5DAU A;  3JAM i;  1TVX A;  3OSO A;  1FNW A;  2SNS A;  3A8I E;  4LFB Q;  2YTX A;  1UAP A;  1X3E A;  2QW7 A;  1HCZ A;  4OGQ C;  5FLM H;  4DV3 L;  5KYL A;  2A68 C;  1JJC B;  1NMG A;  3S1Q H;  2K75 A;  2EYH A;  3KK7 A;  1K3B C;  5L37 A;  1F9Q A;  3KUP A;  3QR8 A;  3VR3 A;  1XNQ L;  3L0O A;  1STY A;  2K5V A;  5COR A;  4A93 G;  5IGE A;  1SYG A;  3GTO B;  3MXN B;  2I0Q A;  2NN6 I;  1VQ9 A;  4KHV A;  4I65 A;  1Q7Y C;  1J5E L;  4BY7 H;  2QDB A;  4OX9 L;  1I6H H;  1Y1V G;  5C3E B;  2IX0 A;  1EQQ A;  2IX1 A;  1Q3L A;  4KKU A;  1QNU A;  4XQN A;  2K50 A;  3FVQ A;  4AYB E;  1T5X D;  3WOF A;  3GTK H;  2ZTE A;  4BY1 G;  4FP5 D;  1LT4 D;  4HSP A;  2M00 A;  3SK8 A;  4K6D A;  5ELD A;  1PH9 A;  2KHS A;  3BYY B;  1I4R A;  1L2F A;  2ZJQ A;  4FF2 A;  1RCV D;  3AFP A;  5BN4 A;  1K8G A;  4HSV A;  4R1J A;  3T13 A;  2MGS A;  1GUW A;  3D0F A;  3PMF A;  5C5M A;  2HCC A;  5LMN W;  3J7Z C;  4DR7 L;  4YIJ A;  2MPM A;  3MXU A;  5K5P A;  4LWC A;  4N8F A;  2N8N A;  2Z0S A;  4IUQ A;  4G7H C;  4JI3 L;  3TP8 A;  2Z6K A;  4Y7N B;  1BQQ T;  4LFA Q;  4BA1 I;  1ZYR C;  4CBV A;  3PO3 B;  3GTP B;  1QIL A;  4KV6 A;  1FNU A;  2WAC A;  5JEA H;  3I55 A;  3H3V H;  3URY A;  1U0L A;  3S1N H;  3OWE B;  4XT1 B;  1EWI A;  1EOV A;  4YY3 L;  5LMU Q;  2K5D A;  4DV6 L;  2QA4 A;  5C4X G;  2Q8T A;  5IP7 H;  4HCS A;  1VF5 C;  4MTK A;  5IT9 c;  1X6O A;  1HR0 L;  1MIU A;  3I70 A;  4OWX B;  3TRE A;  2OF1 A;  2FXQ A;  1M90 C;  4JV5 L;  2WB1 B;  1ROD A;  2D62 A;  1EQR A;  4A3C G;  2GVA A;  4NP5 A;  2R92 H;  3OW2 A;  3PIO 3;  2B2T A;  1SNO A;  2MO1 A;  2P5Z X;  3QOJ A;  3TP7 A;  5CGK A;  2H5X A;  3K5O A;  1ENC A;  4FDB A;  2ZJP A;  4L63 B;  1EYD A;  1C48 A;  1U4M A;  3U9S A;  2K32 A;  3DEP A;  3RZD H;  4DV2 Q;  2EY6 A;  1VQN A;  1Y69 U;  1W2B A;  1LTG D;  4X62 L;  4RH6 A;  3NEM A;  4DAP A;  2B63 G;  1U9R A;  1BDO A;  4J15 A;  2CHB D;  4A4I A;  4C1N I;  4POG A;  2VNU D;  2RCF A;  2YTY A;  3QWN A;  4ZK9 B;  4C3H G;  1L1O A;  1X3F A;  2E75 C;  3HOZ H;  2VQF Q;  1N33 Q;  2BOS A;  5DEH A;  4H44 C;  3KLR A;  5M5Y B;  3H0G H;  3ND9 A;  3TME A;  4WRD A;  1A0I A;  4GN3 B;  4CDD C;  1PA6 A;  1O80 A;  1A6X A;  2VUM H;  4RGT A;  3I3C A;  1CQF A;  1I4Q A;  2F0E A;  1SSO A;  1IBK L;  4IUV A;  2HT1 A;  2V1C C;  4IJH A;  1X3G A;  1T9H A;  5FLX c;  1VQ5 A;  3M4Y A;  3X3M A;  4JW0 A;  3GTG H;  2J4X A;  3NTH A;  2JEA I;  3L7Z C;  2E2D C;  5I9O A;  4L5T A;  4R8I A;  2A6H C;  2NN6 G;  4IFD J;  3UDG A;  4X66 L;  3S1M B;  2NVY B;  4A93 B;  1X54 A;  1I50 H;  2F0G A;  3K81 C;  4LF7 L;  1PYW D;  4RWS C;  4QUC A;  1PH8 A;  4A3B H;  4CKC A;  5CV6 A;  2MFI A;  3GTL B;  3HKS A;  4JC0 A;  2ES2 A;  4IPH A;  2VQE L;  5C44 B;  3FP9 A;  3G7L A;  3EN2 A;  3I72 A;  5EJW A;  3TQY A;  1PTO D;  3TEH B;  5IGG A;  1D2B A;  4QCL A;  1JIC A;  2HHH Q;  3EFX D;  5BR8 L;  1K8A C;  2B3G A;  1KRS A;  3QB3 A;  1JJG A;  4E6I A;  4A3K H;  4JI7 Q;  1XJV A;  1KDB A;  3V2T A;  1DON A;  3HOW G;  2YV5 A;  3MEF A;  3K5L A;  3OW7 A;  5IYD H;  1LTL A;  2JA7 G;  2G9H D;  1TS5 A;  2F0P A;  4K0K L;  4RCN A;  2JA9 A;  2WKD A;  2A69 C;  3S17 B;  3S16 B;  2XGT A;  1STG A;  3DMU A;  2ZM6 L;  1IXR A;  3K58 A;  3M7N A;  3J81 j;  3MWY W;  3U50 C;  1N36 Q;  3E9H A;  4UY8 C;  2F0W A;  1HNW L;  3I4M B;  4DXF A;  3TSS A;  3NEN A;  1DM0 B;  1SFO B;  4IPD A;  1U4P A;  5J22 A;  4MTN A;  1EQT A;  3H3V C;  2RHQ B;  4JOI A;  4ME5 A;  3E0J A;  1N8R C;  2RSN A;  4PZ6 A;  2FMM A;  5DM7 3;  1ONL A;  3GP7 A;  2KQ3 A;  4R4T A;  1F9S A;  2D0O A;  2EQS A;  3P7J A;  1OXX K;  2KJX A;  2F0I A;  1CA5 A;  4JI2 L;  3OIQ A;  1Y8P B;  1WTP A;  5CV8 A;  1LTA D;  4KD4 A;  2Q2U A;  5D14 A;  2B2W C;  4PZ7 A;  2E76 C;  3SGI A;  1YIT A;  5GAH C;  3TZU A;  4A3E B;  1B7Y B;  2EXZ A;  1EIF A;  4LK1 C;  4AYB B;  2IWH A;  5J39 A;  4WJ4 A;  1HR0 W;  3AEV A;  3I4N H;  2JE6 I;  4EQO A;  3D8G A;  2F0O A;  4DK1 A;  1PDQ A;  4JPB W;  1E2W A;  1HUM A;  3Q8D A;  3WWV A;  3K80 C;  5JVH 3;  1P8L A;  1CSP A;  1RDP D;  3M3Y H;  2MNA A;  1XYI A;  3SR1 A;  4ZKB B;  4QMG A;  5IT9 L;  3LNN A;  1VQ7 A;  2F3I A;  4NXN L;  3S1Q B;  2UXD Q;  3CCV A;  4DV0 Q;  5M3F G;  1BOS A;  1ICF B;  1J6Q A;  1SMY C;  1WVL A;  4TSS A;  1IBM Q;  1MSG A;  3NQT A;  4N9T A;  4IFD I;  4K2L A;  3K57 A;  1AW7 A;  4A3I H;  1TU2 B;  2N78 A;  4BY7 B;  1EEI D;  2B8F A;  3K7U C;  4CJ0 B;  4UPA A;  4RA8 A;  4N8X 1;  1HJP A;  4LF6 L;  3Q0A A;  5LL6 S;  1CTM A;  3CU7 A;  2ZXO A;  1BO0 A;  4ZRZ A;  3GTK B;  1B3A A;  1K9M C;  1Q86 C;  4OO1 H;  2L15 A;  2E2H H;  2N49 A;  5FKA C;  1K28 A;  3AB9 A;  3S1R H;  5BN5 A;  3OIP A;  1YNJ D;  1B9N A;  1EIH A;  4TQU S;  1PFB A;  1GO3 E;  4FYD A;  4BXX G;  1OXS C;  2EYL A;  4DR2 L;  3TDQ A;  4R4I A;  3ONA B;  1YHQ A;  3AU7 A;  4TRD A;  3D4D A;  4DUY L;  1H9J A;  2NUC A;  1WTW A;  1STB A;  5M3M G;  4EX5 A;  2EE1 A;  2EVB A;  4DK3 C;  4CDE C;  2PZU A;  2PNR C;  1G51 A;  4IOA A;  3CCM A;  2F3V A;  1VCI A;  2Z9H A;  1CUK A;  1STN A;  5AFW A;  4UAI A;  1IYU A;  2F0Q A;  3G4S A;  1NY4 A;  1V1P A;  5EPJ A;  2DN8 A;  3FKI H;  5EBD A;  4K2K A;  3J80 i;  3S1N B;  3NSW A;  1G2S A;  5M5W B;  4DN4 M;  2EJF C;  4Y7N H;  3BG3 A;  3Q22 A;  5KEE A;  2K14 A;  1RTO A;  5IT9 E;  1Y8N B;  2Q2T A;  3JC6 6;  4NXM L;  4KK7 A;  1VQC A;  1LO5 D;  1SAP A;  1Y1W G;  1FGU A;  4F7X A;  3TP5 A;  4OL7 A;  2R92 B;  2Q2I A;  1F9P A;  4RAU C;  3RN5 A;  4POF A;  1X32 A;  5KIX A;  2A5H A;  5EKK A;  3AMU A;  5GQO A;  2JK8 A;  3D4R A;  3GO5 A;  2JQO A;  2R3Z A;  1PVO A;  1A63 A;  3T1H Q;  4ZLT F;  1G2T A;  1XNR Q;  3HOY H;  4JI1 Q;  1VQB A;  3RZD B;  2EYO A;  1H9S B;  1GUN A;  1VQO A;  3I2Z A;  1RL2 A;  1EY5 A;  1RJT A;  3L2P A;  4K5V A;  5HY6 A;  1FJG Q;  2PZT A;  1X9N A;  3I7F A;  4YCV A;  4RGM A;  1VQ6 A;  3CHB D;  3HOZ B;  3SXH A;  5C4Z A;  5EGT A;  3KLS A;  2F0T A;  4ODG A;  1D6E C;  3K5N A;  5J3B A;  3SHL A;  4LUO A;  5K36 H;  4DV4 Q;  3ULP A;  2NVT B;  5C3E G;  1E2Z A;  3IFD A;  1QZG A;  5KGU A;  1XPO A;  5IYC H;  3LX0 A;  1FNV A;  2VUM B;  3CRK C;  1JJ2 A;  4LFA L;  2JN4 A;  1UE1 A;  5JAV A;  4AQY L;  4A3J B;  1PTO H;  1JB7 A;  2B2U C;  4A3M B;  1I5F A;  3G6J B;  5FLX E;  4C3J H;  5KND A;  1WD1 A;  5LMU L;  2F0H A;  2OXP A;  3GTG B;  4H7B A;  1Z47 A;  4IFD G;  5IGC A;  1TII D;  4X3S A;  1LTI D;  3M4Q A;  3M9B A;  3Q6S A;  1Q8K A;  3TN2 A;  1I50 B;  5CR3 A;  2F52 A;  4A3B B;  3HS0 C;  3PV0 A;  2QF7 A;  2AUK A;  4DUZ Q;  1ESR A;  4EGV A;  2B2V C;  3KBG A;  3PO3 G;  4A3F B;  2XWJ B;  3F8T A;  1GHK A;  5JEA J;  2NVY H;  3HOU H;  4A3L H;  1PH1 A;  1MKH A;  5ISR A;  2UXC Q;  2F0F A;  1XTC D;  4RGN A;  4LF5 Q;  4DK6 C;  4A3K B;  5JJZ A;  3E0E A;  4KI0 A;  4X64 L;  4JI5 Q;  1C9O A;  4KKT A;  4F88 A;  4DV2 L;  1ZEQ X;  3T53 B;  3U9O A;  1CKN A;  1XPU A;  1IKL A;  1UNS A;  1ASZ A;  3H94 A;  3F2D A;  1VQH A;  3L9A X;  1S5D D;  3O13 A;  1TQO A;  2QGQ A;  3IFT A;  1O7L A;  3KDF B;  1D7Q A;  3BVM A;  2SEB D;  3J7A V;  2NVX B;  1OO9 B;  3DM1 A;  3G71 A;  3R2T A;  4XQJ A;  1E1O A;  2XRQ D;  2VQF L;  5C3W A;  1EZ6 A;  2JP1 A;  3UE0 A;  1BXT A;  2K28 A;  2BE5 D;  1VQJ A;  3PUY A;  1MJE A;  4KTA A;  1SYD A;  1XTD A;  2Y0S E;  1XWE A;  4A3D H;  1E7Z A;  1DOL A;  5E4X A;  2B2Y A;  1CHQ D;  4TKO B;  2JEB I;  4DV7 L;  1VDZ A;  2ICI A;  1IKM A;  2I5L X;  3GV3 A;  1QUQ A;  2NWG A;  3RNU A;  2KEC A;  3C46 A;  2KEE A;  3PUV A;  1HNX Q;  3I91 A;  2CQA A;  1VQE A;  2XRS D;  3K7A B;  4GNX B;  5A2Q L;  3I4M H;  4OHJ A;  4QUF A;  4P74 A;  2CFM A;  3HOX B;  2L5T A;  4A76 A;  1EY7 A;  4ZUJ A;  5GAG C;  1K83 H;  3HFZ B;  5JPN C;  3FRP B;  1JWS D;  2HQL A;  5IGD A;  3HRZ C;  1HUN A;  4KJO A;  2UUB Q;  1EYA A;  1SYE A;  1HZB A;  1F2Z A;  3PIP 3;  4DXG A;  3A56 A;  1O7I A;  2AMC B;  3I4N B;  4YHH Q;  2NZH A;  2EIF A;  4CKB A;  3DHQ A;  4WOR A;  4DK0 A;  1EIY B;  3UDF A;  3PO2 G;  4S3S A;  3AQQ A;  3M3Y B;  3OOC A;  4CJ1 B;  5FK9 C;  4JI7 L;  2JA5 B;  3VA7 A;  2Q8I B;  2BA0 A;  1EQV A;  1A3V A;  2UUC L; 
#chains in the Genus database with same CATH homology
 4RGO S;  2LFN A;  3WDN A;  1PRT D;  2MHV A;  2N88 A;  2F03 A;  1SYB A;  1IW7 D;  4DU9 A;  3OMC A;  2CW0 D;  4A3I B;  1TY0 A;  3A7A B;  5DNF A;  2FHT A;  3L3O C;  2NB0 A;  1Z6H A;  1HFG A;  3ITP A;  1I4P A;  2GA4 B;  3N6R A;  1JOK A;  3TBI B;  2AUJ D;  3NXW A;  1PTO C;  2E2H B;  3S1R B;  5A2Q E;  1BCP D;  1U4R A;  1G91 A;  4XQQ A;  2KCC A;  1QB5 D;  1LLR D;  4FO2 A;  1ET6 A;  4NMZ A;  4XTC S;  4K5W A;  1RF2 D;  2RKS A;  1L0X B;  2HDL A;  3IAY A;  2RBM A;  2PQE A;  4G4K A;  4Z9C B;  3FKI B;  1F2M A;  1NSN S;  1S5F D;  3RLF A;  1D1I A;  1EZ8 A;  1GHJ A;  4DA2 A;  2FJ2 A;  1B9M A;  4Q5V A;  5C4J B;  3VYT A;  4L6T B;  4IUN A;  5CYU A;  1M4V A;  2BDO A;  1X3Q A;  1PFN A;  2J0T D;  5IGB A;  3HOY B;  1CQV A;  4RHS A;  2G9D A;  4H0L C;  4MIU A;  2WII B;  4XYQ A;  5IIF A;  1PXU A;  5JPM C;  1EIG A;  4P2C B;  3V96 A;  1YNN D;  2DY8 A;  1FYC A;  1LT3 D;  2AWN A;  3KLS X;  2AQ2 B;  4KD3 A;  1TS3 A;  3H6M A;  1F77 A;  1HRJ A;  1EFI D;  4K14 A;  3OWF A;  1DJR D;  2K5W A;  4X3U A;  2K6A A;  2F4I A;  1LAB A;  1PTO B;  1EOT A;  4C3J B;  4U68 A;  5E3F A;  3BYT B;  5J1Z A;  3JAM L;  2R61 A;  3GV6 A;  2Y0S B;  5LL6 X;  3WOE A;  3LWE A;  1YNJ C;  3HG9 A;  1UEA B;  1A3T A;  5JEA G;  4FXD A;  1ET9 A;  1EEF D;  1SND A;  1SXT A;  1ESF A;  1W6J A;  3HOU B;  4XYO A;  2D9U A;  1DCZ A;  1HPC A;  2KUM A;  3KF8 A;  4QF4 A;  1HQM C;  1PTO F;  3MC0 B;  3NWS A;  1JE4 A;  4PNY A;  1AN8 A;  1DYQ A;  2B2W A;  4KN7 C;  2K04 A;  2L55 A;  1NR2 A;  2EJM A;  2N55 A;  4A3D B;  2VXW A;  3PUW A;  1I4G A;  1S4Z A;  2L4N A;  2EYP A;  4RHR A;  2WV6 D;  3J7Y W;  1EY6 A;  1SYC A;  3NTI A;  1K8O A;  2Q8R E;  4IAL A;  1K83 B;  1AZP A;  2SDF A;  1KLG D;  1B53 A;  3P1H A;  4HN7 A;  1V1O A;  4CHT B;  3IKJ A;  1EY0 A;  3NWT A;  5I9P A;  2JSO A;  1SNQ A;  4KY5 A;  5LHY 1;  1RHP A;  2WAQ B;  1I4X A;  1HXY D;  4HR7 B;  1X3P A;  4IUT A;  4OO1 I;  4Q0F A;  4HMI A;  1PFM A;  5KNB A;  3ERQ A;  4ZUI A;  4RCO A;  2WIN B;  1VMP A;  2MP1 A;  3K5M A;  4JBW A;  3M85 A;  2I07 B;  2EOT A;  3MFG A;  2F1M A;  5IGF A;  4V0B A;  4R8N A;  2XVS A;  5E1F A;  4RKB A;  2MUY A;  1A2U A;  3W2D A;  2ENB A;  5COY A;  5C0X H;  3RUZ A;  1QCB D;  1E0B A;  4F8M A;  3J7A F;  2AQ3 B;  4HCE A;  1AP0 A;  1RD9 D;  5CV7 A;  1AZQ A;  1QG7 A;  2IT1 A;  5C3X A;  3M7G A;  2Z4I A;  4QIW B;  1D5X C;  2IJ0 A;  2JYO A;  3SE0 A;  2EYM A;  5TSS A;  5I4D A;  1OXU A;  1CM9 A;  1ML0 D;  3VYS A;  4B9X A;  4EVO A;  2LS0 1;  1T5E A;  1A15 A;  2FIN B;  2DY7 A;  4FF4 A;  2BE5 C;  1MI2 A;  3PUX A;  4KY6 A;  2NTT A;  3QIA A;  4F87 A;  3FPU B;  3MAQ A;  3S2H B;  2NYZ D;  2KOL A;  5I6Y A;  1G6Z A;  1LAC A;  3A55 A;  5EKL A;  5JVG 3;  3D6C A;  4DNR B;  3RD4 A;  1LT5 D;  1TWG B;  3BVG A;  2K05 A;  2PW5 A;  3FMC A;  4BA2 I;  5EBC A;  1AEX A;  3D31 A;  2XWB B;  1EWH A;  4BWG B;  3CQZ B;  3NHH A;  2IL8 A;  2HDM A;  1LTS D;  4ZQ3 A;  3T51 B;  1TWA B;  3TZD A;  3NTK A;  1EWC A;  1Q1B A;  1CK1 A;  1EY4 A;  3NBH A;  1MSH A;  3K6O A;  1LT6 D;  3HOW B;  2B2V A;  2JA7 B;  1C4Q A;  4CJ2 C;  1PRT C;  1TT2 A;  5FO8 B;  1S5E D;  2X6G A;  2ZXR A;  3R93 A;  3FEW X;  4WFN 3;  1BNZ A;  2EY1 A;  5EQ0 A;  1LTR D;  1KDC A;  1IYV A;  1IW7 C;  4OO1 G;  2DNE A;  2CW0 C;  2PW7 A;  4XIG S;  1I4H A;  3MXN A;  4ID6 A;  1HQR D;  2RVL A;  2PPB C;  3LWU A;  1GOZ A;  4G7O C;  1WTQ A;  5A35 A;  1F2Y A;  4K6L A;  2Z4H A;  4FXK C;  5ELE A;  2JA8 B;  2QKI C;  4G7Z C;  1V8Q A;  3A7L A;  3A8K E;  1BCP C;  1EU4 A;  3OPO A;  1JOR A;  1EY9 A;  2PZW A;  2WKC A;  1DOK A;  4NW2 A;  2C9O A;  3FDT A;  2IW3 A;  1I3Q B;  1GUG A;  2F0V A;  1HTL D;  2F0U A;  5CV9 A;  2F0S A;  1CZW A;  1HFN A;  1VF7 A;  2KED A;  5G3L D;  3K0Y A;  4RKL A;  2EDG A;  5BN3 A;  2TMP A;  4HMJ A;  2R6G A;  1A2T A;  1V43 A;  3RMH A;  1TY2 A;  2ZT9 C;  1WCM B;  2Z1C A;  1EYC A;  1R4Q B;  5M3F B;  3GTJ B;  4IUR A;  3HOV B;  4U67 3;  4FF1 A;  5I2X A;  1WTR A;  2VB3 X;  2VB2 X;  3VR6 A;  3QJY A;  4DGZ A;  2KA7 A;  3SK4 A;  1NR4 A;  5K36 G;  3VR4 A;  2PMZ B;  1Q12 A;  3BDO A;  4EQN A;  3J80 L;  4K8I A;  1OXT A;  1SYF A;  1PRT B;  1YNN C;  1Q1E A;  1D1K A;  1B4O A;  2K5Q A;  5ELC A;  3DXJ C;  1BR9 A;  3R2I A;  1MBY A;  4C3J G;  3GD7 A;  4X3T A;  1SBB B;  4MHE A;  1LV9 A;  1V1P B;  1LTT D;  1STE A;  2QIL A;  2X6L A;  3D6W A;  4GZY C;  3H09 A;  1PMR A;  3DWQ A;  1ICW A;  3FPP A;  1BCP B;  1MD2 D;  2BA1 A;  2XIW A;  1GUS A;  2YYZ A;  1BBX C;  1F9R A;  3C1E A;  1S5B D;  4O42 A;  1Y1W B;  3S15 B;  1PRT F;  4JK1 C;  1QNK A;  3VR2 A;  1WD0 A;  1J8I A;  2R7Z B;  2L12 A;  2L9H A;  2F0D A;  1SDF A;  3HP3 A;  2ZXP A;  4I7Z C;  4ZYS A;  1VMC A;  1H9K A;  3NP8 A;  1PZK D;  3J80 E;  1B44 D;  2EPB A;  4CGY B;  3CKI B;  5ELF A;  1BCP F;  4NKL A;  5D3I B;  3NUC A;  5C4H A;  1JQY D;  1JB3 A;  4DAV A;  1SJH D;  2KVM A;  5D65 A;  3BDC A;  3TP6 A;  3DEO A;  2F0J A;  3MHB A;  1DZ1 A;  2RSO A;  1O7Z A;  4RFB A;  2D5D A;  2DNC A;  1WTO A;  1PLF A;  4C2M B;  4IN3 A;  5JOB A;  2PCF B;  1HHV A;  2JA6 B;  2D2C C;  5CBE E;  1Q90 A;  3VYR A;  1O7Y A;  1TWC B;  2B8G A;  1D5Z C;  2L1B A;  3PUZ A;  5FO9 B;  4KY7 A;  3SK6 A;  1B2T A;  2IX3 A;  2A73 B;  2L0C A;  2NN6 H;  1WTX A;  3EJI A;  1GUT A;  1JWM D;  5IOD A;  2M2L A;  1QOH A;  4PMB A;  2V4D A;  5C5L A;  2RDH A;  2R93 B;  5M5X B;  2J7Z A;  1FD7 D;  4A3G B;  4XT3 B;  4O1N A;  4DFA A;  4IQZ A;  2HUG A;  2E74 C;  2QEJ C;  1D5M C;  1W6K A;  3GTQ B;  4XXE A;  5C0X J;  1KDA A;  3SEB A;  4C3I B;  3VA5 A;  2H4O A;  2E2J B;  5CV5 A;  5F2D A;  3I90 A;  5IOC A;  1NAP A;  1AFP A;  3N52 A;  1SNP A;  5KYI A;  3IL8 A;  3HGB A;  1Q8I A;  5M9O A;  1XX8 A;  3MFY A;  2A6E D;  1TS4 A;  2MJ8 A;  5T1I A;  1PZI D;  4BBR B;  1JC7 A;  1C8C A;  4OIJ A;  4KN4 C;  1EY8 A;  2O4X A;  1EU3 A;  1JR0 D;  2LY7 A;  1F2L A;  1ILP A;  1WTV A;  2B2T C;  4FNF A;  2F0L A;  2A68 D;  1GXD C;  3PO2 B;  3X3N A;  1IHZ A;  2K7V A;  2RDF A;  4BBS B;  3M4O B;  1G29 1;  3NE5 B;  2BDN A;  3GTM B;  2FFK B;  2EYJ A;  3J81 L;  3NPP A;  2F3W A;  1QE6 A;  1JWU D;  4H13 C;  2AWO A;  2HQE A;  1ZXT A;  4B08 A;  2SOB A;  3F2U A;  2NZ1 D;  5FO7 B;  1HA5 A;  4LJZ C;  1NUC A;  4LAA A;  1NCV A;  2WP8 J;  1R9T B;  1CZG A;  1KNA A;  3OHX C;  1H9S A;  4J1M A;  5EPK A;  3QO2 A;  1Y1V B;  4KJN A;  4ZAI A;  4PMC A;  1XXG A;  2F0M A;  2IPK D;  3JAM E;  1II3 A;  1H9R A;  4BY1 B;  3BS1 A;  5E4W C;  1ZYR D;  5C0X I;  4WJW A;  4IZ8 A;  3EVQ A;  2BCO A;  3MVV A;  2RDG A;  3S14 B;  4DF7 A;  1H9M A;  3QOL A;  1TKW B;  3EA6 A;  4K8J A;  3E6Z X;  5KNC A;  1IL8 A;  3VR5 A;  3C1F A;  3J81 E;  5CV4 A;  3VYU A;  1HTP A;  4FVM A;  4MN3 A;  3T16 A;  1KNE A;  5C4X B;  3SK5 A;  3ZYY X;  2NBF A;  3KBX A;  2EZV A;  1U4L A;  3Q24 A;  2B39 A;  1OXV A;  1B50 A;  1BF4 A;  1Y8O B;  1B1Z A;  1RTN A;  2TSS A;  4OIK A;  1SNC A;  1G8Z D;  3SVM A;  3K59 A;  4ZKC B;  3P75 A;  4L8J A;  4FXG C;  2B63 B;  4HED A;  1I6H B;  4K5X A;  4C3H B;  3BDL A;  4N9P A;  3ND8 A;  4LMQ D;  4ILW A;  3Q23 A;  3HEJ A;  3EQL C;  1JCK B;  4PQX A;  5D3D A;  2NTS A;  1TR5 A;  3MTS A;  2OEO A;  4M8A A;  1GJX A;  2A6H D;  2EYF A;  3W3A A;  3NQI A;  1HA6 A;  4HAE A;  2EY5 A;  1SJE D;  3ERO A;  1DD2 A;  2JXM B;  1K8M A;  1EL0 A;  4QB4 A;  3NBI A;  1MGS A;  2YU9 B;  3R3O A;  4XDX A;  2I46 A;  4IFD H;  5DM6 3;  2CVR A;  2HCI A;  5FLX L;  5HGT A;  1STH A;  2B2U A;  3T4A C;  3H91 A;  1UUP A;  2A69 D;  1SE3 A;  5EKI A;  1ENA A;  2LMC B;  2AQ1 B;  3DUZ A;  2X69 A;  1GUO A;  4J8Q A;  2ICE C;  1Z7T A;  2K33 A;  5C0X G;  1SE2 A;  2PO4 A;  4V19 0;  3BVZ A;  2L11 A;  5KRU A;  2O2L D;  4UDU C;  1KTK A;  4PV1 C;  5EPL A;  1SNM A;  3UI2 A;  4DAY A;  5HUR A;  3HKZ B;  2XNA C;  3V05 A;  2LKV A;  2A74 C;  2K03 A;  1E2V A;  3H0G B;  4KKS A;  5CMD A;  1ENF A;  1TWF B;  3MZ5 A;  4PMW A;  3S9W A;  2NVQ B;  1SEB D;  1M8A A;  2EY2 A;  2K01 A;  3D4W A;  3I73 A;  3HZX A;  1CFM A;  5C6A A;  5I6W A;  3GQB A;  3A54 A;  1A3U A;  1DXM A;  1PZJ D;  1J9O A;  2H1E A;  2RA4 A;  3T56 B;  4IUP A;  3C3L A;  3I8Z A;  2K1B A;  2EJG C;  2XN9 C;  3MEH A;  3CRL C;  4M1U B;  3A8J E;  4C1N K;  1DOM A;  3MA2 B;  3S2D B;  5G3L F;  1SMY D;  2E2I B;  3MXG A;  2M9V A;  3MXP A;  2F0N A;  3D3R A;  2QCP X;  1L0Y B;  1CHP D;  1TS2 A;  1ZKO A;  1CT1 D;  3QG1 A;  3SDZ A;  5I2Y A;  4X3K A;  4J6H A;  1CI3 M;  1FGB D;  1S5C D;  4CKE A;  4EQP A;  2Z8L A;  4B9W A;  4C56 C;  5NUC A;  3DWA A;  2PYK A;  4ULL A;  5CC4 A;  4FF3 A;  3BZD B;  1STA A;  2SNM A;  1I6V C;  3I4L A;  4C3I G;  1KAB A;  4DNT B;  1R4P B;  1KAA A;  4HTH A;  2RQX A;  2FMC A;  3C2P A;  2F0K A;  4NDX A;  3RZO B;  1KLU D;  4R9W A;  4KMU C;  1SE4 A;  5M3M B;  5ELB A;  3OMG A;  1RKN A;  3P20 A;  4KHZ A;  4IUU A;  2KCN A;  1FR3 A;  1O78 A;  2ID0 A;  4ABN A;  1BUV T;  1JOO A;  1JOQ A;  2XSC A;  1LTB D;  2OT2 A;  1QJO A;  2A6E C;  5T1G A;  2C5C A;  3DWP A;  2O5I C;  4BS9 A;  3NK9 A;  3E5S A;  1TWH B;  5FOB B;  2O5J C;  1CA6 A;  1QWY A;  4G57 A;  1ILQ A;  5CBA E;  2B2Y C;  3R8B A;  5DAU A;  1TVX A;  3OSO A;  1FNW A;  2SNS A;  3A8I E;  1UAP A;  4OGQ C;  1HCZ A;  5KYL A;  2A68 C;  2EYH A;  3KK7 A;  1F9Q A;  3KUP A;  3VR3 A;  1STY A;  5COR A;  5IGE A;  1SYG A;  3GTO B;  2NN6 I;  4KHV A;  4I65 A;  2QDB A;  5C3E B;  2IX0 A;  2IX1 A;  1Q3L A;  4KKU A;  1QNU A;  4XQN A;  3FVQ A;  1T5X D;  3WOF A;  4FP5 D;  1LT4 D;  4HSP A;  2M00 A;  3SK8 A;  5ELD A;  4K6D A;  2KHS A;  3BYY B;  1I4R A;  4FF2 A;  1RCV D;  5BN4 A;  4HSV A;  3T13 A;  2MGS A;  1GUW A;  3PMF A;  5C5M A;  2HCC A;  4YIJ A;  2MPM A;  3MXU A;  5K5P A;  4IUQ A;  4G7H C;  3TP8 A;  4Y7N B;  1BQQ T;  4BA1 I;  1ZYR C;  4CBV A;  3PO3 B;  3GTP B;  1QIL A;  4KV6 A;  1FNU A;  2WAC A;  5JEA H;  3URY A;  3OWE B;  4XT1 B;  2K5D A;  2Q8T A;  4HCS A;  1VF5 C;  3I70 A;  2OF1 A;  2WB1 B;  1ROD A;  2D62 A;  4NP5 A;  3PIO 3;  2B2T A;  1SNO A;  3QOJ A;  3TP7 A;  5CGK A;  3K5O A;  1ENC A;  4L63 B;  1EYD A;  1C48 A;  1U4M A;  3U9S A;  2K32 A;  3DEP A;  2EY6 A;  1Y69 U;  1LTG D;  4RH6 A;  4DAP A;  1U9R A;  1BDO A;  4C1N I;  2CHB D;  2VNU D;  3QWN A;  4ZK9 B;  4C3H G;  2E75 C;  2BOS A;  5DEH A;  4H44 C;  3KLR A;  5M5Y B;  3ND9 A;  3TME A;  4WRD A;  1O80 A;  1A6X A;  4RGT A;  3I3C A;  1CQF A;  1I4Q A;  2F0E A;  1SSO A;  4IUV A;  3M4Y A;  3X3M A;  2J4X A;  3NTH A;  2JEA I;  3L7Z C;  2E2D C;  5I9O A;  4R8I A;  2A6H C;  2NN6 G;  4IFD J;  3S1M B;  2NVY B;  4A93 B;  2F0G A;  1PYW D;  4RWS C;  4QUC A;  4CKC A;  5CV6 A;  3GTL B;  5C44 B;  3G7L A;  3I72 A;  5EJW A;  1PTO D;  5IGG A;  1D2B A;  4QCL A;  1JIC A;  3EFX D;  3QB3 A;  4E6I A;  1KDB A;  3V2T A;  1DON A;  3K5L A;  3OW7 A;  2G9H D;  1TS5 A;  2F0P A;  4RCN A;  2WKD A;  2A69 C;  3S17 B;  3S16 B;  1STG A;  3DMU A;  3K58 A;  3M7N A;  3MWY W;  2F0W A;  3I4M B;  4DXF A;  3TSS A;  1DM0 B;  1SFO B;  5J22 A;  1U4P A;  1EQT A;  3H3V C;  4ME5 A;  3E0J A;  2RSN A;  2FMM A;  5DM7 3;  1ONL A;  3GP7 A;  2KQ3 A;  1F9S A;  3P7J A;  1OXX K;  2KJX A;  2F0I A;  1CA5 A;  3OIQ A;  1Y8P B;  1WTP A;  5CV8 A;  1LTA D;  4KD4 A;  5D14 A;  2B2W C;  2E76 C;  3TZU A;  4A3E B;  2EXZ A;  4LK1 C;  4AYB B;  2IWH A;  5J39 A;  2JE6 I;  4EQO A;  3D8G A;  2F0O A;  4DK1 A;  1PDQ A;  1E2W A;  1HUM A;  5JVH 3;  1RDP D;  1XYI A;  3SR1 A;  4ZKB B;  4QMG A;  5IT9 L;  3LNN A;  3S1Q B;  1BOS A;  1SMY C;  1WVL A;  4TSS A;  1MSG A;  3NQT A;  4N9T A;  4IFD I;  4K2L A;  3K57 A;  1AW7 A;  1TU2 B;  4BY7 B;  1EEI D;  2B8F A;  4CJ0 B;  4RA8 A;  3Q0A A;  5LL6 S;  1CTM A;  3CU7 A;  2ZXO A;  1BO0 A;  4ZRZ A;  3GTK B;  1B3A A;  4OO1 H;  5FKA C;  3AB9 A;  5BN5 A;  3OIP A;  1YNJ D;  1B9N A;  1EIH A;  4TQU S;  1PFB A;  4FYD A;  1OXS C;  2EYL A;  3TDQ A;  3ONA B;  3AU7 A;  4TRD A;  3D4D A;  1WTW A;  1H9J A;  2NUC A;  1STB A;  2EE1 A;  2EVB A;  2PZU A;  2PNR C;  2F3V A;  1VCI A;  1STN A;  5AFW A;  4UAI A;  1IYU A;  2F0Q A;  1V1P A;  5EPJ A;  2DN8 A;  5EBD A;  4K2K A;  3S1N B;  3NSW A;  1G2S A;  5M5W B;  4DN4 M;  2EJF C;  3BG3 A;  3Q22 A;  5KEE A;  1RTO A;  5IT9 E;  1Y8N B;  4KK7 A;  1LO5 D;  1SAP A;  4F7X A;  3TP5 A;  4OL7 A;  2R92 B;  1F9P A;  4RAU C;  1X32 A;  5KIX A;  2A5H A;  5EKK A;  3AMU A;  3D4R A;  3GO5 A;  2R3Z A;  4ZLT F;  1G2T A;  3RZD B;  2EYO A;  1H9S B;  1GUN A;  1EY5 A;  1RJT A;  4K5V A;  2PZT A;  4RGM A;  3CHB D;  3HOZ B;  3SXH A;  5C4Z A;  5EGT A;  3KLS A;  2F0T A;  4ODG A;  1D6E C;  3K5N A;  3SHL A;  5K36 H;  2NVT B;  1E2Z A;  3IFD A;  5KGU A;  3LX0 A;  1FNV A;  2VUM B;  3CRK C;  5JAV A;  4A3J B;  1PTO H;  2B2U C;  4A3M B;  3G6J B;  5FLX E;  5KND A;  1WD1 A;  2F0H A;  2OXP A;  3GTG B;  4H7B A;  1Z47 A;  4IFD G;  5IGC A;  1TII D;  4X3S A;  1LTI D;  3Q6S A;  3TN2 A;  1I50 B;  5CR3 A;  4A3B B;  3HS0 C;  3PV0 A;  2QF7 A;  2AUK A;  1ESR A;  4EGV A;  2B2V C;  3KBG A;  4A3F B;  2XWJ B;  1GHK A;  5JEA J;  5ISR A;  2F0F A;  1XTC D;  4RGN A;  4A3K B;  5JJZ A;  4KI0 A;  4KKT A;  4F88 A;  1ZEQ X;  3T53 B;  3U9O A;  1IKL A;  1UNS A;  3H94 A;  3L9A X;  1S5D D;  3O13 A;  1TQO A;  3IFT A;  1O7L A;  3BVM A;  2SEB D;  3J7A V;  2NVX B;  1OO9 B;  3DM1 A;  3R2T A;  4XQJ A;  2XRQ D;  5C3W A;  1EZ6 A;  2JP1 A;  1BXT A;  2K28 A;  2BE5 D;  3PUY A;  4KTA A;  1SYD A;  1XWE A;  1DOL A;  5E4X A;  2B2Y A;  1CHQ D;  4TKO B;  2JEB I;  1VDZ A;  2ICI A;  1IKM A;  3GV3 A;  2NWG A;  2KEC A;  3C46 A;  2KEE A;  3PUV A;  3I91 A;  2CQA A;  2XRS D;  3K7A B;  5A2Q L;  4OHJ A;  4QUF A;  3HOX B;  2L5T A;  1EY7 A;  4ZUJ A;  5JPN C;  3FRP B;  1JWS D;  5IGD A;  3HRZ C;  1HUN A;  4KJO A;  1EYA A;  1SYE A;  1F2Z A;  3PIP 3;  4DXG A;  3A56 A;  3I4N B;  4CKB A;  3DHQ A;  4WOR A;  4DK0 A;  4S3S A;  3M3Y B;  3OOC A;  4CJ1 B;  5FK9 C;  2JA5 B;  3VA7 A;  2Q8I B;  2BA0 A;  1EQV A;  1A3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...