1RKNA

Solution structure of 1-110 fragment of staphylococcal nuclease with g88w mutation
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
110
structure length
110
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRWLAYIYADGKMVNEALVRQGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 10
structure length 110
sequence length 110
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2003-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rknA00
2OEOA 3OMCA 1KAAA 4I65A 1A2TA 1KDBA 1SYCA 3D6CA 1JORA 3SR1A 4NDXA 4DGZA 2F0NA 1SNDA 3TP5A 4QF4A 4K14A 2F0PA 5HURA 2PW7A 4QMGA 2F0MA 3RUZA 3NUCA 4PMCA 5F2DA 3SHLA 4KD4A 4DU9A 3EJIA 1SNOA 3EROA 4R8NA 4ZUJA 1EZ8A 1EYAA 4KJNA 5IGCA 1EY9A 4K6DA 3NXWA 2PZWA 2F0EA 4F7XA 5IGEA 2EXZA 1SNQA 2M00A 3P75A 5KYIA 2EYMA 4ID6A 5I6WA 4KJOA 2RDFA 2OF1A 3D8GA 1SNCA 5EKKA 5IGGA 2EY5A 2EYOA 4NP5A 3E5SA 4KD3A 2F0KA 1RKNA 1TT2A 3ERQA 4N9TA 4LAAA 5EKLA 4DF7A 5I9PA 5ISRA 1ENAA 3DMUA 1SYEA 5KEEA 1SNMA 2F0LA 2F0UA 2EY1A 1F2ZA 3OSOA 3QB3A 4B9XA 3SK8A 1EYCA 5E3FA 2SNMA 3DHQA 4PMBA 1SYFA 4S3SA 4WORA 1EYDA 5CV4A 5CV7A 4H7BA 5DAUA 4J1MA 3LX0A 3SXHA 4EQNA 1STYA 3TP8A 5CR3A 3BDCA 4IZ8A 3HEJA 4NKLA 5IGBA 4KHVA 1EY4A 2O4XA 2F0SA 2SOBA 1JOQA 4OL7A 5IOCA 2EYLA 2PW5A 3EVQA 2QDBA 4K5XA 5C5MA 3TP7A 4QB4A 5M9OA 3BDLA 1A2UA 1SNPA 2EYFA 1NUCA 5CV9A 1EY8A 5K5PA 2HQEA 2WACA 1EY6A 2F0FA 2F0QA 3NQTA 3U9OA 2F0OA 2F3WA 3TP6A 4EQPA 5C3WA 3VA5A 4MIUA 1AEXA 5CGKA 4RKLA 1EZ6A 1SYGA 3MXPA 3HZXA 4DFAA 4WRDA 1JOKA 4HMIA 2SNSA 4K5VA 5JAVA 2F0VA 2F0HA 1F2MA 5IODA 2F0IA 5KRUA 1A3VA 2KQ3A 3MHBA 3R3OA 5C3XA 5J39A 3OMGA 1F2YA 5I6YA 2RKSA 3QOLA 4ZUIA 1II3A 3V2TA 4KV6A 3C1FA 2F0GA 1EQVA 5EGTA 3NK9A 4HTHA 3P1HA 5KIXA 1EY7A 3D4WA 1STBA 5J1ZA 3OWFA 1JOOA 2PZTA 4RKBA 4ODGA 5IGFA 1KDCA 4B9WA 4K8IA 3C1EA 5E1FA 4K8JA 2F0DA 2PYKA 4EQOA 3T13A 5IGDA 4TRDA 4IALA 1KABA 5NUCA 2EYPA 1NSNS 3ITPA 5KYLA 2PQEA 3D4DA 3SK6A 2EYJA 4K2KA 5CV6A 4EVOA 2LKVA 3NHHA 4NMZA 1TQOA 2ENBA 2F0TA 4KTAA 4E6IA 1A3UA 2PZUA 3T16A 1STAA 3NP8A 2F0JA 3TMEA 5C4HA 5DEHA 4ME5A 5C5LA 1KDAA 2OXPA 2RBMA 3S9WA 4KY6A 2EY6A 5CV5A 1IHZA 1STHA 3QOJA 4K2LA 4J6HA 5JOBA 2NUCA 4PNYA 5IIFA 5J22A 4N9PA 2EYHA 3MZ5A 1STGA 4KY5A 4ZQ3A 3PMFA 5CV8A 1ENCA 5CC4A 1A3TA 4G57A 5KGUA 1U9RA 1SYDA 3MVVA 3SK5A 3SK4A 1SYBA 5C4ZA 1STNA 4KY7A 1TR5A 4K5WA 5C6AA 5I9OA 1EY0A 2EY2A 3H6MA 4HMJA 1EY5A 4IUNA 4F8MA 5HGTA 2F0WA 4YIJA 2F3VA 2KHSA 3MEHA
chains in the Genus database with same CATH superfamily
2B2TA 2EVBA 3OMCA 4A3JG 3K80C 1JORA 4CHTB 1Q8KA 1R9TH 2R7ZB 1ML0D 1Y1WB 2F0PA 3SEBA 3FEWX 4CDDC 4OWWB 4R8NA 1DJRD 5C3EB 5IGCA 2XNAC 5C0XH 1JJ2A 1SMYD 1DOMA 4FYDA 1XX8A 1SEBD 1K3RA 1EWIA 2F0KA 5A2QL 1TT2A 3M7NA 3H91A 4B3RL 1H9SB 2B2TC 3OW2A 3U4ZA 2HIVA 3CXCA 4H7BA 3A5UA 4B3SQ 1LLRD 4DR7Q 2AWOA 3TP8A 1I4QA 4AQYQ 2E2JB 5ELBA 5IOCA 1PH9A 1TVXA 5HGQA 1BBUA 4CBVA 1MGSA 4P71A 4XT1B 1CKNA 5K5PA 1T5EA 1IKLA 1WFQA 1A62A 1TS4A 4QL5A 3U9OA 2F0FA 2F0QA 2PNHA 4DV3L 1EFWA 3I70A 3VA5A 1DD2A 2KEDA 3K5MA 1EZ6A 1PRTB 3TREA 4WJ4A 1TWCB 4A3DH 5IT9E 3AB9A 2K03A 2RQXA 2FMMA 1IBKQ 1E3PA 1KC8C 3CAMA 1PMRA 3X3MA 3QOLA 1E0BA 1II3A 3KF8A 3HOZB 1CTMA 5DNFA 4XDXA 3EIVA 1RJTA 3T1YQ 3HKSA 2KCTA 3CMEA 4HJ9A 1Q82C 3HOYG 5IGDA 2HQLA 4DXFA 4A3IB 3JAME 3VYRA 5C0XG 1ASYA 1O7IA 1LTAD 4KTAA 4JPBW 2MHVA 3EA6A 1N32Q 4V190 4LF9L 2XRSD 1CZWA 3IFTA 1CUKA 3S1NB 5IIFA 1Q46A 1PDQA 2R6GA 5AFWA 4ZQ3A 5D3IB 3W2DA 4DR6L 5JJIA 5IYCG 4DAMA 1U0LA 4NW2A 1XTDA 1KLGD 4OIJA 3KLSX 4OO1H 4KY7A 5M3MB 1AN8A 1S5ED 4IUTA 4BBRH 5ELCA 2YU9H 2PPBC 1A15A 2FFKB 4DK1A 1ILQA 2PNRC 3ERSX 1ESFA 1OXTA 4B3TQ 1PRTD 1OO9B 2QF7A 1J5EQ 4UP9A 3D4RA 1YI2A 2VUMB 5IGGA 4QIWB 4A3DG 5EKKA 4LUZA 3SE0A 1SLJA 1X32A 3S2DH 2H4OA 3I4MH 2C9OA 3G4SA 3G6JB 3O13A 3K57A 3DUZA 1PZJD 2ICIA 2JA8B 1F9QA 2WKCA 1ICFB 3J7AF 3G7LA 1WTWA 2A74C 1I50H 2ZT9C 3HRZC 4G7HC 1GHJA 2IL8A 4JYAQ 1PH2A 2QEXA 2F3IA 4DR2L 1C8CA 1A6XA 2E76C 4QB4A 2E5LQ 4DK0A 2WKDA 1PFMA 3E0EA 1D5MC 3K0XA 4AH6A 2WAQE 4A3KH 4RGOS 2P5ZX 1JOKA 4CGYB 4A3MH 1A3VA 5C3XA 1AZQA 3DM3A 3OMGA 2JE6I 5C4XH 4BBRG 1V43A 3C1FA 4C3IB 2UXDQ 4CJ2C 2CH4A 3I55A 2R93G 2RF4A 4WJ3M 1D1KA 3A7LA 1S5CD 2NYZD 4K8IA 4OX9Q 2IHFA 2FINB 3CC7A 5FK9C 2B63B 2A19A 1KLUD 2EYJA 1N36Q 4L5RC 4PZ7A 4DKAC 1S5FD 4OXPA 3C3LA 1GHKA 1Y8NB 3I4MG 3OIPA 1STHA 1J6QA 3LWEA 3S14H 1YJWA 4GKKQ 2JJQA 2B3GA 1SYBA 3C2PA 3P7JA 3F8TA 1VQOA 2R92G 1E1TA 2F3VA 2K75A 2B39A 3MTSA 3D6CA 4B3SL 4DR7L 1SAPA 1ZYRD 4AQYL 4LF8Q 4X3UA 1HNZQ 2Y0SB 3GP7A 3J7AV 3WDNA 4DAVA 2PZWA 4F7XA 1K83H 1RDPD 5IGEA 4A3KG 2JK8A 5KYIA 3RN2A 4HIDA 3DWPA 4KJOA 1MSHA 5I6WA 3DLLA 4NXMQ 3M9BA 4RMFA 4A3MG 4KD3A 1HR0Q 2LSSA 1PH1A 4A3EB 3FMCA 5IP9H 1TY0A 3GTKH 1SNMA 2F0LA 1RTOA 3HKZG 1F2ZA 3KOJA 4TVAB 2D2CC 3K59A 1VQMA 4CDEC 2NB0A 1EYGA 4PMBA 4R8IA 1BKBA 1I3QB 1VQAA 4X66Q 1K28A 5LMNQ 4LFCQ 2KUMA 2WB1B 1NJIC 1IBKL 4R9WA 1U4PA 2K5VA 1VQKA 2O4XA 1HQMC 4A3FB 1Y1VH 2E74C 5E4XA 1GUNA 3T1YL 2MUYA 4HSPA 4RH6A 2NZOA 1NCVA 1CA6A 4CJ0B 1LTGD 2K04A 1BCPD 1YHBA 1DCZA 2KJXA 2ZTEA 4MTNA 4TQUS 1QNUA 2EOTA 1SYGA 1VQ6A 4QUCA 3LGJA 1E2VA 4X3KA 2NVQB 1N32L 4BXXH 3D3RA 3U9SA 1SRUA 5JJKA 5I6YA 2RKSA 3A56A 4A3GB 4UP8A 4X3SA 3FRPB 4APVA 1HNWQ 3MXGA 1KDCA 3PGZA 4PZ8A 3M4YA 3T13A 2AUKA 3F2DA 3L3OC 3QR8A 1MSGA 1HR0W 4AYBB 4B3MQ 4B3TL 3L9AX 4HN7A 4BY1H 2IWHA 1CT1D 5DEHA 1J5EL 2EY6A 3NWTA 4HCEA 2G9DA 1SE3A 4DV5Q 1QE6A 2DJGC 5CV8A 3S1QH 1B70B 3GO5A 3OPOA 4ZKBB 1GUWA 2ZTCA 2NN6I 1XMQQ 4K5WA 5C6AA 3X3NA 4JW0A 2J0TD 3K7UC 5KNDA 1Y1VG 4YHHQ 4DR3Q 1HCZA 3TDQA 3OIQA 3IAYA 4IOAA 1SNDA 1SSOA 4C3HH 1EIGA 4CKBA 3T1HQ 5C4JB 4HAEA 2Q2TA 3EJIA 1BXTA 5CORA 3KF6B 1JJGA 5EPLA 4JYAL 1MJCA 1O7YA 3JC66 1HQRD 2M00A 2E5LL 1JB7A 3MXNA 3HKZE 1FNVA 3HGBA 3E0JA 2VB2X 1J8IA 3BZCA 2HHHQ 3KBGA 3I73A 4IPCA 4KI0A 2WFWA 2F0UA 4XQQA 4JI3Q 1OXXK 3CRKC 2Q8IB 4DV4L 1L0YB 1XNQQ 4GKJQ 3PO3H 3DEPA 1AW7A 1B8AA 4EQNA 2R3ZA 1QNKA 4R4CA 4EGVA 3CRLC 1TWHH 3K7AB 4OL7A 2UXDL 5IT9L 4IUUA 3EVQA 1WCMB 2L1BA 2DJFC 1VCIA 4KN4C 4FVMA 2R7DA 1L1OA 4OX9L 4BY1G 4M8AA 2HQEA 3GTMB 1VQHA 5FLMG 2F3WA 2PMZE 5CGKA 1N36L 5KNBA 2QEJC 1HNXQ 1FD7D 3MA2B 1TXYA 1ONLA 1S5BD 3OHXC 1QZGA 2KEEA 3JAML 1F2YA 3MC0B 3S1RH 5C0XJ 3VYSA 2JA7G 4GKKL 1L1OC 1C7YA 3NBIA 3CU7A 2MO0A 1PH3A 3D6WA 3TS0A 5I2XA 3S1MH 4CDFC 2ZXPA 3D4DA 3M3YH 5E7NA 5JVG3 1E7ZA 3KLWA 1IW7C 1VQCA 4LF8L 4P73A 3NTKA 3I4NB 3V05A 2MNAA 1HNZL 4HR7B 1SE8A 3GTQH 2V4DA 4CDCC 4HJAA 3URYA 2PCFB 4JBKA 4XIGS 4RHSA 1PRTF 1AFPA 4NXML 4L5TA 3PO3G 5ELDA 3CCEA 1D6EC 1HR0L 2OTJA 1TS2A 3PCOB 3SK5A 2N55A 2XSCA 3FHWA 3ULJA 4DV2Q 1D1IA 1YHAA 1GM5A 1SYCA 4X66L 4J8QA 5LMNL 4LFCL 3TP5A 4QF4A 4I7ZC 2I0QA 2KHIA 2A69C 5C44H 3M7GA 5T1IA 1PZKD 3KBXA 4IFDH 2F0EA 2EXZA 1SNQA 3L0OA 1G6PA 2B2WA 3H94A 1LTTD 3K6OA 1QG7A 2EY5A 4O2DA 3J80E 2J4XA 1JWSD 5ISRA 2EY1A 3OSOA 1EYDA 5LL6S 4OHJA 3MFYA 2AQ1B 3RNUA 1BNZA 4IZ8A 4DNTB 4BBSH 1W6KA 2B2WC 4LF9Q 3W1BA 2AKWB 2EYLA 1HNWL 4EX5A 1CHQD 2A6EC 1H95A 2L5TA 4DR6Q 1NUCA 3H0GH 2PQAB 1PFNA 1K73C 1X3EA 3HOVH 2QDLA 1LO5D 1TWFB 3Q0AA 3H3VH 3HOXH 1BVSA 4B3ML 2SNSA 2NBFA 5CBEE 2DGYA 3NE5B 2O5JC 3KJPA 3MHBA 1Q7YC 1TS3A 1XPOA 1JC7A 1PYWD 1X54A 1VQGA 4DV5L 3DM1A 3TZUA 3UI2A 5JVH3 2Z8LA 1STBA 1QZHA 4RKBA 4A3BB 2CQOA 2YV5A 5H1SE 2RA4A 4UP7A 5LHY1 1XMQL 4EQOA 5C44G 4TRDA 2JA6H 4YHHL 2K5DA 4DR3L 4DXGA 4IFDG 1KXLA 1X3GA 1EUJA 1X3FA 1SXTA 3AYHB 3T1HL 2PZUA 3NSWA 3M4OB 1EQTA 1BDOA 3A55A 1E2ZA 3FKIG 1S5DD 4RA8A 2R7ZH 4I7AA 1Y1WH 4L8JA 2BA0A 1SJHD 5EAYA 4DA2A 1HHVA 1KL9A 3F2UA 3HOUB 3MVVA 2HHHL 5C3EH 2JSOA 1S72A 2G9HD 2Z9HA 1OXSC 4JI3L 1YZ6A 1RCVD 4GKJL 1XNQL 3GDEA 2MFIA 1JQYD 1SROA 3K81C 1B50A 4IOCA 4KHPQ 1GKHA 4JI6Q 2F0MA 4P75A 3NUCA 1VQDA 1QVGA 2O2LD 3OOCA 1HZCA 4JC0A 1F77A 3AMUA 3VA7A 3ER0A 1UE5A 4C1NI 1K0RA 1PH6A 2E2JH 4KN7C 1JT8A 4IPDA 2YYZA 1C48A 1Q81C 5GAHC 1BCPF 4GOPB 1HNXL 5DAUA 4A3JB 4J1MA 1ILPA 4GS3A 1KRTA 2D0PA 4DAYB 3BDCA 3VR4A 4M1UB 1G2SA 3HEJA 4JBJA 1BOSA 5I2YA 1QOHA 1KIXA 1PHJA 1TWCH 5C5MA 1B9MA 1A2UA 5BN5A 3CHBD 5IP7H 3TRZA 2K01A 1DGSA 1L0XB 2A1AA 3CCMA 1HFGA 1X56A 3HOZH 2WP8J 2C5CA 1F9SA 4GLAC 2Q2HA 2R7ZG 1Y1WG 1X3QA 2MP1A 2KCMA 2IT1A 1HTPA 4YWKA 3OW7A 1XMOL 5C3EG 3K5OA 2NWGA 4A3IH 1ZEQX 2F0GA 3UE1A 4DV7Q 3R8BA 1JOOA 3I4OA 4P72A 1B4OA 2F0DA 3S1NH 1ET6A 4DV2L 3RR5A 5NUCA 4DR1Q 1QJOA 2K14A 5CV6A 1Y69U 2WAQB 1SBBB 4ZRZA 1C0AA 3Q23A 3T51B 3PIP3 2E2IB 3WOFA 5M3MH 2BE5D 4KY6A 4OWTB 1GO3E 1MJEA 2F1MA 3W1GA 1I94Q 3M4QA 4A3CH 1U9RA 1SYDA 2Z4HA 5JPNC 3HOYB 3W5OA 1EY0A 5FO9B 2ZXRA 3BYTB 2F0WA 1IYVA 3Q22A 4ZLTF 2VUMH 1AZPA 1K8GA 2KCCA 2EDGA 3SR1A 4NDXA 5HURA 2KECA 5F2DA 2EIFA 2AHOB 1D2BA 2JA8H 4JI5Q 4JI4Q 4R4QA 4IUVA 1SNCA 2ALYB 3K5NA 2XWJB 3GTLB 1ESRA 1YNXA 1RKNA 5EKLA 3QIAA 3RZDB 4POGA 4P2CB 2Q2IA 3OYYA 4A3IG 4FF1A 1KD1C 1MHWC 3Q8DA 1F2LA 2B8GA 3PIO3 1M8AA 4LJZC 5EBCA 4Y52H 3HOWH 3MXUA 1LT5D 3R2TA 3A0JA 3KF6A 5IWAQ 2HT1A 4J15A 3VR5A 2GVBA 3KK7A 1LACA 4FXKC 4YCVA 2D0OA 1OTCA 1GXDC 5GAGC 1MI2A 3J81j 3J81L 2CVRA 4C3IH 2UUBQ 3AQQA 1K9MC 5FKAC 4DFAA 3I56A 5GADC 2F0VA 2F0HA 4A3CG 3R2IA 2OWOA 2B63H 1PV4A 1JICA 3MAQA 2VUMG 5EGTA 3NK9A 5KIXA 3G48A 1F9PA 1YJ9A 2HIXA 4Z9CB 2NTTA 3S15B 1R4QB 1Q3LA 5E1FA 3A74A 2K5WA 2DNCA 3HOWB 2JA8G 2CQAA 2KOLA 2ATWA 3T4AC 1YITA 4KHPL 4NMZA 1EOTA 4DV4Q 4UY8C 1M1KC 3FPPA 3JAMi 4LF7L 4JI6L 3QWNA 4LW1A 3VR2A 4OO1G 3ZYYX 2QA4A 4J6HA 2VY3A 5I4DA 1LTRD 5KNCA 1G51A 2R93B 1T9HA 1ENCA 1NY4A 3BG3A 5K36H 3DEOA 4X62Q 3I90A 2DN8A 4DNRB 1VQEA 5CYUA 1LABA 2A6HD 4HJ5A 1STEA 3J80L 4I65A 1DXMA 3RLNA 4C3JB 3KDFB 5EJWA 4K14A 3CQZB 2PW7A 2OCEA 2Z6KA 4A3EH 2VW9A 3EROA 2NZHA 1VQJA 2EQSA 2RHSB 1I3QH 1WJJA 4HCSA 1HZAA 5E4WC 1IKMA 1PTOB 1NR4A 2IHEA 4L5QA 3TBIB 3IKJA 5IT9c 4A3FH 2R92B 2VZAA 3VYTA 4Y7NB 3DWAA 2Z6KC 1KNEA 1U5KA 4MZ9A 3G6EA 1GOZA 3ULPA 3MFGA 4LWCA 4GNXA 4QUFA 1CZGA 4XYOA 3DWQA 1QUQA 4DV7L 2NVQH 1UUPA 1HUMA 3JAMc 2FJ2A 3NTIA 3UDFA 1VQPA 2K28A 1EY6A 3NQTA 4A3GH 4DR1L 3K8AA 3HKZB 1YIJA 1EU3A 1AP0A 5C4XG 1CQFA 1I4HA 1CHPD 4GNXC 1WTVA 2K4KA 3RLFA 2Y0SG 5LMUQ 2B2YA 2B2VA 4IFDJ 4K0KL 1HJPA 1O7ZA 2K32A 4QJFA 1EQVA 1I94L 2K6AA 1EY7A 5COYA 2PZTA 5IGFA 5TSSA 1XPUA 1EWHA 4A3EG 3AFQA 2PI2A 2FXQA 4G4KA 5FLXL 5M5WB 4HEDA 2EJFC 2MJ8A 3Q24A 1I6HB 3A7AB 2FMCA 1TQOA 2ENBA 2F0TA 2PMZB 3H15A 3K5LA 2B2VC 2F03A 2OXPA 3FPUB 3VR3A 2MGSA 5CV5A 4H02A 1IHZA 2X69A 4KLKA 4JI5L 4DV0Q 2NUCA 4JI4L 2O5IC 4A93B 1RL2A 2E2HB 2N88A 3N6RA 1EL0A 3IFDA 1CKNB 3NPPA 2N78A 5C4JH 1J9OA 1FL0A 3H6MA 1CI3M 4ULLA 3ERQA 1WTQA 3GTOB 4NXNQ 2KVMA 2F0NA 5D65A 1K0SA 1N34Q 4QMGA 1JJCB 2LFNA 3I91A 4X65Q 4O0AA 3GTGB 1UE1A 5IWAL 1EZ8A 1PVOA 5IP9G 4G7ZC 3KF8B 1ZKOA 3BZKA 2K05A 3PUVA 5LMNW 3RN5A 2ZTDA 2EYOA 2HCIA 5EBDA 4LFAQ 1EIYB 3A5ZB 3K7AH 1PYSB 2I5LX 2UUBL 1WCMH 3CPWA 3GTPB 1CFMA 1UAPA 5CV7A 1GUSA 4AYBG 4LK1C 4XT3B 2B2UA 2I07B 2AQ3B 1QCBD 3GTMH 3LWUA 4TSSA 1YVCA 1SMYC 4JOIA 1VMPA 3A8KE 4UPAA 4LFBQ 2ZM6Q 3AFPA 1Q1EA 3H3VC 1HUNA 3E9IA 1SNPA 1ICWA 1GUGA 3NTHA 1KNAA 2D62A 2JA9A 4FDBA 1B2TA 2ID0A 4BXXG 1CA5A 4DK6C 3GTJB 2L4NA 4GOPA 2B2UC 4KMUC 2GA4B 3HZXA 4R1JA 2R7FA 2I5HA 1JB3A 4OONA 3NBHB 5D3DA 3RZOH 5J39A 1SFOB 1LUZA 3UE0A 3V2TA 4KV6A 1FNUA 4QY7A 1NTGA 1X55A 4HTHA 5ELNA 4ZAIA 2G5DA 2NTSA 3I4NH 4RHRA 4YCWA 4X62L 3MWYW 1X9NA 3UDIA 2PYKA 2L15A 3EBEA 1KABA 2BE5C 1H9SA 2QGQA 2JEAI 3GD7A 4JV5L 1RTNA 2BH8A 2KENA 1ZXTA 2F0JA 4ME5A 1IXRA 2RSNA 4LNQA 1CSQA 2JA7B 1P16A 4FF4A 4C3HG 5I9OA 3EQLC 4GLXA 2EY2A 4OEMB 3RZOB 3MEHA 1WYDA 1FGBD 1V1PB 2F52A 1A63A 5GAEC 4X6AH 2UUCQ 1VQIA 2QCPX 4PMCA 1SNOA 4LF6Q 1EYAA 4O42A 1I4GA 1XMOQ 4FXDA 4Q5VA 1TKWB 3AU7A 2QW7A 5JJZA 1I5FA 2B8FA 1IBLQ 1FGUA 3G71A 1UNSA 4LAAA 3VR6A 3PF4A 1SYEA 1TS5A 1U4MA 2NVYB 2EZVA 1PRTC 4KKUA 1QILA 1Z9FA 2N3SA 4RCNA 2VQFQ 2UXCQ 1STYA 2XRQD 4P74A 3ICEA 1Y14B 1BUVT 5LMUL 1LV9A 1G6ZA 1PH4A 2F0SA 3J7ZC 1Q86C 3CW2C 2PW5A 1LTID 1TWFH 5J3BA 4C1NK 2NN6H 1M4VA 1KRSA 2EYFA 3BDLA 5CV9A 1T5XD 1YNND 4DR5L 2WACA 2K1BA 3CD6A 3S16B 3U4VA 4BY7B 1L2FA 4U68A 4A3BH 4POFA 2JYOA 4RG1A 4MN3A 4O1NA 3A54A 2HD3A 3U50C 1QVCA 4DV0L 1ASZA 3E9HA 3CC4A 4FNFA 5JEAH 5AJ3Q 2MO1A 1VQ5A 3D4WA 1SR3A 3OWFA 2RVLA 3J81i 3M4OH 4L63B 5C0XI 1LTBD 1L0WA 4XXEA 3T53B 5KYLA 3W3AA 2PQEA 5BN3A 1A0IA 4NXNL 3HOUH 1TWAB 1N34L 1A3UA 3SGIA 3TMEA 2NVTB 2KBNA 3L7ZC 4X65L 2RBMA 3HP3A 1SDFA 2D5DA 1RIPA 3R93A 2A6HC 1VQBA 3MZ5A 3PO2B 5M3FB 1CKMA 1ENFA 1VS0A 2K7VA 1A3TA 1TWGB 2BDOA 1D5ZC 2UUAQ 4LFAL 1E1OA 5EKIA 5BR8Q 2IJ0A 1TR5A 2A68D 3I7FA 3I72A 2I5MX 5L37A 4IUNA 3M4PA 2OQKA 2KHSA 2XVSA 1KAAA 2JXMB 1CK1A 1HFNA 2ZJPA 2TMPA 2CW0D 4KD4A 4LFBL 2ZM6L 3BVGA 4R4TA 1JWUD 1K3BC 4A3JH 3TN2A 3HG9A 3FKIB 4RGNA 3U58A 1YNJD 3FP9A 5LL6X 3KLSA 2RCFA 4A3BG 4NP5A 3L2PA 1XNRL 3NQIA 1ZYRC 3J80i 3DMUA 3CC2A 1FYCA 3MEFA 4BBSG 4B9XA 2JA5B 2EJMA 5JEAG 3BDOA 2NVXB 5M5YB 3N52A 1VF7A 5G3LD 3NELA 3SXHA 1AE2A 3TSSA 3KUPA 3J81c 3F2BA 5CR3A 3A8IE 4LF7Q 2IW3A 1EY4A 3H0GG 3K0YA 2QDBA 3HOVG 2E8GA 1CM9A 4GN5A 1LM0A 5M9OA 3HOXG 2BH2A 2F4IA 3PF5A 4RCOA 3I3CA 2JQOA 2VXWA 1AEXA 1EEID 3CPFA 3KJOA 1LT3D 1PTOF 4WRDA 1B53A 1PYBA 4K5VA 2IX3A 1AE3A 1KQSA 1BCPC 2BCOA 2Z6BA 1XYIA 2M9VA 2JA6G 2X6GA 2Q8RE 3Q6SA 4U673 2E2IH 4IPHA 3VYUA 5FO8B 1VQFA 2Z1CA 4K8JA 4QCLA 3TEHB 4IALA 1WTXA 4LUOA 1NMFA 1W6JA 4GZYC 3S17B 2LKVA 2C35B 4IUPA 2UUCL 3T16A 3HOYH 2E2DC 1B1ZA 2EJGC 1D8LA 3S24A 4WJWA 1CKOA 4LF6L 3J80c 4A75A 2SEBD 1B3AA 3PMFA 2PI2E 1IBLL 1L1OB 3SK4A 2QKIC 2TSSA 4C2MB 5HGTA 4F8MA 5A35A 4Q0FA 4NB3A 5IYCH 1KDBA 1W3SA 2VQFL 1N9WA 1O78A 3GTLH 2UXCL 4JK1C 1K8OA 2WIIB 1UWVA 3RUZA 1N8RC 3RZDH 4AIMA 1SMXA 1IL8A 3S2HB 4ZUJA 1SJED 2HDMA 4K6DA 1DYQA 2E75C 2EPBA 4X64Q 1H9MA 4K0KQ 4IQZA 4CJ1B 3T56B 4JI1Q 1E2WA 3E5SA 1R9TB 1AH9A 3ND8A 2RCNA 4UDUC 5KEEA 4ME3A 1LYLA 1UE6A 5E3FA 3DHQA 4WORA 1SYFA 2WAQG 1VQLA 3IRBA 1A8VA 5IP7G 5FOBB 4DNIA 1P8LA 1MD2D 4KKSA 1WVLA 5AJ3L 2I46A 1F9RA 3HOZG 1G291 5CMDA 1M90C 2XWBB 4EQ5A 3TP6A 2K5HA 4YWLA 3K58A 1I4PA 3GV6A 3S15H 3B6YA 1BBXC 2LXJA 1BO0A 2RHQB 5FLXc 1GJXA 4UHVA 4F87A 1NAPA 2K52A 2VB3X 1H9KA 1JMCA 1C9OA 4IJLA 2JEBI 3CMAA 1VQ7A 4ABNA 1IW7D 5EQ0A 3RD4A 1VMCA 3GQBA 3SDZA 1OXUA 4LF4L 2UUAL 4A3DB 1HXYD 5BR8L 5M3MG 1JE4A 4DV1Q 1HA5A 4DUYQ 1QVFA 2R93H 1VQ4A 4K2KA 1H9RA 2CH4W 2RDGA 2AWNA 1BF4A 2L55A 3H09A 1B44D 3NBHA 1LT4D 3S9WA 4DV6Q 1YJNA 2NZ1D 4N9PA 1EQRA 2LY7A 4IO9A 2V1CC 4C3JH 2GN5A 1EOVA 3GV3A 5CC4A 3CQZH 4PG3A 2A69D 2LXKA 1FR3A 2YTXA 1EY5A 1Q12A 2UXBL 4IPGA 1PTOH 1CQVA 1V1OA 2KCNA 3PUYA 5GROA 1S40A 4DUZL 2OTLA 3PUZA 3D0FA 3I4LA 4JI8Q 2HUGA 1NR2A 2R92H 3UDGA 4Y7NH 1EY9A 1RF2D 3BS1A 1IBMQ 4OWXB 4BBRB 3BVZA 3P75A 2YU9B 4ALPA 2EYMA 2RDFA 1DONA 4YY3Q 1I6VC 1LTLA 1WD1A 4JBMA 4DF7A 5EPJA 5I9PA 3HOWG 2A8VA 1XWEA 3SK8A 1EYCA 2A6ED 4WFN3 4S3SA 1S3OA 2CFMA 4CKCA 4JV5Q 1V1PA 2DNEA 1YNNC 2H1EA 5IGBA 2ZJQA 3S2DB 4KHVA 1JCKB 3I4MB 5FO7B 1I4RA 4C3IG 4PMWA 4RGMA 1GVPA 3BU2A 3CCRA 1PH7A 3EFXD 4BA2I 4PZ6A 2DY8A 5GQOA 2F0OA 4HIMA 1DM0B 1I50B 5EPKA 2B63G 1WTRA 1IL2A 4BA1I 4ZK9B 1HZBA 1WTOA 4C3JG 5JAVA 1F2MA 2KHJA 2KQ3A 3R3OA 1EIFA 2H5XA 5M5WH 1E24A 1BCPB 4LMQD 4CKEA 1I6HH 1TY2A 4A3KB 3P1HA 4DR4Q 1JWMD 3LNNA 4A3MB 2CKZB 3FVQA 1FVIA 4PV1C 2F4VQ 3WWVA 3QG1A 4OIKA 1PH5A 4A93H 2WINB 4MTKA 1YHQA 4PQXA 1LT6D 3PSIA 3SK6A 5JPMC 2E2HH 5C4XB 2LMCB 2Q8TA 1HPCA 3AEVA 3NHHA 2BOSA 3QJYA 2AQ2B 4E6IA 1U4LA 2XTIA 5K36G 2R61A 2A68C 4QQBX 4QIWE 4X64L 3GTOH 2EYHA 4KY5A 1DOLA 1HH2P 4JI1L 2A5HA 1VF5C 3J7YW 2ZJRA 5IY0A 3GTGH 1PA6A 2IX1A 2PQAA 4DR5Q 2CW0C 2DUDA 1PTOD 2L11A 2OEOA 3S14B 3STBD 2GVAA 1YNJC 4DGZA 2B2YC 1MBYA 2WB1G 3RMHA 2UU9Q 3SHLA 1FNWA 5G3LF 3GTPH 4ZYSA 3KYHC 4H13C 5JEAJ 4A3FG 3FDTA 4GN3B 3PQIA 4ID6A 4V0BA 2OF1A 3D8GA 4YCUA 5IYDH 4JG2A 3TS2A 1VQNA 1WI5A 1ENAA 3C46A 2JP1A 3D31A 1VQ9A 2N8NA 1WTPA 1W2BA 1K83B 1Z47A 4X3TA 1NBWA 3E3XA 4LF5Q 5ELEA 3GTJH 4A93G 5A2QE 3GTKB 4A3GG 4FO2A 4K5XA 1X3PA 4MHEA 3WOEA 1I4XA 4R4IA 2EXDA 3SVMA 1SFOH 4DV1L 1HA6A 4DUYL 3OTOQ 1BBWA 4RKLA 1Y1VB 3MXPA 3PIPA 1FJGQ 4XTCS 2ASBA 4YWMA 5FLMH 2F0IA 4N8X1 4JI2Q 4DV6L 3BJUA 3VDYA 3OWEB 1VQ8A 4JI0Q 1PLFA 4IURA 3CCVA 5DM73 2JN4A 4A76A 5J1ZA 1G2TA 1Z6HA 4IFDI 3EN2A 2WV6D 1XNRQ 2MQHA 4XQNA 3ITPA 1NSNS 4BS9A 1CSPA 2LS01 2JA7H 4N8FA 1IYUA 2PO4A 4GLVB 1XTCD 2Y0SE 4JI8L 3IL8A 4JOIC 5IYDG 4DAYA 1MIUA 2K33A 2VQEQ 4NPSA 1N33Q 4K2LA 5J22A 5JOBA 1IBML 4PNYA 1Q8IA 4BWGB 2VS1A 1STGA 1YBYA 4YY3L 2ZXOA 1K8AC 1GUOA 1IYJB 3CCSA 4BY1B 4C56C 2FHTA 4GOPC 4YIJA 3TP7A 4HIOA 3PIOA 2WB1E 1A2TA 1D7QA 4ZCKA 3S1QB 1ET9A 4DN4M 2ES2A 1XPRA 2NVYH 3H3VI 4JI7Q 1KHIA 4DU9A 1O80A 3CCUA 2L0CA 1WCMG 2A73B 2IX0A 2K50A 2Z4IA 5CBAE 1D5XC 1SN8A 4C3HB 1EQQA 3KFUA 1H9JA 3QB3A 2XGTA 1NMGA 1GUTA 3E6ZX 5CV4A 4DK3C 1O7LA 1PH8A 3PUXA 2YTVA 2BDNA 3LX0A 4TKOB 2K5NA 2K5QA 5BN4A 4A3LH 3S16H 5T1GA 2SOBA 1JOQA 1RODA 5DM63 1LTSD 3J81E 3F2CA 3CCQA 4BY7H 4DR4L 1KTKA 5FJ8H 1PZID 4R4OA 3PO3B 3HFZB 2B29A 3PV0A 1QB5D 2SDFA 3F1ZA 1B9NA 2F4VL 4IN3A 2OT2A 4EQPA 4XYQA 1BQQT 1JR0D 1NNXA 4L6TB 4B3RQ 4AYBE 1TWHB 2M2LA 2CWAA 3BVMA 1OXVA 4JBWA 4ZKCB 2AMCB 5KRUA 2ICEC 3I4NG 1NE3A 4ZUIA 5IYBH 3CP0A 1TWAH 4H44C 3UDXA 4ODGA 2NVTH 2CWPA 4B9WA 4RGTA 4DV3Q 2EYPA 1TIID 3PO2H 1V9PA 4OGQC 5M3FH 4HJ8A 2KA7A 3S1RB 3CCLA 2XIWA 1TWGH 1YEZA 4EVOA 1PXUA 4FF3A 1Y8PB 5M5XH 3BZDB 1UE7A 3NP8A 2UU9L 2CHBD 5C5LA 3ZJYC 1KDAA 4HSVA 3A8JE 4GNXB 3QOJA 4LUVA 3BYYB 3S1MB 1QUQB 4RWSC 5IE8A 4FF2A 1RHPA 3M3YB 4G57A 2HCCA 2VNUD 4FP5D 1STNA 4A3LG 1QWYA 1E22A 3HS0C 3NENA 4HMJA 5DLQE 3GTQB 2RSOA 3FKIH 4BY7G 2RDHA 4HJ7A 5ELOA 1EU4A 5FJ8G 4GN4B 1B7YB 4HIKA 1C4QA 4LF5L 1MKHA 3P20A 1UEAB 2DY7A 2L9HA 1Z7TA 2X6LA 2JA5H 4KJNA 1EFID 1RD9D 3NXWA 2NVXH 3I8ZA 5M5YH 1U4RA 3RLOA 4G7OC 1R4PB 1SE4A 1Q1BA 1HTLD 4LF4Q 5M5XB 4N9TA 1UEBA 1X6OA 3OTOL 2J7ZA 1DOKA 5C44B 1G8ZD 2OQ0A 1SE2A 2SNMA 5IYBG 1FJGL 2MPMA 3ULLA 5HY6A 2NN6G 1BR9A 2Q2UA 4JI2L 4L5SA 3DXJC 2N49A 4NKLA 4DPGA 4JI0L 4XQJA 1Q90A 4ILWA 3PO2G 4H0LC 2D9UA 5M3FG 1G91A 1K8MA 2XN9C 4F88A 1XXGA 4B08A 1DZ1A 2YTYA 1EY8A 3PUWA 3ND9A 5JJLA 1KAWA 5C3WA 4QGUA 4BBSB 3QO2A 4MIUA 1X65A 1IZ6A 4IJHA 3NWSA 5ELFA 2UXBQ 3TQYA 4OELB 3KLRA 4HMIA 4JCVE 3CF5A 4DUZQ 3KDFA 5IODA 1PFBA 1V1QA 2VQEL 4IUQA 3H0GB 1Y8OB 1N33L 1EIHA 1WOCA 2VL6A 3ONAB 4A4IA 2IPKD 3V96A 3S17H 3HOVB 5FLXE 4DR2Q 3J7A5 4JVZA 4KHZA 3M85A 3HOXB 3HOUG 3C1EA 3CCJA 4FXGC 2BA1A 1WTHA 1VDZA 2JA5G 2AUJD 3CKIB 4RAUC 4OO1I 2IY5B 1TU2B 1WD0A 1JE5A 1XJVA 4K6LA 2L12A 1STAA 4RFBA 5C4HA 4JI7L 1S4ZA 2QILA 4C2MH 4DAPA 1HRJA 1EEFD 2JA6B 1B3QA 1PTOC 3NEMA 4MNOA 5D14A 2Z0SA 3I2ZA 2CCZA 1EWCA 4KKTA 3MXNB 3STBC 5KGUA 1V8QA 2EE1A 1HZ9A 3S2HH 5C4ZA 4UAIA 1PFSA 3TZDA 2HDLA 4KK7A 1GD7A
chains in the Genus database with same CATH topology
2B2TA 2EVBA 3OMCA 1JORA 4CHTB 2R7ZB 1ML0D 1Y1WB 2F0PA 3SEBA 3FEWX 4R8NA 1DJRD 5C3EB 5IGCA 2XNAC 5C0XH 1SMYD 1DOMA 4FYDA 1XX8A 1SEBD 2F0KA 5A2QL 1TT2A 3M7NA 3H91A 1H9SB 2B2TC 4H7BA 1LLRD 2AWOA 3TP8A 1I4QA 2E2JB 5ELBA 5IOCA 1TVXA 4CBVA 1MGSA 4XT1B 5K5PA 1T5EA 1IKLA 1TS4A 3U9OA 2F0FA 2F0QA 3I70A 3VA5A 1DD2A 2KEDA 3K5MA 1EZ6A 1PRTB 1TWCB 5IT9E 3AB9A 2K03A 2RQXA 2FMMA 1PMRA 3X3MA 3QOLA 1E0BA 1II3A 3KF8A 3HOZB 1CTMA 5DNFA 4XDXA 1RJTA 5IGDA 4DXFA 4A3IB 3JAME 3VYRA 5C0XG 4KTAA 1LTAD 2MHVA 3EA6A 4V190 2XRSD 1CZWA 3IFTA 3S1NB 5IIFA 1PDQA 2R6GA 5AFWA 4ZQ3A 5D3IB 3W2DA 4NW2A 1KLGD 4OIJA 3KLSX 4OO1H 4KY7A 5M3MB 1AN8A 1S5ED 4IUTA 5ELCA 2PPBC 1A15A 2FFKB 4DK1A 1ILQA 2PNRC 1ESFA 1OXTA 1PRTD 1OO9B 2QF7A 3D4RA 2VUMB 5IGGA 4QIWB 5EKKA 3SE0A 1X32A 2H4OA 2C9OA 3G6JB 3O13A 3K57A 3DUZA 1PZJD 2ICIA 2JA8B 1F9QA 2WKCA 3J7AF 3G7LA 1WTWA 2A74C 2ZT9C 3HRZC 4G7HC 1GHJA 2IL8A 1C8CA 1A6XA 2E76C 4QB4A 4DK0A 2WKDA 1PFMA 1D5MC 4RGOS 1JOKA 4CGYB 1A3VA 5C3XA 1AZQA 3OMGA 2JE6I 4C3IB 1V43A 3C1FA 4CJ2C 1D1KA 3A7LA 1S5CD 2NYZD 4K8IA 2FINB 5FK9C 2B63B 2EYJA 1KLUD 1S5FD 3C3LA 1GHKA 1Y8NB 3OIPA 1STHA 3LWEA 1SYBA 3C2PA 3P7JA 2F3VA 2B39A 3MTSA 3D6CA 1SAPA 1ZYRD 4X3UA 2Y0SB 3GP7A 3J7AV 3WDNA 4DAVA 2PZWA 4F7XA 1RDPD 5IGEA 5KYIA 3DWPA 4KJOA 1MSHA 5I6WA 4KD3A 4A3EB 3FMCA 1TY0A 1SNMA 2F0LA 1RTOA 3K59A 1F2ZA 2D2CC 2NB0A 4PMBA 4R8IA 1I3QB 2KUMA 2WB1B 4R9WA 1U4PA 2O4XA 1HQMC 4A3FB 2E74C 5E4XA 1GUNA 2MUYA 4HSPA 4RH6A 1CA6A 1NCVA 4CJ0B 1LTGD 2K04A 1BCPD 1DCZA 2KJXA 4TQUS 1QNUA 2EOTA 1SYGA 4QUCA 2NVQB 1E2VA 4X3KA 3D3RA 3U9SA 5I6YA 2RKSA 3A56A 4A3GB 4X3SA 3FRPB 3MXGA 1KDCA 3M4YA 3T13A 2AUKA 3L3OC 1MSGA 4AYBB 3L9AX 4HN7A 2IWHA 1CT1D 5DEHA 2EY6A 3NWTA 4HCEA 2G9DA 1SE3A 1QE6A 5CV8A 3GO5A 3OPOA 4ZKBB 1GUWA 2NN6I 4K5WA 5C6AA 3X3NA 5KNDA 2J0TD 1HCZA 3TDQA 3OIQA 3IAYA 1SNDA 1SSOA 1EIGA 4CKBA 5C4JB 4HAEA 3EJIA 1BXTA 5CORA 5EPLA 1O7YA 1HQRD 2M00A 3MXNA 1FNVA 3HGBA 3E0JA 2VB2X 1J8IA 3KBGA 3I73A 4KI0A 2F0UA 4XQQA 1OXXK 3CRKC 2Q8IB 1L0YB 3DEPA 1AW7A 4EQNA 2R3ZA 1QNKA 4EGVA 3CRLC 3K7AB 4OL7A 5IT9L 4IUUA 3EVQA 1WCMB 2L1BA 1VCIA 4KN4C 4FVMA 3GTMB 4M8AA 2HQEA 2F3WA 5CGKA 5KNBA 2QEJC 1FD7D 3MA2B 1ONLA 1S5BD 3OHXC 2KEEA 3JAML 1F2YA 3MC0B 5C0XJ 3VYSA 3NBIA 3CU7A 3D6WA 5I2XA 2ZXPA 3D4DA 5JVG3 1IW7C 3NTKA 3I4NB 3V05A 4HR7B 2V4DA 3URYA 2PCFB 4XIGS 4RHSA 1PRTF 1AFPA 5ELDA 1D6EC 1TS2A 3SK5A 2N55A 2XSCA 1D1IA 1SYCA 4J8QA 3TP5A 4QF4A 4I7ZC 2A69C 3M7GA 5T1IA 1PZKD 3KBXA 4IFDH 2F0EA 2EXZA 1SNQA 2B2WA 3H94A 1LTTD 3K6OA 1QG7A 2EY5A 3J80E 2J4XA 1JWSD 5ISRA 2EY1A 3OSOA 1EYDA 5LL6S 4OHJA 3MFYA 2AQ1B 1BNZA 4IZ8A 4DNTB 1W6KA 2B2WC 2EYLA 1CHQD 2A6EC 2L5TA 1NUCA 1PFNA 1LO5D 1TWFB 3Q0AA 2SNSA 2NBFA 5CBEE 3NE5B 2O5JC 3MHBA 1TS3A 1JC7A 1PYWD 3DM1A 3TZUA 3UI2A 5JVH3 2Z8LA 1STBA 4RKBA 4A3BB 2RA4A 5LHY1 4EQOA 4TRDA 2K5DA 4DXGA 4IFDG 1SXTA 2PZUA 3NSWA 3M4OB 1EQTA 1BDOA 3A55A 1E2ZA 1S5DD 4RA8A 4L8JA 2BA0A 1SJHD 4DA2A 1HHVA 3F2UA 3HOUB 3MVVA 2JSOA 2G9HD 1OXSC 1RCVD 1JQYD 1B50A 2F0MA 3NUCA 2O2LD 3OOCA 1F77A 3AMUA 3VA7A 4C1NI 4KN7C 2YYZA 1C48A 1BCPF 5DAUA 4A3JB 4J1MA 1ILPA 3BDCA 3VR4A 4M1UB 1G2SA 3HEJA 1BOSA 5I2YA 1QOHA 5C5MA 1B9MA 5BN5A 1A2UA 3CHBD 2K01A 1L0XB 1HFGA 2WP8J 2C5CA 1F9SA 1X3QA 2MP1A 2IT1A 1HTPA 3OW7A 3K5OA 2NWGA 1ZEQX 2F0GA 3R8BA 1JOOA 1B4OA 2F0DA 1ET6A 5NUCA 1QJOA 5CV6A 1Y69U 2WAQB 1SBBB 4ZRZA 3Q23A 3T51B 3PIP3 2E2IB 3WOFA 2BE5D 4KY6A 2F1MA 1U9RA 1SYDA 2Z4HA 5JPNC 3HOYB 1EY0A 5FO9B 2ZXRA 3BYTB 2F0WA 1IYVA 3Q22A 4ZLTF 1AZPA 2KCCA 2EDGA 3SR1A 4NDXA 5HURA 2KECA 5F2DA 1D2BA 4IUVA 1SNCA 3K5NA 2XWJB 3GTLB 1ESRA 1RKNA 5EKLA 3QIAA 3RZDB 4P2CB 4FF1A 1F2LA 2B8GA 3PIO3 1M8AA 4LJZC 5EBCA 3MXUA 1LT5D 3R2TA 3VR5A 3KK7A 1LACA 4FXKC 1GXDC 1MI2A 3J81L 2CVRA 5FKAC 4DFAA 2F0VA 2F0HA 3R2IA 1JICA 3MAQA 5EGTA 3NK9A 5KIXA 1F9PA 4Z9CB 2NTTA 3S15B 1R4QB 1Q3LA 5E1FA 2K5WA 2DNCA 3HOWB 2CQAA 2KOLA 3T4AC 4NMZA 1EOTA 3FPPA 3QWNA 3VR2A 4OO1G 3ZYYX 4J6HA 5I4DA 1LTRD 5KNCA 2R93B 1ENCA 3BG3A 5K36H 3DEOA 3I90A 2DN8A 4DNRB 5CYUA 1LABA 2A6HD 1STEA 3J80L 4I65A 1DXMA 4C3JB 5EJWA 4K14A 3CQZB 2PW7A 3EROA 4HCSA 5E4WC 1IKMA 1PTOB 1NR4A 3TBIB 3IKJA 2R92B 3VYTA 4Y7NB 3DWAA 1KNEA 1GOZA 3MFGA 4QUFA 1CZGA 4XYOA 3DWQA 1UUPA 1HUMA 2FJ2A 3NTIA 2K28A 1EY6A 3NQTA 3HKZB 1EU3A 1AP0A 1CQFA 1I4HA 1CHPD 1WTVA 3RLFA 2B2YA 2B2VA 4IFDJ 1O7ZA 2K32A 1EQVA 2K6AA 1EY7A 5COYA 2PZTA 5IGFA 5TSSA 1EWHA 4G4KA 5FLXL 5M5WB 4HEDA 2EJFC 2MJ8A 3Q24A 1I6HB 3A7AB 2FMCA 1TQOA 2ENBA 2F0TA 2PMZB 3K5LA 2B2VC 2F03A 2OXPA 3FPUB 3VR3A 2MGSA 5CV5A 1IHZA 2X69A 2NUCA 2O5IC 4A93B 2E2HB 2N88A 3N6RA 1EL0A 3IFDA 3NPPA 1J9OA 3H6MA 1CI3M 4ULLA 3ERQA 1WTQA 3GTOB 2KVMA 2F0NA 5D65A 4QMGA 2LFNA 3I91A 3GTGB 1EZ8A 4G7ZC 1ZKOA 2K05A 3PUVA 2EYOA 2HCIA 5EBDA 3GTPB 1CFMA 1UAPA 5CV7A 1GUSA 4LK1C 4XT3B 2B2UA 2I07B 2AQ3B 1QCBD 3LWUA 4TSSA 1SMYC 1VMPA 3A8KE 1Q1EA 3H3VC 1HUNA 1SNPA 1ICWA 1GUGA 3NTHA 1KNAA 2D62A 1B2TA 2ID0A 1CA5A 3GTJB 2L4NA 2B2UC 4KMUC 2GA4B 3HZXA 1JB3A 5D3DA 5J39A 1SFOB 3V2TA 4KV6A 1FNUA 4HTHA 4ZAIA 2NTSA 4RHRA 3MWYW 2PYKA 1KABA 2BE5C 1H9SA 2JEAI 3GD7A 1RTNA 1ZXTA 2F0JA 4ME5A 2RSNA 2JA7B 4FF4A 4C3HG 5I9OA 3EQLC 2EY2A 3RZOB 3MEHA 1FGBD 1V1PB 2QCPX 4PMCA 1SNOA 1EYAA 4O42A 1I4GA 4FXDA 4Q5VA 1TKWB 3AU7A 5JJZA 2B8FA 1UNSA 4LAAA 3VR6A 1SYEA 1TS5A 1U4MA 2NVYB 2EZVA 1PRTC 4KKUA 1QILA 4RCNA 1STYA 2XRQD 1BUVT 1LV9A 1G6ZA 2F0SA 2PW5A 1LTID 4C1NK 2NN6H 1M4VA 3BDLA 2EYFA 5CV9A 1T5XD 1YNND 2WACA 2K1BA 3S16B 4BY7B 4U68A 2JYOA 4MN3A 4O1NA 3A54A 4FNFA 5JEAH 3D4WA 3OWFA 2RVLA 4L63B 5C0XI 1LTBD 4XXEA 3T53B 5KYLA 3W3AA 2PQEA 5BN3A 1TWAB 1A3UA 3TMEA 2NVTB 3L7ZC 2RBMA 3HP3A 1SDFA 2D5DA 3R93A 2A6HC 3MZ5A 3PO2B 5M3FB 1ENFA 2K7VA 1A3TA 1TWGB 2BDOA 1D5ZC 5EKIA 2IJ0A 1TR5A 2A68D 3I72A 4IUNA 2KHSA 2XVSA 1KAAA 2JXMB 1CK1A 1HFNA 2TMPA 2CW0D 4KD4A 3BVGA 1JWUD 3TN2A 3HG9A 3FKIB 4RGNA 1YNJD 5LL6X 3KLSA 4NP5A 3NQIA 1ZYRC 3DMUA 1FYCA 4B9XA 2JA5B 2EJMA 5JEAG 3BDOA 2NVXB 5M5YB 3N52A 1VF7A 5G3LD 3SXHA 3TSSA 3KUPA 5CR3A 3A8IE 2IW3A 1EY4A 3K0YA 2QDBA 1CM9A 5M9OA 2F4IA 4RCOA 3I3CA 2VXWA 1AEXA 1EEID 1LT3D 1PTOF 4WRDA 1B53A 4K5VA 2IX3A 1BCPC 2BCOA 1XYIA 2M9VA 2X6GA 2Q8RE 3Q6SA 4U673 3VYUA 5FO8B 2Z1CA 4K8JA 4QCLA 4IALA 1WTXA 1W6JA 4GZYC 3S17B 2LKVA 4IUPA 3T16A 2E2DC 1B1ZA 2EJGC 4WJWA 2SEBD 1B3AA 3PMFA 3SK4A 2QKIC 2TSSA 5HGTA 4C2MB 4F8MA 5A35A 4Q0FA 1KDBA 1O78A 4JK1C 1K8OA 2WIIB 3RUZA 3S2HB 1IL8A 4ZUJA 1SJED 2HDMA 4K6DA 1DYQA 2E75C 2EPBA 1H9MA 4IQZA 4CJ1B 3T56B 1E2WA 3E5SA 1R9TB 3ND8A 4UDUC 5KEEA 5E3FA 3DHQA 4WORA 1SYFA 5FOBB 1MD2D 4KKSA 1WVLA 2I46A 1F9RA 1G291 5CMDA 2XWBB 3TP6A 3K58A 1I4PA 3GV6A 1BBXC 1BO0A 1GJXA 4F87A 1NAPA 2VB3X 1H9KA 2JEBI 4ABNA 1IW7D 5EQ0A 3RD4A 1VMCA 3GQBA 3SDZA 1OXUA 4A3DB 1HXYD 1JE4A 1HA5A 4K2KA 1H9RA 2RDGA 2AWNA 1BF4A 2L55A 3H09A 1B44D 3NBHA 1LT4D 3S9WA 2NZ1D 4N9PA 2LY7A 3GV3A 5CC4A 2A69D 1FR3A 1EY5A 1Q12A 1PTOH 1CQVA 1V1OA 2KCNA 3PUYA 3PUZA 3I4LA 2HUGA 1NR2A 1EY9A 1RF2D 3BS1A 4BBRB 3BVZA 3P75A 2YU9B 2EYMA 2RDFA 1DONA 1I6VC 1WD1A 4DF7A 5EPJA 5I9PA 1XWEA 3SK8A 1EYCA 2A6ED 4WFN3 4S3SA 4CKCA 1V1PA 2DNEA 1YNNC 2H1EA 5IGBA 3S2DB 4KHVA 1JCKB 3I4MB 5FO7B 1I4RA 4C3IG 4PMWA 4RGMA 3EFXD 4BA2I 2DY8A 2F0OA 1DM0B 1I50B 5EPKA 1WTRA 4BA1I 4ZK9B 1WTOA 4C3JG 5JAVA 1F2MA 2KQ3A 3R3OA 1BCPB 4LMQD 4CKEA 1TY2A 4A3KB 3P1HA 1JWMD 3LNNA 4A3MB 3FVQA 4PV1C 3QG1A 4OIKA 2WINB 4PQXA 1LT6D 3SK6A 5JPMC 5C4XB 2LMCB 2Q8TA 1HPCA 3NHHA 2BOSA 3QJYA 2AQ2B 4E6IA 1U4LA 5K36G 2R61A 2A68C 2EYHA 4KY5A 1DOLA 2A5HA 1VF5C 3J7YW 2IX1A 2CW0C 1PTOD 2L11A 2OEOA 3S14B 1YNJC 4DGZA 2B2YC 1MBYA 3RMHA 3SHLA 1FNWA 5G3LF 4ZYSA 4H13C 5JEAJ 3FDTA 4ID6A 4V0BA 2OF1A 3D8GA 1ENAA 3C46A 2JP1A 3D31A 1WTPA 1K83B 1Z47A 4X3TA 5ELEA 5A2QE 3GTKB 4FO2A 4K5XA 1X3PA 4MHEA 3WOEA 1I4XA 3SVMA 1HA6A 4RKLA 1Y1VB 3MXPA 4XTCS 2F0IA 3OWEB 1PLFA 4IURA 5DM73 5J1ZA 1G2TA 1Z6HA 4IFDI 2WV6D 4XQNA 3ITPA 1NSNS 4BS9A 2LS01 1IYUA 2PO4A 1XTCD 3IL8A 4DAYA 2K33A 4K2LA 5J22A 5JOBA 4PNYA 1Q8IA 4BWGB 1STGA 2ZXOA 1GUOA 4BY1B 4C56C 2FHTA 4YIJA 3TP7A 1A2TA 3S1QB 1ET9A 4DN4M 4DU9A 1O80A 2L0CA 2A73B 2IX0A 2Z4IA 5CBAE 1D5XC 4C3HB 1H9JA 3QB3A 1GUTA 3E6ZX 5CV4A 1O7LA 3PUXA 3LX0A 2BDNA 4TKOB 2K5QA 5BN4A 5T1GA 2SOBA 1JOQA 1RODA 5DM63 1LTSD 3J81E 1KTKA 1PZID 3PO3B 3PV0A 1QB5D 2SDFA 1B9NA 4IN3A 2OT2A 4EQPA 4XYQA 1BQQT 1JR0D 4L6TB 1TWHB 2M2LA 3BVMA 1OXVA 4JBWA 4ZKCB 5KRUA 2ICEC 4ZUIA 4H44C 4ODGA 4B9WA 4RGTA 2EYPA 1TIID 4OGQC 2KA7A 3S1RB 2XIWA 4EVOA 1PXUA 4FF3A 1Y8PB 3BZDB 3NP8A 2CHBD 5C5LA 1KDAA 4HSVA 3A8JE 3QOJA 3BYYB 3S1MB 4RWSC 4FF2A 1RHPA 3M3YB 4G57A 2HCCA 2VNUD 4FP5D 1STNA 1QWYA 3HS0C 4HMJA 3GTQB 2RSOA 2RDHA 1EU4A 1C4QA 3P20A 1UEAB 2DY7A 2L9HA 1Z7TA 2X6LA 4KJNA 1EFID 1RD9D 3NXWA 3I8ZA 1U4RA 4G7OC 1R4PB 1SE4A 1Q1BA 1HTLD 5M5XB 4N9TA 2J7ZA 1DOKA 5C44B 1G8ZD 1SE2A 2SNMA 2MPMA 2NN6G 1BR9A 3DXJC 4NKLA 4XQJA 1Q90A 4ILWA 4H0LC 2D9UA 1G91A 1K8MA 2XN9C 4F88A 1XXGA 4B08A 1DZ1A 1EY8A 3PUWA 3ND9A 5C3WA 4BBSB 3QO2A 4MIUA 3NWSA 5ELFA 3KLRA 4HMIA 5IODA 1PFBA 4IUQA 3H0GB 1Y8OB 1EIHA 3ONAB 2IPKD 3V96A 3HOVB 5FLXE 4KHZA 3M85A 3HOXB 3C1EA 4FXGC 2BA1A 1VDZA 2AUJD 3CKIB 4RAUC 4OO1I 1TU2B 1WD0A 4K6LA 2L12A 1STAA 4RFBA 5C4HA 1S4ZA 2QILA 4DAPA 1HRJA 1EEFD 2JA6B 1PTOC 5D14A 1EWCA 4KKTA 5KGUA 1V8QA 2EE1A 5C4ZA 4UAIA 3TZDA 2HDLA 4KK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEO A;  3OMC A;  1KAA A;  4I65 A;  1A2T A;  1KDB A;  1SYC A;  3D6C A;  1JOR A;  3SR1 A;  4NDX A;  4DGZ A;  2F0N A;  1SND A;  3TP5 A;  4QF4 A;  4K14 A;  2F0P A;  5HUR A;  2PW7 A;  4QMG A;  2F0M A;  3RUZ A;  3NUC A;  4PMC A;  5F2D A;  3SHL A;  4KD4 A;  4DU9 A;  3EJI A;  1SNO A;  3ERO A;  4R8N A;  4ZUJ A;  1EZ8 A;  1EYA A;  4KJN A;  5IGC A;  1EY9 A;  4K6D A;  3NXW A;  2PZW A;  2F0E A;  4F7X A;  5IGE A;  2EXZ A;  1SNQ A;  2M00 A;  3P75 A;  5KYI A;  2EYM A;  4ID6 A;  5I6W A;  4KJO A;  2RDF A;  2OF1 A;  3D8G A;  1SNC A;  5EKK A;  5IGG A;  2EY5 A;  2EYO A;  4NP5 A;  3E5S A;  4KD3 A;  2F0K A;  1RKN A;  1TT2 A;  3ERQ A;  4N9T A;  4LAA A;  5EKL A;  4DF7 A;  5I9P A;  5ISR A;  1ENA A;  3DMU A;  1SYE A;  5KEE A;  1SNM A;  2F0L A;  2F0U A;  2EY1 A;  1F2Z A;  3OSO A;  3QB3 A;  4B9X A;  3SK8 A;  1EYC A;  5E3F A;  2SNM A;  3DHQ A;  4PMB A;  1SYF A;  4S3S A;  4WOR A;  1EYD A;  5CV4 A;  5CV7 A;  4H7B A;  5DAU A;  4J1M A;  3LX0 A;  3SXH A;  4EQN A;  1STY A;  3TP8 A;  5CR3 A;  3BDC A;  4IZ8 A;  3HEJ A;  4NKL A;  5IGB A;  4KHV A;  1EY4 A;  2O4X A;  2F0S A;  2SOB A;  1JOQ A;  4OL7 A;  5IOC A;  2EYL A;  2PW5 A;  3EVQ A;  2QDB A;  4K5X A;  5C5M A;  3TP7 A;  4QB4 A;  5M9O A;  3BDL A;  1A2U A;  1SNP A;  2EYF A;  1NUC A;  5CV9 A;  1EY8 A;  5K5P A;  2HQE A;  2WAC A;  1EY6 A;  2F0F A;  2F0Q A;  3NQT A;  3U9O A;  2F0O A;  2F3W A;  3TP6 A;  4EQP A;  5C3W A;  3VA5 A;  4MIU A;  1AEX A;  5CGK A;  4RKL A;  1EZ6 A;  1SYG A;  3MXP A;  3HZX A;  4DFA A;  4WRD A;  1JOK A;  4HMI A;  2SNS A;  4K5V A;  5JAV A;  2F0V A;  2F0H A;  1F2M A;  5IOD A;  2F0I A;  5KRU A;  1A3V A;  2KQ3 A;  3MHB A;  3R3O A;  5C3X A;  5J39 A;  3OMG A;  1F2Y A;  5I6Y A;  2RKS A;  3QOL A;  4ZUI A;  1II3 A;  3V2T A;  4KV6 A;  3C1F A;  2F0G A;  1EQV A;  5EGT A;  3NK9 A;  4HTH A;  3P1H A;  5KIX A;  1EY7 A;  3D4W A;  1STB A;  5J1Z A;  3OWF A;  1JOO A;  2PZT A;  4RKB A;  4ODG A;  5IGF A;  1KDC A;  4B9W A;  4K8I A;  3C1E A;  5E1F A;  4K8J A;  2F0D A;  2PYK A;  4EQO A;  3T13 A;  5IGD A;  4TRD A;  4IAL A;  1KAB A;  5NUC A;  2EYP A;  1NSN S;  3ITP A;  5KYL A;  2PQE A;  3D4D A;  3SK6 A;  2EYJ A;  4K2K A;  5CV6 A;  4EVO A;  2LKV A;  3NHH A;  4NMZ A;  1TQO A;  2ENB A;  2F0T A;  4KTA A;  4E6I A;  1A3U A;  2PZU A;  3T16 A;  1STA A;  3NP8 A;  2F0J A;  3TME A;  5C4H A;  5DEH A;  4ME5 A;  5C5L A;  1KDA A;  2OXP A;  2RBM A;  3S9W A;  4KY6 A;  2EY6 A;  5CV5 A;  1IHZ A;  1STH A;  3QOJ A;  4K2L A;  4J6H A;  5JOB A;  2NUC A;  4PNY A;  5IIF A;  5J22 A;  4N9P A;  2EYH A;  3MZ5 A;  1STG A;  4KY5 A;  4ZQ3 A;  3PMF A;  5CV8 A;  1ENC A;  5CC4 A;  1A3T A;  4G57 A;  5KGU A;  1U9R A;  1SYD A;  3MVV A;  3SK5 A;  3SK4 A;  1SYB A;  5C4Z A;  1STN A;  4KY7 A;  1TR5 A;  4K5W A;  5C6A A;  5I9O A;  1EY0 A;  2EY2 A;  3H6M A;  4HMJ A;  1EY5 A;  4IUN A;  4F8M A;  5HGT A;  2F0W A;  4YIJ A;  2F3V A;  2KHS A;  3MEH A; 
#chains in the Genus database with same CATH topology
 2B2T A;  2EVB A;  3OMC A;  4A3J G;  3K80 C;  1JOR A;  4CHT B;  1Q8K A;  1R9T H;  2R7Z B;  1ML0 D;  1Y1W B;  2F0P A;  3SEB A;  3FEW X;  4CDD C;  4OWW B;  4R8N A;  1DJR D;  5C3E B;  5IGC A;  2XNA C;  5C0X H;  1JJ2 A;  1SMY D;  1DOM A;  4FYD A;  1XX8 A;  1SEB D;  1K3R A;  1EWI A;  2F0K A;  5A2Q L;  1TT2 A;  3M7N A;  3H91 A;  4B3R L;  1H9S B;  2B2T C;  3OW2 A;  3U4Z A;  2HIV A;  3CXC A;  4H7B A;  3A5U A;  4B3S Q;  1LLR D;  4DR7 Q;  2AWO A;  3TP8 A;  1I4Q A;  4AQY Q;  2E2J B;  5ELB A;  5IOC A;  1PH9 A;  1TVX A;  5HGQ A;  1BBU A;  4CBV A;  1MGS A;  4P71 A;  4XT1 B;  1CKN A;  5K5P A;  1T5E A;  1IKL A;  1WFQ A;  1A62 A;  1TS4 A;  4QL5 A;  3U9O A;  2F0F A;  2F0Q A;  2PNH A;  4DV3 L;  1EFW A;  3I70 A;  3VA5 A;  1DD2 A;  2KED A;  3K5M A;  1EZ6 A;  1PRT B;  3TRE A;  4WJ4 A;  1TWC B;  4A3D H;  5IT9 E;  3AB9 A;  2K03 A;  2RQX A;  2FMM A;  1IBK Q;  1E3P A;  1KC8 C;  3CAM A;  1PMR A;  3X3M A;  3QOL A;  1E0B A;  1II3 A;  3KF8 A;  3HOZ B;  1CTM A;  5DNF A;  4XDX A;  3EIV A;  1RJT A;  3T1Y Q;  3HKS A;  2KCT A;  3CME A;  4HJ9 A;  1Q82 C;  3HOY G;  5IGD A;  2HQL A;  4DXF A;  4A3I B;  3JAM E;  3VYR A;  5C0X G;  1ASY A;  1O7I A;  1LTA D;  4KTA A;  4JPB W;  2MHV A;  3EA6 A;  1N32 Q;  4V19 0;  4LF9 L;  2XRS D;  1CZW A;  3IFT A;  1CUK A;  3S1N B;  5IIF A;  1Q46 A;  1PDQ A;  2R6G A;  5AFW A;  4ZQ3 A;  5D3I B;  3W2D A;  4DR6 L;  5JJI A;  5IYC G;  4DAM A;  1U0L A;  4NW2 A;  1XTD A;  1KLG D;  4OIJ A;  3KLS X;  4OO1 H;  4KY7 A;  5M3M B;  1AN8 A;  1S5E D;  4IUT A;  4BBR H;  5ELC A;  2YU9 H;  2PPB C;  1A15 A;  2FFK B;  4DK1 A;  1ILQ A;  2PNR C;  3ERS X;  1ESF A;  1OXT A;  4B3T Q;  1PRT D;  1OO9 B;  2QF7 A;  1J5E Q;  4UP9 A;  3D4R A;  1YI2 A;  2VUM B;  5IGG A;  4QIW B;  4A3D G;  5EKK A;  4LUZ A;  3SE0 A;  1SLJ A;  1X32 A;  3S2D H;  2H4O A;  3I4M H;  2C9O A;  3G4S A;  3G6J B;  3O13 A;  3K57 A;  3DUZ A;  1PZJ D;  2ICI A;  2JA8 B;  1F9Q A;  2WKC A;  1ICF B;  3J7A F;  3G7L A;  1WTW A;  2A74 C;  1I50 H;  2ZT9 C;  3HRZ C;  4G7H C;  1GHJ A;  2IL8 A;  4JYA Q;  1PH2 A;  2QEX A;  2F3I A;  4DR2 L;  1C8C A;  1A6X A;  2E76 C;  4QB4 A;  2E5L Q;  4DK0 A;  2WKD A;  1PFM A;  3E0E A;  1D5M C;  3K0X A;  4AH6 A;  2WAQ E;  4A3K H;  4RGO S;  2P5Z X;  1JOK A;  4CGY B;  4A3M H;  1A3V A;  5C3X A;  1AZQ A;  3DM3 A;  3OMG A;  2JE6 I;  5C4X H;  4BBR G;  1V43 A;  3C1F A;  4C3I B;  2UXD Q;  4CJ2 C;  2CH4 A;  3I55 A;  2R93 G;  2RF4 A;  4WJ3 M;  1D1K A;  3A7L A;  1S5C D;  2NYZ D;  4K8I A;  4OX9 Q;  2IHF A;  2FIN B;  3CC7 A;  5FK9 C;  2B63 B;  2A19 A;  1KLU D;  2EYJ A;  1N36 Q;  4L5R C;  4PZ7 A;  4DKA C;  1S5F D;  4OXP A;  3C3L A;  1GHK A;  1Y8N B;  3I4M G;  3OIP A;  1STH A;  1J6Q A;  3LWE A;  3S14 H;  1YJW A;  4GKK Q;  2JJQ A;  2B3G A;  1SYB A;  3C2P A;  3P7J A;  3F8T A;  1VQO A;  2R92 G;  1E1T A;  2F3V A;  2K75 A;  2B39 A;  3MTS A;  3D6C A;  4B3S L;  4DR7 L;  1SAP A;  1ZYR D;  4AQY L;  4LF8 Q;  4X3U A;  1HNZ Q;  2Y0S B;  3GP7 A;  3J7A V;  3WDN A;  4DAV A;  2PZW A;  4F7X A;  1K83 H;  1RDP D;  5IGE A;  4A3K G;  2JK8 A;  5KYI A;  3RN2 A;  4HID A;  3DWP A;  4KJO A;  1MSH A;  5I6W A;  3DLL A;  4NXM Q;  3M9B A;  4RMF A;  4A3M G;  4KD3 A;  1HR0 Q;  2LSS A;  1PH1 A;  4A3E B;  3FMC A;  5IP9 H;  1TY0 A;  3GTK H;  1SNM A;  2F0L A;  1RTO A;  3HKZ G;  1F2Z A;  3KOJ A;  4TVA B;  2D2C C;  3K59 A;  1VQM A;  4CDE C;  2NB0 A;  1EYG A;  4PMB A;  4R8I A;  1BKB A;  1I3Q B;  1VQA A;  4X66 Q;  1K28 A;  5LMN Q;  4LFC Q;  2KUM A;  2WB1 B;  1NJI C;  1IBK L;  4R9W A;  1U4P A;  2K5V A;  1VQK A;  2O4X A;  1HQM C;  4A3F B;  1Y1V H;  2E74 C;  5E4X A;  1GUN A;  3T1Y L;  2MUY A;  4HSP A;  4RH6 A;  2NZO A;  1NCV A;  1CA6 A;  4CJ0 B;  1LTG D;  2K04 A;  1BCP D;  1YHB A;  1DCZ A;  2KJX A;  2ZTE A;  4MTN A;  4TQU S;  1QNU A;  2EOT A;  1SYG A;  1VQ6 A;  4QUC A;  3LGJ A;  1E2V A;  4X3K A;  2NVQ B;  1N32 L;  4BXX H;  3D3R A;  3U9S A;  1SRU A;  5JJK A;  5I6Y A;  2RKS A;  3A56 A;  4A3G B;  4UP8 A;  4X3S A;  3FRP B;  4APV A;  1HNW Q;  3MXG A;  1KDC A;  3PGZ A;  4PZ8 A;  3M4Y A;  3T13 A;  2AUK A;  3F2D A;  3L3O C;  3QR8 A;  1MSG A;  1HR0 W;  4AYB B;  4B3M Q;  4B3T L;  3L9A X;  4HN7 A;  4BY1 H;  2IWH A;  1CT1 D;  5DEH A;  1J5E L;  2EY6 A;  3NWT A;  4HCE A;  2G9D A;  1SE3 A;  4DV5 Q;  1QE6 A;  2DJG C;  5CV8 A;  3S1Q H;  1B70 B;  3GO5 A;  3OPO A;  4ZKB B;  1GUW A;  2ZTC A;  2NN6 I;  1XMQ Q;  4K5W A;  5C6A A;  3X3N A;  4JW0 A;  2J0T D;  3K7U C;  5KND A;  1Y1V G;  4YHH Q;  4DR3 Q;  1HCZ A;  3TDQ A;  3OIQ A;  3IAY A;  4IOA A;  1SND A;  1SSO A;  4C3H H;  1EIG A;  4CKB A;  3T1H Q;  5C4J B;  4HAE A;  2Q2T A;  3EJI A;  1BXT A;  5COR A;  3KF6 B;  1JJG A;  5EPL A;  4JYA L;  1MJC A;  1O7Y A;  3JC6 6;  1HQR D;  2M00 A;  2E5L L;  1JB7 A;  3MXN A;  3HKZ E;  1FNV A;  3HGB A;  3E0J A;  2VB2 X;  1J8I A;  3BZC A;  2HHH Q;  3KBG A;  3I73 A;  4IPC A;  4KI0 A;  2WFW A;  2F0U A;  4XQQ A;  4JI3 Q;  1OXX K;  3CRK C;  2Q8I B;  4DV4 L;  1L0Y B;  1XNQ Q;  4GKJ Q;  3PO3 H;  3DEP A;  1AW7 A;  1B8A A;  4EQN A;  2R3Z A;  1QNK A;  4R4C A;  4EGV A;  3CRL C;  1TWH H;  3K7A B;  4OL7 A;  2UXD L;  5IT9 L;  4IUU A;  3EVQ A;  1WCM B;  2L1B A;  2DJF C;  1VCI A;  4KN4 C;  4FVM A;  2R7D A;  1L1O A;  4OX9 L;  4BY1 G;  4M8A A;  2HQE A;  3GTM B;  1VQH A;  5FLM G;  2F3W A;  2PMZ E;  5CGK A;  1N36 L;  5KNB A;  2QEJ C;  1HNX Q;  1FD7 D;  3MA2 B;  1TXY A;  1ONL A;  1S5B D;  3OHX C;  1QZG A;  2KEE A;  3JAM L;  1F2Y A;  3MC0 B;  3S1R H;  5C0X J;  3VYS A;  2JA7 G;  4GKK L;  1L1O C;  1C7Y A;  3NBI A;  3CU7 A;  2MO0 A;  1PH3 A;  3D6W A;  3TS0 A;  5I2X A;  3S1M H;  4CDF C;  2ZXP A;  3D4D A;  3M3Y H;  5E7N A;  5JVG 3;  1E7Z A;  3KLW A;  1IW7 C;  1VQC A;  4LF8 L;  4P73 A;  3NTK A;  3I4N B;  3V05 A;  2MNA A;  1HNZ L;  4HR7 B;  1SE8 A;  3GTQ H;  2V4D A;  4CDC C;  4HJA A;  3URY A;  2PCF B;  4JBK A;  4XIG S;  4RHS A;  1PRT F;  1AFP A;  4NXM L;  4L5T A;  3PO3 G;  5ELD A;  3CCE A;  1D6E C;  1HR0 L;  2OTJ A;  1TS2 A;  3PCO B;  3SK5 A;  2N55 A;  2XSC A;  3FHW A;  3ULJ A;  4DV2 Q;  1D1I A;  1YHA A;  1GM5 A;  1SYC A;  4X66 L;  4J8Q A;  5LMN L;  4LFC L;  3TP5 A;  4QF4 A;  4I7Z C;  2I0Q A;  2KHI A;  2A69 C;  5C44 H;  3M7G A;  5T1I A;  1PZK D;  3KBX A;  4IFD H;  2F0E A;  2EXZ A;  1SNQ A;  3L0O A;  1G6P A;  2B2W A;  3H94 A;  1LTT D;  3K6O A;  1QG7 A;  2EY5 A;  4O2D A;  3J80 E;  2J4X A;  1JWS D;  5ISR A;  2EY1 A;  3OSO A;  1EYD A;  5LL6 S;  4OHJ A;  3MFY A;  2AQ1 B;  3RNU A;  1BNZ A;  4IZ8 A;  4DNT B;  4BBS H;  1W6K A;  2B2W C;  4LF9 Q;  3W1B A;  2AKW B;  2EYL A;  1HNW L;  4EX5 A;  1CHQ D;  2A6E C;  1H95 A;  2L5T A;  4DR6 Q;  1NUC A;  3H0G H;  2PQA B;  1PFN A;  1K73 C;  1X3E A;  3HOV H;  2QDL A;  1LO5 D;  1TWF B;  3Q0A A;  3H3V H;  3HOX H;  1BVS A;  4B3M L;  2SNS A;  2NBF A;  5CBE E;  2DGY A;  3NE5 B;  2O5J C;  3KJP A;  3MHB A;  1Q7Y C;  1TS3 A;  1XPO A;  1JC7 A;  1PYW D;  1X54 A;  1VQG A;  4DV5 L;  3DM1 A;  3TZU A;  3UI2 A;  5JVH 3;  2Z8L A;  1STB A;  1QZH A;  4RKB A;  4A3B B;  2CQO A;  2YV5 A;  5H1S E;  2RA4 A;  4UP7 A;  5LHY 1;  1XMQ L;  4EQO A;  5C44 G;  4TRD A;  2JA6 H;  4YHH L;  2K5D A;  4DR3 L;  4DXG A;  4IFD G;  1KXL A;  1X3G A;  1EUJ A;  1X3F A;  1SXT A;  3AYH B;  3T1H L;  2PZU A;  3NSW A;  3M4O B;  1EQT A;  1BDO A;  3A55 A;  1E2Z A;  3FKI G;  1S5D D;  4RA8 A;  2R7Z H;  4I7A A;  1Y1W H;  4L8J A;  2BA0 A;  1SJH D;  5EAY A;  4DA2 A;  1HHV A;  1KL9 A;  3F2U A;  3HOU B;  3MVV A;  2HHH L;  5C3E H;  2JSO A;  1S72 A;  2G9H D;  2Z9H A;  1OXS C;  4JI3 L;  1YZ6 A;  1RCV D;  4GKJ L;  1XNQ L;  3GDE A;  2MFI A;  1JQY D;  1SRO A;  3K81 C;  1B50 A;  4IOC A;  4KHP Q;  1GKH A;  4JI6 Q;  2F0M A;  4P75 A;  3NUC A;  1VQD A;  1QVG A;  2O2L D;  3OOC A;  1HZC A;  4JC0 A;  1F77 A;  3AMU A;  3VA7 A;  3ER0 A;  1UE5 A;  4C1N I;  1K0R A;  1PH6 A;  2E2J H;  4KN7 C;  1JT8 A;  4IPD A;  2YYZ A;  1C48 A;  1Q81 C;  5GAH C;  1BCP F;  4GOP B;  1HNX L;  5DAU A;  4A3J B;  4J1M A;  1ILP A;  4GS3 A;  1KRT A;  2D0P A;  4DAY B;  3BDC A;  3VR4 A;  4M1U B;  1G2S A;  3HEJ A;  4JBJ A;  1BOS A;  5I2Y A;  1QOH A;  1KIX A;  1PHJ A;  1TWC H;  5C5M A;  1B9M A;  1A2U A;  5BN5 A;  3CHB D;  5IP7 H;  3TRZ A;  2K01 A;  1DGS A;  1L0X B;  2A1A A;  3CCM A;  1HFG A;  1X56 A;  3HOZ H;  2WP8 J;  2C5C A;  1F9S A;  4GLA C;  2Q2H A;  2R7Z G;  1Y1W G;  1X3Q A;  2MP1 A;  2KCM A;  2IT1 A;  1HTP A;  4YWK A;  3OW7 A;  1XMO L;  5C3E G;  3K5O A;  2NWG A;  4A3I H;  1ZEQ X;  2F0G A;  3UE1 A;  4DV7 Q;  3R8B A;  1JOO A;  3I4O A;  4P72 A;  1B4O A;  2F0D A;  3S1N H;  1ET6 A;  4DV2 L;  3RR5 A;  5NUC A;  4DR1 Q;  1QJO A;  2K14 A;  5CV6 A;  1Y69 U;  2WAQ B;  1SBB B;  4ZRZ A;  1C0A A;  3Q23 A;  3T51 B;  3PIP 3;  2E2I B;  3WOF A;  5M3M H;  2BE5 D;  4KY6 A;  4OWT B;  1GO3 E;  1MJE A;  2F1M A;  3W1G A;  1I94 Q;  3M4Q A;  4A3C H;  1U9R A;  1SYD A;  2Z4H A;  5JPN C;  3HOY B;  3W5O A;  1EY0 A;  5FO9 B;  2ZXR A;  3BYT B;  2F0W A;  1IYV A;  3Q22 A;  4ZLT F;  2VUM H;  1AZP A;  1K8G A;  2KCC A;  2EDG A;  3SR1 A;  4NDX A;  5HUR A;  2KEC A;  5F2D A;  2EIF A;  2AHO B;  1D2B A;  2JA8 H;  4JI5 Q;  4JI4 Q;  4R4Q A;  4IUV A;  1SNC A;  2ALY B;  3K5N A;  2XWJ B;  3GTL B;  1ESR A;  1YNX A;  1RKN A;  5EKL A;  3QIA A;  3RZD B;  4POG A;  4P2C B;  2Q2I A;  3OYY A;  4A3I G;  4FF1 A;  1KD1 C;  1MHW C;  3Q8D A;  1F2L A;  2B8G A;  3PIO 3;  1M8A A;  4LJZ C;  5EBC A;  4Y52 H;  3HOW H;  3MXU A;  1LT5 D;  3R2T A;  3A0J A;  3KF6 A;  5IWA Q;  2HT1 A;  4J15 A;  3VR5 A;  2GVB A;  3KK7 A;  1LAC A;  4FXK C;  4YCV A;  2D0O A;  1OTC A;  1GXD C;  5GAG C;  1MI2 A;  3J81 j;  3J81 L;  2CVR A;  4C3I H;  2UUB Q;  3AQQ A;  1K9M C;  5FKA C;  4DFA A;  3I56 A;  5GAD C;  2F0V A;  2F0H A;  4A3C G;  3R2I A;  2OWO A;  2B63 H;  1PV4 A;  1JIC A;  3MAQ A;  2VUM G;  5EGT A;  3NK9 A;  5KIX A;  3G48 A;  1F9P A;  1YJ9 A;  2HIX A;  4Z9C B;  2NTT A;  3S15 B;  1R4Q B;  1Q3L A;  5E1F A;  3A74 A;  2K5W A;  2DNC A;  3HOW B;  2JA8 G;  2CQA A;  2KOL A;  2ATW A;  3T4A C;  1YIT A;  4KHP L;  4NMZ A;  1EOT A;  4DV4 Q;  4UY8 C;  1M1K C;  3FPP A;  3JAM i;  4LF7 L;  4JI6 L;  3QWN A;  4LW1 A;  3VR2 A;  4OO1 G;  3ZYY X;  2QA4 A;  4J6H A;  2VY3 A;  5I4D A;  1LTR D;  5KNC A;  1G51 A;  2R93 B;  1T9H A;  1ENC A;  1NY4 A;  3BG3 A;  5K36 H;  3DEO A;  4X62 Q;  3I90 A;  2DN8 A;  4DNR B;  1VQE A;  5CYU A;  1LAB A;  2A6H D;  4HJ5 A;  1STE A;  3J80 L;  4I65 A;  1DXM A;  3RLN A;  4C3J B;  3KDF B;  5EJW A;  4K14 A;  3CQZ B;  2PW7 A;  2OCE A;  2Z6K A;  4A3E H;  2VW9 A;  3ERO A;  2NZH A;  1VQJ A;  2EQS A;  2RHS B;  1I3Q H;  1WJJ A;  4HCS A;  1HZA A;  5E4W C;  1IKM A;  1PTO B;  1NR4 A;  2IHE A;  4L5Q A;  3TBI B;  3IKJ A;  5IT9 c;  4A3F H;  2R92 B;  2VZA A;  3VYT A;  4Y7N B;  3DWA A;  2Z6K C;  1KNE A;  1U5K A;  4MZ9 A;  3G6E A;  1GOZ A;  3ULP A;  3MFG A;  4LWC A;  4GNX A;  4QUF A;  1CZG A;  4XYO A;  3DWQ A;  1QUQ A;  4DV7 L;  2NVQ H;  1UUP A;  1HUM A;  3JAM c;  2FJ2 A;  3NTI A;  3UDF A;  1VQP A;  2K28 A;  1EY6 A;  3NQT A;  4A3G H;  4DR1 L;  3K8A A;  3HKZ B;  1YIJ A;  1EU3 A;  1AP0 A;  5C4X G;  1CQF A;  1I4H A;  1CHP D;  4GNX C;  1WTV A;  2K4K A;  3RLF A;  2Y0S G;  5LMU Q;  2B2Y A;  2B2V A;  4IFD J;  4K0K L;  1HJP A;  1O7Z A;  2K32 A;  4QJF A;  1EQV A;  1I94 L;  2K6A A;  1EY7 A;  5COY A;  2PZT A;  5IGF A;  5TSS A;  1XPU A;  1EWH A;  4A3E G;  3AFQ A;  2PI2 A;  2FXQ A;  4G4K A;  5FLX L;  5M5W B;  4HED A;  2EJF C;  2MJ8 A;  3Q24 A;  1I6H B;  3A7A B;  2FMC A;  1TQO A;  2ENB A;  2F0T A;  2PMZ B;  3H15 A;  3K5L A;  2B2V C;  2F03 A;  2OXP A;  3FPU B;  3VR3 A;  2MGS A;  5CV5 A;  4H02 A;  1IHZ A;  2X69 A;  4KLK A;  4JI5 L;  4DV0 Q;  2NUC A;  4JI4 L;  2O5I C;  4A93 B;  1RL2 A;  2E2H B;  2N88 A;  3N6R A;  1EL0 A;  3IFD A;  1CKN B;  3NPP A;  2N78 A;  5C4J H;  1J9O A;  1FL0 A;  3H6M A;  1CI3 M;  4ULL A;  3ERQ A;  1WTQ A;  3GTO B;  4NXN Q;  2KVM A;  2F0N A;  5D65 A;  1K0S A;  1N34 Q;  4QMG A;  1JJC B;  2LFN A;  3I91 A;  4X65 Q;  4O0A A;  3GTG B;  1UE1 A;  5IWA L;  1EZ8 A;  1PVO A;  5IP9 G;  4G7Z C;  3KF8 B;  1ZKO A;  3BZK A;  2K05 A;  3PUV A;  5LMN W;  3RN5 A;  2ZTD A;  2EYO A;  2HCI A;  5EBD A;  4LFA Q;  1EIY B;  3A5Z B;  3K7A H;  1PYS B;  2I5L X;  2UUB L;  1WCM H;  3CPW A;  3GTP B;  1CFM A;  1UAP A;  5CV7 A;  1GUS A;  4AYB G;  4LK1 C;  4XT3 B;  2B2U A;  2I07 B;  2AQ3 B;  1QCB D;  3GTM H;  3LWU A;  4TSS A;  1YVC A;  1SMY C;  4JOI A;  1VMP A;  3A8K E;  4UPA A;  4LFB Q;  2ZM6 Q;  3AFP A;  1Q1E A;  3H3V C;  1HUN A;  3E9I A;  1SNP A;  1ICW A;  1GUG A;  3NTH A;  1KNA A;  2D62 A;  2JA9 A;  4FDB A;  1B2T A;  2ID0 A;  4BXX G;  1CA5 A;  4DK6 C;  3GTJ B;  2L4N A;  4GOP A;  2B2U C;  4KMU C;  2GA4 B;  3HZX A;  4R1J A;  2R7F A;  2I5H A;  1JB3 A;  4OON A;  3NBH B;  5D3D A;  3RZO H;  5J39 A;  1SFO B;  1LUZ A;  3UE0 A;  3V2T A;  4KV6 A;  1FNU A;  4QY7 A;  1NTG A;  1X55 A;  4HTH A;  5ELN A;  4ZAI A;  2G5D A;  2NTS A;  3I4N H;  4RHR A;  4YCW A;  4X62 L;  3MWY W;  1X9N A;  3UDI A;  2PYK A;  2L15 A;  3EBE A;  1KAB A;  2BE5 C;  1H9S A;  2QGQ A;  2JEA I;  3GD7 A;  4JV5 L;  1RTN A;  2BH8 A;  2KEN A;  1ZXT A;  2F0J A;  4ME5 A;  1IXR A;  2RSN A;  4LNQ A;  1CSQ A;  2JA7 B;  1P16 A;  4FF4 A;  4C3H G;  5I9O A;  3EQL C;  4GLX A;  2EY2 A;  4OEM B;  3RZO B;  3MEH A;  1WYD A;  1FGB D;  1V1P B;  2F52 A;  1A63 A;  5GAE C;  4X6A H;  2UUC Q;  1VQI A;  2QCP X;  4PMC A;  1SNO A;  4LF6 Q;  1EYA A;  4O42 A;  1I4G A;  1XMO Q;  4FXD A;  4Q5V A;  1TKW B;  3AU7 A;  2QW7 A;  5JJZ A;  1I5F A;  2B8F A;  1IBL Q;  1FGU A;  3G71 A;  1UNS A;  4LAA A;  3VR6 A;  3PF4 A;  1SYE A;  1TS5 A;  1U4M A;  2NVY B;  2EZV A;  1PRT C;  4KKU A;  1QIL A;  1Z9F A;  2N3S A;  4RCN A;  2VQF Q;  2UXC Q;  1STY A;  2XRQ D;  4P74 A;  3ICE A;  1Y14 B;  1BUV T;  5LMU L;  1LV9 A;  1G6Z A;  1PH4 A;  2F0S A;  3J7Z C;  1Q86 C;  3CW2 C;  2PW5 A;  1LTI D;  1TWF H;  5J3B A;  4C1N K;  2NN6 H;  1M4V A;  1KRS A;  2EYF A;  3BDL A;  5CV9 A;  1T5X D;  1YNN D;  4DR5 L;  2WAC A;  2K1B A;  3CD6 A;  3S16 B;  3U4V A;  4BY7 B;  1L2F A;  4U68 A;  4A3B H;  4POF A;  2JYO A;  4RG1 A;  4MN3 A;  4O1N A;  3A54 A;  2HD3 A;  3U50 C;  1QVC A;  4DV0 L;  1ASZ A;  3E9H A;  3CC4 A;  4FNF A;  5JEA H;  5AJ3 Q;  2MO1 A;  1VQ5 A;  3D4W A;  1SR3 A;  3OWF A;  2RVL A;  3J81 i;  3M4O H;  4L63 B;  5C0X I;  1LTB D;  1L0W A;  4XXE A;  3T53 B;  5KYL A;  3W3A A;  2PQE A;  5BN3 A;  1A0I A;  4NXN L;  3HOU H;  1TWA B;  1N34 L;  1A3U A;  3SGI A;  3TME A;  2NVT B;  2KBN A;  3L7Z C;  4X65 L;  2RBM A;  3HP3 A;  1SDF A;  2D5D A;  1RIP A;  3R93 A;  2A6H C;  1VQB A;  3MZ5 A;  3PO2 B;  5M3F B;  1CKM A;  1ENF A;  1VS0 A;  2K7V A;  1A3T A;  1TWG B;  2BDO A;  1D5Z C;  2UUA Q;  4LFA L;  1E1O A;  5EKI A;  5BR8 Q;  2IJ0 A;  1TR5 A;  2A68 D;  3I7F A;  3I72 A;  2I5M X;  5L37 A;  4IUN A;  3M4P A;  2OQK A;  2KHS A;  2XVS A;  1KAA A;  2JXM B;  1CK1 A;  1HFN A;  2ZJP A;  2TMP A;  2CW0 D;  4KD4 A;  4LFB L;  2ZM6 L;  3BVG A;  4R4T A;  1JWU D;  1K3B C;  4A3J H;  3TN2 A;  3HG9 A;  3FKI B;  4RGN A;  3U58 A;  1YNJ D;  3FP9 A;  5LL6 X;  3KLS A;  2RCF A;  4A3B G;  4NP5 A;  3L2P A;  1XNR L;  3NQI A;  1ZYR C;  3J80 i;  3DMU A;  3CC2 A;  1FYC A;  3MEF A;  4BBS G;  4B9X A;  2JA5 B;  2EJM A;  5JEA G;  3BDO A;  2NVX B;  5M5Y B;  3N52 A;  1VF7 A;  5G3L D;  3NEL A;  3SXH A;  1AE2 A;  3TSS A;  3KUP A;  3J81 c;  3F2B A;  5CR3 A;  3A8I E;  4LF7 Q;  2IW3 A;  1EY4 A;  3H0G G;  3K0Y A;  2QDB A;  3HOV G;  2E8G A;  1CM9 A;  4GN5 A;  1LM0 A;  5M9O A;  3HOX G;  2BH2 A;  2F4I A;  3PF5 A;  4RCO A;  3I3C A;  2JQO A;  2VXW A;  1AEX A;  1EEI D;  3CPF A;  3KJO A;  1LT3 D;  1PTO F;  4WRD A;  1B53 A;  1PYB A;  4K5V A;  2IX3 A;  1AE3 A;  1KQS A;  1BCP C;  2BCO A;  2Z6B A;  1XYI A;  2M9V A;  2JA6 G;  2X6G A;  2Q8R E;  3Q6S A;  4U67 3;  2E2I H;  4IPH A;  3VYU A;  5FO8 B;  1VQF A;  2Z1C A;  4K8J A;  4QCL A;  3TEH B;  4IAL A;  1WTX A;  4LUO A;  1NMF A;  1W6J A;  4GZY C;  3S17 B;  2LKV A;  2C35 B;  4IUP A;  2UUC L;  3T16 A;  3HOY H;  2E2D C;  1B1Z A;  2EJG C;  1D8L A;  3S24 A;  4WJW A;  1CKO A;  4LF6 L;  3J80 c;  4A75 A;  2SEB D;  1B3A A;  3PMF A;  2PI2 E;  1IBL L;  1L1O B;  3SK4 A;  2QKI C;  2TSS A;  4C2M B;  5HGT A;  4F8M A;  5A35 A;  4Q0F A;  4NB3 A;  5IYC H;  1KDB A;  1W3S A;  2VQF L;  1N9W A;  1O78 A;  3GTL H;  2UXC L;  4JK1 C;  1K8O A;  2WII B;  1UWV A;  3RUZ A;  1N8R C;  3RZD H;  4AIM A;  1SMX A;  1IL8 A;  3S2H B;  4ZUJ A;  1SJE D;  2HDM A;  4K6D A;  1DYQ A;  2E75 C;  2EPB A;  4X64 Q;  1H9M A;  4K0K Q;  4IQZ A;  4CJ1 B;  3T56 B;  4JI1 Q;  1E2W A;  3E5S A;  1R9T B;  1AH9 A;  3ND8 A;  2RCN A;  4UDU C;  5KEE A;  4ME3 A;  1LYL A;  1UE6 A;  5E3F A;  3DHQ A;  4WOR A;  1SYF A;  2WAQ G;  1VQL A;  3IRB A;  1A8V A;  5IP7 G;  5FOB B;  4DNI A;  1P8L A;  1MD2 D;  4KKS A;  1WVL A;  5AJ3 L;  2I46 A;  1F9R A;  3HOZ G;  1G29 1;  5CMD A;  1M90 C;  2XWB B;  4EQ5 A;  3TP6 A;  2K5H A;  4YWL A;  3K58 A;  1I4P A;  3GV6 A;  3S15 H;  3B6Y A;  1BBX C;  2LXJ A;  1BO0 A;  2RHQ B;  5FLX c;  1GJX A;  4UHV A;  4F87 A;  1NAP A;  2K52 A;  2VB3 X;  1H9K A;  1JMC A;  1C9O A;  4IJL A;  2JEB I;  3CMA A;  1VQ7 A;  4ABN A;  1IW7 D;  5EQ0 A;  3RD4 A;  1VMC A;  3GQB A;  3SDZ A;  1OXU A;  4LF4 L;  2UUA L;  4A3D B;  1HXY D;  5BR8 L;  5M3M G;  1JE4 A;  4DV1 Q;  1HA5 A;  4DUY Q;  1QVF A;  2R93 H;  1VQ4 A;  4K2K A;  1H9R A;  2CH4 W;  2RDG A;  2AWN A;  1BF4 A;  2L55 A;  3H09 A;  1B44 D;  3NBH A;  1LT4 D;  3S9W A;  4DV6 Q;  1YJN A;  2NZ1 D;  4N9P A;  1EQR A;  2LY7 A;  4IO9 A;  2V1C C;  4C3J H;  2GN5 A;  1EOV A;  3GV3 A;  5CC4 A;  3CQZ H;  4PG3 A;  2A69 D;  2LXK A;  1FR3 A;  2YTX A;  1EY5 A;  1Q12 A;  2UXB L;  4IPG A;  1PTO H;  1CQV A;  1V1O A;  2KCN A;  3PUY A;  5GRO A;  1S40 A;  4DUZ L;  2OTL A;  3PUZ A;  3D0F A;  3I4L A;  4JI8 Q;  2HUG A;  1NR2 A;  2R92 H;  3UDG A;  4Y7N H;  1EY9 A;  1RF2 D;  3BS1 A;  1IBM Q;  4OWX B;  4BBR B;  3BVZ A;  3P75 A;  2YU9 B;  4ALP A;  2EYM A;  2RDF A;  1DON A;  4YY3 Q;  1I6V C;  1LTL A;  1WD1 A;  4JBM A;  4DF7 A;  5EPJ A;  5I9P A;  3HOW G;  2A8V A;  1XWE A;  3SK8 A;  1EYC A;  2A6E D;  4WFN 3;  4S3S A;  1S3O A;  2CFM A;  4CKC A;  4JV5 Q;  1V1P A;  2DNE A;  1YNN C;  2H1E A;  5IGB A;  2ZJQ A;  3S2D B;  4KHV A;  1JCK B;  3I4M B;  5FO7 B;  1I4R A;  4C3I G;  4PMW A;  4RGM A;  1GVP A;  3BU2 A;  3CCR A;  1PH7 A;  3EFX D;  4BA2 I;  4PZ6 A;  2DY8 A;  5GQO A;  2F0O A;  4HIM A;  1DM0 B;  1I50 B;  5EPK A;  2B63 G;  1WTR A;  1IL2 A;  4BA1 I;  4ZK9 B;  1HZB A;  1WTO A;  4C3J G;  5JAV A;  1F2M A;  2KHJ A;  2KQ3 A;  3R3O A;  1EIF A;  2H5X A;  5M5W H;  1E24 A;  1BCP B;  4LMQ D;  4CKE A;  1I6H H;  1TY2 A;  4A3K B;  3P1H A;  4DR4 Q;  1JWM D;  3LNN A;  4A3M B;  2CKZ B;  3FVQ A;  1FVI A;  4PV1 C;  2F4V Q;  3WWV A;  3QG1 A;  4OIK A;  1PH5 A;  4A93 H;  2WIN B;  4MTK A;  1YHQ A;  4PQX A;  1LT6 D;  3PSI A;  3SK6 A;  5JPM C;  2E2H H;  5C4X B;  2LMC B;  2Q8T A;  1HPC A;  3AEV A;  3NHH A;  2BOS A;  3QJY A;  2AQ2 B;  4E6I A;  1U4L A;  2XTI A;  5K36 G;  2R61 A;  2A68 C;  4QQB X;  4QIW E;  4X64 L;  3GTO H;  2EYH A;  4KY5 A;  1DOL A;  1HH2 P;  4JI1 L;  2A5H A;  1VF5 C;  3J7Y W;  2ZJR A;  5IY0 A;  3GTG H;  1PA6 A;  2IX1 A;  2PQA A;  4DR5 Q;  2CW0 C;  2DUD A;  1PTO D;  2L11 A;  2OEO A;  3S14 B;  3STB D;  2GVA A;  1YNJ C;  4DGZ A;  2B2Y C;  1MBY A;  2WB1 G;  3RMH A;  2UU9 Q;  3SHL A;  1FNW A;  5G3L F;  3GTP H;  4ZYS A;  3KYH C;  4H13 C;  5JEA J;  4A3F G;  3FDT A;  4GN3 B;  3PQI A;  4ID6 A;  4V0B A;  2OF1 A;  3D8G A;  4YCU A;  5IYD H;  4JG2 A;  3TS2 A;  1VQN A;  1WI5 A;  1ENA A;  3C46 A;  2JP1 A;  3D31 A;  1VQ9 A;  2N8N A;  1WTP A;  1W2B A;  1K83 B;  1Z47 A;  4X3T A;  1NBW A;  3E3X A;  4LF5 Q;  5ELE A;  3GTJ H;  4A93 G;  5A2Q E;  3GTK B;  4A3G G;  4FO2 A;  4K5X A;  1X3P A;  4MHE A;  3WOE A;  1I4X A;  4R4I A;  2EXD A;  3SVM A;  1SFO H;  4DV1 L;  1HA6 A;  4DUY L;  3OTO Q;  1BBW A;  4RKL A;  1Y1V B;  3MXP A;  3PIP A;  1FJG Q;  4XTC S;  2ASB A;  4YWM A;  5FLM H;  2F0I A;  4N8X 1;  4JI2 Q;  4DV6 L;  3BJU A;  3VDY A;  3OWE B;  1VQ8 A;  4JI0 Q;  1PLF A;  4IUR A;  3CCV A;  5DM7 3;  2JN4 A;  4A76 A;  5J1Z A;  1G2T A;  1Z6H A;  4IFD I;  3EN2 A;  2WV6 D;  1XNR Q;  2MQH A;  4XQN A;  3ITP A;  1NSN S;  4BS9 A;  1CSP A;  2LS0 1;  2JA7 H;  4N8F A;  1IYU A;  2PO4 A;  4GLV B;  1XTC D;  2Y0S E;  4JI8 L;  3IL8 A;  4JOI C;  5IYD G;  4DAY A;  1MIU A;  2K33 A;  2VQE Q;  4NPS A;  1N33 Q;  4K2L A;  5J22 A;  5JOB A;  1IBM L;  4PNY A;  1Q8I A;  4BWG B;  2VS1 A;  1STG A;  1YBY A;  4YY3 L;  2ZXO A;  1K8A C;  1GUO A;  1IYJ B;  3CCS A;  4BY1 B;  4C56 C;  2FHT A;  4GOP C;  4YIJ A;  3TP7 A;  4HIO A;  3PIO A;  2WB1 E;  1A2T A;  1D7Q A;  4ZCK A;  3S1Q B;  1ET9 A;  4DN4 M;  2ES2 A;  1XPR A;  2NVY H;  3H3V I;  4JI7 Q;  1KHI A;  4DU9 A;  1O80 A;  3CCU A;  2L0C A;  1WCM G;  2A73 B;  2IX0 A;  2K50 A;  2Z4I A;  5CBA E;  1D5X C;  1SN8 A;  4C3H B;  1EQQ A;  3KFU A;  1H9J A;  3QB3 A;  2XGT A;  1NMG A;  1GUT A;  3E6Z X;  5CV4 A;  4DK3 C;  1O7L A;  1PH8 A;  3PUX A;  2YTV A;  2BDN A;  3LX0 A;  4TKO B;  2K5N A;  2K5Q A;  5BN4 A;  4A3L H;  3S16 H;  5T1G A;  2SOB A;  1JOQ A;  1ROD A;  5DM6 3;  1LTS D;  3J81 E;  3F2C A;  3CCQ A;  4BY7 H;  4DR4 L;  1KTK A;  5FJ8 H;  1PZI D;  4R4O A;  3PO3 B;  3HFZ B;  2B29 A;  3PV0 A;  1QB5 D;  2SDF A;  3F1Z A;  1B9N A;  2F4V L;  4IN3 A;  2OT2 A;  4EQP A;  4XYQ A;  1BQQ T;  1JR0 D;  1NNX A;  4L6T B;  4B3R Q;  4AYB E;  1TWH B;  2M2L A;  2CWA A;  3BVM A;  1OXV A;  4JBW A;  4ZKC B;  2AMC B;  5KRU A;  2ICE C;  3I4N G;  1NE3 A;  4ZUI A;  5IYB H;  3CP0 A;  1TWA H;  4H44 C;  3UDX A;  4ODG A;  2NVT H;  2CWP A;  4B9W A;  4RGT A;  4DV3 Q;  2EYP A;  1TII D;  3PO2 H;  1V9P A;  4OGQ C;  5M3F H;  4HJ8 A;  2KA7 A;  3S1R B;  3CCL A;  2XIW A;  1TWG H;  1YEZ A;  4EVO A;  1PXU A;  4FF3 A;  1Y8P B;  5M5X H;  3BZD B;  1UE7 A;  3NP8 A;  2UU9 L;  2CHB D;  5C5L A;  3ZJY C;  1KDA A;  4HSV A;  3A8J E;  4GNX B;  3QOJ A;  4LUV A;  3BYY B;  3S1M B;  1QUQ B;  4RWS C;  5IE8 A;  4FF2 A;  1RHP A;  3M3Y B;  4G57 A;  2HCC A;  2VNU D;  4FP5 D;  1STN A;  4A3L G;  1QWY A;  1E22 A;  3HS0 C;  3NEN A;  4HMJ A;  5DLQ E;  3GTQ B;  2RSO A;  3FKI H;  4BY7 G;  2RDH A;  4HJ7 A;  5ELO A;  1EU4 A;  5FJ8 G;  4GN4 B;  1B7Y B;  4HIK A;  1C4Q A;  4LF5 L;  1MKH A;  3P20 A;  1UEA B;  2DY7 A;  2L9H A;  1Z7T A;  2X6L A;  2JA5 H;  4KJN A;  1EFI D;  1RD9 D;  3NXW A;  2NVX H;  3I8Z A;  5M5Y H;  1U4R A;  3RLO A;  4G7O C;  1R4P B;  1SE4 A;  1Q1B A;  1HTL D;  4LF4 Q;  5M5X B;  4N9T A;  1UEB A;  1X6O A;  3OTO L;  2J7Z A;  1DOK A;  5C44 B;  1G8Z D;  2OQ0 A;  1SE2 A;  2SNM A;  5IYB G;  1FJG L;  2MPM A;  3ULL A;  5HY6 A;  2NN6 G;  1BR9 A;  2Q2U A;  4JI2 L;  4L5S A;  3DXJ C;  2N49 A;  4NKL A;  4DPG A;  4JI0 L;  4XQJ A;  1Q90 A;  4ILW A;  3PO2 G;  4H0L C;  2D9U A;  5M3F G;  1G91 A;  1K8M A;  2XN9 C;  4F88 A;  1XXG A;  4B08 A;  1DZ1 A;  2YTY A;  1EY8 A;  3PUW A;  3ND9 A;  5JJL A;  1KAW A;  5C3W A;  4QGU A;  4BBS B;  3QO2 A;  4MIU A;  1X65 A;  1IZ6 A;  4IJH A;  3NWS A;  5ELF A;  2UXB Q;  3TQY A;  4OEL B;  3KLR A;  4HMI A;  4JCV E;  3CF5 A;  4DUZ Q;  3KDF A;  5IOD A;  1PFB A;  1V1Q A;  2VQE L;  4IUQ A;  3H0G B;  1Y8O B;  1N33 L;  1EIH A;  1WOC A;  2VL6 A;  3ONA B;  4A4I A;  2IPK D;  3V96 A;  3S17 H;  3HOV B;  5FLX E;  4DR2 Q;  3J7A 5;  4JVZ A;  4KHZ A;  3M85 A;  3HOX B;  3HOU G;  3C1E A;  3CCJ A;  4FXG C;  2BA1 A;  1WTH A;  1VDZ A;  2JA5 G;  2AUJ D;  3CKI B;  4RAU C;  4OO1 I;  2IY5 B;  1TU2 B;  1WD0 A;  1JE5 A;  1XJV A;  4K6L A;  2L12 A;  1STA A;  4RFB A;  5C4H A;  4JI7 L;  1S4Z A;  2QIL A;  4C2M H;  4DAP A;  1HRJ A;  1EEF D;  2JA6 B;  1B3Q A;  1PTO C;  3NEM A;  4MNO A;  5D14 A;  2Z0S A;  3I2Z A;  2CCZ A;  1EWC A;  4KKT A;  3MXN B;  3STB C;  5KGU A;  1V8Q A;  2EE1 A;  1HZ9 A;  3S2H H;  5C4Z A;  4UAI A;  1PFS A;  3TZD A;  2HDL A;  4KK7 A;  1GD7 A; 
#chains in the Genus database with same CATH homology
 2B2T A;  2EVB A;  3OMC A;  1JOR A;  4CHT B;  2R7Z B;  1ML0 D;  1Y1W B;  2F0P A;  3SEB A;  3FEW X;  4R8N A;  1DJR D;  5C3E B;  5IGC A;  2XNA C;  5C0X H;  1SMY D;  1DOM A;  4FYD A;  1XX8 A;  1SEB D;  2F0K A;  5A2Q L;  1TT2 A;  3M7N A;  3H91 A;  1H9S B;  2B2T C;  4H7B A;  1LLR D;  2AWO A;  3TP8 A;  1I4Q A;  2E2J B;  5ELB A;  5IOC A;  1TVX A;  4CBV A;  1MGS A;  4XT1 B;  5K5P A;  1T5E A;  1IKL A;  1TS4 A;  3U9O A;  2F0F A;  2F0Q A;  3I70 A;  3VA5 A;  1DD2 A;  2KED A;  3K5M A;  1EZ6 A;  1PRT B;  1TWC B;  5IT9 E;  3AB9 A;  2K03 A;  2RQX A;  2FMM A;  1PMR A;  3X3M A;  3QOL A;  1E0B A;  1II3 A;  3KF8 A;  3HOZ B;  1CTM A;  5DNF A;  4XDX A;  1RJT A;  5IGD A;  4DXF A;  4A3I B;  3JAM E;  3VYR A;  5C0X G;  4KTA A;  1LTA D;  2MHV A;  3EA6 A;  4V19 0;  2XRS D;  1CZW A;  3IFT A;  3S1N B;  5IIF A;  1PDQ A;  2R6G A;  5AFW A;  4ZQ3 A;  5D3I B;  3W2D A;  4NW2 A;  1KLG D;  4OIJ A;  3KLS X;  4OO1 H;  4KY7 A;  5M3M B;  1AN8 A;  1S5E D;  4IUT A;  5ELC A;  2PPB C;  1A15 A;  2FFK B;  4DK1 A;  1ILQ A;  2PNR C;  1ESF A;  1OXT A;  1PRT D;  1OO9 B;  2QF7 A;  3D4R A;  2VUM B;  5IGG A;  4QIW B;  5EKK A;  3SE0 A;  1X32 A;  2H4O A;  2C9O A;  3G6J B;  3O13 A;  3K57 A;  3DUZ A;  1PZJ D;  2ICI A;  2JA8 B;  1F9Q A;  2WKC A;  3J7A F;  3G7L A;  1WTW A;  2A74 C;  2ZT9 C;  3HRZ C;  4G7H C;  1GHJ A;  2IL8 A;  1C8C A;  1A6X A;  2E76 C;  4QB4 A;  4DK0 A;  2WKD A;  1PFM A;  1D5M C;  4RGO S;  1JOK A;  4CGY B;  1A3V A;  5C3X A;  1AZQ A;  3OMG A;  2JE6 I;  4C3I B;  1V43 A;  3C1F A;  4CJ2 C;  1D1K A;  3A7L A;  1S5C D;  2NYZ D;  4K8I A;  2FIN B;  5FK9 C;  2B63 B;  2EYJ A;  1KLU D;  1S5F D;  3C3L A;  1GHK A;  1Y8N B;  3OIP A;  1STH A;  3LWE A;  1SYB A;  3C2P A;  3P7J A;  2F3V A;  2B39 A;  3MTS A;  3D6C A;  1SAP A;  1ZYR D;  4X3U A;  2Y0S B;  3GP7 A;  3J7A V;  3WDN A;  4DAV A;  2PZW A;  4F7X A;  1RDP D;  5IGE A;  5KYI A;  3DWP A;  4KJO A;  1MSH A;  5I6W A;  4KD3 A;  4A3E B;  3FMC A;  1TY0 A;  1SNM A;  2F0L A;  1RTO A;  3K59 A;  1F2Z A;  2D2C C;  2NB0 A;  4PMB A;  4R8I A;  1I3Q B;  2KUM A;  2WB1 B;  4R9W A;  1U4P A;  2O4X A;  1HQM C;  4A3F B;  2E74 C;  5E4X A;  1GUN A;  2MUY A;  4HSP A;  4RH6 A;  1CA6 A;  1NCV A;  4CJ0 B;  1LTG D;  2K04 A;  1BCP D;  1DCZ A;  2KJX A;  4TQU S;  1QNU A;  2EOT A;  1SYG A;  4QUC A;  2NVQ B;  1E2V A;  4X3K A;  3D3R A;  3U9S A;  5I6Y A;  2RKS A;  3A56 A;  4A3G B;  4X3S A;  3FRP B;  3MXG A;  1KDC A;  3M4Y A;  3T13 A;  2AUK A;  3L3O C;  1MSG A;  4AYB B;  3L9A X;  4HN7 A;  2IWH A;  1CT1 D;  5DEH A;  2EY6 A;  3NWT A;  4HCE A;  2G9D A;  1SE3 A;  1QE6 A;  5CV8 A;  3GO5 A;  3OPO A;  4ZKB B;  1GUW A;  2NN6 I;  4K5W A;  5C6A A;  3X3N A;  5KND A;  2J0T D;  1HCZ A;  3TDQ A;  3OIQ A;  3IAY A;  1SND A;  1SSO A;  1EIG A;  4CKB A;  5C4J B;  4HAE A;  3EJI A;  1BXT A;  5COR A;  5EPL A;  1O7Y A;  1HQR D;  2M00 A;  3MXN A;  1FNV A;  3HGB A;  3E0J A;  2VB2 X;  1J8I A;  3KBG A;  3I73 A;  4KI0 A;  2F0U A;  4XQQ A;  1OXX K;  3CRK C;  2Q8I B;  1L0Y B;  3DEP A;  1AW7 A;  4EQN A;  2R3Z A;  1QNK A;  4EGV A;  3CRL C;  3K7A B;  4OL7 A;  5IT9 L;  4IUU A;  3EVQ A;  1WCM B;  2L1B A;  1VCI A;  4KN4 C;  4FVM A;  3GTM B;  4M8A A;  2HQE A;  2F3W A;  5CGK A;  5KNB A;  2QEJ C;  1FD7 D;  3MA2 B;  1ONL A;  1S5B D;  3OHX C;  2KEE A;  3JAM L;  1F2Y A;  3MC0 B;  5C0X J;  3VYS A;  3NBI A;  3CU7 A;  3D6W A;  5I2X A;  2ZXP A;  3D4D A;  5JVG 3;  1IW7 C;  3NTK A;  3I4N B;  3V05 A;  4HR7 B;  2V4D A;  3URY A;  2PCF B;  4XIG S;  4RHS A;  1PRT F;  1AFP A;  5ELD A;  1D6E C;  1TS2 A;  3SK5 A;  2N55 A;  2XSC A;  1D1I A;  1SYC A;  4J8Q A;  3TP5 A;  4QF4 A;  4I7Z C;  2A69 C;  3M7G A;  5T1I A;  1PZK D;  3KBX A;  4IFD H;  2F0E A;  2EXZ A;  1SNQ A;  2B2W A;  3H94 A;  1LTT D;  3K6O A;  1QG7 A;  2EY5 A;  3J80 E;  2J4X A;  1JWS D;  5ISR A;  2EY1 A;  3OSO A;  1EYD A;  5LL6 S;  4OHJ A;  3MFY A;  2AQ1 B;  1BNZ A;  4IZ8 A;  4DNT B;  1W6K A;  2B2W C;  2EYL A;  1CHQ D;  2A6E C;  2L5T A;  1NUC A;  1PFN A;  1LO5 D;  1TWF B;  3Q0A A;  2SNS A;  2NBF A;  5CBE E;  3NE5 B;  2O5J C;  3MHB A;  1TS3 A;  1JC7 A;  1PYW D;  3DM1 A;  3TZU A;  3UI2 A;  5JVH 3;  2Z8L A;  1STB A;  4RKB A;  4A3B B;  2RA4 A;  5LHY 1;  4EQO A;  4TRD A;  2K5D A;  4DXG A;  4IFD G;  1SXT A;  2PZU A;  3NSW A;  3M4O B;  1EQT A;  1BDO A;  3A55 A;  1E2Z A;  1S5D D;  4RA8 A;  4L8J A;  2BA0 A;  1SJH D;  4DA2 A;  1HHV A;  3F2U A;  3HOU B;  3MVV A;  2JSO A;  2G9H D;  1OXS C;  1RCV D;  1JQY D;  1B50 A;  2F0M A;  3NUC A;  2O2L D;  3OOC A;  1F77 A;  3AMU A;  3VA7 A;  4C1N I;  4KN7 C;  2YYZ A;  1C48 A;  1BCP F;  5DAU A;  4A3J B;  4J1M A;  1ILP A;  3BDC A;  3VR4 A;  4M1U B;  1G2S A;  3HEJ A;  1BOS A;  5I2Y A;  1QOH A;  5C5M A;  1B9M A;  5BN5 A;  1A2U A;  3CHB D;  2K01 A;  1L0X B;  1HFG A;  2WP8 J;  2C5C A;  1F9S A;  1X3Q A;  2MP1 A;  2IT1 A;  1HTP A;  3OW7 A;  3K5O A;  2NWG A;  1ZEQ X;  2F0G A;  3R8B A;  1JOO A;  1B4O A;  2F0D A;  1ET6 A;  5NUC A;  1QJO A;  5CV6 A;  1Y69 U;  2WAQ B;  1SBB B;  4ZRZ A;  3Q23 A;  3T51 B;  3PIP 3;  2E2I B;  3WOF A;  2BE5 D;  4KY6 A;  2F1M A;  1U9R A;  1SYD A;  2Z4H A;  5JPN C;  3HOY B;  1EY0 A;  5FO9 B;  2ZXR A;  3BYT B;  2F0W A;  1IYV A;  3Q22 A;  4ZLT F;  1AZP A;  2KCC A;  2EDG A;  3SR1 A;  4NDX A;  5HUR A;  2KEC A;  5F2D A;  1D2B A;  4IUV A;  1SNC A;  3K5N A;  2XWJ B;  3GTL B;  1ESR A;  1RKN A;  5EKL A;  3QIA A;  3RZD B;  4P2C B;  4FF1 A;  1F2L A;  2B8G A;  3PIO 3;  1M8A A;  4LJZ C;  5EBC A;  3MXU A;  1LT5 D;  3R2T A;  3VR5 A;  3KK7 A;  1LAC A;  4FXK C;  1GXD C;  1MI2 A;  3J81 L;  2CVR A;  5FKA C;  4DFA A;  2F0V A;  2F0H A;  3R2I A;  1JIC A;  3MAQ A;  5EGT A;  3NK9 A;  5KIX A;  1F9P A;  4Z9C B;  2NTT A;  3S15 B;  1R4Q B;  1Q3L A;  5E1F A;  2K5W A;  2DNC A;  3HOW B;  2CQA A;  2KOL A;  3T4A C;  4NMZ A;  1EOT A;  3FPP A;  3QWN A;  3VR2 A;  4OO1 G;  3ZYY X;  4J6H A;  5I4D A;  1LTR D;  5KNC A;  2R93 B;  1ENC A;  3BG3 A;  5K36 H;  3DEO A;  3I90 A;  2DN8 A;  4DNR B;  5CYU A;  1LAB A;  2A6H D;  1STE A;  3J80 L;  4I65 A;  1DXM A;  4C3J B;  5EJW A;  4K14 A;  3CQZ B;  2PW7 A;  3ERO A;  4HCS A;  5E4W C;  1IKM A;  1PTO B;  1NR4 A;  3TBI B;  3IKJ A;  2R92 B;  3VYT A;  4Y7N B;  3DWA A;  1KNE A;  1GOZ A;  3MFG A;  4QUF A;  1CZG A;  4XYO A;  3DWQ A;  1UUP A;  1HUM A;  2FJ2 A;  3NTI A;  2K28 A;  1EY6 A;  3NQT A;  3HKZ B;  1EU3 A;  1AP0 A;  1CQF A;  1I4H A;  1CHP D;  1WTV A;  3RLF A;  2B2Y A;  2B2V A;  4IFD J;  1O7Z A;  2K32 A;  1EQV A;  2K6A A;  1EY7 A;  5COY A;  2PZT A;  5IGF A;  5TSS A;  1EWH A;  4G4K A;  5FLX L;  5M5W B;  4HED A;  2EJF C;  2MJ8 A;  3Q24 A;  1I6H B;  3A7A B;  2FMC A;  1TQO A;  2ENB A;  2F0T A;  2PMZ B;  3K5L A;  2B2V C;  2F03 A;  2OXP A;  3FPU B;  3VR3 A;  2MGS A;  5CV5 A;  1IHZ A;  2X69 A;  2NUC A;  2O5I C;  4A93 B;  2E2H B;  2N88 A;  3N6R A;  1EL0 A;  3IFD A;  3NPP A;  1J9O A;  3H6M A;  1CI3 M;  4ULL A;  3ERQ A;  1WTQ A;  3GTO B;  2KVM A;  2F0N A;  5D65 A;  4QMG A;  2LFN A;  3I91 A;  3GTG B;  1EZ8 A;  4G7Z C;  1ZKO A;  2K05 A;  3PUV A;  2EYO A;  2HCI A;  5EBD A;  3GTP B;  1CFM A;  1UAP A;  5CV7 A;  1GUS A;  4LK1 C;  4XT3 B;  2B2U A;  2I07 B;  2AQ3 B;  1QCB D;  3LWU A;  4TSS A;  1SMY C;  1VMP A;  3A8K E;  1Q1E A;  3H3V C;  1HUN A;  1SNP A;  1ICW A;  1GUG A;  3NTH A;  1KNA A;  2D62 A;  1B2T A;  2ID0 A;  1CA5 A;  3GTJ B;  2L4N A;  2B2U C;  4KMU C;  2GA4 B;  3HZX A;  1JB3 A;  5D3D A;  5J39 A;  1SFO B;  3V2T A;  4KV6 A;  1FNU A;  4HTH A;  4ZAI A;  2NTS A;  4RHR A;  3MWY W;  2PYK A;  1KAB A;  2BE5 C;  1H9S A;  2JEA I;  3GD7 A;  1RTN A;  1ZXT A;  2F0J A;  4ME5 A;  2RSN A;  2JA7 B;  4FF4 A;  4C3H G;  5I9O A;  3EQL C;  2EY2 A;  3RZO B;  3MEH A;  1FGB D;  1V1P B;  2QCP X;  4PMC A;  1SNO A;  1EYA A;  4O42 A;  1I4G A;  4FXD A;  4Q5V A;  1TKW B;  3AU7 A;  5JJZ A;  2B8F A;  1UNS A;  4LAA A;  3VR6 A;  1SYE A;  1TS5 A;  1U4M A;  2NVY B;  2EZV A;  1PRT C;  4KKU A;  1QIL A;  4RCN A;  1STY A;  2XRQ D;  1BUV T;  1LV9 A;  1G6Z A;  2F0S A;  2PW5 A;  1LTI D;  4C1N K;  2NN6 H;  1M4V A;  3BDL A;  2EYF A;  5CV9 A;  1T5X D;  1YNN D;  2WAC A;  2K1B A;  3S16 B;  4BY7 B;  4U68 A;  2JYO A;  4MN3 A;  4O1N A;  3A54 A;  4FNF A;  5JEA H;  3D4W A;  3OWF A;  2RVL A;  4L63 B;  5C0X I;  1LTB D;  4XXE A;  3T53 B;  5KYL A;  3W3A A;  2PQE A;  5BN3 A;  1TWA B;  1A3U A;  3TME A;  2NVT B;  3L7Z C;  2RBM A;  3HP3 A;  1SDF A;  2D5D A;  3R93 A;  2A6H C;  3MZ5 A;  3PO2 B;  5M3F B;  1ENF A;  2K7V A;  1A3T A;  1TWG B;  2BDO A;  1D5Z C;  5EKI A;  2IJ0 A;  1TR5 A;  2A68 D;  3I72 A;  4IUN A;  2KHS A;  2XVS A;  1KAA A;  2JXM B;  1CK1 A;  1HFN A;  2TMP A;  2CW0 D;  4KD4 A;  3BVG A;  1JWU D;  3TN2 A;  3HG9 A;  3FKI B;  4RGN A;  1YNJ D;  5LL6 X;  3KLS A;  4NP5 A;  3NQI A;  1ZYR C;  3DMU A;  1FYC A;  4B9X A;  2JA5 B;  2EJM A;  5JEA G;  3BDO A;  2NVX B;  5M5Y B;  3N52 A;  1VF7 A;  5G3L D;  3SXH A;  3TSS A;  3KUP A;  5CR3 A;  3A8I E;  2IW3 A;  1EY4 A;  3K0Y A;  2QDB A;  1CM9 A;  5M9O A;  2F4I A;  4RCO A;  3I3C A;  2VXW A;  1AEX A;  1EEI D;  1LT3 D;  1PTO F;  4WRD A;  1B53 A;  4K5V A;  2IX3 A;  1BCP C;  2BCO A;  1XYI A;  2M9V A;  2X6G A;  2Q8R E;  3Q6S A;  4U67 3;  3VYU A;  5FO8 B;  2Z1C A;  4K8J A;  4QCL A;  4IAL A;  1WTX A;  1W6J A;  4GZY C;  3S17 B;  2LKV A;  4IUP A;  3T16 A;  2E2D C;  1B1Z A;  2EJG C;  4WJW A;  2SEB D;  1B3A A;  3PMF A;  3SK4 A;  2QKI C;  2TSS A;  5HGT A;  4C2M B;  4F8M A;  5A35 A;  4Q0F A;  1KDB A;  1O78 A;  4JK1 C;  1K8O A;  2WII B;  3RUZ A;  3S2H B;  1IL8 A;  4ZUJ A;  1SJE D;  2HDM A;  4K6D A;  1DYQ A;  2E75 C;  2EPB A;  1H9M A;  4IQZ A;  4CJ1 B;  3T56 B;  1E2W A;  3E5S A;  1R9T B;  3ND8 A;  4UDU C;  5KEE A;  5E3F A;  3DHQ A;  4WOR A;  1SYF A;  5FOB B;  1MD2 D;  4KKS A;  1WVL A;  2I46 A;  1F9R A;  1G29 1;  5CMD A;  2XWB B;  3TP6 A;  3K58 A;  1I4P A;  3GV6 A;  1BBX C;  1BO0 A;  1GJX A;  4F87 A;  1NAP A;  2VB3 X;  1H9K A;  2JEB I;  4ABN A;  1IW7 D;  5EQ0 A;  3RD4 A;  1VMC A;  3GQB A;  3SDZ A;  1OXU A;  4A3D B;  1HXY D;  1JE4 A;  1HA5 A;  4K2K A;  1H9R A;  2RDG A;  2AWN A;  1BF4 A;  2L55 A;  3H09 A;  1B44 D;  3NBH A;  1LT4 D;  3S9W A;  2NZ1 D;  4N9P A;  2LY7 A;  3GV3 A;  5CC4 A;  2A69 D;  1FR3 A;  1EY5 A;  1Q12 A;  1PTO H;  1CQV A;  1V1O A;  2KCN A;  3PUY A;  3PUZ A;  3I4L A;  2HUG A;  1NR2 A;  1EY9 A;  1RF2 D;  3BS1 A;  4BBR B;  3BVZ A;  3P75 A;  2YU9 B;  2EYM A;  2RDF A;  1DON A;  1I6V C;  1WD1 A;  4DF7 A;  5EPJ A;  5I9P A;  1XWE A;  3SK8 A;  1EYC A;  2A6E D;  4WFN 3;  4S3S A;  4CKC A;  1V1P A;  2DNE A;  1YNN C;  2H1E A;  5IGB A;  3S2D B;  4KHV A;  1JCK B;  3I4M B;  5FO7 B;  1I4R A;  4C3I G;  4PMW A;  4RGM A;  3EFX D;  4BA2 I;  2DY8 A;  2F0O A;  1DM0 B;  1I50 B;  5EPK A;  1WTR A;  4BA1 I;  4ZK9 B;  1WTO A;  4C3J G;  5JAV A;  1F2M A;  2KQ3 A;  3R3O A;  1BCP B;  4LMQ D;  4CKE A;  1TY2 A;  4A3K B;  3P1H A;  1JWM D;  3LNN A;  4A3M B;  3FVQ A;  4PV1 C;  3QG1 A;  4OIK A;  2WIN B;  4PQX A;  1LT6 D;  3SK6 A;  5JPM C;  5C4X B;  2LMC B;  2Q8T A;  1HPC A;  3NHH A;  2BOS A;  3QJY A;  2AQ2 B;  4E6I A;  1U4L A;  5K36 G;  2R61 A;  2A68 C;  2EYH A;  4KY5 A;  1DOL A;  2A5H A;  1VF5 C;  3J7Y W;  2IX1 A;  2CW0 C;  1PTO D;  2L11 A;  2OEO A;  3S14 B;  1YNJ C;  4DGZ A;  2B2Y C;  1MBY A;  3RMH A;  3SHL A;  1FNW A;  5G3L F;  4ZYS A;  4H13 C;  5JEA J;  3FDT A;  4ID6 A;  4V0B A;  2OF1 A;  3D8G A;  1ENA A;  3C46 A;  2JP1 A;  3D31 A;  1WTP A;  1K83 B;  1Z47 A;  4X3T A;  5ELE A;  5A2Q E;  3GTK B;  4FO2 A;  4K5X A;  1X3P A;  4MHE A;  3WOE A;  1I4X A;  3SVM A;  1HA6 A;  4RKL A;  1Y1V B;  3MXP A;  4XTC S;  2F0I A;  3OWE B;  1PLF A;  4IUR A;  5DM7 3;  5J1Z A;  1G2T A;  1Z6H A;  4IFD I;  2WV6 D;  4XQN A;  3ITP A;  1NSN S;  4BS9 A;  2LS0 1;  1IYU A;  2PO4 A;  1XTC D;  3IL8 A;  4DAY A;  2K33 A;  4K2L A;  5J22 A;  5JOB A;  4PNY A;  1Q8I A;  4BWG B;  1STG A;  2ZXO A;  1GUO A;  4BY1 B;  4C56 C;  2FHT A;  4YIJ A;  3TP7 A;  1A2T A;  3S1Q B;  1ET9 A;  4DN4 M;  4DU9 A;  1O80 A;  2L0C A;  2A73 B;  2IX0 A;  2Z4I A;  5CBA E;  1D5X C;  4C3H B;  1H9J A;  3QB3 A;  1GUT A;  3E6Z X;  5CV4 A;  1O7L A;  3PUX A;  3LX0 A;  2BDN A;  4TKO B;  2K5Q A;  5BN4 A;  5T1G A;  2SOB A;  1JOQ A;  1ROD A;  5DM6 3;  1LTS D;  3J81 E;  1KTK A;  1PZI D;  3PO3 B;  3PV0 A;  1QB5 D;  2SDF A;  1B9N A;  4IN3 A;  2OT2 A;  4EQP A;  4XYQ A;  1BQQ T;  1JR0 D;  4L6T B;  1TWH B;  2M2L A;  3BVM A;  1OXV A;  4JBW A;  4ZKC B;  5KRU A;  2ICE C;  4ZUI A;  4H44 C;  4ODG A;  4B9W A;  4RGT A;  2EYP A;  1TII D;  4OGQ C;  2KA7 A;  3S1R B;  2XIW A;  4EVO A;  1PXU A;  4FF3 A;  1Y8P B;  3BZD B;  3NP8 A;  2CHB D;  5C5L A;  1KDA A;  4HSV A;  3A8J E;  3QOJ A;  3BYY B;  3S1M B;  4RWS C;  4FF2 A;  1RHP A;  3M3Y B;  4G57 A;  2HCC A;  2VNU D;  4FP5 D;  1STN A;  1QWY A;  3HS0 C;  4HMJ A;  3GTQ B;  2RSO A;  2RDH A;  1EU4 A;  1C4Q A;  3P20 A;  1UEA B;  2DY7 A;  2L9H A;  1Z7T A;  2X6L A;  4KJN A;  1EFI D;  1RD9 D;  3NXW A;  3I8Z A;  1U4R A;  4G7O C;  1R4P B;  1SE4 A;  1Q1B A;  1HTL D;  5M5X B;  4N9T A;  2J7Z A;  1DOK A;  5C44 B;  1G8Z D;  1SE2 A;  2SNM A;  2MPM A;  2NN6 G;  1BR9 A;  3DXJ C;  4NKL A;  4XQJ A;  1Q90 A;  4ILW A;  4H0L C;  2D9U A;  1G91 A;  1K8M A;  2XN9 C;  4F88 A;  1XXG A;  4B08 A;  1DZ1 A;  1EY8 A;  3PUW A;  3ND9 A;  5C3W A;  4BBS B;  3QO2 A;  4MIU A;  3NWS A;  5ELF A;  3KLR A;  4HMI A;  5IOD A;  1PFB A;  4IUQ A;  3H0G B;  1Y8O B;  1EIH A;  3ONA B;  2IPK D;  3V96 A;  3HOV B;  5FLX E;  4KHZ A;  3M85 A;  3HOX B;  3C1E A;  4FXG C;  2BA1 A;  1VDZ A;  2AUJ D;  3CKI B;  4RAU C;  4OO1 I;  1TU2 B;  1WD0 A;  4K6L A;  2L12 A;  1STA A;  4RFB A;  5C4H A;  1S4Z A;  2QIL A;  4DAP A;  1HRJ A;  1EEF D;  2JA6 B;  1PTO C;  5D14 A;  1EWC A;  4KKT A;  5KGU A;  1V8Q A;  2EE1 A;  5C4Z A;  4UAI A;  3TZD A;  2HDL A;  4KK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...