1RKQA

Crystal structure of had-like phosphatase yida from e. coli
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
271
structure length
271
Chain Sequence
b'SLAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAVDNAIPSVKEVANFVTKSNLEDGVAFAIEKYVLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yidA
molecule tags Structural genomics, unknown function
source organism Escherichia coli
publication title Crystal Structure of NYSGRC target T1436: A Hypothetical protein yidA.
rcsb
total genus 96
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.1.3.23: Sugar-phosphatase.
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 1rkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rkqA01
4RETA 4HGPA 2AUTA 3UMGA 3MN1A 5ALXA 3WKEA 4YCLA 4UMDA 2ZG6A 2WF7A 3A1CA 3UMCA 4EEKA 4MUMA 5IT0A 1TE2A 5AKJA 3WK5A 5ALDA 3L0BA 3TLMA 5IS2A 3KOOA 2GHQA 2YMPA 3ZUPA 1L7NA 4E88A 5ALYA 2IOHA 1J8DA 1S2OA 4UAVA 3QU5A 1Z5GA 5ALZA 4BBJA 2YJ3A 3IRUA 5AW8A 1Z4OA 2IYEA 1L8OA 2AH5A 2YY6A 2HEGA 2HX1A 2PKEA 2CFTA 5AKIA 2G09A 1N9KA 3WKAA 2YN4A 1SWVA 4BX2A 3K1ZA 4KX5A 2AMYA 4KNVA 3ONNA 2Q4RA 1ZD5A 5AW9A 4AP9A 3ZI4A 2P11A 2CFSA 2D2VA 2I54A 3NALA 4J2TA 1QQ6A 2R8ZA 5AVUA 2G08A 4YIKA 1RQLA 2HOQA 3NUQA 1WVIA 4I9FA 5AVTA 1TJ3A 3PGVA 2I6XA 2HI0A 3QUBA 1U02A 2ODAA 3W5BA 2ZXEA 2I7DA 1RLMA 3A3YA 5ALVA 3ESQA 3R9KA 2EARA 4Y2TA 4CF4A 3PGLA 4Y2PA 4UU1A 2P27A 1S8OA 2FPXA 5ALPA 3CZ4A 3R09A 1O03A 2JAOA 1Q91A 3WK7A 5AI6A 2I33A 4Y2SA 4HYTA 3KDPA 2C88A 2OYCA 3OCYA 2WF9A 5AVQA 3FM9A 1ZRMA 3OCZA 4B6JA 5AW0A 2GO7A 3GYGA 3NASA 1Z88A 4ZEXA 3MMZA 3BA6A 2OM6A 1FEZA 3I28A 2RAVA 5ALWA 5AI4A 4ZEWA 1TJ5A 3QU9A 4CF5A 3AR9A 4NWIA 4BYGA 4XPZA 1QQ5A 3ESRA 4OCZA 4YH1A 3I6BA 1ZJJA 1Z4KA 4FYPA 3F9RA 3B9BA 4DWOA 4FFDA 2FI1A 4UU0A 5AI5A 4CNQA 1MH9A 3M9LA 5IT4A 1RDFA 5ALJA 3ZX5A 3E58A 3QU4A 3L0CA 4KN8A 3ZVLA 4UAUA 3N1UA 3U7HB 3RF6A 5AW2A 5A3RA 3W5DA 1VFPA 1L7OA 4MWOA 1KYTA 3L7YA 3I1YA 5AI9A 1RMQA 4NABA 1RQNA 2ZBEA 1VJRA 5AK6A 2GMWA 3E81A 4PNHA 4HAIA 3AR8A 2IA5A 4JDPA 2EATA 2HO4A 4EELA 4GXTA 1LVHA 4HGRA 4UMFA 4H1WA 5ALQA 3DAOA 4UMEA 4G9BA 4XQ0A 4J03A 1RRCA 1QQ7A 3N5KA 2YFYA 3S6JA 4EZEA 4C4TA 2CN1A 2G06A 2WHEA 3QXGA 1T9ZA 4XE5A 5AVWA 2I34A 2WF5A 3WKDA 1XP5A 2YJ4A 5AIBA 5ALIA 5ALTA 1YMQA 1LTQA 4HGOA 2P9JA 5AM5A 1VJ5A 1Q92A 4UARA 3FZQA 3MPOA 2IOFA 3AR2A 3ZVNA 1ZOLA 1O08A 1NRWA 4UW9A 3ZW7A 2EAUA 2I55A 1RC8A 2P69A 3AR3A 1N8NA 1U2SA 3NRJA 2C8LA 1RKVA 3QGMA 4BEWA 3D6JA 5AW5A 5AW1A 3HLTA 1EK1A 4BNDA 1XPJA 1NF2A 4UM5A 5ALOA 3AR7A 2HCFA 2WM8A 4L6CA 1CQZA 4Y2UA 1WR8A 3NAMA 3ZU6A 2B82A 3BWVA 3U13A 3U7FB 2B30A 4AS3A 3EF0A 3QUTA 3WK9A 3AR5A 3EF1A 5AVXA 1J97A 2JAUA 3KD3A 2B8JA 4UMVA 3SF0A 5AW3A 4OFZA 4Y2JA 3E84A 5ALKA 4BNDB 5AM0A 3SKXA 2RARA 1RLOA 3N07A 5AKHA 3UM9A 2BDEA 3KC2A 3OPXA 4FE3A 4NV0A 5AVZA 5AK3A 5ALFA 5ALSA 3FPBA 4I9GA 5AKZA 3SD7A 2B0CA 2IOFK 4IG4A 4BX3A 2R8EA 2G1AA 4Y2XA 3VAYA 5AW4A 2G80A 1WZCA 4NFLA 2OBBA 3QYPA 4CE6A 3FPSA 1NNLA 3AR4A 2JARA 1RKQA 4G63A 5ALMA 4KX3A 1L7MA 3WKCA 4C4SA 2C8KA 1RLTA 4OHFA 2HHLA 3QU7A 1YV9A 2RBKA 1X42A 4Y2YA 4YIHA 3W5AA 2HSZA 4YCNA 2JGAA 2X4DA 3WGUA 2FUCA 4NAVA 3J7TA 5AKGA 3UMBA 4HGNA 2FPRA 1TJ4A 4AS2A 3B9RA 3CNHA 1EK2A 4KNWA 1XVIA 2W11A 1RMYA 5AKEA 1L8LA 1T5TA 1Z4MA 4RESA 3MC1A 3IJ5A 4DFDA 4CF3A 4F72A 5AM1A 5AKKA 2B1RA 5AM3A 1L6RA 3OCVA 4HGQA 3PDWA 2YMLA 3U26A 5E0OA 2MSNA 5ALNA 3QNMA 5AVVA 2FPUA 2WFAA 2YJ6A 3M1YA 5AVRA 2VKQA 2HF7A 1Y8AA 2YMQA 3ZWDA 4O8CA 2O2XA 3EWIA 3ZTWA 1RPZA 3QLEA 4JB3A 5AHXA 3L1VA 4DW8A 4ZEVA 4L6AA 4EX6A 3QUCA 1ZD4A 3WK8A 5AI8A 5AW7A 2B8EA 1Z4IA 3EPRA 2YBDA 2HDOA 3HYCA 3L8HA 5A3SA 3SHQA 4XOUA 1SU4A 5ALHA 3RFUA 1Z4JA 3FVVA 3A1DA 4OD0A 1Z5UA 1CR6A 4IFTA 3QX7A 4UATA 1YS9A 4EX7A 4GIBA 1TA0A 4Y2VA 4L57A 2WF8A 3L8EA 2FPSA 1U7OA 1RMTA 3ZVMA 3NIWA 1Z4NA 2ZOSA 1ZD3A 5AIAA 5ALRA 4YGYA 3E8MA 3IB6A 1WPGA 3U7EB 5ALLA 3DDHA 2NO5A 1Z4QA 5FP0A 3ZTYA 2FPWA 4YCMA 5ALUA 5AKLA 3U19A 4Y2RA 1L7PA 2NYVA 3P96A 1SWWA 1IWOA 3KBBA 2W43A 3WK4A 1YJ5A 1QH9A 1U7PA 1QYIA 2PR7A 2QLTA 3OTQA 3L1UA 2MU1A 3ZX4A 4BX0A 4KYTA 2NO4A 3QU2A 4UM7A 3B8EA 2G07A 3QUQA 4Y2QA 3ED5A 3L5KA 1YDFA 1Z4PX 3WK6A 5AVYA 1ZRNA 3OCXA 2ZBGA 4EENA 2BY4A 5AM4A 5AI0A 1T5SA 2WF6A 2QYHA 3WKBA 3ZWKA 1ZD2P 3OCUA 1K1EA 2FDRA 3I76A 2B1QA 2C9MA 5AESA 5AW6A 4BKMA 5JJBA 1YNSA 1U2TA 3SMVA 5AM2A 1AQ6A 1JUDA 5AK4A 2FEAA 3SLRA 3N28A 2Q4TA 2YMMA 2AGVA 2GFHA 4BEVA 4F71A 5AVSA 3AR6A 3U7GA 4C4RA 3L0YA 5AICA 2CFRA 2Q5EA 2R8XA 5ALGA 3ET5A 5AKYA 3OCWA 5A3QA 2C4NA 2DQSA 4UASA 2ZBFA 3DV9A 2G0AA 5AKXA 4DCCA 1ZS9A 3SKYA 2PQ0A 3DNPA 3L8GA 3NANA 1F5SA 3KZXA 5ALEA 3R4CA 2OA0A 2BDUA 3A1EA 2FUEA 1Z4LA 3ET4A 3L8FA 3PCTA 2JAWA 3N8GA 3WGVA 1PW5A 5T41A 2HF2A 5AK5A 3FGOA 2O9JA 2ZBDA 4QQFA 4Y3UA 2GHTA 2W4MA 3W5CA 2RB5A 2YJ5A 1RKUA 2R8YA 4QJBA
chains in the Genus database with same CATH superfamily
1Z8FA 3W7VA 4LFAB 2WJPA 1K6IA 4MVJM 4GXRA 3WV5A 3ZCSA 1O97D 5ALXA 3H4VA 3IOYA 1GRNA 1XAIA 1T0PA 2V5AA 4URWR 3PC8A 3B51X 1FS4A 4DRXA 4L22A 3UK2A 3WK5A 1D6NA 1EZ4A 4GI1A 3TLMA 1WPXA 2IBMA 4F45A 1GNRA 1AV7A 3KXLA 2CC2A 3W3AD 1B2LA 2Y1CA 1K7FB 4WDQA 2Z9BA 1KEZA 4TYNA 5KNBA 1W44A 3STHA 2IOHA 2UU9B 2XSZA 4PEVA 1X2EA 2LDBA 1J9ZA 1BNCA 3LC1O 3QA9A 5BVHB 1A7UA 2QW0X 5C37A 1K3UB 3UWOA 1R0CA 1OFGA 1P0CA 1C3OA 3PJGA 2FFJA 3B3QA 4MEBA 5G40A 5GIOE 4P3OA 3T9BA 4I2NA 5B7QA 2YFHA 2DCUA 3P0EA 3N7AA 4ARUA 4DL9A 4KJZA 3C5EA 4EUNA 1FFAA 4KQ6A 4F4JA 2Y1EA 1FMCA 2CJWA 5A4FS 1NW6A 5BVGA 3ONNA 4D3DA 1P3JA 4KE6A 2P9GA 4P35A 5JCOA 3SF8A 3VPSA 3DAGA 2OVFA 3GR6A 2CFSA 4CFYA 3RK0A 4Q1EA 1OAOA 1T2CA 2DFVA 1DNPA 3IBGA 4ZTZB 3GV0A 2XZPA 4TKZA 1BSVA 1H94A 4MKGA 1EB8A 3H5RA 3UAOA 1YIOA 1DUIA 2ZIAA 4GSYA 1M75A 1A8SA 1JVSA 3H5VA 3MGBA 3PFBA 4IJMA 4QYWA 1QB7A 3ETGA 3BEDA 4RVUA 2HHHB 2P40A 3EZ2A 1TJ3A 4I9FA 2AYXA 1SXJE 1ZNXA 2GAOA 2ZRCA 4HWOA 1CSEE 2PSFA 4NONA 1JKJA 3QUBA 5EXSA 4DC9A 3A6GA 4OBBA 3ZC3A 3W5BA 2HSEA 1BJTA 1UT6A 2ZXEA 3G9QA 4PG6A 2P0EA 1JG3A 4DLNA 3EH2A 4EKIA 5L4SA 2H9YA 1X8KA 1QIFA 1W88A 1TU3A 4WIAA 4HPWA 4IIFA 4EECA 1E2HA 4FJ2A 1V4NA 2FVYA 1DC4A 3SSAA 3O3MB 4IJVA 4UU1A 4A1OA 2DPGA 4L3VA 4PO8A 3ZG6A 3CH4B 3EQ6A 4BTVA 2HMVA 2ARKA 1ZIDA 5KS2A 1SK9A 1POXA 1M1NA 1N6PA 2FPPB 2P3QA 2P6MA 2PTHA 3WWPA 5IBPA 3OLVA 2LPMA 5BYKA 4AS1A 3VUEA 2P41A 4MHOA 1DAGA 3DFZA 4LBYA 4UQOA 4QWMA 3RK1A 4AD8A 1QM5A 1KYQA 2I5PO 3HXQA 3OX2A 5IM4A 2PVSA 1J1ZA 3L7AA 1EDZA 4RLQA 4M7RA 5GJCA 1F60A 1EFRA 4FDVA 4IDGA 2AA3A 2QG4A 1DDOA 3HJGA 2RBGA 2YN2A 3IQEA 1GTL1 3DDCA 4IMRA 4HX2A 1WUJS 2E6UX 1SEPA 4RGQA 2F1KA 3I73A 3LM8A 1SPXA 4MV7A 3QSGA 3GL9A 3I28A 2VCYA 2RAVA 1WAMA 1CUDA 2SHKA 2ZANA 4DSAA 5FWYA 3W2EA 4REQA 1CQXA 1IIRA 2O3TA 2ZJ1A 4NWIA 3WLNA 4B8WA 2J0UB 1NNI1 1QUEA 1X38A 3RS2A 2V45A 4DAOA 2C96A 3LXRA 2AFIA 5LZ9A 2EX4A 2OV6A 2MSEB 4IL5A 1Z3IX 4HWGA 4KK4A 4QEZA 1FDVA 2GCPA 4E11A 4RKEA 3F9RA 1HY3A 2OBFA 2WUEA 4K9SA 3SP1A 3W8DA 2O3UA 4J4TA 4ZRDA 4HATA 4W8GA 3F8SA 3TSCA 2GPJA 3VHLB 4ABTA 3BXPA 1QNFA 3PEEA 4MYCA 2R6DA 1UDRA 4L5YA 1Z15A 3ZY4A 3IAS1 3T3PB 4L73A 1NXQA 2W8ZA 4ISBA 3PK0A 1E8MA 2C4WA 3QMPA 3TQFA 3FCEA 1JYSA 2NV0A 4MWSA 3R76A 1C1HA 2ET6A 3EC7A 3KBOA 2QXTA 5EKUA 1FVOA 2Z2YA 1J00A 1E96A 2DFPA 2X77A 4FZ5A 4NG4A 1SNYA 3Q9LA 5ENZA 1JFFA 1DEAA 4LYAA 2PTGA 1V47A 1W47A 1PJ2A 5A9SA 3FF4A 1Q2XA 4NZMA 3WOHA 1FNNA 4ETMA 1AKEA 3AUSA 5CB4A 1J2TA 4PFQA 2V7QA 3DTNA 3O8QA 4GC5A 4O4IF 2XQIA 1YZQA 2H48A 3ONWA 4IIBA 3S40A 3R7BA 2QD5A 1Y6QA 4A7PA 2OBLA 1LY1A 1PGJA 1JWBB 3REFA 1XRJA 4G9EA 2HADA 1RRCA 1DE0A 1QQ7A 2CLSA 4MA5A 1C41A 4WOCA 1ID1A 3HA3A 4F8JA 4O1IA 1HO3A 1A8HA 3DLCA 3VSCA 1V5WA 3L6OO 4QVGA 3QTLA 3I5XA 4M2LA 1NXWA 3QRWA 4QLOA 2PL5A 3VOSA 3ETEA 3HR7A 3OE4A 4I55F 1NHWA 5K3AA 4YRAA 1L7DA 1M6WA 2JEYA 2VHQA 4MVJA 1Z25A 3DW3X 4RNCA 3ELYA 1UKCA 5I7OA 4I55A 1KMCA 2ODTX 3AEZA 1CP2A 3KKNA 3J7AC 3SZRA 1TA9A 1JFSA 1PEDA 2GBFA 3LCMA 5DZSA 1C0IA 1NYQA 1P1HA 2UUAB 5B30A 4FMDF 5FPPA 4DQUA 2N1MA 1H2FA 1E77A 3X1ZA 3LJKA 4JYCA 1MJGM 1T25A 3ZHUA 2I7XA 4UARA 3WL8A 5A6VA 4F1JA 5EJEA 1HNWB 1EFVA 3R3XA 2VTBB 4C7XA 3DMNA 3AHEA 3ZVNA 1X6VA 4JR2A 3OEED 5LDHA 1Q0ZA 1QRDA 3CX3A 1JFRA 3F9IA 1ACLA 4GFDA 2FLVA 5ARBA 5BWCA 4YA6A 3IDFA 2PSJA 2X9NA 1QG0A 3ZHOA 4CLRA 2XT6A 3QW2A 4YRLA 4FHCA 4FMCF 3VZPA 5JAMA 5JQGB 4CVNA 5A03A 2V3WA 3CVOA 2C8LA 3VU3A 3ZU5A 4FD2A 1Z07A 1Y7PA 2WYHA 2WFMA 1QDEA 2ZAGA 2QMZA 5IWCA 4L78A 3COJA 3G1WA 3ONDA 4X97A 3D81A 5BYBA 1IK6A 2R6HA 4HR7A 4AFNA 4YJKA 3VR1A 2A9OA 1IZYA 3DNMA 3DKIA 5BWOA 3BIFA 1DAFA 3KLBA 5B2ZA 2FFBA 3AM5A 2Q1YA 3O91A 3HNOA 2C9OA 5TEWA 4M1ZA 2ECPA 3M6FA 3SHTA 1B42A 1H4QA 5FX2A 4FM9A 3ZU6A 3KV3O 5HBGA 2ON6A 2XZOA 4UREA 5G0VA 2B82A 1S2IA 2GN6A 4B8YA 1ENZA 3UVEA 3GUHA 5JZMA 2WZQA 5F4BA 3EF0A 3DMTC 1ZGZA 3ICPA 4A8JC 4B31A 2DEUA 1FTWA 3PVZA 1RCUA 2ZBRA 1SU8A 4FEGA 2WIDA 1QFJA 3DV2A 3BJIC 3FTCA 1EBFA 3LYUA 4IIUA 4JROA 4WK6A 1G8AA 3ZLBA 7AT1A 4I6GA 2AXNA 5BVGB 4YRZA 1OA1A 4HRVA 2VRNA 2ZB3A 3U40A 2HDWA 1R6BX 3EZGA 4E4RA 1C2TA 2BC9A 2JFFA 2HCTA 2X14A 2WYWA 3ZIAA 4UPDA 4X6XA 4BLQA 1DG9A 1XMPA 2B0CA 2XCQA 1V6CA 1LB1B 2QRKA 1FFWA 1TZJA 5EERA 2QSZA 5ENVA 4DSUA 1M66A 5IYZA 5HDQA 3HKBB 3KM0A 2CLLB 4NFLA 1GU0A 4GX1A 3L0OA 3EVZA 2YIJA 2AQKA 4ED9A 1C2YA 5F9FA 4RV9A 3SY8A 4INPA 2AJ8A 3AO0B 5EJGA 2VP5A 1EE9A 3V9PA 4EOGA 2JIZA 1J9GA 3QU7A 1Y1QA 5DOVA 2XKBA 4P3XA 2YYZA 3M4ZA 4JBXA 4MP3A 1JKIA 3ODPA 3O3OB 4CN9A 4J0GA 5HIIA 3FDFA 3JSXA 2PLAA 4BNZA 5KKCA 4GO1A 2NUTB 5EJMA 3HLYA 4RS4A 5HUHA 1XEFA 3OIWA 2FSFA 2I8AA 4GVLA 4GICA 5EINA 1M0TA 1EK2A 1GPDG 4KNWA 3FKJA 4XIFA 5KQPA 3JCZA 2Q3FA 3A6JA 3P2OA 3FN4A 2GXQA 3MD9A 1KP9A 4F6CA 1RXYA 4CF3A 4D26A 2ZI9A 2J9FA 3ZDDA 4YRFA 3UJBA 4ZICA 2QSYA 5AKKA 2NTVA 3OM8A 3VX4A 5AM3A 4XOIA 3QITA 3D8HA 3BXOA 3O21A 5TXGA 4CQMD 1XN4A 1MEJA 1FSSA 4OHKA 1UIRA 4MRVA 4YAFA 1A2BA 3LKDA 3ZLTA 3QPUA 2FSHA 3WGKA 3WYFA 3P9IA 2AJTA 1EG7A 1OKKA 3AFHA 3AQIA 3HSKA 4FT2A 4KUEA 1JDVA 1TZKA 3IYLW 5G1NA 5LA6A 2FPUA 4QOGA 2Q7OE 4EHAA 1YJBA 3SSNA 3S2EA 1MJFA 3M33A 4M89A 2AG0A 5FB3A 1GTVA 4MVCA 2NNWB 1NNUA 4QYXA 1QSGA 1UXOA 1J6UA 2FWMX 3SJUA 3RSZA 4RMIA 4P83A 3I9KA 1XZHA 4UZSA 2FSPA 3ZCVA 4DIBA 3O8CA 1Z0JA 1EK0A 5B3JA 4RZ3A 1GSOA 3BL5A 4AQDA 2QAGA 5CM2Z 4EO4A 2VK1A 3A6ZA 4G0MA 3K5HA 1YRQA 1LRKA 2D74A 2D13A 1HORA 4JK3A 3TOVA 4LBVA 4S0XA 5L3ZA 4RZIA 2X1VA 4N47A 4G1UC 3V8EA 2G1PA 3DEKA 2HMYB 4I5EA 1SKQA 1T6BY 1GUZA 4A6XA 5LPNA 2IOYA 1U2EA 2DHDA 3KQNA 4FOSA 2CDRA 4DZRA 2WWIA 1U2DA 2WD8A 1TZCA 4XOUA 3EARA 3M8KA 2YDYA 1L4HA 3K0EA 1YRBA 2FFRA 4Z3DA 4DWVA 3ZHTA 2GPBA 2XB8A 3B5IA 9GPBA 1SBNE 1BYUA 2PFKA 3N75A 3KTOA 4S1NA 2VAWA 4P2BA 1UEXC 2ZCJA 1J25A 2CVQA 3FBGA 1ZCJA 4N5LA 2X9LA 2IDJA 1O6ZA 3TJMA 3H84A 2QRZA 3UTDA 5KINB 5A04A 4P2GA 3M1LA 2PJUA 1DOHA 3I2HA 4UXIA 1XMOB 4G4SP 4F4UA 4BEBA 3D5TA 1EBBA 2KB0A 1MJGA 3BGSA 3KKZA 1P5HA 2XXBA 3W05A 3QOWA 4EYGA 2V8OA 4UTPA 4TLBA 5KNDA 5ALLA 1FTQA 3IUYA 5J9FA 3TRFA 3EUWA 3PC3A 1NR1A 1Z4QA 3ESAA 2JHCA 3JAWB 3K6JA 1Z2OX 1KE2A 2Q3DA 1SFRA 4D9FA 1PKEA 3LY9A 3PBKA 1J39A 4HEA1 3D7KA 1UZNA 4TWZA 1XMJA 4PN7A 1QX4A 1V95A 1S8NA 4BMVA 2OPBA 5CNJA 5K0LA 5ILGA 5JW6A 3K70B 5ARDA 3U1BA 1QH8A 1U7UA 3H9UA 1OX4A 4QASA 4Y6OA 2CB9A 1KIFA 1QK3A 1SBIA 5BRAA 1F3OA 3KT8A 1JEJA 3WK4A 3OMLA 3VJLA 4HH1A 3CY6A 4V39A 1NBME 4M9XA 3OWOA 1E2MA 1QHIA 3KLMX 4B35A 3FH0A 3K0SA 4IJ6A 5NLLA 3SI7A 3NJ4A 4E14A 3U44B 1IBCA 3O38A 4BO7A 4QXPA 1QCYA 3L6CA 3P9SA 4HDKA 4DT1A 4R40A 4RJLA 2VWPA 4OB7A 4R3NA 4X92A 4ZDIA 4DKJA 4NU6A 1P7YA 1H1DA 1CP3A 2O0JA 3PWTA 2FZVA 2XD9A 4IR7A 3B5EA 3BHMA 4LHXA 1VYHA 3QHQA 4JY7A 3SZLA 1ZN7A 4FBGA 3OZRA 4M1TA 1TVKB 5LN1A 1G8YA 1HDZA 1S96A 3H05A 4DRYA 1QVZA 2IYPA 3R24A 4NOJA 3K94A 2ZSAA 3NVMB 3AJDA 5HE8A 1QR2A 2WMNB 5EYPB 3G8AA 4M1SA 4DY4A 1WS6A 3H4IA 4H7EA 1PZFA 4RF5A 4H59A 3QKWA 1XRNA 1IZ7A 2D5CA 2BD0A 4HZGA 1N2JA 4LNUA 2HQ1A 3EBLA 3P9ZA 1GL3A 2HFJA 4HN2A 4O4JA 2QUJA 2Q07A 4QLAA 3SLRA 3TKLA 4ETWA 1G38A 4WCVA 4XX1A 3JV7A 1B7GO 2XBLA 1U7WA 3GY0A 3WGNA 3H5IA 4U0JA 3OPMA 3TEMA 5F2NA 4MKHA 3EVAA 3KOYA 4QKQA 5AVSA 3U7IA 3GEPA 2HM7A 1XU9A 4A23A 3LW7A 2NAFA 1NW3A 2I65A 1ZGBA 3IULA 2EX0A 4YS6A 4R69A 1SG0A 4NBVA 5FPQA 3P4YA 3NBKA 3FE2A 4HXYA 1LGYA 4HLUA 3VHXB 3F46A 4RFSA 1C7JA 2BFOA 1K9SA 2QP4A 1NJ6A 4ZQBA 4CCAA 2H5LA 4WNAB 4UEWA 4MVJP 2IHTA 3W2IA 4LE0A 4P81A 4FK8A 4QD3A 5EWMB 2XF2A 3ZVKA 1I2MA 4I99A 1E1QA 3ETCA 5G4KB 3VZQA 1JQAA 3R23A 1T8YA 4QPNA 3ZXIA 4OH1A 1MIHA 3LV8A 2OA0A 1FXUA 1ODCA 2H4XA 3EBPA 3WXMA 1B26A 1G7SA 3MB8A 2XNSA 1L5HB 1NPTO 1Z4LA 3NYWA 4EUSA 4L2IB 2H7XA 1SC6A 1Z22A 1V1RA 4QYTA 4D4LA 1NONA 2Q8NA 2HL6A 2IZZA 3K30A 4TQUS 4WGGA 4DF3A 4PIMA 3VHXA 1TAHA 4FC6A 1HSZA 2ZSKA 3WY9A 1NV8A 2YJ5A 4JJGA 1GU7A 4E08A 2UXBB 4EEZA 1PTKA 4GBMA 2YDXA 1ZMTA 2O2CA 2AW3A 2Q9BA 2ZUBA 1B73A 3GMSA 3AFNA 1E2NA 5D85A 4ZCQA 4ALLA 1KZGB 3PPVA 1L8QA 1O5TA 3E9RA 3PEUA 3PVCA 4LECA 4MROA 5EIFA 5C2JB 3QNUA 2DTXA 4QYMA 3MUEA 3MW8A 1E6KA 1HLGA 2KBFA 3FYCA 4RLFA 4CIBA 3ZLJA 3TNFA 3Q8MA 5A0VA 3WL4A 2WT8A 4KYUA 5CPBA 5E1DA 3U3XA 5E3IA 1QAMA 5B1YA 4EI8A 3GHYA 3FDIA 3INNA 1FFDA 3RVKA 2ONKA 1DXYA 1UPAA 2ZQYA 3HZZA 4KBYA 2Y2VA 4JIMA 4KQEA 3K92A 1LH0A 4B75A 4HQLA 1UXIA 1KVUA 2YY6A 3ESZA 1BCRA 3HFGA 3NVKI 2BONA 2PKEA 1JH9A 1H2YA 2QU7A 2G09A 1EXNA 4L0CA 4WCFB 1N2OA 2EYUA 9ATCA 1D2GA 4L1KA 5BP7A 4WLUA 1K7CA 3KE9A 3A3NA 2AMYA 1Z5ZA 2G5TA 3QLVA 1IK4A 4OFXA 3GJXC 3OMWA 1LSUA 4EJ2A 4R8RA 4AP9A 3TBFA 5TPZA 1YI1A 3A4VA 1NURA 1WUIS 4LRSB 1N4AA 3UN1A 3ZPXA 1O4VA 1PSWA 1AKVA 2IZ7A 3BFVA 3LQYA 1Y5LA 4EL0A 1R64A 2FGJA 3FTFA 3X1JA 3CRRA 3G59A 4NU5A 1XCJA 3KJGA 4F4IA 4OTZA 2JASA 2Z3ZA 5J40A 3BTOA 1N9ZA 2J8ZA 5FI1B 4CKWB 1JWLA 1E94E 3INGA 2G3YA 4B44A 2WE8A 1VECA 3CF0A 2F48A 2FK8A 2I6XA 3B3JA 4FDLA 4QBIA 5K3SA 1U02A 4RTKA 5FKJA 3FYHA 4XIYA 5JG7A 4JX9A 2YWRA 1TX4B 1N5KA 2XUDA 1AC5A 5J43A 2G8LA 2YJTD 2P27A 2ZS8A 4XCVA 2EHJA 4XA8A 1ANKA 4M54A 1HA3A 3O73A 5ALPA 2SNIE 3CLVA 3TW8A 5MGBA 2NZUG 5B37A 2QORA 3P4XA 5E4FA 3C3KA 2OO5C 4IIVA 1E6EA 5EAIA 2WA2A 4M9SA 4XGQA 5GJVC 1H8EA 4S2UA 3LSYA 2WWRA 2NZYA 1A97A 3O84A 2OCAA 1Z6AA 2ZTLA 3IELA 4FGZA 4S35A 5HF5A 5DJ5A 2GVNA 3OCZA 5AW0A 2ECQA 1Y48E 4G1BA 5JSZA 4EGAA 1U4NA 5CYGA 2V0GA 4GYKA 4OQPA 5ICSA 1NX6A 1GCGA 4OP2A 4RWEA 1LI4A 3GP8A 4R1OA 5K20A 2HKIA 5JVDB 4X65B 4BZWA 2VPTA 3ZHSA 2B2XA 3B9PA 2Y66A 3B1VA 2YS6A 1FIUA 1DEXA 4JI8B 3B6ZA 2I2WA 4QYIA 4EKDA 1TU4A 5IKPA 2PZGA 1XOIA 2RCYA 4R0MA 2O59A 3G0DA 1C29B 4IV8A 3AH8A 4FFWA 1PVOA 5GVRA 3EMVA 4N0QA 3RFXA 1ZJJA 2XJ9A 5DLPA 1QBGA 2YOGA 4DQKA 2FI1A 2RGGA 4Q4HA 2ZIXA 2YRFA 5AI5A 4AF8A 4K0KB 3UCFA 3SC6A 2BKVA 2CHEA 4EI2A 1ZCZA 2PH3A 1LTKA 2QVBA 3DBRB 2HJVA 1X1BA 4A6EA 4QTXA 4K87A 4KOAA 5AVJA 1G2PA 2JFVA 2V7QD 5CA0B 2PYDA 1LPOA 2W8BA 3QU4A 4KV7A 1POWA 4ZVNA 2ODQA 2BW0A 4BDTA 4DJEC 3LUCA 1I2DA 2V96A 1GZ7A 1FMFA 1QQAA 1IY9A 2FRDC 1MQ8B 4L9WA 1YJCA 4C22A 1I13A 1M1YA 3N6XA 2QY6A 1GNVA 1XXHA 1E58A 1HOXA 5EJ9A 1SXJC 1H23A 3MT7A 3KQPA 2PEZA 2Y77A 5HEKA 4HO1X 1O96B 5JRZA 5JO9A 4FN5A 5AI9A 4NABA 2OCGA 1JDSA 5T57A 1TM5E 3IHWA 2WJAA 2JCYA 4J7XA 4RY9A 2BFBB 4ZDJA 1W4ZA 4UUNA 2RDMA 4IDOA 4S24A 5EZYA 1G59A 4JYPA 1GRVA 3LUHA 3T5PA 1G60A 2HLDA 2IA5A 4JDPA 3GDHA 1L7EA 2HO4A 3M70A 3UFXA 4KAXA 2L69A 3HR4A 3IGFA 1XMSA 4ID9A 4TKMA 5EXDA 1P0PA 1RYZA 1UDCA 2VPXA 3MINB 3QYFA 4Y6GB 3K8YA 1RXIA 5C4IA 4HGYA 1ISMA 2WG1A 1GZ6A 3AXSA 3T9EA 3PFKA 2Q5JA 1G291 3FSGD 3MRSA 1FNSA 4G1MB 3ZXSA 3FX2A 3OEEA 1KFCB 2YWBA 5I7AA 3WOVA 4F4CA 3B13B 3TZLA 4GZMA 3WWOA 2IU3A 5KJFA 2ACWA 3IKLA 4EJSB 5IC4A 1AOXA 2QMQA 4NJOA 1F6DA 3G6WA 4N6OA 4TV9B 5JYDA 5KSZA 1HFWA 1KBZA 3E1KA 3N7UA 4R51A 5I9BA 4D3YA 1T8RA 3IR6A 1BH6A 1VLJA 4ND5A 5A5FA 3EGWA 1Y7HA 3DMGA 4RQBA 5EVJA 1EJ0A 4WK0B 1NW4A 3DV0B 4BQNA 2BFDA 2OV4A 3RRNA 1DWQA 1ZK2A 5I9IA 1E2FA 3C7AA 4IGFA 1YZYA 4TUYB 1GUBA 1K3TA 4Y0NA 4F11A 3KUUA 2ST1A 3OQMA 1N2IA 2V55B 4UAJA 4B3RB 1S4QA 1T26A 2UYOA 3W8FA 3HCOA 1ZEMA 1I9GA 3IIMA 3HBMA 2XRZA 1JV2B 3BHIA 2IRWA 3HFRA 3BMQA 1Z13A 1Z38A 4ZZ0A 1NRXA 4OREX 2EV9A 3OZ7A 1P81A 3DULA 4B5KA 1LS1A 3MIZA 1T9KA 2E9SA 3WGJA 4ASUD 5TEVA 2IHNA 4DPKA 1Y98A 1CVIA 3H04A 3N05A 4KIJA 1EK1A 3AEKA 3ZCUA 2UYCA 4Q9DA 3PQ4A 4L4YA 5SZHB 4BNDA 2HY7A 5CYOA 1BX0A 1NN5A 2F1RA 4HDRB 4MIOA 1KI4A 4DDUA 2AOUB 5CPFA 3UH1A 4GPBA 4F60A 1WR8A 4RL6A 1JL3A 3NAMA 1TQ2A 3K7EA 3NHYA 3OZCA 2FKAA 2XNDD 1SQGA 3IP6A 4WJKB 3V5NA 2AQHA 5KSPA 2G9ZA 4IVRA 4O4LF 1KDZA 4Z0TA 3U7FB 4DR7B 1WZEA 1J1UA 4LC9A 2VNKA 4A2WA 1YRWA 2WU1A 2Q5IA 2RGDA 3FRHA 1TIPA 1OV4A 2J3JA 2RI6A 5EWJB 2QF7A 3TUJC 5KYKA 1RPAA 3WA6A 1X3LA 2DHEA 2FEPA 3NQ41 4U7FA 5CDFE 1U5CA 3MGKA 1N75A 2G77B 3G1UA 1DXOA 2E87A 4R01A 3IQHX 3AUUA 5LBIA 5H3LA 4PSCA 1SBZA 4CM8A 3K70D 1N2BA 2Q0XA 4G24A 3R40A 3TBHA 4NV0A 3CNOA 5KOJB 3AERB 2OQRA 4ZT2A 2EBWA 2QZJA 3H6GA 4P32A 3SKVA 2Q27A 2RHCA 1OT5A 1YB4A 4Z54A 4GE0A 1EFHA 4Q3AA 4HSGA 1U6JA 2B5OA 5AD1A 2C78A 3PXEA 4WJZA 1GADO 3Q41A 1IPEA 1KRHA 4WCDA 5IKOA 2OK8A 2B8NA 4M8LA 4ZGGA 1H4TA 3KB1A 2W0MA 4WV3A 3VSAA 3RUPA 1ORHA 2QGZA 5HX7A 1YB1A 2PWAA 3IUQA 4HBGA 3W5SA 3ZNNA 4IIDA 3S5UA 4KQJA 4DQ0A 5CBKA 3RJ9A 4LOAA 4AS2A 2QPTA 1N4DA 3I0ZA 3FHCB 4JDUA 3GAMA 4OXQA 4H6PA 5HE9A 4XTRA 5EZ5A 2P6OA 2XE8A 2ZYIA 5CK4A 5D84A 1LX7A 4GRIA 1JJAA 3Q0IA 9LDTA 5CH8A 1Y6FA 5CTJA 3AFIA 3IKTA 1JXMA 1TUBB 1GG5A 4TMWA 3MZ0A 3F7MA 3TG2A 1M0WA 5JS6A 4KQ9A 2H0AA 2GPTA 2V7WA 1L6RA 1JFVA 2PLRA 2QA5A 1QUFA 1R5NA 4A4DA 3QX8A 3NGLA 1IHXA 2HTFA 2JLQA 5GWXA 4J8PA 5E0OA 1Q1ZA 4XWKA 2JKYA 5IAKA 5AVVA 5CGQB 2Y0CA 1AK2A 1WVGA 1ZXXA 3A1WA 2YJ6A 1SUAA 3AGQA 3DZFA 4MR7B 1HV8A 3R1IA 5CVCA 3WAKA 4BQSA 2C7RA 1RTTA 4BPBA 4HN9A 1I4TD 4GUAA 4DR1B 3R8CA 1GGHA 2IYAA 4A6PA 4MVJI 1M2EA 2CEKA 2VHUA 2ZJ6A 3PDUA 3BRWA 4GMGA 3SXPA 3IDSA 3AB7A 3V33A 3CRZA 4M4SA 3NIDB 4ZU1X 2NU9A 4F97A 2ZIGA 3P2MA 3NRBA 4L8FA 4PPGA 3ON5A 3GNQA 3SZMA 2K7FA 1NPDA 3SHOA 3MSCA 5GJBA 4PC3A 2VXBA 1RXUA 4JSRA 3OQ6A 4ESVA 2O3SA 1QJ4A 2RD2A 3ISVA 1Z7WA 4D42A 1M1NB 5M04A 3B70A 1Y1PA 1EVYA 2CLHB 2COEA 1VE1A 3MILA 3PGA1 2O1EA 4Q3BA 3ZY5A 4TSKA 3KB6A 4EVQA 3KEOA 3DTYA 1T3HA 4DMFA 3TRHA 3NLLA 4QSHA 1LX6A 2PGXA 2OXFA 5K4HA 1W7AA 1YMUA 2UUPA 4BC0A 3CLHA 3HKDB 3W6OA 1Y82A 2EEZA 3JZDA 1K63A 2UYQA 3R77A 4BN0A 3H2SA 1A69A 1QIJA 1YVEI 4UHJA 4K6HA 3U3JA 2OV1A 1CR1A 3W5VA 3EBOA 3TPFA 3OM0A 1KEWA 1RFLA 4MV5A 3JTEA 2YWEA 2MSKA 2QGFA 2HSJA 4ZOBA 3SX4A 3PQ7A 1KI8A 2OBMA 4PYKA 3S3TA 1EMDA 3T0GA 3QV1A 2QQGA 2QU8A 5CB6A 3WYGA 5IKXA 1DEHA 2ZAIA 3KYCA 3BG5A 2RGEA 3WGYA 4FFRA 2VHCA 3H2GA 3RC1A 1SWWA 3BL6A 5GONA 4AY2A 3HB4X 2EZ9A 1FSPA 1F2DA 2FZCA 1GNTA 2OWDA 2QYTA 3ZGNA 2OESA 4EA8A 1CQIA 3LF1A 4PVDA 3DM9B 2XPCA 4RJKA 1O94D 4FLMA 1ENYA 2WU4A 3DDWA 4CYMA 2CLFB 3E0XA 5EJ7A 4KYTA 3KSAC 2GBPA 4H6VA 1GRQA 3D6HA 3E2IA 2ETVA 4KVAA 3PI7A 4RZQA 4X41A 1FP2A 4GLOA 4NMLA 1SQSA 3DM5A 3Q3JB 2FOIA 2Z6QA 3PUKA 1P45A 2YUTA 4U2EA 3RAEC 1E3IA 2Q1TA 1F0PA 4OI4A 4XUDA 5L7WA 1CPYA 4FR2A 3TXAA 2LVBA 2JFOA 4XDYA 1NF9A 5AK0A 4PSUA 3WRXC 1CEYA 2CZGA 2ORVA 1XZEA 4HT3B 4MYSA 2UZAA 3EY4A 5TY0A 5DLYA 3ZWKA 1DAKA 1KWGA 4B79A 3OBBA 1LQTA 2FWPA 5JJBA 2DHRA 2PLNA 5LVAA 2YRWA 3QW4B 4JJ6A 2M6RA 4YFYA 3SMVA 1YU6A 2H9AA 3WNDA 4II2A 2BKUA 2E4WA 4OHZA 4GM4A 3O8QB 4CEJB 2YMMA 1XTZA 2P9TA 5IBQA 1J42A 2OBXA 2AGVA 2GM4A 4WMLA 5A0FA 4CJXA 4HJRA 5TQ0A 3DMTA 2ECOA 5A71A 3MAGA 2QJTA 2SCUB 1C9DB 1G3QA 1KFEB 3LPLA 3HKCA 1Z7EA 3O1JC 4MKRA 4TXMA 5BSWA 2CFRA 1XE3A 3F7NA 4ZK6A 5HVNA 3R7LA 2FPIA 2BWJA 3A9WA 3UBTA 3RTCA 2AFIE 1WXHA 1IXYA 4D6XA 2E37A 1WULS 1KHTA 4ODIA 1HT2E 1R4MB 1E60A 1DKPA 1SQFA 3M2PA 2GBLA 3LDHA 4GP7A 5H1YA 1V8DA 1E3JA 1DC8A 1BJKA 2QRQA 1ISPA 1P9NA 2YOHA 4MEJA 4F7DA 5HILA 3GC6A 1AKNA 4FMPA 3WLKX 2JIBA 2VHYA 4U9IS 1OROA 4UZFA 3UYKA 3OIDA 2O1XA 2NSLA 1TD9A 3BDVA 2PGIA 1MR3F 1VBFA 3NEJA 1U8XX 4TWIA 2ZP1A 2V1UA 1K27A 1J90A 1QP4A 1VJ0A 5IANA 1ZJWA 2AF4C 4TN1A 4CEHA 5EP1A 5P21A 2YVLA 1X70A 1BHQ1 2IIBA 1JA9A 1LPSA 3UMJA 4NJMA 3PDCA 2HHCA 2ZBDA 1QKJA 2JHFA 2X8JA 3BICA 4MQUA 3BQMB 3MRXA 4YT5A 5ITSA 3VQTA 2W2KB 4IF6A 2B1IA 2G5CA 3ZHCA 2MYTA 5HXAA 5C1DA 2WIBA 1UADA 2NZVG 2QVZX 3ZV3A 2DAPA 4M1MA 2HUNA 3GCXA 3OZAA 5AOCA 5BURA 3I04A 4WK2B 3RHTA 5BSVA 3IPXA 2M6LA 3RYCB 3A1CA 2IYFA 3F4BA 4CR7A 3M5PA 4D8TA 3AZQA 3PQ2A 3UT0A 3K9GA 1IQRA 2A67A 2GCEA 4UE2A 1OBCA 4GOOD 3QTTA 4MS3B 3A27A 3LCRA 5KC8A 1GGMA 4I46A 1CS0B 4XW2A 4JA0A 1KHHA 1IM5A 1PD1A 4N8DA 4URUR 2J9YB 1C1DA 1Y5RA 4K9MA 1RLUA 4IDPA 4NULA 5ALYA 4QELA 4R2XA 3G02A 3ZJVA 2C5AA 3EAFA 5EJ8A 4U9UA 4HFJA 1B6TA 1U9IC 3TQSA 3SR4A 4MMYB 1NAIA 1HE2A 5FV7A 4E5VA 5MN6A 2VP6A 1E1RA 3HN6A 5CEEA 1XD9A 1GXSA 2OAGA 3D4BA 1SIOA 3P9RA 5HTKA 1P73A 3BAFA 3I0MA 3WR5A 1WKCA 1BOFA 3P2YA 1RTKA 1QO0D 4M0MA 2G9NA 2BN4A 1A96A 3QVMA 2VT6A 4HDCA 3NNDA 4PLHA 2ZLBA 5F7ZA 2XTZA 1MXHA 1TFRA 4Q24A 3WLSA 5JLAA 5JFGA 1XRRA 1MA3A 3OT1B 2P1DA 1AF7A 5A06A 2JFGA 4Q12A 5C52B 4D96A 4PNZA 1BGXT 2AK2A 2NVWA 4WRRA 3SBOA 4BTEA 4RKFA 2LIVA 5SY4A 3ORSA 3OURA 5IKEA 4BX8A 5BVHA 3CXRA 2E5FA 4G1VA 2JIPA 9ABPA 3CUTA 4DYVA 1V8BA 5JWOA 2VOEA 1FBTA 1YSCA 3E5NA 3LAWA 1RQRA 4PVCA 5CT5A 3L8CA 1NLUA 5G0SA 3TOSA 5I5EA 1LI7A 2O8BB 1OF1A 1Y8QB 2I7DA 1MC8A 3K5PA 3L1HA 2PANA 4PPFA 4TMXA 4ZVVA 1BKDR 2REQA 4OP3A 2H7CA 2X0KA 2ZR7A 4DLXA 1EUZA 2VAMA 4Q1BA 4Y2PA 5JU6A 3QEMB 5KNCD 1DDIA 2XUQA 3F9CA 4LDNA 1W0KD 1J21A 2H4HA 4MVJF 2B5VA 3ADOA 4F92B 3OY2A 1E9FA 2YXBA 2GHRA 4EITA 3VKWA 2WLSA 3E2PA 4C14A 5KOHA 1JT2A 2A9RA 2O2GA 2P8SA 2BIFA 2VCHA 3T1YB 1II8A 2X4IA 5LSAA 3Q8LA 3OCYA 4TQAA 4MTCA 5A4JA 3PC6A 3FYUB 4MWZA 1GCOA 1KY4A 4C6TA 4I50B 1NJ1A 1T1GA 3DFUA 3PNLA 1X8JA 1OXKB 1RJDA 2J9FB 2JS7A 4NU0A 4ND8A 4YHHB 2APJA 4C3UA 1I30A 1KK0A 1OHHD 1Q1NA 1UC5B 1YZKA 4NIMA 4ENRA 3MMZA 1JECA 1NP3A 1FTNA 1KEEA 2CXXA 3DOJA 1F1BA 3KE8A 2ONYA 3TL3A 3Q7IA 4D4JA 4GLJA 1F4PA 4LEIA 4WX2B 5DYGA 4UTRA 3QEMA 1SCJA 3Q8KA 4DVJA 1Q0QA 1AT1A 4D44A 1V9SA 3CH6A 3LY8A 4MOWA 3V00A 4A92A 4XGKA 2CZQA 2FYTA 3F3SA 5FFNA 5FOQA 1REQA 1V71A 4DV2B 4RGBA 1L5RA 3AG5A 2YV3A 4YH1A 3AHIA 3RSOA 1VIYA 2EP8A 1CJSA 1GKUB 3CG4A 2G36A 3DZHA 3EGXB 3A6EA 4FYPA 2D1SA 4H35A 3HC7A 4DWOA 4J3FA 1UUFA 3LYLA 4UVDA 4F2DA 2VLBA 3OZFA 4JGGA 1VCMA 4GE3A 1U1IA 2OKGA 3IBSA 2P9FA 1G8FA 3DEZA 3OZDA 4DC1A 1GPJA 4UFPA 5TGTA 1H5NA 1S8AA 2QMEA 3CX4A 1ZGJA 3GLGE 2JI4A 3PEFA 3HXKA 3IJPA 2XBMA 3BE4A 5JNSA 2Q62A 1IWBB 3FLMA 2O2IA 4F6LA 1S89A 2NAPA 3LDGA 4HDQB 2J45A 3VZSA 3L6RA 1LLUA 2X7JA 2EZ4A 3F0TA 3ICWA 4L3OA 4FFMA 2FZ4A 4O4HB 3VH2A 2DFNA 1JHQA 4JYBA 2LUOA 1KOJA 5FJJA 2O0KA 1U8AA 3IQDB 5K05A 5CCXA 5FTLA 2ZYGA 5C7IO 1C8KA 2NT3A 2XA9A 3KWMA 1GPNA 3HEBA 3OIUA 4U6NA 3KYDA 4E5NA 4XRGA 1L4GA 3V1KA 1RKBA 3UHPA 4XKJA 2PCLA 1YK1A 1ZC4A 2CDCA 3MFYA 3EOBI 2XQVA 4R1SA 5IDYA 2P5TB 1NMYA 2DWPA 2GMWA 3I8XA 4IMPA 3I1JA 4YRCA 1J33A 1Q7BA 2L42A 1OLXA 3KJZA 3MM4A 4C2BA 5ITWA 1Q0LA 4PCAA 4WUVA 3PQ5A 3K70C 2O0LA 1U8FO 4JVOA 1UP4A 5BQXA 4MWBA 2PKWA 3OZSA 3DAOA 2DYKA 1OWLA 3CF4G 3EDCA 4CTOA 3OE7D 5KREA 4R2HA 4D45A 1ZZGA 1M6NA 2VK2A 5JY6A 5KIAA 1L5SA 2ZK7A 3QPWA 4HLQB 4B4DA 1BXZA 2PS9A 5D51S 2WILA 1NUUA 2UUBB 5FPYA 2WR8A 4XUCA 4YDHB 1FFGA 3MEQA 4OGLA 1J20A 3UCXA 3ED1A 1FLAA 4Z7OB 1INLA 4W5OA 3TIXB 4PLWA 2GFIA 2C3UA 4FR5A 4MKZA 1L5KA 4HDKB 2N75A 3PSAA 2W2MA 3EOAI 3ILVA 4H0FA 4IP0A 3RQSA 2DR2A 4HGOA 2NGRA 1SXJD 2OP1A 4W9NC 4FUTA 2ZAMA 2X2FA 2QM8A 4AJHA 2GF9A 4BUCA 4M1QA 3R6LA 2YH2A 3RSFA 1O6FA 1T36B 4LF4B 3W1WA 2BJVA 4V03A 4HFRA 4Q82A 1HTBA 2VWHA 2R6CA 1D2EA 2ISQA 2FWBA 2PXAA 2YXLA 3ENKA 1IOLA 3L6EA 1QIIA 3S8EA 5ECWA 3HXOA 1U2SA 2V7TA 3KZMA 1U6KA 1RWPA 1XZFA 3K0KA 2CXPA 3AUKA 3UAYA 1L5MA 5K4GA 1PG0A 3IKMB 3DCYA 1TM2A 5KDOA 2ZT6A 2OXIA 1D03A 4XSGA 4LZAA 4QWWA 2C9CA 2WWHA 2M98A 5FL7A 3GJQA 3WGLA 4BRUA 1S2GA 3TE7A 3LK6A 1NMZA 4TKUB 3U3MA 5JPIA 2XXJA 3IAHA 2FDCA 5LNK6 1E20A 2XDQA 3CWCA 3HYRA 4Q9HA 3ROFA 5C7OO 4BLVA 5L6LB 1EDOA 1YS2X 1O77A 5ITZA 3HYSA 4IRMA 4IZIA 5NULA 3MOSA 1THZA 1JSCA 1VPTA 2HC9A 2NU6A 3G8CA 5COQA 4BAUA 1J07A 2WSYB 4NPHA 3ESDA 5JDCC 5I7SA 3KZKA 4DMLA 4B3IA 1IEWA 1QZUA 5AM0A 3SKXA 4HNVA 4MK4A 4EKGA 1J5PA 4QSMA 3UM9A 4JU9A 2EKZA 4R8VA 5FLEX 3HM2A 2VATA 4RMJA 1D9XA 2JFZA 1AHIA 2X5NA 4IQ8A 4J07A 3AM4A 2RB4A 2J1LA 1W52X 3FWYA 3EXG1 4MRMA 4CM9A 1FFHA 3QEJA 1T5BA 4KXFB 5KTSA 3PVSA 1XZQA 4C0SA 2QVXX 4PQRA 5CT6A 2LNDA 1WZCA 3M6AA 3R5SA 4G36A 4CKEB 5M34A 2R7MA 2VP2A 4G0QA 2NU6B 1DMRA 2JFUA 2ECFA 1X1TA 2C8KA 2ZUVA 1CDEA 1BS2A 2MOKA 2WFLA 1VTKA 1FLNA 2WJGA 2PRIA 4LRWA 4OA8A 5HPYB 3RANA 3U4MA 1QIDA 1OYWA 2MR6A 3NJ8A 2QT1A 1TC1A 2PFSA 3WGUA 3PNOA 1HX7A 1P1IA 3B36A 4FEAA 1PUXA 4LVOA 2P4HX 3CNHA 2VZ0A 1NRJB 2YJNA 1XEXA 1IE3A 1Z5NA 4IMIB 1MNAA 2X8BA 3KFVA 3QQPA 5EKTA 2DBVO 4KAFA 5GONB 5H82A 5CFMA 2NYRA 5HK8A 3K53A 1A98A 3EOZA 3NBAA 1JU9A 4YFVA 2EBHX 2WPDD 3ER6A 5GIPE 4OLAA 4R1UA 3N0RA 5FUQA 3Q7SA 1VKNA 4NV3A 3HZHA 1JIJA 3BD7A 3PHHA 4RCZA 2F3PA 3WSVA 5L7YA 5FBVB 4DCSA 3HRHA 1V48A 2HZBA 3C7TA 1VMIA 2PGJA 4HEQA 1KAEA 1T4DA 4Y9DA 1KYVA 1NQXA 2ZYVX 4R68A 3CVXA 2Z30A 5EP2A 1P61B 3BM5A 4Q6WA 2CLOB 4A03A 1EE2A 1OH5A 3FPLA 1JSZA 4K9LA 1CRQA 4IUYA 1JR3A 4O02B 2X0EA 5IEBA 5TPZD 2B2NA 1FW8A 3DE0X 3DLTA 4FKBA 1ZNQO 3RS8A 3SN6A 1D4OA 3SOPA 2HF7A 3I9V1 2W0SA 2YMQA 5P8WA 2IP4A 4GX2A 3S29A 4PY2A 1K0FA 2X0NA 2OR3A 4DOMA 1BE8A 3RRFA 4U2BA 4KPEC 4PTZA 5LMNB 1QORA 1W2HA 2OKCA 4ESOA 1YOVA 3THXA 2ORIA 2D2FA 3L0ZA 3T1QA 5I8WA 1U8EA 1C1XB 4OBXA 1F2UB 3KQWA 5CJPA 3IAAA 4WKCA 4DGSA 4K6FA 2XEDA 4FGSA 4PZ9A 3E7DA 3WGGA 3KJIA 1T29A 1U3CA 2Q9CA 4LRXA 2IQ5A 2BPOA 2EIXA 1KQFA 4YI5A 1A88A 3QH4A 4QUDA 2CHGA 2NTNA 1CUIA 1E1MA 1SUWA 5BV0A 3OEWA 2QS9A 4YVFA 1A9SA 3A1DA 4QEKA 3PFGA 3ROXA 4YQYA 2JJ1A 3UWKA 1RM5A 4QOIA 2KLBA 3QXJA 1UODA 4A8JA 4Q9AA 4DCTA 3BD9A 4QJ3A 5LDGA 1EWYA 2WA1A 1QVVA 2ZVDA 3MWGA 3NTQA 4CR8A 2XRYA 1XALA 3FB1A 2P2YA 3D54D 2EJCA 4KEAA 1E1LA 1EP1B 4UXHA 3KQTA 1QYCA 2EOAA 1S0UA 1CVLA 4ZKDA 5C1IA 3K6SA 721PA 1S3FA 1X7XA 4LAFA 1DV1A 2HK8A 2NO5A 3V80A 4ALNA 5AJHA 2RK6A 2QUHA 4Q4JA 1XLWA 3V1YA 1J7KA 1W85A 1GYQA 1F4VA 1L7PA 1NP6A 2GZ1A 3MJHA 4LQDA 2Q99A 3LS2A 4E0BA 4P7FA 4R1MA 3TDMA 1DSSG 3TMYA 1YKSA 2X8LA 4Q9NA 4B71A 3H3XA 3IT3A 1SVSA 4GMDA 4HDMA 4DB4A 2ZSDA 1ZVJA 1ZUWA 2H2GA 4O08A 4WEOA 4YQEA 4RDCA 1GNSA 3ZX4A 2IBTA 3T94A 3LI2A 3RHFA 4NMMA 3UC5A 1FFBA 4ZI7A 1MC5A 4ZOLB 3H2BA 2WW8A 2GEBA 1E98A 5FT9A 2QN3A 3G13A 2QTMA 3FZYA 4JU8A 5EXPA 5T8KC 4F84A 2RH4A 3D7MA 3I8SA 2RK3A 1ZN8A 1E79D 4KMRA 5IK2A 1I1NA 1EM6A 4UPVA 2WNIA 3A0UA 1UIMA 1W85B 1A9TA 2P90A 1KI2A 1T5SA 5ER9A 2C04A 2GESA 1TW3A 2WV7A 4KXYA 1EVEA 3C85A 4G1CA 4G67A 4Y0VA 3WYDA 4XQCA 1L5WA 5FJIA 5LOVA 3KQOA 4UNNA 2V4MA 5AM2A 1AQJA 2FXVA 2WWXA 3B48A 2FN9A 4IUCS 4POOA 2F7SA 4K3VA 4RTRA 3DBLA 5EHZA 2P68A 2W90A 4TGLA 1JDZA 3AFOA 1I80A 2LV8A 4EJ0A 1GR0A 1AO3A 3CCBA 2XGJA 3IURA 1TKAA 2QNRA 1ZK4A 2CE7A 2Z98A 2ZRQA 4WNYA 1NYTA 3DAFA 5EPUA 1P80A 5H3CA 4N6NA 4QBGB 4TXNA 5HWSA 5L3QA 5JDIA 2DFTA 3BH7A 3NEAA 4MR8B 3CLUD 4OHXA 2Y6VA 2WMDA 3ZY2A 1DBWA 2AYZA 1WA5A 3I9OA 3MTDA 4BJ3A 4OJTA 4JOBA 4PX2A 1SEVA 3SZGA 1AUVA 1Y80A 5DI3B 3RBAA 5LQRA 4QFDA 2PUVA 4AJ9A 1MPTA 2Q4EA 2ZBUA 4DUPA 3NU1A 2Q9AA 3PYMA 3AKCA 5KYXB 2RHGB 4MW0A 4IIHA 4M60A 3RTGA 1K8ZB 3S1LA 3HU3A 3CJRA 4WXEA 2XZTA 1GG2A 1TI7A 4TTRA 5EIXA 1RBMA 4UQLA 4B3CA 4KR2A 3KHSA 1SKMA 4BU0A 2JAWA 1A3CA 4FDMA 4D0LB 2HCRA 5BY2A 1KRWA 4Z2YA 4BS9A 5KSYA 3Q98A 4BZZA 3QKRA 2DE0X 2HDNB 2ONCA 2QM7A 4N3CA 3SU8A 1NKSA 3AX6A 1NAHA 1ZM9A 2H5IA 3MT0A 3QTBA 4LJ7A 3KELA 5DWDA 3U80A 4F3KA 2PO5A 3W5HA 1CQPA 3ZNOA 5BMVA 1LRJA 3LT2A 5ILQA 5DI3A 2AWOA 3WRYA 1RAFA 3JQ8B 2YC2C 1SXIA 1TZ2A 4LDJA 1O4WA 1TVEA 1NUAA 3RSQA 3LGAA 2EWVA 3C7KA 5KYXA 1PDVA 1E5XA 2WF7A 2W00A 3MLAA 1U1FA 2A0UA 4RACA 3BL8A 4FFVA 3BULA 3TK1A 3JWIA 4V02A 1EUCA 3IVCA 3AXTA 2ROQA 3CZMA 4DDMA 3CT4A 3TE6A 1E61A 3QFFA 5LYJA 4EK9A 3HFSA 2HPHA 3KKOA 3SQLA 1OZHA 4HUQA 1N34B 3SNKA 4HNHA 3MMNA 5ALZA 5J4LA 1FUKA 4NR0A 4FVTA 3Q1LA 3NWOA 4LN1A 3THSA 3P2JA 3AL0C 3NRCA 1PJTA 5KJEA 1Q14A 4TYYA 1H6CA 3V8RA 4NS1A 2WBLC 4OLFA 3OM1A 4B4UA 4I1PA 1U2GA 4EPWA 2D54A 13PKA 2V4ZA 1IVYA 4WT7A 2D2XA 2X0DA 1PV1A 1APBA 3N2KA 4CMJA 1WCV1 1RYDA 3OO0A 3UPDA 2OXCA 1RR6A 1JEDA 4MQ6A 5DXAA 3U81A 4DMUB 3GLQA 2PUAA 3Q2OA 4OLBA 2H1SA 1TF5A 2R85A 3A1NA 3D7NA 2QW8A 4TN5A 1E4EA 5LYJB 2PAAA 5DYTA 3SEZA 2K2WA 5EE9A 1PFWA 3ENZA 3PXDA 1KEUA 4TMVA 1QANA 4G6ZA 1PGOA 4MLCA 2O2EA 2W2XA 3DEAA 2PZBA 3G7NA 5I4CA 3KV1A 1TKBA 2H1WA 1GFIA 2W9XA 2BFCA 3JD2A 1JJBA 2XGOA 3GXOA 2RKWA 1X1CA 1E6CA 1EFCA 4IYJA 3KJQA 1ODLA 3OQVA 3V55A 1Z6ZA 2RHOA 4QFMA 3GNSA 4NVRA 5AHKA 5C31A 1S8FA 5MN4A 1FBNA 4K1XA 1YMVA 1TQ6A 3LRXA 2VUUA 1GRRA 4RPHA 1TYEB 1XZGA 2O8CA 4EW2A 1FYWA 1GDHA 4IY1A 4JGIA 3SX0A 4RHFA 3I4FA 2ZSHA 3CC8A 2Y9PB 3L77A 3LO5A 4U2DA 4JI7B 3LD9A 2LZ0A 3L6UA 2IU0A 1EJBA 2FPXA 3P20A 2BTEA 2C8VA 2NZ8A 1PWHA 4GZLA 3RBZA 3UAGA 5K8JB 3ECCA 2D3TA 3DO6A 3L79A 1L7XA 3K1AB 2VDUE 3E27A 3MJSA 4YPFA 1IH8A 3AEUA 2PY6A 4IHKA 3BGWA 3A04A 4UUOA 3VC2A 2HZ7A 3WLJA 4C1NA 5L8VA 4FXOA 3PRKE 1LV8A 3AUAA 1EEHA 1V26A 2F90A 2J7KA 3QXXA 4GOJA 3DGFC 4NARA 3UB2A 5JS8A 2VDKB 2JLXA 2GTHA 4DNPA 5E6RB 4DEYA 3I2KA 2FMXA 2JZOA 3A7DA 4ZEXA 1GRCA 2C5GA 3GEMA 1YR8A 5KAPA 2WSLA 4B7AA 4G4JA 1N2XA 1KC1A 2KBEA 1KQGA 3ONVA 4TS9A 3FETA 2VAPA 5EMMA 2QQ5A 1G3MA 1KDOA 4HVCA 1OLOA 4DILA 2IELA 2VF7A 4TOIA 3HXMA 1RRMA 1QF7A 1J2YA 1ZD1A 1VKZA 4HQ6A 1IB6A 4TPKA 4OCZA 4LV8B 1NQVA 1EXWA 4RD6A 2BI8A 3RVLA 3GCZA 3H3FA 3TQCA 3BGIA 3C0KA 3ERCA 1AQIA 4L3WA 1YS4A 1R9GA 1MH9A 4NYMR 4XAQA 2OOSA 2YW2A 3O82A 1QRUA 3MK31 3O47A 2HD4A 1AKMA 1XA3A 2Q28A 4E2WA 3M82A 3O7WA 4FN4A 1XTSA 3D02A 4PFKA 3DLPX 4TTTS 5C8ZA 5DEIA 5D3KA 2BFAA 2JI9A 1P9LA 1KAMA 3NDIA 1L5HA 3ZVLA 2SBTA 2G1KA 1DG3A 4RTJA 2EJVA 4ISCA 4M53A 4DMHA 5DSTA 4QICA 3OZGA 4WL0A 1I4LD 2QXUA 4TVOA 3NB0A 3W5DA 1E5QA 2VJAA 3P27A 4NS4A 2V7EA 4IQ4A 3VR6A 1VLQA 5COAA 4CQLA 2WWVD 3LW8A 3O7MA 3EIQA 2WQ6A 3GWZA 4QBFA 3FJ1A 5MFPA 3O8OA 1Y1TA 4PANA 1XYYA 2VO1A 4U0KA 2A1UB 1O87A 4ZD6A 4AJOA 4CM4B 3T1TA 8ABPA 2DFKB 4EHHA 5DGIA 1FQWA 4W9MC 2FN4A 1YZVA 4LJ9A 2G1UA 1NFRA 1P2DA 1RU3A 3OPVA 5HF9A 3NXKA 4S1WA 5A7GA 3QVWA 1JDNA 1ZNZA 3IT1A 2YIDA 4R31A 1N7GA 1A9RA 5JD3A 3VDMA 1ZIXA 1PEYA 3FAZA 2R96A 2GGSA 2BR3A 3ICOA 2DUMA 2PUFA 3IQZA 1T9GS 1QTQA 1GPWB 3DZJA 2ZBPA 2WP8J 3U48A 3EVEA 1DV2A 4OQNA 5K45A 5JH7F 1SCKA 2J7PD 3WNBA 2CXQA 4OEHA 5CGZA 5KC9A 2ZUEA 2E5WA 4JBGA 5CX1B 4XE5A 2Z0MA 5C5DA 6NULA 1PSDA 4M7WA 2C0PA 1E59A 1XP5A 2JZNA 2AT1A 4HDNA 4LNHA 2JJYA 5EN4A 5KO2A 5IJXA 3IIIA 2OFXA 1GSIA 2VYND 2H2HA 2VEOA 4PIPA 3ZVRA 1WHTB 1M8JA 2P9JA 2PV7A 3HU5A 1NXSA 3K0FB 4HX9A 5GOTA 2PBZA 4AIRA 1IUNA 1TFUA 2FF7A 3AY6A 1Q92A 3QY0A 3FZQA 3GVPA 4M6WB 3H87A 2AFHB 4AL4A 1KVRA 2IOFA 3TKAA 3DLIA 2KE5A 4W7SA 4B3MB 4M9ZA 1OILA 1E2QA 4CDNA 1KY2A 1U90A 1T1JA 2IY9A 3E05A 1AKRA 3BGDA 3EXFB 4IH1A 1KZHA 3UV3A 4P1ZA 4DEVA 3DBVO 2QTCA 4FTWA 4HUTA 1VMKA 3F2VA 3ZW8A 2ZJYA 2NZWA 2AQIA 3TFQA 1U9IA 1E0JA 4JXKA 1XTUA 3V1TC 1F17A 4Z0PA 3TQIA 4MTLA 5HRUA 3STXA 1EAMA 4YAUA 2B4TO 1JLKA 4I4IA 4ZFNA 3VTKA 3E9QA 1W8IA 5GMOA 3TXXA 1IJKA 1C50A 2DBZA 3DA8A 4DG9A 5FDFA 2ZJFA 1H5QA 3E1GA 1E9SA 3SX2A 4B46A 4KWEA 4RD0A 5EHIA 1BU5A 5KHLB 4KGXA 5B57C 4ZYZA 1EFPB 4E15A 2EJTA 3EXG2 1OZGA 2JJMA 5CVVA 1K97A 3TSYA 1JR2A 1XVAA 4NAHA 4R2KA 3U13A 1R0BA 3R3SA 4DIOA 4HK4A 4JB8A 1QG2A 4BO2A 3AIMA 1IOZA 2PDAA 3K8OE 2KMLA 3W4JA 2E48A 1S9DA 1I0LA 2ID9A 3EMDA 1DVRA 2BFFB 1FDIA 4BE4A 2ZJ3A 1USVA 1YQTA 3GJYA 4QQNA 5TPWA 4BLOA 4Z6KA 4ALIA 1IYZA 1MBZA 2KLHA 1WB4A 1YKGA 3BN3A 2W6JA 5F3DA 3AIOA 2GBCA 2Y93A 4D9JA 2QRNA 4XD7D 5ALFA 4HMOA 2Z2XA 5AXBA 1Y9JA 3HGTA 1WPQA 1UKVY 3C48A 3GHHA 4EUKA 4U63A 3G2NA 2XMSA 5BN5A 1M3SA 2C77A 3PP8A 2XMGA 1I6LA 5K6AC 1MIOB 2AVNA 1VCHA 1BKSB 4CE6A 2B6HA 3AR4A 2JBWA 1WXQA 4TYMA 5LU8A 1FFXA 2XMZA 3ZW9A 4X91A 2BZSA 5A7FA 3PHBE 1V7PC 1DAHA 2ZYWX 3MELA 2QRUA 2TMKA 2Y3IA 5IT5A 3ETDA 1SM4A 3CW2A 1KAOA 4X66B 1SBTA 4NCHA 3CLTD 4Q4JB 4ZC8A 2J5KA 2VIIA 1BS9A 2PBLA 5AKGA 1UT8A 4IBOA 1N5JA 4MPTA 5GV8A 3UMBA 3ZBPA 1SJ9A 3T7DA 1NQ5A 4BB0A 4DREA 3DDNA 1FQJA 1G5RA 2OCLA 2XQFA 1KOLA 2PRKA 3C41J 4B4VA 4HX5A 4AMZA 3HU1A 1Q74A 1AUPA 2EIHA 2JAXA 3ITDA 3ME5A 1DG1G 4H1TA 1ZBQA 4PWYA 4KODA 1A95A 1EDBA 4Y2HA 1E7SA 4L8YA 1KJJA 4NBWA 1JJIA 2I3BA 3B1FA 5FBLB 3BWMA 1BGWA 5KYVA 3GD5A 1ULAA 4O33A 3TZCA 4ZV4A 3CLTC 2R8PA 2Y68A 4FGLA 1Y34E 1LEHA 1G20A 5DSXA 3V34A 4DSOA 5I7WA 2IVFA 2ENWA 2WFAA 1PV4A 1XKQA 2X41A 3LY7A 3G89A 3PV0A 1H9CA 1T1EA 2DVMA 2ZQZA 3QPVA 3VU1A 2BE9A 4KXUA 1XIVA 2MIIA 3FPHA 3Q3HA 4DR2B 3GFSA 1SPBS 5K3BA 3T3NA 1PFUA 5B4TA 4YECA 3DD5A 4KO8A 3TEJA 4MW6A 2AI1A 1BE0A 3D4LA 2OZPA 1CZHA 1YR2A 1ZD4A 1B8VA 2YIMA 1CUBA 3OT4A 4HG2A 2BOVA 4L8WB 4P6VF 1Y8QA 2EW2A 1U0RA 4GBJA 3NOXA 3VDNB 4RENA 4DQDA 4V1CA 1ZHOA 1LVGA 2LTAA 4RHXA 4NCIA 5JMPA 3BIWA 2JA2A 3EPRA 3F5MA 3U5TA 3LZ6A 2HDOA 3IAS6 1DKMA 2RGUA 3QLUC 4DBLE 1CJUC 1ZUNA 3PTAA 4QHSA 2Q2OA 4Y7CA 4I50F 4MS1B 4IAOA 3WE7A 3RUDA 1SU4A 2YZ2A 2P6NA 3N3BC 3OEHA 3OLCX 3HVJA 1ESNA 1HQYE 4GXNA 5HG0A 3ZWMA 2CHVA 1Z5UA 2HT6A 2WUDA 3RSCA 1G42A 5J63A 2HIGA 1KDTA 3W04A 2HHJA 2ZRKA 2O2HA 1I7NA 1PJZA 4MPJA 3CQ9A 3BF8A 3MS2A 4NV1A 2P4SA 4AN0A 5BR4A 4IQGA 1ADCA 3ZVMA 1FK8A 2C8JA 3TD2A 2I71A 2QTHA 3MCAA 4YGYA 4LHWA 1A4RA 4INZA 4RO0A 2PGDA 4CG2A 4QTYA 1TYBE 1J2RA 5ICFA 2PZFA 1AQLA 1U9YA 3D3JA 2YVQA 3GAAA 4PF1A 4RNDB 1XSEA 5FULA 4UUAA 2DU8A 4X64B 3GA7A 2GX6A 4M0LA 2VQ6A 1D7AA 1DKQA 2UV8A 3P0IA 3TZEA 1M76A 1YJ5A 4UE6A 4CM1A 1JS1X 4P22A 3X1YA 1QIEA 2JGJA 1O97C 3RVOA 4A73A 2J5BA 2J5XA 3HN2A 1JVNA 1L7AA 1OB2A 1Z74A 1Y1KE 2PKQP 2YWFA 1PWYE 1O5OA 1A71A 1W48A 2EJBA 4DDVA 1NUTA 3VNUA 1K0UA 3C3WA 4ZMBA 1PR2A 2GJ8A 1XA4A 1G20E 4JS0A 3OFKA 3JQGA 5G0WA 5JZBA 3SEQA 3WZLA 3PL5A 1JN0A 1QGED 2DPYA 2WYIA 2BRUC 3AB8A 3KOZA 3M4NA 3MCUA 4IOMA 2FJUA 3UF0A 4OX9Y 1KY3A 2IXBA 3SXUB 3FYDA 1CCWA 4AZ0A 5KOJA 1ZVKA 1B16A 2CFCA 4G5GA 4NE9A 4WOBA 2Q41A 2F1IA 4M8SA 1JA0A 5EE1A 1W87A 5DLQC 2X22A 4JD5A 4RM2A 5IULC 4BKMA 3NONA 4RM3A 4RYLA 4LZJA 4A1FA 1A8QA 1OCEA 3B1KA 1NMXA 1JDJA 3MWEB 2FEAA 4J1TA 3DP7A 3G2HA 1CUAA 1XMXA 1YBMA 1Z18A 1EB9A 1ZK3A 2PT5A 5CJ2A 2CV0A 4O3MA 5KKAA 1ODIA 1O2DA 4KXXA 3PD0A 1MOSA 4EATA 1HMYA 4KIGA 4BCDA 3CE6A 4IZOA 4JVMA 4F4FA 4EI9A 2ZULA 1QV9A 2PNJA 3ZZMA 4L95C 1MA0A 4KWTA 1T34A 1Y3CE 2QTRA 1T15A 5UKDA 1W4CA 1QGYA 3NOQA 3QVSA 3RRMA 1IN6A 1SBHA 2WUFA 3KUKA 4A82A 2O6HA 2B61A 2WAAA 4CM3A 4DCCA 2R5NA 2QD2A 4W63A 3BWDD 3OA2A 1XLVA 1BHSA 4X54A 2DH6A 3I04M 3B6KA 3CR3C 4NEGA 4PHGA 3SZUA 1Z7BA 3E7FA 4LK2A 3ZQ4A 3EAQA 2DSTA 3RTDA 1T9HA 3N74A 2H65A 3R9XA 4LCJA 4KDCA 4V0NA 4H7PA 4RTLA 2ZB4A 2C5BA 3K4QA 5HKOA 1FW6A 5I7FA 2NVUB 4JUCA 4YRNA 2WU3A 4CIXA 4RAQA 5JSFA 2KSQA 5CU7A 4CMEA 3EZ7A 4D79A 1SIUA 5DGHA 2RB5A 1DKOA 3DOIA 4XPIA 5IVDA 4TLAA 1K8XB 4E30A 3A7EA 4M0UA 1WXGA 1KPIA 1HZZA 3SS8A 4ZPXA 5C0OE 3T7KA 2ATCA 1OXMA 2RJOA 2YZNA 4JVLA 5CLLA 4LRTB 4EF4A 3PU6A 3A4IA 3KWLA 4TL7A 3LIPA 4GEGA 3DKKA 5ABPA 5BWBA 3PA8A 3H9GA 5BYJA 3UMCA 3CNEA 2B69A 3R75A 1W36D 3A36A 2IEZA 2WIKA 5EJ5A 3C6KA 2IEIA 2O7VA 3K32A 4TXJA 1HBJA 2OM2A 4NZNA 5LZ7A 2HT1A 3PQ8A 1YDEA 4TRJA 1G6KA 4L85A 4IFIA 3S0JA 3WYCA 3FSGA 2WB4A 3UMMA 2ZUFA 4DB2A 1ZO8A 1CC1S 1E9VA 2A0KA 4HEA6 3G8YA 4MS4A 2UXCB 4UAVA 5AW8A 4K03A 3NTRA 3UG7A 5CA1B 4E2ZA 1VE6A 3CT6A 3FOWA 3MJ4A 4FE4A 2A9JA 4J6FA 4MAAA 1QHSA 1G2OA 4PC7A 4R5MA 3OWHA 5TF4A 2HX1A 2NU7A 1O95C 3QIVA 2Q2VA 1S6YA 2HLDD 1JXQA 3UT6A 3I6QA 3WLTA 1U04A 5DW0A 3UV7A 1P2UA 3RYCA 4JN6B 2NXJA 3WAGA 5EG5A 3L07A 3C3DA 5L4NA 1JHOA 3HCDA 3ZDXB 3F6RA 4ON9A 4D8XA 5K1ZA 4RJ2A 2D2VA 4N39A 1J8MF 1IXRC 1CS0A 1USUA 4G0OA 4WVLA 2IBSA 4YQFA 3RUEA 1NUSA 2A1IA 1AY0A 2J33A 5EPOA 1M1YB 4ARCA 1KAHA 4KH1A 1XQWA 4J9VA 3T1VA 1DS6A 5AVUA 1ISGA 2J85A 1QLWA 2IVZA 3HS3A 2QTNA 5EUMA 5CG1A 2QUZA 1NFQA 3LPCA 4W1PA 3E6AA 4KZKA 4RC9A 2ZRIA 3HWX1 1U2RA 3WZMA 1QO0A 2ODAA 4N0MA 1T8WA 4N40A 2I9KA 4EQ6A 1W4RA 5G2OA 4S05A 4FWIB 3UXHA 4YJ3B 1XMIA 2GT1A 1MU0A 4HYYA 3A4MA 4GOND 5T4FA 3UAZA 1Y3HA 1EU1A 1YO6A 3UY4A 3I6YA 5LYJF 3R5JA 3OT1A 1OVMA 2AI3A 2QZZA 2VBCA 2WOJA 2YNMA 3CZ4A 3FZEA 5JE8A 1P7CA 4DV0B 1Z0AA 2O8EB 4OKIA 4KHPB 1FYFA 4D9IA 5E6SB 4FJ0A 4HRAA 4ALJA 2Z6AA 3K1JA 2P6RA 2O2DA 1VL6A 2YYAA 4L76A 4XEHA 5LZ5A 4ASUA 4DCMA 1NMEA 3WFJA 2C00A 4NBNA 4C0HA 7REQB 4CQMA 2IYOA 3L43A 3RHSA 4C07A 2GO7A 1DEOA 1XZAA 4L7VA 3D31A 1PNQA 3TN7A 3W7AA 3JPWA 2OCXA 1DTEA 4HXGA 1HR0B 1VLLA 1Q83A 5JZ9A 3I92A 4QEDA 2RC6A 4F93B 1OYVA 5BSGA 1K68A 4R3WA 3HA2A 5ALWA 1XNQB 1TJ5A 2RIPA 1M1YE 4RE6A 1N1DA 5JHGB 2ISSD 2WM2A 2O8EA 1HKUA 5FUWA 1XK6A 3AM3A 4LI0A 4BYGA 4FGKA 2F8SA 4U5XA 2PX2A 2AX4A 1Y6GA 3R9XB 4GM0A 3I6BA 3OTOB 2VNSA 1NHGA 4B84A 2BMEA 1BH2A 4CNQA 4XM1A 1PJBA 4W6QA 3IC5A 3M9LA 1MTOA 2FPMA 1KXZA 2QAGB 4IDCA 4P5PA 2B37A 3M49A 4OUDB 3NH9A 4YI3A 3W5JA 2X6RA 3CRNA 5IT4A 2J7PA 4RV5A 5DFAA 5EMJA 2R86A 2Q50A 5ALJA 3UGKA 1GZSA 1PGQA 2YFKA 4MJLA 3JY6A 3ND5A 4KN8A 2JJ2D 2A35A 2D5AA 3U3ZA 3UATA 4BAZA 4NHOA 2BEVB 3HP1A 4MUBA 1I2AA 4YV2A 3QKSB 3BXHA 2PE5A 1BZYA 1UMDB 2ZRPA 3LXUX 3T35A 3A4LA 3IVXA 1EP3B 2WRZA 4WY2A 3UAXA 4ZYVA 1Z2NX 1H0SA 1NN1A 4NESA 4OIFA 3TGLA 1S1CA 4MIKA 2H54A 4MGKR 5BV1A 4MITA 3L7YA 3IVGA 4PYNA 2PMEA 3T06B 4YMVA 3TRJA 3N2YA 1QGDA 4MJXA 3NC1C 1RAIA 1BXKA 4GOXA 3S68A 5A6SA 4Q4LA 3D3QA 2ZVQX 4J94A 3UYLA 2V6GA 1VJRA 5JPCA 4KQCA 1Y9DA 2IYNA 1UM8A 2FA9A 2IU4A 3FHOA 1ESZA 2X0IA 1W1UA 4JMPA 4TYPA 5ETJA 1RPTA 1O9GA 1A8UA 4ROTA 2VBFA 1WIWA 4AIIA 5DM60 4EZBA 1YQXA 3NBYC 3UMGA 2C2BA 2R60A 4HBZA 4MV1A 2XKJE 4Z9YA 2IHZA 2C4MA 1P4SA 2G28A 1C4OA 2ZUUA 4QDJA 1CZKA 2YFYA 3FPEA 5CFLA 1YF3A 3RK4A 2AYYA 2IS1A 3VPFA 2DBQA 3N39C 2XITA 2R6GA 5EIOA 4WZAB 4Y6RA 2DMRA 1Y9AA 2G7ZA 3M3PA 5JNTA 3R4VA 1SCDA 5J59A 3WICA 5G3ZA 4X00A 3SQMA 4ZZ3A 5K7SA 4DIUA 1FX0A 1V8ZA 1ZONA 2VT7A 3OHPA 5E1BA 1JHDA 4LZOA 3WKDA 3A1VA 2B4YA 2XRFA 1I0ZA 2MJLA 4I14A 1ZN2A 4AUEA 4CTNA 3JAMA 1L4NA 3BIXA 4Z4IA 4O2LA 2MSCB 3K9CA 2OYRA 3CB4A 4OFBA 2HRCA 5IPFA 3V3KA 3G0CA 4MDEA 3KYBA 5EFZA 3MWYW 1B76A 1M2VA 2PZAA 2HQRA 3HVKA 3AV3A 1ZGAA 3V2GA 3VKHA 1DHTA 1QFMA 1NRWA 3BWCA 3IUJA 4UW9A 3WLMA 5IYZB 2PZ8A 5HS6A 4Q7LA 2MSWA 4C3VA 5U4XA 2PXCA 2ZE5A 1NW9B 10MHA 2NTJA 3CSSA 1TXGA 5K3EA 3B2NA 1B1CA 3DUFA 1U8UA 4DR6B 4MQFB 5FEUA 3WO0A 2WWWA 5C4MA 2H17A 2W58A 2OL4A 1UQRA 5AOVA 4EBBA 3SR3A 2VDLB 2PLWA 3VKUA 2XF8A 1Z6XA 3GOQA 1FQKA 1M1XB 2VRCA 2ZUDA 3A4YA 4FONA 4R8MA 4UM5A 5F98A 3GJ5A 3ZR4B 2HCFA 2VJMA 3R5FA 4CI0B 2PKYX 3MXTA 1U8YA 1L3CA 2GR9A 1UBKS 2JIOA 4IEFB 3VM6A 3W9SA 5L4LA 2W6JD 4LYFA 5TMBA 4D2IA 1YA4A 3Q5EA 4MR8A 4F86A 1G19A 3K73O 3ZKWB 2EP7A 3EXEB 3WLOA 3T7TA 2PK3A 2OO3A 1WP9A 2BEUA 4KB5A 3DSRA 1JDTA 1SULA 4WCFC 3NBQA 2HXYA 1TB4A 2F43A 4K9KA 4ND8B 4Q4AB 3VPBA 4B83A 1E2BA 2WWTA 3TL6A 3Q2IA 2B94A 1KSHA 1MUUA 3HCWA 4GP6A 1VHLA 4EUHA 1SCIA 3H42B 4KP7A 4LJYA 4Y2JA 5DO9A 3KAPA 2EU8A 2IV3A 3AHHA 2AN1A 3SF8B 3CEAA 3LWDA 4I4TA 1Y3AA 4B34A 4EM6A 1CUXA 1L5LA 5IM4F 1P5JA 4R0NA 5BPFA 4OHUA 3RE1A 4CKCB 3JQEA 4RPKA 1EX7A 2WWGA 2CF5A 2ZJ8A 5AK3A 1MHTA 1PK8A 3A9SA 1OXSC 1YHYA 3MWDA 1YDHA 3QKRB 4IUDS 1P7ZA 3WMRA 2H1RA 4W99A 2ZTMA 3ROKA 4CRWB 1IQUA 1B93A 2P9EA 5C1BA 1E2PA 2XUOA 3ZEAA 1T9DA 2H08A 3OU6A 5EGNA 3TTWA 1P33A 1RKQA 1ZW1A 4X6LA 1ELOA 1TD1A 1I33A 1P19A 2E89A 4E09A 3UNXA 3TMKA 3WVNA 4C0QC 2HMTA 1HM5A 1MABA 4AJ1A 1ST2A 4PO1A 5CFOA 3ILSA 4COOA 2C9ZA 4X95A 1GZUA 1Q12A 3L9XA 1NDHA 3KU4A 1R0KA 1EUDA 1WDLA 1VSQA 3G88A 5IDXA 2I1QA 4YREA 3VZRA 1UM9A 3EPKA 3JZAA 2Q1SA 3DDOA 2XT0A 2BM1A 2WSMA 3SC4A 5KWJA 4ENUA 1IHYA 1WBBA 3FTDA 2IEAA 2A4MA 4DMGA 2A0WA 1SKYB 4YEDA 2WSIA 4RK5A 1CX9B 3L8ZA 4EG0A 1AK9A 3P7MA 5FUXA 5A9SB 2YUIA 1TK2A 3UUFA 2CNBA 7MHTA 4CPDA 3DO5A 1T4BA 4CLOB 4KLAA 3STYA 5KVCA 3CEPB 2PUGA 4M9QA 4AB1A 2B1RA 5TVKA 2B35A 2HMUA 4F9FA 3BCSA 4A0QA 1PLLA 2BI4A 4OYYA 4A5SA 1WQ1R 1N2EA 2WZBA 5BRJA 2NVOA 3CKLA 2C2HA 3OOYA 3QNMA 2BUBA 3MIIA 4B73A 2Z2ZA 4CUKA 3K6RA 1LWOA 2WKQA 1PT6A 1VFNA 4LYYA 1KI3A 1ZH6A 3SIWA 3TNDA 4J16A 3IT0A 2W6QA 3JW8A 4JB0A 4CGYA 2BZ0A 4AUNA 4EW1A 1N9GA 4DCPA 3DAHA 3KFLA 3EDQA 3DL0A 1V5EA 4IIGA 3VV2A 4E5KA 1XRQA 2DT5A 4ZI2A 1DOZA 1PK9A 3WYAA 1QV7A 4BLPA 4DW8A 2G5GX 4J0IA 3ZDYB 5ER6A 3HBJA 2W6ID 4WVFA 5LMZA 3OTWA 2A9KA 4O2AF 5AI8A 3SQXA 1WZUA 4EH1A 1K08A 4CU2A 5FA5A 2QD4A 3LKZA 1S01A 4IOJA 1Z9BA 4PGFA 5EZYF 5K4AA 3L7NA 4RTQA 1NVMB 2C1EA 3TLZA 3KZCA 4KGDA 4CG0A 1CY6A 1XZBA 2FWIA 2HQSA 3HY4A 1GYRA 4C7KA 1KDRA 4F0JA 3PC2A 1GY8A 1JILA 2AEFA 2JCSA 4XCQA 1COWA 2YBEA 4YMTA 1XZCA 3OZVA 1GKLA 3E70C 3BTVA 3QF7A 3EUEA 2R4QA 5JFOA 1JFLA 2H5EA 2YVUA 3K20A 3BFJA 3QA3E 2PH1A 5B4VA 3U4CA 1XK7A 4LVNA 4FGUA 1P2SA 3VHQA 4MW7A 4B4OA 4KLNA 4MRNA 4QDKA 1Q0TA 2HA2A 3L8EA 3MYRA 1W30A 2ZJOA 4HEJA 1XQXA 4MQFA 2HIAA 4PR3A 2RKOA 4X6YA 1CXZA 2F00A 3WISA 5K99A 1ST3A 4JLOA 1P0FA 2FUNB 4OHWA 3U7EB 1PLKA 5G3YA 7MDHA 4GD3Q 4AY5A 4NMWA 1JSXA 4ENTA 2XHEA 4KBFA 5FP0A 4IHQA 1QG4A 5DH9A 3AWIA 1U4SA 1F4LA 1VPVA 2W2LD 5ELLA 3RFVA 1UZLA 4BFTA 4DUGD 5B64A 2FSVA 4EFDA 5JNUA 1AHPA 2C0QA 4QGHA 3REQA 4RK4A 2VG8A 3RVPA 1DTWB 3BMNB 2UAGA 2DQKA 3WIUA 3H16A 3FG9A 4JL5A 4RZSA 2XUZA 2Z9CA 1PNVA 4JLPA 1A2OA 3TLJA 2I4TA 4ZO6A 1QYIA 1DUSA 2ZI3A 4R9RA 5LUAA 3NUGA 3L1UA 2MU1A 1UKBA 3USES 1M6VA 4RKYA 2JIQA 1ZGCA 2EFJA 1XU4A 3KCNA 5CVUA 4FE7A 3DBRA 1UBHS 1TW2A 1CUEA 4I1OA 3MTEA 3L5KA 3SLKA 3WSWA 1Z4PX 3AVOA 4FQ7A 2WEKA 4N3AA 2BFMA 4MVJG 1JDBC 4WY8A 1JGTA 3I12A 1YR6A 2MHCA 3UK0A 2OFFA 3QEOA 3WXBA 2OECA 1H2BA 3GJZA 4LDAA 3F4LA 1G4AE 1ZH0A 5KU1A 3IPAA 2I80A 2RGYA 1LZKA 1PDWA 5AI0A 5IMBA 4P53A 2QYHA 1LI5A 1Z12A 1YDGA