1RKQA

Crystal structure of had-like phosphatase yida from e. coli
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
271
structure length
271
Chain Sequence
SLAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAVDNAIPSVKEVANFVTKSNLEDGVAFAIEKYVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of NYSGRC target T1436: A Hypothetical protein yidA.
rcsb
molecule keywords Hypothetical protein yidA
molecule tags Structural genomics, unknown function
source organism Escherichia coli
total genus 96
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.1.3.23: Sugar-phosphatase.
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 1rkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rkqA01
3N1UA 1YMQA 1YNSA 1O08A 5AK5A 4HGNA 4YIHA 3QUQA 4Y2XA 2CFSA 4GIBA 2HCFA 5A3RA 4J03A 1K1EA 2YJ4A 2WF9A 3I28A 2FPXA 2FPRA 3U7HB 2HX1A 3IJ5A 1L8OA 2IOHA 1ZRNA 2YFYA 5ALVA 3N5KA 2GHQA 4GXTA 3DNPA 5E0OA 1U2SA 5AKGA 3U19A 3KBBA 5ALXA 2ZG6A 3WK5A 3QU5A 1Z4PX 2YN4A 3OCZA 3NRJA 5AM0A 3PCTA 1T5TA 3L5KA 5AI6A 3DDHA 1QYIA 2ODAA 4UMEA 3AR4A 4DCCA 5AICA 3OCXA 2BDEA 2OYCA 2WHEA 3WK9A 2ZBFA 3CZ4A 4MUMA 4YCMA 1YV9A 5T41A 2FI1A 3ZTWA 2GHTA 4EEKA 4HGPA 4BX0A 2GMWA 1SWVA 2C8LA 4Y2PA 2JARA 4XOUA 5ALEA 3MPOA 2JAUA 2WF8A 2CFRA 3AR5A 3CNHA 2QYHA 3E8MA 3QNMA 3QU9A 4BNDA 2G0AA 2GO7A 4CNQA 5AVXA 1RLMA 2W4MA 3L8EA 1T5SA 1YDFA 1RDFA 3B8EA 5AKZA 3M9LA 1NF2A 3QXGA 3AR3A 4NABA 1ZJJA 3OCVA 5AKEA 3B9RA 3ZWKA 2YMQA 1ZD5A 4UM7A 1Q92A 1XP5A 4DWOA 4I9GA 3I1YA 1U02A 4Y2JA 1CR6A 3DV9A 1N9KA 3A1DA 3ED5A 1VFPA 5AKKA 3FZQA 2R8YA 2D2VA 2YMLA 4Y2UA 3WGVA 4HYTA 1EK2A 2P27A 2P11A 5AW4A 2RARA 2G1AA 1L8LA 3BWVA 1RC8A 3EF0A 5ALJA 1TJ3A 1YS9A 1KYTA 2ZOSA 4KYTA 4ZEWA 3WKCA 3A1EA 1RQLA 3NIWA 3WKBA 2G07A 2IOFA 5AK6A 3N8GA 4FYPA 4CF4A 5ALPA 3WKEA 2JAWA 2R8EA 2C8KA 1U7PA 1NRWA 2AMYA 4XPZA 3QGMA 4UMVA 2PR7A 1RLTA 1LTQA 1Z4MA 3E58A 5ALYA 2O9JA 2WFAA 2HOQA 3ONNA 2RBKA 3OTQA 4L6CA 5ALRA 2HF7A 2OA0A 1SU4A 2CFTA 1JUDA 4UASA 5AK4A 2I34A 4Y2VA 3EWIA 3NANA 4ZEVA 1X42A 5AI8A 5AVRA 2IOFK 3E84A 4CE6A 3ESQA 3NAMA 4KNVA 5AKYA 1NNLA 4Y2TA 3D6JA 3KOOA 5AW3A 4NV0A 3WKDA 1ZD2P 4FE3A 2B8EA 3FVVA 5JJBA 1AQ6A 2WF7A 3E81A 3ET4A 2JGAA 4C4RA 2PKEA 1Y8AA 1MH9A 5AVQA 1VJRA 2HI0A 2FPUA 1LVHA 1XVIA 3NALA 5ALHA 3L1UA 2WF5A 5ALDA 4L57A 5AESA 3SKYA 5ALLA 3A3YA 1TJ5A 2AUTA 3U7FB 1RMYA 2B1RA 4Y2YA 4Y2RA 3ZUPA 3FGOA 4G9BA 4BBJA 5AIBA 4YCLA 4DFDA 1Z4NA 1T9ZA 1IWOA 2HEGA 1TE2A 4AP9A 1ZD3A 2YY6A 3QU4A 2W43A 4KX5A 3B9BA 5AI9A 3NUQA 4HGOA 1TJ4A 5ALQA 3WK7A 4HGRA 2G09A 2YJ3A 4UMFA 3HYCA 3RFUA 4HGQA 2GFHA 2HDOA 2P69A 2B0CA 3L8GA 2FPSA 3IB6A 5AKXA 3AR9A 2I54A 3PGVA 5ALNA 5A3QA 3WK8A 4YIKA 4RESA 5AW0A 4IG4A 1U7OA 1Z5GA 2JAOA 3KDPA 1ZOLA 3W5DA 3P96A 3R4CA 4KX3A 4OCZA 1F5SA 2WF6A 3FPSA 4KNWA 1U2TA 3BA6A 2G08A 1WZCA 4CF5A 1XPJA 4MWOA 3QU2A 4OD0A 3ZVNA 3SMVA 3L0CA 5IT0A 2Q4TA 5AI0A 4EX7A 3AR8A 4XQ0A 1VJ5A 1FEZA 3I76A 2O2XA 2IYEA 3DAOA 4OFZA 3UMGA 1Z4KA 3QYPA 2VKQA 2FUCA 3QX7A 3R9KA 1RKQA 2EATA 4CF3A 5AM2A 3WK6A 2RAVA 3F9RA 3QUTA 4BX3A 2FPWA 1RKVA 3L1VA 2EARA 2YBDA 3W5CA 3ZX5A 1L6RA 2NYVA 2X4DA 3SKXA 1S8OA 1QQ5A 1Q91A 2I33A 4YCNA 1WPGA 2C9MA 5ALSA 5FP0A 2MSNA 5AW7A 2ZBEA 5AK3A 3SD7A 4AS2A 1EK1A 5AW8A 3VAYA 2B1QA 5AIAA 1Z4JA 4QQFA 5AI5A 4F72A 4YGYA 3KZXA 4BNDB 5ALFA 4EZEA 1RQNA 4BEWA 3W5AA 2I7DA 2HF2A 3L0YA 2YMMA 3ZWDA 1WR8A 2NO5A 4UU0A 5ALZA 5ALTA 4Y3UA 3SLRA 2Q5EA 3QUBA 3ZW7A 3KD3A 1S2OA 5AHXA 2YJ5A 2YJ6A 2R8ZA 1L7PA 3ET5A 2OBBA 4B6JA 4HAIA 5ALIA 4L6AA 4EELA 3N28A 5AW2A 1RMQA 3FPBA 3MN1A 2FUEA 4H1WA 2C4NA 4J2TA 1J8DA 4NFLA 1YJ5A 4EENA 1QH9A 2P9JA 3EPRA 3IRUA 3KC2A 5AM5A 3ESRA 2HSZA 5AKIA 1QQ7A 3GYGA 3ZVLA 4BX2A 3S6JA 1L7NA 1Z4IA 4UATA 1RLOA 3R09A 4E88A 4G63A 3L8FA 4UU1A 1PW5A 2AGVA 4BYGA 3ZU6A 1RPZA 1RKUA 1ZRMA 4YH1A 5A3SA 2FDRA 2YMPA 2W11A 5AW9A 1Z4OA 5AVSA 1RMTA 4C4SA 5ALKA 4AS3A 3AR7A 2HHLA 1Z4QA 3OCUA 4JDPA 3L8HA 3L0BA 2WM8A 5AVZA 3PGLA 3I6BA 2BY4A 5AVUA 2B8JA 5IS2A 1J97A 4EX6A 5ALOA 4Y2QA 1L7MA 2G80A 2ZXEA 3U7GA 5AKLA 1CQZA 1ZS9A 2C88A 3WKAA 5AVYA 3U13A 2RB5A 3N07A 3OPXA 1ZD4A 4DW8A 1N8NA 3ZI4A 4F71A 3MC1A 3W5BA 4O8CA 4UAVA 5AVVA 4FFDA 4NWIA 2G06A 4C4TA 3RF6A 3OCWA 2PQ0A 3SF0A 3ZVMA 2Q4RA 3U7EB 5AKJA 2BDUA 4RETA 1Z4LA 3TLMA 3L7YA 3OCYA 3M1YA 3AR6A 1Z5UA 4JB3A 2ZBGA 3K1ZA 3J7TA 3UMBA 4UARA 3PDWA 3WGUA 2DQSA 2MU1A 2FEAA 5IT4A 5AVWA 2I6XA 1TA0A 4I9FA 5ALGA 2R8XA 5AI4A 4NAVA 2AH5A 5ALMA 3U26A 1L7OA 3MMZA 3QUCA 1Z88A 5ALUA 2B30A 5ALWA 4KN8A 3SHQA 5AKHA 2EAUA 4UMDA 5AW1A 4OHFA 2OM6A 5AM3A 3WK4A 3HLTA 5AM4A 3UM9A 2HO4A 4QJBA 4Y2SA 2B82A 4ZEXA 2CN1A 4UM5A 4BKMA 1O03A 5AM1A 2I55A 1RRCA 5AW6A 4XE5A 3AR2A 4BEVA 1QQ6A 1WVIA 3QU7A 2ZBDA 3UMCA 2IA5A 3ZTYA 3NASA 4UW9A 3QLEA 3ZX4A 3EF1A 3FM9A 3A1CA 4UAUA 2NO4A 5AVTA 2QLTA 4IFTA 4PNHA 1SWWA 5AW5A
chains in the Genus database with same CATH superfamily
4YQEA 1JNXX 3FBGA 3M6WA 4QICA 3L7DA 5K3SA 1LRLA 1X7ZA 3W7VA 4YT8A 3TI9A 4AIIA 1KWGA 4IIJF 1DAPA 2CJYA 4K9SA 1IN5A 3A1WA 3CN7A 4YI3A 1MHPA 3JQGB 5TQVA 4MINA 3TIFA 4N6NA 2CSUA 3V34A 1IJBA 2OMEA 3PFBA 5BO5A 2AI3A 3B38A 3OZSA 3PF8A 2PQ2A 5DLDA 1DC8A 1U0HC 3RCBA 1KI2A 4PGHA 3ETHA 1O7JA 4FUTA 4Q24A 5DM0A 5I48A 1VECA 1USWA 2ATCA 1AURA 1YS4A 2I6SA 1JG1A 1E6WA 2W6MA 1HTBA 3B6MA 2WSYB 1ZUNB 3QPAA 1CNMA 1WPQA 1CJVC 3SC4A 5BWMA 3B48A 4AQYB 1EZ4A 2R48A 3UK1A 4KFTA 1ISJA 4YASA 2RCYA 3KB6A 4HXYA 3GXOA 4IFIA 4HAZA 2XE7A 1CUBA 4YFVA 3V1LA 3L5KA 4ZYWA 2WWIA 2XKAA 4D0SA 2JGMA 2QE7D 3DD5A 2G1KA 5CFNA 2IK8A 3KTDA 3ZU5A 4NX2A 1GNRA 4E3ZA 4G41A 1VE7A 5LDHA 4KE8A 4RA9B 3DE3X 3MTDA 3LQFA 3MWLA 4KTVE 4ZQBA 1M10A 1C80A 1TKCA 1YZHA 2WM3A 3LGAA 4O2BF 4EQZA 3WQQA 3PFFA 5MN6A 4RHUA 3U4DA 2J1LA 4KFUA 2OYCA 1BZYA 1E2JA 3QLVA 1GKIA 3OO1A 3IDOA 1I7NA 4CODB 4EP1A 2ZJBA 5CH8A 1FDWA 2GZAA 4E1VA 3LDFA 2JHGA 4BAZA 2CNWD 2ZAYA 4H3SA 4U02A 1GP2A 3A9RA 3CRZA 1GZ5A 1CLUA 1PGJA 1CZRA 5BXQC 2LTAA 5JWRA 5F7JA 2FX3A 3RG2A 3RSOA 4AZTA 1KOFA 3BVPA 4UVIA 1JT2A 3RVQA 4PS1A 5DGCA 3TR6A 2BP7B 5FO0A 2C96A 1BVHA 2AFIE 1X7YA 1LLCA 3C8MA 4QFMA 1CUIA 2X42A 1B0ZA 3USZA 1Z75A 2VTEA 5EXEA 1XRPA 1YR3A 5LZ4A 4J94A 3WJ7A 2F2TA 1GTRA 1SUPA 4HAUA 1KTIA 2XX3A 4EEZA 4EW3A 2YMQA 4PQGA 1IN7A 1RHRA 3FVQA 2X86A 1F2DA 3CM0A 4O63O 4ZCLA 4DWOA 1W9MA 3CZQA 4IIXA 3OE1A 4PC3A 3N05A 1UMDB 4A23A 4IV8A 4BO3A 1NVVQ 3JD2A 3U4GA 4DWVA 2PL1A 2RKBA 1KSGA 3DMTA 3N39C 4RJKA 2X8LA 4UBLA 4ENTA 2BFDA 5A6VA 4DTIA 4JEIA 2W4QA 4IJ5A 2C7BA 3M4NA 4M8KA 4F7DA 5AVKA 1X15A 1C4WA 2IZ6A 1NYRA 3AUXA 4Y2UA 4DG8A 1UINA 5IZCA 3ICQB 2P11A 1M6YA 3OM0A 3TMYA 1QFYA 1DSSG 3ZHOA 5AW4A 3BMQB 5AHWA 3QVGA 3IAS6 2AVNA 2QUJA 3E5RA 4PC7A 4UUQA 5KCMA 3RRNA 4BNKA 8ATCA 3LVFO 3AF5A 4QRHA 1KFKB 1W0CA 2RGXA 3NATA 2XMRA 3WL7A 3HU5A 2B0JA 1N36B 1XQWA 5I45A 1TI7A 2DQKA 3A1EA 4OU5A 5C32A 3TO5A 4URHA 4AJEA 4DA6A 5AXBA 1OXVA 2F48A 2YZMA 1WVMA 2Y1WA 3REOA 1E9SA 2JFHA 1WXDA 1LLUA 2AFIB 3LPMA 9LDTA 1HK7A 2X23A 1P9LA 1NWHA 5I6DA 5DM70 1H9BA 1A8HA 3BMNA 3SOZA 3L41A 2PR7A 3DM5A 4CEHA 1E4VA 3D4LA 3HP1A 3GRRA 4CQLA 1G1AA 1LTQA 1UK9A 2YYSA 3SJZA 3G9UA 1KR2A 4IZHA 4L28A 1I01A 2VL7A 4UBIA 3MRXA 4I55F 3IR6A 1UXIA 3NONA 2OHGA 2HF9A 3AWDA 3UJ3X 4DLVA 3KKQA 2DC1A 5ESRA 3TJRA 3TX2A 2GJKA 4DR2B 2ZWMA 1IMOA 5FEUA 3H9BA 1D2HA 3H3XA 3E22A 2REOA 1DKNA 4H0CA 3VX4A 5C8DA 2C9DA 1DS6A 3TAUA 1QTIA 4MVJA 1KK3A 4XB6B 1EFVA 2OQRA 2V8OA 4FYJA 3VKFA 1WXQA 1EFRD 1LWNA 5GJCA 3UAXA 3VR2D 4DHEA 4E2ZA 1SZPA 4IGKA 2MSKA 5G40A 5AJYA 3UT0A 3UWSA 4C08A 3OKFA 4P81A 4EG8A 4E6EA 1G9XA 1QUEA 3DOEA 1AO3A 3FVVA 3O38A 2WF7A 4QATA 3E81A 4TLLB 2MR5A 2PFKA 3A05A 3OI7A 4J07A 4WEOA 1ZO8A 3ZHZA 3PKJA 5FJIA 4E5DA 3WBJA 3TNLA 1QGED 3RYFA 4YONB 4JVMA 4EGAA 1QYXA 1LI7A 2P2GA 3QWFA 3HDYA 4L7VA 2P90A 4QJ3A 2IIVA 4I1OA 4UVGA 4JJ8A 1ONPA 4A1FA 1FW6A 4P2GA 1I3KA 4P4SB 4Z1OA 3VSCA 3UH1A 1DLJA 4RQAA 3G5TA 4RKYA 4WN9B 4YUYA 5E2BA 2W2KB 1K7SN 4HZUA 4MMXB 4PC1A 5REQB 1U28C 1NJ8A 5CM2Z 4G5YA 4HXGA 4LXIA 2NUAA 4MIYA 4NCKA 3TL3A 1XLUA 2J0QA 4ZO8A 1NLUA 1VI2A 3MINA 3S3TA 3FA2A 3KQUA 4WAUA 3WE7A 3VH1A 5IP5A 4DLZA 3NZEA 3AFOA 2HN9A 5ARDA 3QU4A 3BWDD 2QNIA 3MTEA 3NFYA 4W5WA 5DM2A 3B9BA 2H7YA 2XNKA 1QZXA 4PYJA 2X22A 2J3QA 1QOQB 2P8JA 1C3JA 3HB9A 5FI0B 4F6LA 2G4CA 3GLIA 2O0HA 4YJ3B 3UXHA 3DYBA 3CNOA 3NOOA 1DJOA 4Q1EA 2JAXA 3JYOA 5DISB 1KORA 2W0MA 1SCBA 5CEJA 4W9NC 1R7RA 1SOUA 2H59A 2R65A 4M1QA 4PZUA 4D3YA 5E1OA 4KQGA 2G09A 2QW1A 3HYCA 2FEPA 2D1TA 1U4SA 3DEKA 1GYRA 1U3WA 4A7PA 4P1ZA 5JATA 5JTTA 3CVXA 3T9BA 3V2IA 4AM8A 2C2ZA 1Q1AA 2GERA 2C7VA 1DLIA 2H00A 2W90A 3NYIA 1JVSA 1T91A 1XXHA 4JLUA 3UN1A 1S3FA 2HXSA 3WK8A 4CMIA 5IUJC 3VJRA 5BSRA 1K6MA 2Y4NA 2ET6A 5GJWC 5IJZA 1M0TA 3MYYA 4M99A 3CONA 1JEYB 1QRSA 4TUYB 4FP9A 1FL9A 4TLBA 5TQ0A 3OOWA 4NZPA 1QTNA 4M1KA 1VKJA 5K3EA 2QLFA 1E66A 3BE6A 1R3UA 5EMJA 1G42A 1HL3A 1SN7A 3DXFA 3LM8A 4G5XA 4EF4A 3QX3A 3R0VA 2Q21A 3N8KA 3UJCA 2V6MA 5GPBA 3ICWA 5K4GA 3G1UA 1AXRA 2PCLA 1BKDR 3E9YA 1QORA 1G3QA 2GNOA 4NCIA 5KVQA 3VPCA 4OB8A 4V1CA 2WAXA 3DLHA 3KQWA 3SZRA 3ZY5A 3U6KA 1POXA 2MT9A 4RFVA 1O97C 1X1QA 2H1IA 4ZU3A 1O9BA 3JQAA 3MQ4A 3TOXA 1NNI1 1F8GA 3HNRA 3R3WA 3CPSA 2IXTA 2PH1A 3LSYA 4QKQA 2CXQA 4UAJA 1WDWB 4WIAA 4ZQGA 3AP2A 2QTZA 1A9XB 3CH6A 4GUDA 3ZV3A 3S44A 4B6PA 4R2JA 2HCJB 5CXQA 2FUCA 5IMBA 1PS0A 1L5HB 5CPFA 5G4KA 4BPBA 2HBQA 2FPOA 1JDVA 2OVFA 4U7TB 4E5SA 3VU9B 3C4QA 4YPVA 2QU7A 1N5RA 1QRAA 3MEQA 4NBLA 4RORA 2PL3A 1EUCA 4W4TA 2ZSIA 1XPRA 2EARA 2H5JA 2YBDA 1ES9A 1XQ1A 2OD9A 4R68A 3WLFA 1VTKA 1E0AA 4IILA 4QPJC 1ZL0A 3EWSA 4ENSA 2VN8A 4YP9A 1KYZA 3VPFA 4ANFA 4JUCA 4F5EA 4BO2A 1YHNA 4HN2A 3TM4A 5A02A 3AG6A 1XMOB 4PX3A 3A2NA 2JCBA 1ZH0A 1LA2A 3P1JA 1J8VA 3HFGA 4OQPA 4HT3B 4Q3EA 1A8PA 2RK3A 4KIGA 2W2XA 4MQLA 2YCBA 1Z63A 4BNHA 3IEMA 3GQVA 1T26A 2REQA 2JFNA 3VKUA 2HRDA 1HFKA 2ZROA 3OQIA 3O8OB 1W76A 1MNQA 3PUXA 4WOBA 3R5HA 4X64B 2NAPA 3ND9A 3BIFA 1JLKA 4EPWA 3RFFA 2ZM6B 1K63A 1II9A 1OX6A 4UTXA 4TYNA 3SQMA 1JH9A 4CR7A 1X0XA 2JEYA 4DBLC 2W6ID 2W00A 3UAYA 5F7OA 3IIKA 3ZWYA 4LDPA 4ZJUA 2ZR0A 1R0SA 3C48A 5LP6A 4ZWNA 2FXVA 4N4AA 5ALZA 4QJ5A 4WFJA 2BCJQ 1OI7A 4ZRNA 1T10A 2QUAA 3MUOA 4TWZA 1PHRA 1VJGA 2FW1A 4N0MA 5KKAA 5BSMA 3DFMA 3IQWA 2CWWA 2F3QA 5CH3A 4KQCA 3OTOB 2Y6UA 2GTHA 2WILA 3QUBA 4HS9A 3DDWA 5DEOA 1FLAA 5FOXA 4B0OA 4LC1A 4BWVA 2ZYHA 2RDMA 1DDIA 2PMCA 4LVCA 1L7PA 2FSIA 2G8NA 1DQNA 4IEEA 5HJ2A 2I8LA 2YWXA 4EELA 3PIRA 3OTGA 4JP3A 5ELLA 3T9DA 2PS9A 3KLBA 1HFEL 3EIWA 4MRVA 2VP3A 1UKYA 2AOWA 2YOHA 3ZHCA 4HATA 2HWXA 1WW8A 1GQ2A 1XA3A 4L07A 4QG3A 4EHHA 3TSCA 2GF9A 3I72A 1YJ5A 3LCVB 4KHZA 1C7ZA 5CCEA 1ZJ6A 2WMNB 2Q50A 1JAIA 4O1MA 1RWKA 4B47A 4ZTUB 2DTEA 3AINA 4I1IA 2E4YA 4LYDA 3GYGA 2A67A 1Z62A 2UYHA 1CSEE 2RHWA 4NZOA 3GIWA 4QECA 4RPHA 4QNRA 4GG1A 2Y1FA 3W9YA 1Z6PA 3Q40A 1FXWF 1TA9A 2OV8A 3DMGA 3V8NA 6YASA 1C3EA 2A5DA 2QRMA 1DWUA 2UV8A 1KH3A 1LRJA 2AGVA 4NBRA 4NBKA 3VGPA 4CM9D 5M2QA 1LK0A 3HP7A 5L3QA 3WP1B 4WVFA 5KYXA 3NC0C 1BS2A 4J0DA 3NBQA 4MV0A 1G6KA 3O9ZA 5GWXA 3WL8A 4AKIA 1V16B 5EJ6A 1Y1TA 1EVYA 3EAFA 1FZQA 4MROA 3RIEA 1Z4OA 3CU5A 4CBVA 3MGAA 3O8DA 4K28A 4CKXA 4A2WA 3KM0A 1W5TA 3DFIA 1NVMB 3PD0A 1GSOA 1E69A 4XIGS 1W2GA 3BQ9A 5ECYA 4X7BA 5EJ5A 2X3UA 3L8HA 3ZK8A 1T1GA 5CJJA 1NT4A 1KHHA 4PG7A 2EKZA 1C2YA 3IR5A 1ZM3A 3FOBA 4JLVA 1EIWA 3IALA 2PGAA 5JPDA 3UJNA 1K5HA 3IA7A 3WZLA 1ISSA 3H0EA 3EFEA 2LRHA 2OAEA 3V4LA 3HYLA 1XRQA 4AUKA 1FFXA 5CB4F 4RM2A 2WYWA 5AKLA 3L1HA 4Z3DA 1A76A 3LXXA 4JUIA 1H1LB 4AROA 3DWIA 5U1PA 4HQOA 1G63A 3F9IA 5BN3A 1FU4A 1RNLA 2JCGA 3T7CA 3D3QA 2HLDD 4URFA 3TIGA 4E14A 3C8UA 3K0FB 1A50B 1XCBA 3BCSA 1HEIA 4WLEA 1SHTX 4L4XA 4KO4S 3T34A 3VZBA 4DBVO 4DNQA 5BV2P 4HDMB 1IRXA 4D44A 2PQ0A 1U6KA 1XGKA 1N6IA 3MM4A 1K6EA 1Q83A 5I47A 5I5EA 5F76A 4F0JA 5CD1A 4DDVA 2R8BA 4MQEA 1XJ0A 2EGUA 2AEJA 4AJ4A 3EVBA 4KR3A 3R5FA 4LNUB 3TEFA 2O7SA 2VT3A 3W79A 2CE7A 4TV9B 2FJUA 4BGVA 3TI7A 4GQIA 4JB3A 3SNKA 1TECE 4YUXA 4CEIA 1KAGA 1N2BA 4M76B 2F1KA 3ETNA 3I53A 4QQNA 1M9NA 1ORRA 4GKJB 3C3WA 2Q3LA 1YZ3A 1GRQA 1C41A 3FPLA 5HQ3A 3MAJA 4AKTA 1TM4E 2FLVA 2I2AA 3DAYA 3GQBB 4UNRA 3HU3A 2YXBA 5FLEX 3WNBA 1L7OA 2X6TA 3T8YA 1NIJA 1NHWA 2JK0A 3CR3C 3OFSA 2XUKA 1GLGA 2RKWA 2PMEA 2MDTA 4KQ2A 3C85A 1YRQA 2WBLC 3NM4A 3ZLUA 1DVRA 2Z1NA 3A7DA 5AW1A 2YWJA 3S2ZA 2OHIA 1PR5A 1RI4A 3UM9A 3K09C 3DMPA 4GPD1 3ROMA 1M54A 4BKMA 5JC8A 1JR6A 4JWTA 4W7SA 3JPYA 3HJGA 1L4NA 1P0IA 1NR7A 1W8IA 4J1NA 7GPBA 2C59A 1PJTA 4EQ6A 1SVIA 1NFRA 1VXRA 2VRNA 4BRUA 5IAEA 1MC5A 3QU7A 3WWYA 2ZBDA 1S2LA 2GN9A 2Q4EA 4G9EA 4Q6WA 4DG5A 1T9CA 1M8GA 3VTZA 5A6SB 4HAXA 3ZX4A 4IMRA 3ZDBA 1EWQA 4CTOA 2POQX 4M9RA 1KS9A 1NW6A 2VRWA 1Q44A 1Z08A 3KEFA 3MTIA 3NOVA 4GKBA 1XMIA 3DOUA 3A6EA 1JI3A 1QVAA 1SOMA 3AOGA 4FHGA 1SCUA 4KDFA 4NULA 2NTJA 5DNYB 2R86A 4FKZA 2ECPA 1F20A 4NZZA 4QNMA 1CZKA 2CK3D 4YIHA 1NVAA 1Y7IA 4CDRA 2R87A 2CB9A 4GIBA 2ZTUA 1IULA 2FQ1A 2OTCA 3TKLA 1X38A 1DB3A 1K1EA 1Y3AA 2I4RA 4K5QA 4LMAA 4EA8A 1FUKA 1ZXXA 3DEAA 2R4QA 5L3RA 3LKVA 1DKOA 4YA6A 4HAWA 2IOHA 3QPWA 2Y1EA 1JQJC 1DG9A 1S0UA 2CBZA 1XRNA 3Q12A 3W4KA 1GDTA 1IXZA 1IBRA 2RGNA 1U0OC 4I5DA 5LLDA 3GL9A 3L4JA 3KR2A 4TVSA 2FMXA 4C5BA 3RRFA 4CFZA 3N75A 5ALXA 3UCFA 3WGKA 4IBOA 3EY4A 3WGJA 2WD7A 1VIMA 4IJWA 4LXGA 1FSGA 2EP8A 1K8QA 4D82A 1KEPA 2QRVB 3GJ3A 3O7WA 4ZOAA 2CNNA 3U9SA 3ULKA 4JROA 3AGPA 4AKGA 1FFSA 1P9WA 2BPOA 2JRCA 1I80A 2IQ5A 4BGIA 3AVYA 3TLZA 1X9HA 1Z18A 2CL7X 7REQB 3IBCA 3TYXA 2JLXA 3P5BA 5B1DA 4BKPA 1UP6A 5H82A 1L3CA 3WK9A 4A8JC 1QCZA 1JQ5A 2O0MA 1DBRA 4MUMA 4H6VA 3TD6A 2XMZA 3CIOA 1CW2B 3OX4A 2XUAA 5JO9A 1EPUA 2NXNA 1X1TA 5L7WA 4XFDA 6LDHA 3RFXA 4Y2PA 3HGTA 1E2NA 1KTVA 2B35A 2BFPA 1BHO1 1Q7CA 2FZ5A 3EZ2A 3NNSA 3OOJA 2XDQA 3ZWQA 3X43A 2VCYA 2MJLA 1MOQA 2VI5A 3MCVA 2AXPA 2ZCUA 3UHOA 3LQ2A 3TUIC 1UK7A 1XYYA 5L7TA 1H6CA 2VF2A 4F4IA 4G4JA 1NYQA 2H2FA 5A05A 3KTOA 4M0PA 3W04A 2ENUA 2IXDA 3DL4A 3WIEA 4A6PA 1XB2A 4NABA 1T0BA 4QOJA 1AN9A 3T35A 3WOVA 3HWX1 1ZXLA 4PZAA 4S05A 4EVIA 1ZI6A 1JWAB 2XBUA 4XCXA 3P52A 3G6WA 3LDUA 4KXWA 4I9GA 2M1XA 2IS2A 3L0SA 4RD6A 1OFUA 3OMLA 4DJAA 2RSLA 1CQIA 3ICVA 1E20A 4FEYA 4LZJA 3ZGNA 5CXUA 2OECA 3TDKA 3DO5A 3J80A 4P5EA 1DEXA 3LG2A 2B8TA 3DKPA 4UUBA 3MW8A 3U49A 4KXQA 5DNCA 1BXGB 1O95D 3HWWA 3UAVA 5K8VA 2VTDA 1IOLA 1VHJA 4HQFA 4Y9RA 3TF5A 1T1JA 3QPBA 5HWSA 1EK2A 4DRZA 4LY9A 3G8YA 5EJ2A 3PEEA 1MXFA 4QXOA 5TF0A 3ZD6A 2V7VA 1NUAA 1DV1A 3IERA 4B33A 2GCEA 4LQDA 4OHWA 4ZXFA 1XEWY 1QHHA 1OB2A 1ZJ5A 1RQXA 2FW8A 2AYZA 4S0ZA 2H9YA 2QNBA 4L50A 1MW9X 1JSRA 2JI7A 2PLFA 4ML3A 1QG6A 5I01A 3HKEA 4BNMA 3A4LA 4RBNA 1VG1A 1F2TB 2CYBA 2GWHA 3HO8A 4CMGA 5KJCA 2JD0A 2P9ZA 5IXSA 4NZ9A 1KAOA 2PUTA 3TSZA 4K9PA 1EE2A 1P6QA 1SU8A 4D98A 4W82A 1RADA 2EQ5A 3OJWA 5HNKA 1DQSA 3BD7A 3AKEA 3HUFA 4Q4HA 3R7SA 1A04A 1GQRA 4FHFA 4BMVA 3E58A 4P22A 2Q6VA 1O8BA 2CMFA 3PQ5A 4KXYA 2O9JA 4FGZA 5IVKA 4LHXA 2VHVA 1HOXA 4GUAA 1FS4A 1Q1GA 1M83A 1VSQA 1IN4A 1JYEA 1R6AA 4FFBB 4RD3A 1IZZA 5FL3A 5ALRA 5DB4A 4IOLA 3AUKA 4MK4A 1DXQA 5AK4A 3UUWA 1Y8RB 2DP4E 2JI9A 4ADSG 4EG5A 4Y2VA 1WTCA 1E2KA 4XM0A 5IFKA 4GC9A 3PS9A 4FYVA 3FF4A 5D6OA 1BHQ1 2NT4A 2R7AA 4QLBA 3AT1A 3EXHB 3CCBA 4NCHA 1F8UA 3RUIA 5CU7A 2F1JA 3E9MA 2J9FB 4DA9A 5B12A 1KVRA 2RD2A 1OLSB 3MOIA 3Q87B 3E48A 1SGWA 3Q7EA 1ZD2P 1TZMA 4MDEA 3PXEA 1VMKA 2JGAA 2DQZA 5KSPA 2GDJA 1FDIA 1Y8AA 2I5PO 2C9OA 4EKNB 3Q2KA 3RI3A 1U7WA 4QPZA 5DXFA 2A78A 4EKIA 3ETEA 3GCZA 1TC1A 3OEHD 4IUCS 4EA7A 3D6FA 1P6UA 1C9MA 3C24A 1UPFA 3LLSA 5BV1A 2FE1A 2O1WA 3PPWA 1BJTA 4YO7A 4RVHA 3UAOA 1IQUA 5E4FA 3CZCA 1U5BA 3UOWA 5JLJA 3T3OA 1C3VA 1CZHA 2SKDA 1HE1C 4QYSA 3U1VA 2ATEA 3TXYA 4CJXA 3WQRA 3WFIA 3TX6A 4RDXA 3AEKA 4JZKA 4G0WA 1SAYA 5JG7A 3PHBE 5JFTA 2K4MA 4MMZB 4YT2A 2P9TA 3ZQ4A 1UJBA 1M6HA 3H5RA 3A6LA 3BRSA 4LRQA 4P7FA 3BBPA 3KTAB 3NBAA 2UUCB 1V43A 2OB2A 1MO3A 2CD7A 5DYYA 2QB5A 5TIIA 1CNFA 2IHUA 2QX9A 3LSTA 1JRLA 2OOSA 1YA6A 1S2NA 5H81A 4N5NA 2WNHA 3UW1A 2KE5A 5BSUA 4H4DA 3E9ZA 4K6KA 3NTLA 4QTYA 2QX4A 3PXDA 4MZXA 4JLNA 2FSPA 3KJQA 4XJTA 3O8CA 4YMLA 1D2EA 4F4JA 2C4MA 3HM9A 2YXNA 4JA2A 3L8GA 3WTCA 2C4WA 1JI0A 3CE9A 4HNVA 5IVHA 3RAFC 4ZQIA 3ZUGA 1CJUC 3QJ5A 3DEYX 2QF7A 1IOZA 3IP8A 2MHCA 3ILVA 4ALKA 4J0IA 3OA0A 3VR6H 1W5BA 4BMYA 3SFVA 2HA3A 2WHRA 3W5DA 4PNHA 1IY9A 1E8NA 3OHSX 1EFCA 2AR9A 3C39A 3FF1A 2P30A 2P9YA 4CCYA 3JQQA 1N7HA 3A6DA 3B5IA 1P2UA 4JLWA 3FNRA 3V8PA 3OBIA 3TL6A 3EQ6A 4HD8A 2A9KA 4XUGB 3SMVA 3L0CA 1G0NA 2GN8A 1TOAA 4UBNA 3N76A 3QJYA 5C5EA 4GWLA 3TW4A 4MUEA 3ZCSA 3CCCA 3H2BA 4PYIA 3REQA 2H2DA 3RSHA 2ECFA 1M1YB 2EOAA 4LSMA 5TGDA 2NU8B 3RABA 1FY2A 4NY1A 2FUG6 2J9ZB 5ICMA 3EVNA 3JD1A 3LKZA 2IPOA 3QWAA 1RXCA 1K0FA 2V1XA 4I50B 5JSYA 4ZV7A 1A2BA 5FWNA 3DMFA 1BN6A 4HRYA 2DYKA 2Y0DA 4MUIA 3G8AA 1J99A 4BX3A 4BXOA 3C8DA 3L4EA 3UHPA 5C5CA 4MQ5A 4WZBE 2GKOA 1EE1A 1A72A 2J33A 1A7KA 1BEZA 1CF2O 1J1IA 1SXJC 3FJ1A 4YJHA 4KK4A 1P62B 2W83A 4O6VA 1XT6A 5LBTA 4H1TA 3PNPA 4EF6A 2C5SA 3L46A 5LZ5A 4ILEA 2P1RA 3UQZA 3KOZA 2FZCA 3NKLA 4OXXA 1E9AA 1PR2A 3QELB 3WAKA 2YOGA 3DLIA 2PNJA 4GSYA 3ZE9A 2DRIA 1KMIY 1GADO 2LV8A 1W4RA 5AIAA 2QM0A 4BNXA 2YX1A 2FQYA 4IJKA 2Y0PA 2F1IA 3QPVA 3A6PC 1A9SA 5T4FA 3AVVA 2WJHA 4OQYA 3D3KA 2KQUA 4K3UA 3DL7A 5JBNA 5KNLA 1MXHA 3JQBC 3N6VA 3IQZA 2X8JB 1JR3D 4I4TA 4G1CA 5BW8A 2PUDA 1PZEA 3C1UA 3GR6A 4EG4A 4PNEA 2E9SA 3ZC3A 1ZN9A 5THQA 3UV3A 3DCIA 2DBRA 2J87A 3ZDRA 3V33A 4G97A 5IJ0B 5LOVF 1IH8A 1ISRA 5AO9A 3I05A 2QX7A 1P2TA 1J8FA 1MRZA 3MCTA 1MRSA 4RPGA 1X80B 3EUEA 3NBZC 4TKUA 1WUIS 4OLAA 1DQPA 1G8JA 1GU7A 1V5IA 4PPGA 5EG5A 3DYVA 3L7MA 5CNMA 4ZCPA 3LX4A 1QR6A 3L9XA 3T3GA 5KQRA 5B3KA 3EIEA 1J90A 2IV7A 2VHEA 4GDFA 4TYMA 1BH2A 4B6JA 4M9SA 1A95A 2JD1A 4L6AA 5C2JB 1WHSA 2X0KA 1YQXA 2VNJA 1CUVA 3PB3A 2OPBA 4MW7A 3NHPA 4WZBB 4UNNA 5EPEA 3V80A 5ADVA 5JQGB 2VAVA 4U2GA 4B5LA 3O4RA 1TVKA 1TCUA 3M81A 2D7CA 1RYDA 1G9SA 4AIRA 4WXRA 3JZMA 4NLLA 1LNSA 2JC3A 4U6QA 5GY7A 2FR1A 4Q9AA 2HMVA 2VUTA 7YASA 1N2IA 1WTAA 2YC4C 4O4HA 1QVZA 3B70A 2Q9AA 2X0FA 3VHRA 5JASA 2OXTA 1SUFA 4D42A 4NNOA 3E1SA 4OSOA 3MWJA 5AOCA 4ZCIA 2B94A 2BTOA 2ORED 3JWGA 3K0CA 3LBNA 1HA3A 1IJKA 4JYCA 1Z4IA 1Y1PA 3JARB 2OCBA 2OORC 4G0PA 1RLOA 1GNSA 2ZIZA 2EGGA 2R68A 2CVFA 1RJ9B 3A0RB 3VMFA 4REOA 2CCKA 2WI8A 4BYGA 2R97A 4P7GA 4WCFC 4PNPA 1THMA 1QHIA 2R1VB 4QEDA 5FWYB 5A3SA 5KI6A 4DILA 2HIHA 2R66A 3RSGA 3ZE6A 1OTXA 1REQA 4DDKA 5EJ4A 1YH3A 1ARZA 1C0IA 1JIKA 1RYMA 2Q1SA 4GD3Q 4WMLA 5JRJA 4LZLA 2FSHA 1XAHA 2VLIA 2X8BA 3BHMA 2QTHA 4L0QA 4CKWB 3ZE0B 3GBSA 3IELA 1ZY2A 4JGGA 2DPGA 2J0SA 1PZMA 1MB0A 3I32A 3QFCA 4PEVA 3ISVA 1G20E 3Q11A 5IW8A 2WFMA 3L0BA 1ZN7A 1BFKA 3WYDA 4Q3CA 2C78A 4DGSA 4KGDA 5ERYA 2FCRA 1G4HA 5EMLA 4Z1MD 2YDYA 4KAXA 4CLOA 3P4YA 2QQEA 4ENRA 3CBGA 2RHHA 3A6JA 4JKOA 2OZPA 3HKCA 3STXA 3LHDA 3SYMA 4D9KA 3U7GA 1F4PA 3LOUA 2EEPA 3RT1A 2F7SA 1MG5A 2DPLA 3LA8A 1M0WA 4BQFA 2HR1A 1F5NA 1N5MA 2HGZA 4CTNA 1XQ6A 1GSHA 1G21A 2CMKA 3HYSA 3P5SA 2Q3BA 3JATB 5CDYA 3IV6A 2VPXA 1TKBA 1WF3A 1ZLXA 3GT7A 1I2ZA 1GUBA 1VLVA 2BM0A 2ZRQA 3VO9A 2GXAA 1L4KA 2P6UA 2PZGA 2QSZA 2VTKA 1QC5B 1K8ZB 1MABB 3ORSA 4M0FA 1YVRA 5TMBA 2R4TA 2P62A 3ON5A 3K0KA 1CIVA 3GPCA 3WYGA 4LYEA 3KKLA 3AKYA 5DTQA 4AW9A 3GLTA 1KZ1A 1W8DA 1Z5UA 2OHOA 2WRZA 4XX0B 5F3RA 3SN6A 4XD7D 3WISA 3J7TA 3CNLA 1EEHA 1K75A 3DBHB 2AOXA 3I2GA 4HBGA 1SQ5A 4GECA 1GQYA 1XCPA 3R1IA 5HDBB 4FLEA 1XRJA 3KZ1E 3T3DA 3WTBA 1N34B 1M2VB 2YNMC 4XWAA 3HCAA 4JOSA 3R76A 2PT6A 2P2SA 4DEXA 1U3FA 1G20B 3L2OB 4BMXA 4MJ3A 6AT1A 1L7VC 4DYVA 3OUZA 2BFBA 4Q7QA 2IIQA 1IUNA 1DTWA 1NBME 1W94A 3P9SA 4HUQB 1B42A 3AF2A 3E3LA 4P9NA 3RF7A 1P5RA 4GYJA 3WGHA 1Z6QA 1I7SB 3AVTA 4XLLA 1KY5A 3FMIA 3I01A 1KJZA 1R16A 4LWPA 4F3CA 3TDMA 2GILA 4B85A 2QIOA 3VC3A 2C99A 3PRYA 2HK8A 2ZS9A 4DARA 1O03A 4LV8B 3KR1A 5D1HA 3ZOZA 4X1IB 1XOIA 4I14A 2OESA 5YASA 1CF9A 4QYWA 4C2UA 5KOHA 3NDBB 5K0EA 3UMFA 4S2UA 1Q0QA 3LPCA 4EO7A 1ZWLA 2C9BA 5TNXA 4IVPA 3C15C 1WVIA 1TIKA 5K8UA 5DJ5A 4FFNA 4XD2A 1L7XA 2ID9A 2ZI9A 1E9DA 3VOTA 4GX5A 5ELMA 4ZT4A 3DTVB 5IARA 3T99A 4ICIA 4XDZA 2Z5FA 2QRJA 4DIBA 2Q6IA 1J23A 4YK7A 2IYLD 3EXAA 4IUYA 1QS0A 1CYDA 3PXCX 4RKWA 1A82A 1I7QB 1L8QA 2AG8A 1RBMA 1TU4A 3HP4A 4N18A 1D9XA 2JLYA 2VHZA 1ITZA 2HHJA 3ZHTA 2ISQA 4CHGA 1DRUA 2FSFA 2HCFA 4JCOA 5EKUA 1YK0A 1F1JA 3L0OA 4MR8A 5CVCA 3ZLTA 3AH8A 2B37A 2YJ4A 2GTPA 2FB9A 1IPEA 4KBYA 3GRUA 5H68A 1TQ8A 4D4KA 3EOAI 2HX1A 3BE8A 3ROXA 2MR6A 1HBJA 2QTLA 3WLRA 3F6EX 2W2PA 3QV2A 1YB1A 4C0WA 4GXTA 5JJ5A 4MYSA 1KMQA 2RK4A 3W5HA 2C4HA 4Z3OA 1EGHA 4OYRA 1NJGA 2PRIA 4GZ6A 3SVTA 3RU9A 1ZD9A 4BZXA 2QD3A 5H83A 3WLJA 1IXYA 1Q0LA 3CX7A 3GZJA 5JZOA 2JS7A 2G0NA 4XGNA 4PSAA 2FWAA 4BFZA 3EPLA 1YBFA 1BU8A 5HPYB 4V0QA 3LE8A 1DEHA 1G16A 2P5YA 1X39A 1D04A 3C1TA 3PICA 1IHYA 1KSHA 2HF8A 2JK1A 3A6FA 4MV9A 1GGFA 5EFOA 4EHAA 3W8DA 3UBTA 2BBSA 2HHCA 2IEGA 4OQEA 4WD3A 4DCCA 1KSFX 3IRVA 3AETA 3QG1A 3MS4A 5EN4A 5EIHA 2MYUA 1CJTC 3ER6A 2GR9A 4FCCA 4E11A 2W9XA 1GFWA 2WWYA 2QRKA 2Z43A 4J3NA 4JLJA 4M0LA 4MIKA 3UJAA 2QN7A 5JAQA 3WGNA 4TTVA 2VRCD 2YW2A 5COAA 1WDKA 1F4LA 3TTSA 2ZRBA 2E6UX 3CX8A 3NX4A 4JYBA 5DBGA 2A9RA 3N8IA 3S1AB 3UAZA 3P2JA 5C8VA 5L4NA 2DH5A 3MPOA 2GXQA 2C3YA 4M7WA 4CR6A 2G5TA 4FCTA 5GM1A 4DLNA 4EHNA 1SXPA 1O4WA 2QJRA 2PG3A 5LYJA 1WCIA 3PPVA 1AHHA 5BWCA 4QREA 3OZCA 3QPCA 4HNUA 2R96A 4OYYA 5LFAA 4A2CA 4FHCA 4RD4A 3C1OA 1VE1A 3BTOA 4WL0A 3B2NA 1GPYA 3I23A 1XVLA 2O3SA 3C4VA 3P7MA 1XZHA 3FDIA 1ZUWA 4RFSA 2IS4A 3PFWO 3O4VA 3OCVA 2PDAA 2OBMA 3B9RA 3OZAA 4FDAA 4C0XA 4BNVA 1GARA 4O4LB 1HDRA 4RVOA 3HADA 2O8CA 3GJ4A 1GV1A 1V1MA 4MA0A 1Q17A 2KSQA 1CDEA 3K4HA 1JJIA 4GQBA 4MVCA 3E4CA 1M3SA 4XPIB 4HB2A 2OCPA 4PW0A 3E8XA 3KFXA 3UJBA 4D57A 5BW5A 3QTTA 1O6ZA 4MAAA 1I94B 3BK7A 3AGQA 3JAKA 3RRZA 3L7IA 3U81A 3RRBA 1N9KA 4I6EA 5AKKA 4DPLA 2R8YA 1ZJZA 2QRQA 4DBZA 4V03A 3GFVA 3KZOA 4CEJA 5DK4A 2C1EA 1Q7GA 1XZBA 5MHTA 2JJ1D 5CG1A 3CR7A 1GGKA 2X9NA 3LCUA 1ABEA 1EX9A 3O4HA 2E5WA 3E3AA 4EGFA 1L5KA 1C8VB 1M2FA 3EBOA 5BWNA 4Z4EA 2ONCA 3LT1A 2QP4A 2QZSA 3K8YA 1WXXA 5FUVA 1CULC 3D6HA 2B7LA 1GPKA 4EKYA 1ENPA 2MIIA 5TC4A 1E5TA 1DBWA 1JLLB 2Z4RA 3AUYA 3NIWA 3K53A 4QFCA 5H3HA 3FPKA 2XDYA 1O8CA 1KNXA 1EFKA 3M3PA 2V54A 2YRWA 2OVBA 3SE7A 1Q1EA 1MEOA 1WW3A 4H1UA 5HX7A 1H2YA 2V3WA 3G0DA 1JFTA 5ECGC 1ETHA 4EW2A 3KSMA 1CE8B 2BTQA 6GPBA 1DC3A 1F51E 1RWWA 1U9ZA 4BLWA 3OF3A 5DM60 1UJMA 5TJHA 3QVJA 1KU6A 5K6AC 2F64A 2PV0A 2VJNA 3DBVO 4N0DA 5BUQA 1IZ7A 3UC5A 3RG8A 2NU7A 3C6BA 2H65A 2ZJOA 3O31A 2JCVA 4RY2A 2QBYB 2XXAA 2HZBA 3DOJA 4LZNA 2JLQA 2H3EA 3S99A 4EZIA 4YLYA 4XI9A 2YVUA 3VDMA 2ZRHA 3H8JA 3OZWA 4LZOA 3THOA 4BMSA 3ZJUA 2C9ZA 1Y5NA 4HF7A 1YCFA 3BBLA 5E7JA 3LQQA 3G0IA 5C53B 4HFRA 2C2MA 1E9RA 2XY4A 3O83A 5A4DA 1XKQA 5F4ZA 2J9YB 4ZEVA 1BMFD 3C8HA 4C06A 4DRXB 4R16A 1ZZEA 3B85A 1ICIA 4MV3A 3EC2A 4CMJA 2B3TA 4FSHA 4EB6B 4CL0A 3MJHA 3RC1A 4CKEB 2PIDA 4O4IA 4BFSA 1T3SA 3V7UA 4WJKB 2OXEA 1V7PC 2EKBA 3JVDA 4PPYA 3I6YA 2V6FA 3JAWA 3IH5A 4FZ5A 5CT6A 3E7DA 2VJOA 4B6GA 1SELA 1YMUA 1Z9BA 3ET4A 2OUIA 4JXKA 3RVMA 4F9EA 4FFWA 1BX1A 4GRIA 4RTLA 1DC6A 1O4VA 3WNCA 1UJ5A 5JD4A 4CLRB 2PMWB 1KJIA 3ZHQA 4O59O 4M87A 4XM1A 5DF1A 2ZJ8A 3WRYA 3ETGA 1G7SA 1UMBA 4R1UA 2FV8A 3O26A 4RJJA 3T7AA 2IWHA 5A0VA 4PBRA 3EIHA 3QF4B 5BOVA 1V8PA 4TMZA 2XQGA 1YULA 1OBVA 4GXRA 1SUAA 2P9CA 4CHTA 5BSEA 2IHKA 4EY6A 5A5GA 1TLLA 4PRLA 4JOBA 4CIWA 2HEGA 4C6RA 4CG0A 1JZSA 5BWOA 4LY0A 3H1GA 2DR2A 1EVJA 1I5RA 1X1RA 1ZH2A 2C29D 4BU0A 4R1SA 5KNCA 3VKWA 3BD6A 1T4MA 2HZ7A 4AJOA 5F4BA 1QHFA 1SOAA 1Z5NA 1PT8A 3OPVA 1TCBA 2I0FA 4TYYA 1V5GA 3EGDB 4LJKA 1XTIA 1T5BA 4NG4A 4FU0A 1JFFA 2IX3A 4N1AA 1SK8A 2YZ2A 1CKEA 1YR8A 1LF5A 1HYHA 3BFXA 4Q6BA 1P8JA 2I6FA 3R5XA 2RIPA 1V8FA 2ERYA 2Y1XA 3RTEA 4BO8A 2IHNA 2V3VA 4HGRA 1J1UA 3DZ8A 1R0WA 3KAPA 3FJOA 5K7SA 4U00A 3GLQA 4HGQA 4NRDA 2GKGA 3FCYA 3P9IA 1O5IA 1E77A 1MORA 1SVOA 2IE0A 3ZDXB 3P2IA 5JAHA 2R6JA 3P0HA 3SR0A 3WHKA 1WMDA 4L5AA 4UDXX 2Y67A 5A5EA 4R6XA 4YVFA 1RYNA 3OIVA 3T15A 2AD5A 1II8B 1ISMA 1ZOLA 1J5PA 1N5DA 1U8XX 1IIRA 4YV2A 4KX3A 4IHJF 4NV1A 2VP2A 1EQAA 2A2ZA 1OJ7A 1FFCA 3LX8A 5P21A 2VDWB 4IQ0A 2AZMA 2JCSA 3VH4A 1XQXA 2EL9A 2PGOA 3BA6A 2D6FA 3VVLA 4R84A 4OKSA 1Q7EA 1JEQB 3G2QA 5TDHA 1RKBA 4BQQA 5LU8A 5ICFA 1HTWA 4YC7A 4A5OA 2PQ6A 1K27A 4EMUA 2GD6A 3G0HA 1E2BA 2Y6VA 3OJOA 5HP4A 3NUZA 3ACDA 5B1HA 3LGXA 3W3ZB 1A8SA 1FYEA 1MDBA 4EX7A 4JYMA 4ZI3A 1G7TA 3HS3A 4KI7A 1AH2A 1E1CB 2WJAA 1PP4A 5A9RA 4IINA 5BWBA 2A0WA 3DH0A 3NHAA 3QLTA 5KSZA 4BQIA 5DCWA 4AZWA 4RIIA 3AW9A 3NHZA 2OFOA 4M7OA 3HJTA 3TB4A 1ZM7A 3ZBTA 1Z0SA 3K2IA 1UWKA 4Y0AA 1Y80A 2OMKA 4FGJA 3UJ7A 3H6HA 4R3NA 2Q1XA 3BB4A 2Y2UA 1AKEA 4MKZA 3BYZA 3TSAA 4PLPA 1VSVA 3CWQA 3PEUA 3R7WB 4O4LF 3DL2A 4HAVA 1ZUNA 4B4WA 1S2GA 2BN4A 3SLKA 1PYOA 1ZH4A 1J2UA 4WXMA 2O23A 3I61A 1HNZB 3O90A 1Q91A 3B7GA 2VHWA 3H2KA 2LR0A 3ENWA 4MP8A 3TCXB 4KL8S 3IL2A 3ICOA 3U09A 1EGAA 4F3TA 2BEKA 3LLMA 3AESA 3JYPA 3RASA 1EK1A 3VGJA 3A11A 3VAYA 2PXAA 2J7PA 2JGIA 1C3OB 3D2AA 1PK7A 3ISTA 3LUDA 4G5QA 1EZZA 2BBWA 4OXKA 4OMFG 1EHYA 4AZ3B 4COOA 3SC6A 2XCRB 1CR0A 2GCOB 4QSHA 2BUAA 4RVGA 3MWGA 1GKUB 4YY3B 3ENKA 1R9JA 2A8YA 4JJFA 5CFZA 3M4JA 1CD5A 2C95A 3KV3O 1LGYA 4GFDA 4CT0A 4YV7A 4C9BA 1FJ2A 1H42A 3GAFA 1OOEA 1IJEA 3GFTA 3GELA 5CUQA 2AZ4A 2P1ZA 2VZEA 1RU3A 2OCLA 4Q05A 4FDMA 4RK4A 4PHHA 4JL8A 5KQGA 5LQKA 2HWWA 1QDLB 3AKDA 1GFZA 4ND5A 2YZKA 4JLOA 2PX2A 3PUJA 1GPMA 1NX6A 1T24A 1YXMA 2E37A 5JDCC 3SLRA 3QVWA 3T1HB 2RHDA 3V5NA 3L8CA 1Z74A 2I3BA 3PZBA 4CW7A 4ED9A 1TF7A 4FQ5A 2O3UA 1XALA 4A5SA 1ONOA 1OU4A 5CTAA 1FZTA 2QQFA 1XZPA 1Q7BA 3S55A 4QUHA 1T0IA 4DLTA 1Q0PA 5LZ9A 4HG2A 2QAIA 4B3DA 2V7QA 1A4IA 3DO6A 3GNTA 4GYKA 4X7PA 3I2KA 1HDOA 3CINA 4RW0A 1Q77A 2V9PA 4EJFA 5HCUA 3ANXA 4TTAA 1OI4A 4YFYA 1I30A 1F0YA 3DBRA 4Q7LA 5EJMA 3GVPA 4BFCA 2CNOA 2VH1A 1UMDA 2B8NA 3OLQA 1ZX1A 4FB4A 1N25A 3IBSA 2VUSA 2Q0XA 4JU9A 1DU4A 5KYNA 2RG7A 3S6JA 1ADBA 3SMQA 4YMTA 2F9MA 4YB8A 3R74A 1YFKA 4OHYA 1NG9A 1V11B 3BXXA 4J9UE 4TQAA 3B3AA 2BHLA 3AB8A 2W2MA 3BMQA 1KVUA 3UATA 1LUAA 2H1WA 2AXQA 2CHGA 3BUSA 1DAHA 1PW5A 4CQMD 4MLZA 1IY8A 4FMDB 2V03A 2WW8A 4Z2AA 4C2TA 2ZUWA 3N2YA 2IU6A 1P39A 3R24A 3F74A 3JZFA 1P5FA 3S2GA 4N3NA 4RZ3A 4AC9A 4CT4B 1KDRA 2W11A 1R10A 5AUNB 2BR4A 2FEOA 2IUFA 1BJKA 1VBFA 1AS0A 2AFIA 3NGLA 4RF5A 2XOKA 5DBIA 3X44A 4OXIA 4C4SA 3R5TA 2VATA 2ANBA 1SO8A 2AKYA 2JHFA 3NIGB 1Y6GA 3QBTA 1OH8A 2C03A 2VFAA 2ONYA 4NC9A 8GPBA 1QZTA 2QZ4A 4C1BA 1J7JA 2OFFA 5JZVA 2RI0A 1KQGA 3DFUA 4LJ8A 3UV6A 3JQAD 3NR2A 4F56A 3VV3A 2ENWA 1NXVA 2HA5A 4ZU1X 1GTMA 1RYEA 3E2IA 3BE5A 3PDUA 4C01A 2XTNA 2A9VA 2ETVA 1GEGA 4L3WA 3CNBA 3PTAA 2V9ZA 4R8RA 4DJDC 1SBCA 1FSSA 2FCAA 4NBSA 4QPNA 4QGBA 4Y0VA 1FDUA 1J9ZA 2WG0A 1B0PA 2FG7C 4ZREA 1N8NA 3BDAA 4BZQA 1U6IA 5DPMA 4GU5A 4DWWA 4E2XA 4ZJZA 2X6QA 4RGBA 1CF4A 1M6WA 1EWTA 5F64A 1D4OA 4N5IX 5EY5B 5C5IA 1VYVA 4E03A 2HMYB 4FC6A 4UVEA 1WSWA 4KZPA 5CCDA 5JQWA 1F8XA 4YR7A 4NBVA 4F1KA 4ZYUA 4Q9KA 4AZ0B 3B1KA 1TQ4A 1VL2A 5E95A 2C0PA 3OEYA 1NW4A 4LX8A 4PYOA 5JYDA 1FFAA 3V4VB 3PCXA 4L1KA 4B3HA 1E58A 1JKXA 3DKKA 1Q74A 2ZSDA 1HZZC 3Q9SA 4G0NA 4Z4QA 1N75A 1P72A 1XDSA 2CLCX 3NBYC 3V7FA 3JQ9A 1KGDA 1RI5A 2N42A 2I6XA 3HV2A 2H63A 4DLBA 2ZQ5A 2XYPA 4QVIA 2FEKA 4P4SA 5EP3A 2YHIA 3CNQS 4XJVA 5FJJA 1SD1A 1NX9A 2CMDA 2OCKA 4WN9A 3O92A 5L3VA 5REQA 2Q6OA 1KMNA 3T7DA 1MQSA 4US2R 3RQIA 3S81A 1LLQA 3DT8A 3L7KA 3W2EA 4AZVA 4X1OA 1TRKA 3R3ZA 1WXEA 3DXXA 4X9XA 3Q85A 5DTIA 4ZO6A 1N1GA 2DZDA 4OH7A 1KBQA 3RS5A 2QAGA 1C30B 2B82A 1XD8A 1NNSA 2IC5A 2QTGA 1PJRA 3H1BA 3AHHA 5J2TF 4BO9A 1Q2UA 4BUCA 2BGNA 3SS7X 2V97A 3GC6A 1JYSA 1BQEA 4OQLA 3WQSB 5KDOA 1X14A 1W36B 4L0CA 1Z45A 2RBGA 3HFRA 4YJ3A 3OLZA 4I5GA 4PLWA 1E4EA 5B2EA 4I66A 4MNTA 4HSGA 1W19A 1RXWA 4C7BA 4K9DA 4U4AA 3TJMA 5CGZA 3L01A 1M66A 2J3JA 2FZWA 4BBPA 5GP1A 2VQSA 4NHOA 4C88A 2O8FA 2EIXA 1N0VC 2FPPB 3EA0A 5EJ9A 3RBAA 4MWEA 3HO1A 4II7A 4B8YA 1PFYA 1YQUA 4HVAA 1FDRA 3OY7A 3DAFA 1ID8A 2AJLI 5CDTA 1XTKA 3PQ3A 3VR3A 2RJ3A 4OFBA 3M6UA 4TUYA 5EIFA 3QYAA 3D6NB 1CRWG 4UBMA 3ZI0A 3BMCB 3BIJA 1LDEA 2YQ5A 1KFEB 3CEMA 4QJ4A 4Y0NA 4KN5A 2QLJA 2W2QA 2HPVA 4DLPA 3LW8A 5A9SB 1P31A 3T7RA 3H7AA 4O2AB 4EG7A 4ZK2A 3RSCA 2DY1A 3D9QX 2QTTA 1P4JA 2Y0EA 5HCNA 3ONEA 2J07A 3IESA 1IHXA 1XKTA 2IKQA 5T4EA 1Z6TA 3G79A 4QXQA 4XQGA 5CXXA 3U60B 3P97A 1YFLA 1D6SA 3FRJA 3B36A 1SUDA 4N9QA 5AKGA 5EMHA 3ROQA 1EB8A 3DHVA 4NQZA 5B5SA 2AS0A 2YIJA 4DKXA 4ENUA 4GKKB 4KQFA 2QDKA 2R1TA 4NU5A 1G3UA 3FLMA 1G0OA 1CETA 4PNZA 1I7PA 2XVMA 1JVBA 2D3WA 1JDBC 3C5VA 3MRTA 1Z4PX 4HDNA 4W7IA 3WK5A 1J21A 2WVAA 3I73A 2ZJ4A 3MRSA 3NRJA 3E53A 1A9XA 3UUFA 4CKBA 2QVYX 3ZS8A 421PA 1ZSVA 2PXXA 1PDWA 4PZYA 2QSYA 2EL7A 5F51A 2HJSA 1NF8A 1A97A 3MMSA 4QBTA 1QYIA 2W8BB 3SYTA 3P9QA 1RWQA 1CNEA 2BI7A 3AK4A 4UMEA 4WZ6A 2VWQA 2P8SA 4JLPA 3W8RA 1E7MA 1JG7A 5AICA 3D6TB 4YRLA 1F38A 1XZIA 4X3CA 1AUXA 1G38A 3TQFA 5LD2C 1NT2A 4V3CA 5BRJA 4QYTA 5JCOA 1O0SA 1V8OA 1XHEA 3EZNA 3GMSA 1YV9A 2QPOA 4DV6B 4M2LA 1RBYA 4JVLA 3M34A 3HZZA 2C8LA 3ELUA 3O03A 4QLOA 1DXHA 1CK4A 5HRCA 1W6RA 2WKWA 4O0MA 2ATXA 3OM8A 3IQXA 3ORQA 3AERB 2FFRA 5KWSA 1D2CA 4FMDF 3AHFA 5J59A 3T7EA 3O8OA 2PRYA 4CDMA 2WYOA 3QBEA 3L8EA 2IDKA 3D4PA 2UZAA 3JZDA 5ALUA 2J85A 1YIOA 1YDFA 4YDRA 5A4MS 1AZSC 5EQJB 1QJ4A 3E4DA 5LL6P 3GP5A 3ZWPA 2HT1A 4KO3S 3I52A 2GEVA 2LPMA 3EUFA 2CLLB 3B9PA 4BLOA 1CY7A 3MJRA 4ITVA 3WBBA 2DKOA 1FOEB 2RHMA 3BFPA 2QTBA 2OENG 4R2XA 4KRFA 4K6HA 5CBKA 1PJQA 1ONBA 1ZM9A 1Y9EA 2AN4A 3FNIA 3I0MA 3IVAA 4EJMA 1UJNA 1SHZA 1NV8A 5CGQB 3T9CA 2D2IA 1CJMA 4MWZA 4CM4B 3P0FA 5AVJA 1MJ5A 2D2VA 1OC2A 3QFFA 4H1VA 4UPVA 4YREA 5TEWA 3U4HA 3G5MA 3R77A 1Y3CE 1L8LA 3EZ6A 3FETA 5DHRA 1JT9A 5BR7A 3ZCVA 5JYBA 3MNFA 1Y4SA 3IILA 1TJ3A 1Y63A 2VCEA 4DLYA 3FKQA 1PW7A 4I5FA 4PYQA 3S2IA 5C7LO 5JMOA 4DM3A 5CYPA 3B8HA 1Y98A 4DPMA 4UPEA 4YJFA 1QO0A 2O3RA 5H5JA 1XZMA 2VNAA 3N8GA 2K7FA 3ABOB 2G4VA 4U7GA 5I7WA 2WSSA 3ZXIA 1E6UA 4ZTZB 3HB0A 1E2QA 1GD1O 3QXCA 2JFOA 2IKSA 5ECWA 5EJEA 3NOXA 5T4BA 4UTNA 2OBYA 1PJ2A 3A1NA 2XUDA 3IA2A 5JNSA 4P0TA 1OFUX 4I9NA 2YFKA 1PLLA 3HZHA 3IDAA 2Y2VA 2ZTMA 3IMGA 2PUJA 3WYBA 4B43A 2QOEA 3OQ1A 3ST7A 1X8LA 4Q1FA 3ZHVA 1LX6A 1N2CE 1ZK3A 2IDJA 3DR3A 1IN1A 4OUKX 1WIWA 1V16A 3G2MA 3K31A 2ZIEA 1CQJB 1TEXA 3OTHA 3C5EA 3NLLA 3RHSA 2BKXA 4E94A 2RBKA 3ZR4B 1CUCA 1SQSA 1VPDA 3DJFA 3OPQA 2QRNA 5E9JA 2QQ5A 2HF7A 2ZBQA 2NO1A 4TSFD 1E59A 2ZS7A 5H02A 3VPSA 3VVCA 3EFOB 3PC4A 1KO7A 3HEMA 3OIYA 1IZYA 1L3IA 3RWMB 3EGVA 3KQQA 1J06A 2FRVA 2ZRIA 4RZUA 1V7QA 4O3MA 3MJVA 1WVGA 1Z07A 4A16A 5AI8A 1M1NA 4TZTA 3SOPA 1BKYA 2A59A 4KNVA 5AKYA 4KFCA 4ALNA 1QNLA 3QEBZ 1GUYA 4UFNA 4G4SP 4BU1A 3WB1A 2PJRA 2NVWA 5AW3A 3OQVA 4NV0A 1JALA 2ASEA 3GVIA 4XUDA 3UOGA 1L5MA 1QK5A 1PSZA 2PAAA 1F9EA 3CUEF 3UB4A 4DNOA 2HMUA 2YL2A 3DGEC 3GLUA 3WL6A 3WNZA 5LUAA 4P58A 4ZI7A 9LDBA 4JOCA 4J1TA 2J3MA 2IVFA 4PVDA 4QGSA 5JIBA 4X92A 4OHMA 4OHZA 2GUWA 4NPCA 4Z3KA 1E5XA 2EG5A 2G76A 5GV8A 4R9NA 4URUR 1WW2A 4RCVA 5M3BA 4OM8A 5CVVA 1BXZA 4AMVA 2ANCA 1WY7A 2M2IA 2W6NA 5HM6A 5I3ZA 1G1MA 4Y2RA 4ZQCB 1A88A 1QQTA 3B3QA 4LNUA 3X1DA 2JA1A 1JR3E 2IBMA 2XCSB 1ZBDA 2MSLA 4CI0B 4L5JA 3F6BX 5TR9A 2NXWA 2G28A 2XQFA 4IUBS 4R1TA 2A92A 1EX6A 2F62A 1MOPA 2W43A 4N9WA 4UKDA 1YWGO 4BJ5A 3V8RA 4S04A 1X92A 3ENZA 4O2AF 1C3XA 4R69A 5DX0A 1U1CA 4INOA 1KDZA 1Z25A 4Z99A 3GQBA 1D7AA 1W2WB 4FR5A 5EKTA 1KEEB 3HYNA 4MLDA 2ZU6A 5A9TA 3A10A 1O5TA 1TJ4A 2Z08A 4F86A 4TZ0A 5ALQA 3V7WA 2P2ZA 4Q3BA 1JN0A 3OVMA 3PNLA 2RC6A 3EARA 5DI3B 1YL5A 2P69A 2LXNA 4S1WA 1R37A 2UAGA 2CJPA 1E3EA 2HMSA 4QARA 4LUCA 3MLAA 4NVRA 5H4HA 2FYTA 5JZSA 1TD1A 3RJ9A 1GTJ1 3D5QA 4CG2A 2CHUA 1PL7A 5HHTA 3T1YB 3FRHA 1F0NA 5AJVB 1E6CA 1YDMA 1EFTA 2HPZA 2P3OA 1FRFS 3ENNA 3FMFA 3GCGA 3SVZA 3F3SA 5K99A 2MSWA 1BC5A 3CUYA 3NBUA 1H22A 1M5TA 4PQEA 4EJSC 3PL1A 2BD0A 1UOPA 2Z2JA 3TIVA 1GNVA 2D5LA 4FX5A 1LH0A 1E99A 3LH5A 1VLZA 1AGPA 2Q7OE 1IM5A 2BM1A 3CXRA 2R6ZA 4MVJM 3M9XA 3NCHA 4GL2A 4KMSA 4MPTA 3DTTA 1GDHA 4OBWA 1TUGA 4A9AA 1FS5A 1VJ5A 1FEZA 3DEIA 2C7QA 2O2XA 3QF7A 4S1PA 2Q7DA 3RTGA 5KINB 4JKIA 2CYCA 5DGHA 2OR3A 1AHIA 3IGFA 4C07A 1KO8A 1I9CA 4Q01A 1NM5A 1IK6A 1ZGAA 2VKQA 1RQ7A 1DCMA 2RMKA 1CY6A 3PQ4A 4QTUB 2P1DA 1N2EA 1B76A 3VNQA 3CVYA 1US8B 2EATA 2ZB3A 1DNPA 3SM3A 3WK6A 4M1TA 5C46F 2COKA 2FOIA 3PIDA 5FTMA 1XEFA 5CYGA 3IQDB 3VDRA 4KSCA 1FRNA 1TK9A 2J5RA 1R5BA 2OSVA 4K3VA 3ZX5A 5IYZB 4LKRA 4TLDA 5GTDA 2VJLA 1PS8A 5B55A 2CT8A 3UAWA 1CUEA 4QIHA 1GPLA 3OU2A 3ESDA 4DLKA 1O2DA 3WMEA 5ALSA 3VAZA 4HJXA 3JQ8A 4N82A 2ZBEA 5TLSA 2H1OA 2QRVA 2BF4A 5I9LA 1WEKA 2FP3A 1KQ3A 3FG9A 1NRIA 2TYSB 3LQ4A 2Z2XA 5BN4B 3U17A 4B31A 4DJTA 1I4OA 4GMFA 5K1ZA 3NT2A 2QVZX 1DFGA 2X40A 4JODA 2JEOA 1UK6A 1YDEA 3KVRA 2Q46A 4YLGA 2EBHX 1K9VF 4YAKA 2O1XA 4EYKA 2RHJA 1QSGA 4B3IA 1MRNA 2I7DA 1P4SA 3GA0A 2CVPA 1SPXA 3PRKE 3SICE 4JVNA 2X8AA 4A0FA 1WR8A 2GKSA 3GLFB 1KI1A 2PRJA 1IONA 2Z5LA 3QI2A 4H7PA 5HZMA 4CPDA 5CW2A 4EMBA 4YXFA 4AG6A 5E1DA 1O54A 5JAUA 1YAJA 3F96A 1PRYA 2GK7A 3KWLA 1HORA 1T15A 2HH9A 1XC7A 3LFTA 4DVGA 4PVCA 1JG3A 1RM4A 4CLHA 2OBBA 1QCCA 2YRXA 3PV0A 4B3BA 5LLSA 2YUTA 4JBWA 1F14A 4MHSA 4MWCA 4UULA 4M9QA 4XLZA 3FWPA 5B4UA 1J5XA 1I9GA 1N9ZA 1JMYA 2O2YA 3N2IA 3JVUA 2XCQA 5CA1F 4M6WA 2ZB4A 4UDYX 3QNUA 1P9RA 3P8ZA 4Q1VA 5EUCA 3GFPA 4ZYTA 5J1SB 2Q5CA 3LD9A 2JIRA 3NXSA 3BDIA 4AJKA 3IDZA 4UOQA 1ATZA 3M6XA 4RVSA 3ASZA 3ESRA 5BVGB 2XUGA 1QQ7A 1SOWA 5TVKA 5GIPE 2W42A 4NXNB 2WIGA 4GMXA 3JPWA 5DT9A 3RVKA 1I1HA 1BXGA 2H85A 3C3EA 4PPFA 3CRVA 4PYRA 1N2JA 1PTJC 5HRAA 2EP7A 1T8YA 3MBIA 3FOFC 3B1YA 2AQKA 4AWBA 3LLUA 2DWQA 4X8HA 2M6RA 2J9GA 4A03A 4UU1A 3HJCA 3RS8A 4EY4A 3KSUA 1C0EA 3FYHA 4ZAZA 1U80A 1Q0SA 3TIXB 2WKPA 1O6FA 4NE7A 4EHKA 1UZLA 4YT4A 3IHTA 3U3ZA 3K9NA 1LV7A 4BBZA 4HZGA 1PUIA 5KX5B 5JEEA 5HMMA 3UQYS 1P1RA 2J5QA 1KSJA 2AX4A 3H11B 1F2TA 1CEYA 4DM7A 3IE0A 3L8DA 2L42A 3N0RA 3QFSA 4IMIB 3SFZA 4BJ6A 1VJ0A 1W5FA 1KXJA 3ESBA 5E6SB 2OV6A 2PZBA 4TKVA 3TUZC 1JMKC 3HCRA 1WCV1 3KZVA 3PGLA 5B2ZA 1Y33E 1XEAA 1KEZA 2NNLD 3V1TC 4DCNA 3AU8A 2CXHA 3P9KA 2NSJA 4MH0R 1JIJA 4ZMBA 5KSOA 2NYAA 4X95A 4W5RA 5ALOA 4F3NA 4X54A 2G80A 1OKKA 1Y6ZA 4ALLA 3T0GA 4YRSA 4FFBA 4H77A 1TF5A 1CUAA 3A06A 3KPUA 4X44A 1MG0A 3WKAA 2ZR8A 2RB5A 4OHRA 1UWCA 4RTJA 2VHJA 3ZG6A 1E1QA 1ZD4A 2H5IA 4MW9A 2R6FA 5T7BA 2ZR7A 4F71A 1P9OA 1U1EA 2AJCA 3EPJA 1SEVA 1L4FA 2BRUC 5FUBA 3M6IA 3EXHA 4HAOA 1I3OA 1IAVA 2ZBUA 3H5NA 2WWRA 3AXSA 4L5IA 4L9SA 3W6PA 4EPRA 4ZHQB 3CJQA 3GJ0A 4L8YA 3W6ZA 1OLSA 1NXSA 2TSYB 4U3JA 4C0SA 1QFMA 2EZTA 4RUKA 3QP9A 4P92A 4D92A 3CPEA 1IBMB 3BZWA 3LQKA 1QB8A 3INYA 2OM2A 4Z9BA 1XZEA 3W77A 2O0JA 1JXMA 1HM5A 1RAIA 4F5WA 1QFJA 5D51S 3D2CA 3VO2A 1YTLA 4A6EA 1UOOA 3SSAA 3C3YA 2F9LA 4EITA 1XTQA 5ITWA 4JP2A 2ZPUA 4LK3A 1U2DC 2ODWA 5E7IA 1WKCA 3EZFA 3LHSA 3PBKA 1P4RA 3D7SA 5AI4A 2O59A 4HX9A 1OZHA 2IHYA 3QEJA 1QVVA 4P53A 4P3OA 1TTTA 4OBEA 4K9RA 1WM1A 2V5UA 1LJUA 1HY3A 3EGWA 2XA9A 4RD1A 4DV2B 1YF3A 1C4XA 3SHQA 1AVTA 1RPZA 1KU0A 4JGIA 4F2DA 3VZRA 2P7HA 3GOHA 3I8SA 3BRWA 3NTUA 4N3CA 3TOCA 1PTKA 2Y1LA 1U0RA 2AD1A 4ZGWA 3BXGA 4KPUA 4DR6B 1NW5A 4PYKA 2QJFA 1JDTA 3LP6A 3ZYCA 1A4UA 3KFLA 3T4XA 3M9WA 4OA5A 1URPA 3BSSA 5D00A 4D9NA 2PO5A 4YP6A 5GM2A 3WLEA 3EQ9A 1JU9A 1JMVA 4O5OA 4AF8A 2PD6A 3FZGA 4L74A 1Y89A 4Y18A 3JWEA 4PONA 1NJFA 4X20B 1YBAA 4YJ2F 3FWZA 3HSSA 3UIEA 3I2YX 4GOMD 1TT7A 2GSDA 1E18A 3E27A 2AN3A 1I7LA 4C0JA 4RTKA 1N8TA 4IXTA 2X7JA 1BA2A 1WU7A 1T2UA 1U0NA 1WUYA 2EWWA 2H4WA 3DFKA 3G5LA 3ADPA 5LXTB 4XEUA 2CJXA 2QLTA 4LF6B 2ZJZA 4NCAA 1C9KA 9ABPA 3KSZO 4UZSA 1CR1A 1E63A 3ONDA 1Q84A 2PE5A 1ZGJA 3HXPA 2V6GA 1P2SA 3T1OA 2PGDA 5I7HA 4NBWA 2XF8A 3QTBA 2ZP1A 1KC3A 4GNKA 1WETA 3KT6A 2BKUA 5HZHA 1I4WA 3HE3A 2I4OA 4JI2B 3HVUA 4K6FA 4ER3A 4MB2A 1YO6A 2GESA 3I4FA 2ZJ7A 3WNDA 4QYIB 3ZCXA 4LYYA 4NNPA 3SDZA 4A3SA 2ZQYA 5JNTA 3PP8A 3PXAA 4MVJI 1T2DA 4TX1A 3SQXA 1ZRNA 5CDUA 3D4NA 3ER8A 3B5EA 5ALVA 4IIEA 5CW1A 4ZXPA 3GRKA 4C7MA 1OR8A 1P1JA 3DVQX 1U2PA 2ZUTA 1HE8B 4Y1RB 2OV4A 1NW9B 1ZJYA 3P0JA 3RIHA 1PJBA 4GMGA 3DEHA 1WP9A 3QVSA 3KEGA 2QGFA 3OX3A 3QBJA 3IMFA 1DX9A 1T1EA 5FUWA 1QIKA 5CCXA 3BTUA 1HUQA 1M1YA 4JUFA 1NVGA 4JH0A 1U9IA 3I2HA 1U2GA 4P0QB 3HCDA 1PNQA 5JECA 4I50A 1AA6A 3ZZUA 5B57C 4JBYA 1WXWA 3ZV4A 1DRKA 2H5LA 3DMRA 4RH1A 5MGBA 2H1HA 5B7QA 1RVV1 4IIVA 1X7WB 3ADCA 4EPTA 1Z0IA 3PC8C 1N6LA 4PRYA 2YZ7A 3HMQA 1M76A 2E49A 2I9KA 2R85A 1UFQA 2BFFB 3IEIA 2ZBFA 3EXFA 1TVCA 2Q5HA 2I3ZA 3LQYA 2R4UA 3LT2A 1SHKA 2WU3A 4U63A 5C7OO 3SJCA 1AQLA 4H16A 2MYTA 1QPGA 4RK7A 3QELA 3ZTWA 4OLFA 4C4YA 2GEJA 2YS7A 4BX0A 3VH2A 4D6XA 4EEKA 3G68A 4F8EA 2HCBA 3IOEA 1W48A 4FI3F 1Y37A 1Y42X 3PDIA 5ALEA 5GGXA 1MEEA 5KU1A 3RUHA 4Y67A 4LW8A 3RYCB 1RJGA 2DFNA 5TEVA 4EO4A 2LP4Y 3FR8A 4R83A 4ECEA 3GW8A 2SCUA 1USVA 4DMHA 3K4PA 2JLWA 1ZICA 1RP1A 3PXGA 1Q2XA 5K8LA 2W4MA 4JLAA 5LDGA 5TVGA 4B7AA 5JAMA 3P4UA 1X7ZB 2YXEA 1DRWA 5T8KC 3L18A 2FF7A 2EYUA 3C3CA 1SBYA 1OILA 4GH5A 5IJ0A 2GAJA 3PU6A 5H7XA 3NBKA 2XZPA 4RKEA 1EVIA 5DNWA 4EVRA 4LA4A 3T5GA 1NC1A 4UEQA 3S8EA 4IICA 1X80A 4Q7MB 3H0CA 3ZV7A 5DK6A 1V37A 1BS1A 2VNIA 5KQSA 5IEJA 1A5AB 4A92A 3WHIA 3I92A 1U3CA 2R5NA 3K6KA 2O1EA 2FJ0A 3ZE1B 2RIRA 1ESMA 1UP7A 1PWEA 3E9EA 1MIOA 1DXOA 4GSKA 1BS9A 1PR4A 1E5VA 1C1YA 1XRRA 1Z56C 3BWVA 3EE6A 1ST3A 3ZZ0A 3MTAA 4AN4A 3I9LA 4LE0A 1KOGA 1UZAA 4V1CI 5J3JA 2PFSA 3MCZA 5HKOA 1U0FA 4KR6A 3VYSB 2WICA 3WSVA 4X5OA 2FFJA 1BWSA 3NBFA 3WKBA 1Z8DA 2JJ8A 1XE3A 1XZDA 5LB2A 3WLNA 3PA8A 1SIOA 2WV7A 4Z9XA 4ZHQF 1C4KA 5CNJA 3LPAA 5FORA 1JBQA 4TMXA 3JARA 1AZTA 3II6X 4C0BA 2XQJA 1Y1KE 3GDFA 3DL0A 1DBIA 1RJ9A 1H69A 3DS8A 3ITNA 4WINA 3EHDA 1OA1A 3NHWA 2VKTA 2YS6A 1YI0A 3TZ6A 5KWEA 5FAXA 3H04A 3T7IA 3SYRA 5ICCA 1H2HA 4MB0A 4MW4A 2ZYUX 3H1EA 2R1VA 3OG9A 4GOOD 3V8MA 4AMUA 2XCUA 2JW5A 2M6KA 5FWYA 5CK4A 1DG3A 2UUOA 1E61A 1GZ4A 1NUHA 3D7MA 1UWLA 3T4UA 1QO7A 3D64A 2ST1A 3B3GA 2A88A 3A1UA 2QTRA 3KU1A 4J16C 1P75A 4FNAA 4C6HA 4ECAA 5BXYA 4HDKA 4UFOA 2OA0A 1XTBA 4MIOA 1J22A 1X7YB 4CKWA 1H23A 1JUDA 4KE9A 4JC8A 4JQSA 1YZNA 4AJIA 3AF0A 1Z26A 3ELBA 3HR7A 1I4LD 3C6MA 3QVXA 1QTRA 2VDVE 1C0LA 4I0WB 4AJNA 1RJEA 3D7RA 1SURA 1JAZA 3KCNA 4R2KA 4Y2TA 5DBOA 2X41A 2CV0A 3RGWS 3FVTA 1YJBA 2QAJA 3S2UA 4OQXA 4MHTA 3GLKA 1PZFA 3ORYA 2G17A 4QXRA 4E32A 1D1PA 1AQ6A 4ID9A 1OX4B 1HSZA 3EJ6A 1FP4B 1VMEA 1H4TA 4P54A 3JATA 2FPUA 3EDCA 1UBEA 1BE1A 4PGGA 4MVJE 2BZSA 2ATIA 1H9CA 3K7EA 3OQOA 1H0SA 1IG3A 1M1UA 1Z5WA 3PFNA 5ALDA 4TPKA 3ROTA 2WTMA 1U1GA 3CQ9A 4HYYA 3GUCA 4MVJP 5JD6A 1DZIA 3UT5A 3VYUB 5A62A 3A28A 4DCOA 5FO1A 4Y2YA 5E6RA 2WUDA 3HJUA 3B7PA 2DR0A 3EBPA 5BRNA 1T9ZA 2Q9UA 4XX0A 1XMJA 3SIWA 4AKSA 1SXJD 5L9AA 2RGWA 3DBHA 3IVRA 4F3KA 2JLBA 4KX5A 3PQ7A 4YAEA 4ACBA 1DP4A 2FN7A 4DV0B 3GO4A 2ADMA 2XB4A 5IWCA 1M75A 4MWBA 4QXPA 3GYBA 4R3UC 4DDTA 2KLBA 5KYYA 2W37A 1GPUA 1N0UA 5E38A 3ME5A 5DNEA 5L3ZA 3KR0A 4HUQA 1E7WA 1S9DA 2VJMB 3K8OE 3NQ41 4US1R 4ZQEA 5DNAA 3CISA 3K32A 3VPXA 3K5HA 3WK7A 2EW2A 2XMCA 1WXHA 2M9MA 3GF4A 2I7VA 4HHEA 1KH1A 5LIPA 5CDHA 2EX4A 5AWFC 4DQUA 5BW4A 1H1TA 1ZPDA 4UUNA 1GCIA 1TM2A 2DBVO 2VHCA 3JYNA 1T4CA 3ILYA 3PT5A 5FQOA 4X1IA 4R31A 3RK1A 4D5EA 3EA4A 4EWLA 3HRKA 4IXNA 4NTZA 2XSZA 3E22B 3IAM6 4OQQA 1CJKC 1EXMA 4DSTA 5EERA 4QM7A 2WPNA 5AXAA 5JNVA 1T34A 1TO6A 4HNQA 4NU0A 1U2TA 4ND3A 1KR5A 3LQRA 4J49A 4KGZA 4A27A 2UUAB 3DTVA 3IP7A 2WFLB 5HE8A 1YACA 2NO7A 3RAJA 4LHSA 3NHKA 2FMUA 2R8OA 4OHKA 1EEXB 3U40A 2FETA 1D09A 2QXUA 3HDGA 5KC8A 2G7ZA 2GBFA 3AFMA 5KJFA 1KYXA 1IHOA 2ZITA 4MXDA 2Q6TA 3KQOA 4MGIR 2QS9A 2X4IA 4DDWA 4RK6A 3A36A 4D4GA 5EMNA 4NYMQ 4F4CA 3RYFB 4IEIA 3BHIA 5LNK6 3FCCA 3S8YA 4LJRA 2B5VA 1VYTA 3LF1A 3L4BA 4YV1A 4RV9A 5FWXB 1B16A 4S3MA 5B30A 1EIZA 1FFWA 3H05A 4RCYA 4AY5A 4F8JA 4Z5XA 1NBMA 5EJ7A 1QFXA 5JH7B 2ZW9A 5BW6B 1SBIA 3G9TA 2XE4A 1N1DA 3AKCA 4L72A 2VEOA 2TMKA 2ZE6A 3MINB 2WJGA 2QLBA 1LTKA 1ILEA 2FGJA 3VH3A 1PJSA 5JJIA 3HXLA 2X0JA 1HEYA 1O87A 3E2PA 3SKXA 1E98A 3AUJB 1CLEA 4P6VF 1CQWA 2IU3A 3L1IA 5TPZA 1COWD 1N3BA 1USGA 3Q7SA 1FSFA 2QYTA 4U7HA 3STHA 5IUNC 3TEMA 4Q48A 4LBVA 3UG6A 2E1PA 4AMGA 2EFEB 1M8PA 5JDIA 2XVYA 2PD4A 2XV1A 2Q6KA 4GVLA 1TAQA 1JIQA 1X1CA 1DIOB 2FDXA 4QQFA 1OX5A 3C5HA 4F72A 2BFOA 2ODNA 1T8RA 2RGBA 4HNHA 2IV2X 4EPXA 4EL5A 4ILKA 4IIGA 4EUNA 1RQNA 3D5TA 4BO7A 3GFRA 2E21A 3G2KA 2FSGA 2ONJA 1QLWA 1AOXA 1R8JA 3I0ZA 2YCLA 4YRKA 3IUSA 2AB0A 2JAHA 2Q5OA 5FTKA 5HIKA 2PKCA 1FTNA 2ZVDA 4PLHA 1XMQB 4KR2A 3R6TA 3U3RA 4KUGA 3S1AA 5A04A 1CY4A 2GFQA 3F8WA 3SX4A 1L5YA 1NR1A 3ABSB 1JHPA 2C5AA 2II6A 3LBHA 4KODA 2GUGA 4NZMA 4UD6A 5FPSA 4EABA 5KUTA 1VC2A 4E31A 4A6DA 1NUSA 5K0TA 3KD3A 1GLNA 4HADA 2WINI 1P77A 5AHXA 4XJXA 2J30A 5MN5A 4F3RA 4MUXA 2DSTA 4N8DA 1KERA 1R6UA 1P1CA 2O2HA 3E1KA 3WOHA 4V1CB 4RIHA 2BIFA 2QTMA 1RM5A 4WOPA 1VZ2A 2VEDA 3FZYA 3EFBA 3A2KA 2BUBA 4F60A 2AEMA 3AHIA 2XWPA 4YAGA 1TYEB 4YAJA 3OKPA 1ZI8A 4MYRA 1TO1E 4Z49A 4KLRA 1H0KA 1RP7A 4RXTA 1LC3A 5G1NA 1EWRA 5JNLA 1PJ4A 2XYGA 3T3HA 2AQ8A 5DP2A 3ANSA 5JNRA 5L45A 2QD2A 4HN9A 3QMPA 1WPXA 2C98A 3TAHA 4MW2A 1Y1RA 3ESCA 4BMZA 3I5UA 5C35A 5EHXA 3UGQA 5LIRA 5HIAA 4MRPA 3RS7A 4BTVA 3A6GA 1EUZA 2YNMD 1ZMBA 3CW8X 4KRGA 1LSSA 5KB3A 1YR7A 1K89A 2ZRLA 1CG6A 4O02B 3V4OA 2IYXA 4MPPA 2WP0A 4XDHA 5FYQA 2XI4A 3ABIA 1FE8A 1KP2A 2P6MA 3ZGXA 4ATNA 3JRXA 4MCAA 1RLUA 1TK3A 1ZYUA 1EM8B 2CHFA 3ZY4A 4OPMA 2IV3A 2PPLA 3MD0A 4ITRC 3ZIUA 4CWAA 4CM8B 4B17A 3NC4A 1E1LA 1RI3A 3B51X 4YMHA 1MTOA 3DP9A 4ZC1A 2WB2A 4HVTA 3FWYA 4PAQA 3E9CA 3B2EA 2EG9A 1GRNA 2YWGA 3GN1A 1QVRA 2REQB 4LDQA 1B74A 1WD7A 1Y8CA 2EKDA 4J0HA 5EESA