1RKQA

Crystal structure of had-like phosphatase yida from e. coli
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
271
structure length
271
Chain Sequence
SLAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAVDNAIPSVKEVANFVTKSNLEDGVAFAIEKYVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yidA
publication title Crystal Structure of NYSGRC target T1436: A Hypothetical protein yidA.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 96
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.1.3.23: Sugar-phosphatase.
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 1rkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rkqA01
1RKUA 2WFAA 2HSZA 5ALKA 1U7OA 1Z4QA 1XP5A 2HX1A 4Y2VA 3QGMA 4HAIA 2HCFA 4UM5A 1L7OA 3WKDA 3WGVA 2FPXA 4HGRA 4O8CA 2G1AA 3FPBA 3FPSA 3SMVA 2GFHA 3FZQA 3U7EB 2AMYA 5AVYA 4KX5A 4BKMA 3SKYA 2RARA 3K1ZA 4OCZA 1L8LA 2HF7A 3L0BA 5ALIA 3W5AA 5AI8A 5AKEA 5AM4A 5AM3A 4HGPA 1F5SA 4CF4A 3KOOA 3KDPA 1RQLA 5AK6A 3FVVA 2I34A 4XOUA 3WK4A 3MMZA 4BEWA 5AW3A 5AW1A 2G0AA 2B0CA 2RBKA 3WKEA 2EARA 4H1WA 2PQ0A 2B30A 2VKQA 1VJRA 5AKLA 1RKQA 1T9ZA 4UATA 2X4DA 3M9LA 3OCUA 1N8NA 3OPXA 1S8OA 2FPSA 2FPUA 3HYCA 4YIHA 5ALOA 2I7DA 2P69A 4BNDA 4BX3A 3AR7A 1PW5A 2PR7A 3U7FB 1VFPA 5ALFA 5AVZA 1SWWA 3CNHA 2YJ5A 3VAYA 4Y2QA 1L7MA 3N1UA 3R9KA 1XPJA 1T5TA 3QU2A 5AW7A 2YFYA 3U13A 4F72A 5AM5A 1ZOLA 3W5BA 3MN1A 5AKJA 3DDHA 2CN1A 3B8EA 4HGQA 1KYTA 3N07A 1JUDA 1U02A 2QLTA 2YN4A 5AI6A 4Y2PA 3WK5A 1EK1A 1Z4NA 3ED5A 5ALLA 1Z5GA 5AKHA 1Z4PX 3AR5A 3HLTA 3UMBA 4NV0A 2WF8A 5ALJA 3NRJA 1Z4MA 2JAUA 5AK5A 4B6JA 4UAUA 4AS3A 4UMEA 2FEAA 4KX3A 4BYGA 3ZVNA 3L0CA 1RLMA 3PGVA 2GHTA 3I6BA 1RRCA 5AI0A 3AR2A 1WR8A 3ZUPA 1EK2A 3QUTA 5AK4A 4KN8A 4NFLA 2OA0A 5AW6A 4ZEXA 3L7YA 4YCNA 5ALRA 4L57A 4Y2UA 2NO4A 4EEKA 2BDUA 1J8DA 3AR3A 3QUQA 4CE6A 4E88A 3PDWA 1YNSA 1ZJJA 1ZRNA 3F9RA 3QU4A 5AM0A 3FM9A 1WZCA 4QQFA 2YMLA 3N8GA 2W4MA 2JARA 3SKXA 3E58A 1RDFA 3BWVA 1NRWA 3L5KA 2YMQA 3NIWA 3OCYA 2BDEA 5AW9A 3ZX4A 3BA6A 1Z4KA 2RB5A 5AVSA 5AKKA 1Z4OA 5AICA 3ZX5A 4GXTA 4GIBA 4XQ0A 2ZOSA 3ET4A 5ALHA 2R8YA 1NNLA 5ALMA 5JJBA 1QQ6A 2G06A 3AR9A 3U26A 2I6XA 2FDRA 2CFTA 4DWOA 3SD7A 5AKXA 5AW4A 5AKYA 3EWIA 2ZBEA 4CF3A 1YS9A 1TJ5A 4L6CA 4UM7A 5AKZA 1QYIA 2WF6A 3AR6A 4J2TA 2JAOA 1CR6A 5ALSA 2RAVA 5AI5A 4Y3UA 2GO7A 3B9RA 3E84A 4HGNA 4G9BA 2FUCA 4RESA 2G07A 2IOHA 1ZD3A 4FE3A 1SWVA 3QUBA 2C4NA 1YJ5A 4Y2SA 2HOQA 4UMFA 1LTQA 5AKIA 1O03A 2HO4A 3E8MA 1Z88A 1TA0A 1YMQA 2IOFK 1RMTA 2I33A 5AW8A 5ALQA 4BX2A 3SF0A 3OCZA 1T5SA 5ALZA 1L6RA 5ALUA 1S2OA 2IYEA 3QU5A 1QQ7A 2PKEA 1TJ4A 4Y2XA 3QU7A 3J7TA 3PCTA 2Q5EA 2YMPA 5ALNA 4MWOA 1RPZA 3ZWDA 1RQNA 3WK6A 3TLMA 2YJ3A 5ALVA 2FUEA 1CQZA 2MU1A 4JDPA 3NASA 2P11A 3MPOA 3WK7A 3WKCA 1Q92A 4NABA 3NUQA 4IG4A 1MH9A 4Y2JA 3OTQA 3QUCA 2B8JA 1ZD4A 5AW5A 4XE5A 3WKBA 4AP9A 5ALXA 2IOFA 4EENA 1X42A 4UU1A 1RMQA 2C9MA 5AKGA 1ZD5A 1LVHA 4C4TA 5AHXA 1RLTA 3ET5A 3QU9A 2B1QA 3EF0A 3ZW7A 3OCWA 1FEZA 2D2VA 2NO5A 3MC1A 4ZEVA 3R4CA 5AM2A 3A3YA 4YIKA 3I76A 5ALYA 2BY4A 3L8GA 3EF1A 4YCLA 1Z4IA 1SU4A 2R8XA 3OCXA 5AI9A 4MUMA 2OM6A 2I55A 4UMDA 4OD0A 2AGVA 3QNMA 3L0YA 1ZS9A 3QXGA 5AI4A 2YY6A 3GYGA 2O9JA 4C4SA 2QYHA 2AUTA 5IT4A 2C8KA 3L1UA 4UASA 3WGUA 5AVWA 2G80A 3QX7A 1N9KA 2C88A 2EATA 2HHLA 2WF9A 4EELA 2W11A 4G63A 3ZTYA 1RC8A 3L1VA 3DAOA 3A1CA 4EX7A 3UM9A 2HEGA 3L8HA 3ZVMA 3E81A 3M1YA 5AVTA 3IJ5A 2CFSA 1Z4LA 1Z4JA 1QQ5A 4BNDB 4KNVA 3I28A 3U19A 1VJ5A 3L8EA 4KNWA 2B82A 3IB6A 2B1RA 5AESA 5AVQA 3W5CA 2OYCA 5AVXA 3R09A 4CNQA 4ZEWA 2WM8A 1U2SA 3OCVA 5AM1A 4CF5A 3KC2A 4UW9A 4BEVA 3SHQA 2B8EA 2YJ6A 3S6JA 2DQSA 1RKVA 4EX6A 2ZBDA 1U7PA 2YBDA 1Y8AA 3NALA 1WPGA 3ESRA 2C8LA 2JAWA 2R8EA 4Y2YA 3KZXA 3IRUA 3EPRA 1U2TA 5A3SA 3QLEA 1NF2A 4NAVA 5AK3A 5AIAA 1XVIA 3PGLA 3W5DA 3D6JA 4NWIA 3U7GA 3ESQA 1Z5UA 5AVVA 3DV9A 4DCCA 4AS2A 2O2XA 4F71A 1O08A 5ALTA 1YDFA 4BBJA 2WF5A 2YJ4A 3ZI4A 4JB3A 1RLOA 3WK8A 2EAUA 2IA5A 2G08A 2FPWA 1ZD2P 4YH1A 5T41A 5ALWA 3UMCA 5IS2A 2MSNA 5AVRA 2ODAA 3A1DA 3U7HB 1RMYA 2CFRA 4DFDA 3N5KA 2ZBFA 1K1EA 2ZBGA 2YMMA 4HGOA 3ONNA 1TJ3A 5ALGA 4UARA 1L8OA 3ZTWA 5A3RA 4J03A 2OBBA 3RFUA 3AR4A 2JGAA 4Y2TA 2FPRA 5E0OA 5AIBA 5AW0A 3A1EA 3ZVLA 4RETA 5FP0A 1QH9A 3ZWKA 5A3QA 5AVUA 3CZ4A 4FYPA 3QYPA 2GMWA 4L6AA 2HI0A 1WVIA 4UU0A 4EZEA 5ALPA 4OFZA 2GHQA 4FFDA 4XPZA 4UAVA 1IWOA 4UMVA 4YCMA 4QJBA 3DNPA 4YGYA 2FI1A 3FGOA 3KBBA 4Y2RA 3I1YA 4I9GA 2I54A 3KD3A 4DW8A 1L7PA 4HYTA 1YV9A 3P96A 2NYVA 2R8ZA 2W43A 2WHEA 1AQ6A 2AH5A 2P9JA 4PNHA 3NAMA 1TE2A 4C4RA 2G09A 5ALDA 5AW2A 3RF6A 2WF7A 3N28A 2HF2A 2ZG6A 1L7NA 2Q4RA 4IFTA 3ZU6A 3WK9A 1Q91A 4KYTA 2P27A 3AR8A 2ZXEA 5IT0A 3B9BA 3WKAA 4OHFA 2HDOA 4BX0A 2Q4TA 3SLRA 5ALEA 3L8FA 3UMGA 3NANA 4I9FA 1J97A 1ZRMA
chains in the Genus database with same CATH superfamily
3K9WA 3KDAA 1ISSA 1SKUA 3PZRA 2V65A 1C9NA 1RXCA 2OBNA 4HF7A 4UUAA 1HDYA 2HQ1A 2X0NA 4FN4A 3PTAA 4W1SA 3D2AA 4PGMA 4C0HA 1DQPA 1U7OA 2EFDB 4CKEB 3HNPA 2VTDA 3HJAA 3T35A 4Y2VA 4WNIA 3GRRA 1O94C 1PDOA 3GDWA 4N49A 3HUUA 2PMBA 3ESDA 4MRVA 3FPBA 1JVNA 3ADCA 1F8YA 5BN4B 3O7WA 4B76A 3PIDA 4YMHA 2H08A 2HIHA 2QRQA 4KFCA 2D3TA 1HKHA 1MVNA 2FJPA 3ICWA 3HJHA 4PLVA 2H17A 4YAUA 2HADA 3OESA 1KJNA 3GZTB 1M6NA 1N6HA 1JA1A 3NI2A 1I3LA 1WLSA 3WS7A 5KCZA 4B3SB 4MO9A 3J81k 5KINB 4J7UA 4X1YA 3VNUA 3E9QA 2VQDA 4G2TA 1U11A 2Z3WA 1P7PA 2W98A 4OP2A 4X8LA 2PKRA 1MQ9A 2F1RA 3L2OB 3FVVA 4A73A 2ZUEA 1QGZA 1GPLA 5L7YA 4JKIA 4WKOA 3AM1A 1L7RA 2DE0X 2VJMA 5CLHA 2PVPA 2ODBA 5AUPB 2AC2A 2J5KA 2ZSHA 3QHAA 4H7PA 1RXSA 2HEIA 3EGIA 3PPYA 4ZJZA 4EG4A 2B4YA 2Z58A 3P5BA 1S9HA 3GVPA 2VHEA 4TLMB 3VNAA 1GA6A 3O47A 1JJVA 3IDOA 1X77A 5LM3A 3N87A 3AUTA 4MQFA 1KOJA 2D2IA 1VYTA 3N2KB 4D41A 3H4TA 3WE7A 3DJYA 5C5IA 4I1OA 3E7DA 1S1CA 1H9CA 1U3DA 5L6LB 3IBFA 1S0UA 1W94A 2I7DA 3H65A 4BX3A 1CG6A 4BVAA 3OTOB 4PPYA 1X8LA 2EW8A 3ZBPA 1D6JA 3SFTA 3DV0B 3CWCA 3JPWA 3JR3A 2R5FA 2XLCA 1NSFA 4D9EA 3SEZA 4W9MC 3GLUA 2BT4A 1FJHA 4JC4A 1OLXB 1PNQA 3R9KA 4R1TA 4BQIA 5EXEA 3THWB 1BDIA 1A9TA 5D2CA 3ST7A 1DXHA 4KQFA 1XNJA 2P41A 2XA2A 2FZEA 1X94A 1EM6A 1PUIA 1T5DX 1I80A 3AESA 1MR3F 1BEZA 2HBYA 1PGJA 3DSRA 1AF7A 3HLKA 3L8DA 4HWTA 5AKJA 1RRGA 2CN1A 1U8UA 2R68A 3BERA 4DIDA 2F8LA 4G0XA 5CA0A 5FNZA 4AY6A 4AW9A 3LBHA 3PNBA 4KUGA 4KLZA 2C9BA 3K6JA 4R7TA 2LKDA 2YVLA 6NULA 1GU1A 1OVGA 2XEDA 4E11A 4JI1B 2HCRA 3AY7A 2L82A 2ZRNA 3DVAB 2PSDA 4FJ0A 3QG5A 3EJ6A 2PGNA 1Z17A 3ZWQA 1H3FA 3JQ8B 3ABIA 3UWSA 4CMBA 1L5SA 3FGZA 2WKSA 3L0DA 4UTOA 1QH8A 4RIHA 1FMJA 3GLHE 3IDQA 4E33A 1UAGA 2G28A 4I46A 3C3CA 1YKSA 1ZISA 3IAXA 2BYTA 3F97A 4KPUA 1AKYA 4DAOA 4EKGA 3ISTA 4B73A 3CM0A 1P2BA 2AXEA 2QDKA 3GRCA 3HCRA 4NJEA 4QOGA 3T52A 4D74A 3I2YX 1F1BA 3L0CA 5LZ8A 2D2EA 3FPLA 1G3MA 2HRRA 4FEGA 4M88A 2HV9A 1Z63A 1UODA 2QAGB 3T5MA 4QOIA 5KYYB 2CGEA 4WN9A 1CYEA 3SCZA 1L7VC 1O5OA 2XTMA 3DD5A 4OV6B 3ROEA 2ERCA 2ENWA 2IPLA 4P58A 3SEQA 1DQRA 3JYLA 3UIEA 1A9RA 3M5DA 1A9XA 3A28A 2RI0A 3CLVA 3QXJA 3RNLA 4TMWA 2Z0MA 1OGYA 1IM8A 3C6XA 4PRYA 3G2KA 3HR7A 3L8YA 3GP8A 4R1QA 1UQUA 2A5LA 3ZW8A 4D5EA 5IHPA 2D5LA 4QLAA 1ZK4A 1F8XA 1AKVA 4P83A 4G1BA 2XCSB 3E05A 4RJKA 2RH4A 3CRQA 3FM9A 2G1JA 3KEOA 1W36D 4MIEA 2X5KO 4R68A 1GSIA 2B4QA 2FB9A 1W4BA 1DX9A 3GG2A 4FUQA 4BX8A 3IEVA 3AUKA 2BZSA 2IV7A 3AHFA 5TV2A 2JI9A 3D0OA 2RB5A 3D4LA 2FDCA 5EE9A 1NKVA 3HRHA 1Z38A 2DEUA 1AHPA 3VU3A 1G8KA 2ZKIA 3JD2A 2AZXA 4Q7JB 1NLFA 1GUAA 4K6HA 1GV1A 3A7EA 3C7CB 1QQ6A 2ODWA 3ZE7A 1Z5PA 1PWXA 4OIMA 2I6XA 3R3UA 4BXOB 4B09A 1CY6A 3W05A 1RYHA 2WNSA 2IS4A 3ZDEA 5KAPA 4B17A 3GV0A 4O1HA 1Y8CA 1JSCA 5ECWA 4EHAA 1A72A 3MMPA 1YFJA 2JG3A 3LPDA 4GXQA 1LPPA 3F90A 4CQLA 2W0MA 1USVA 3AEUB 4ZHQF 2QRVB 5BR7A 1DWOA 5IFKA 3I52A 1WABA 3C98A 4J0GA 3K8QA 4O1MA 3UK1A 4TMFA 4YYZA 1FP4A 3A4IA 3OPYA 1UXHA 4ERXA 3WL5A 1GL7A 2ZJ2A 2JFQA 4NULA 4YMTA 2FK8A 1HE5A 3KQYA 4X65B 3NHYA 3ZOZA 2O20A 4WOBA 1HTTA 5KHOC 4L4XA 1Q74A 3BRSA 5KQLA 4PONA 1ZR4A 2CL0X 1QGOA 3K5PA 3F1LA 5LQJA 2CKDA 4G4IA 5SZJA 2ZATA 2F62A 1DBSA 2I76A 3EH1A 4EI7A 3LRTA 4MV7A 5AKIA 4ESVA 3PF9A 5DJ5A 2ZRCA 2WR8A 5DHAA 4PNEA 4RE5A 5GONA 1TA0A 3RBAA 5BSWA 4AULA 4U5XA 4MCHA 2MIIA 1O3YA 3C74A 4AP6A 3ZE8A 2XTNA 4DA9A 2IZ1A 1UMBA 1TGVA 4TVBA 3GMIA 1T5SA 1XZ8A 2QVBA 3O4FA 3VHXB 4H7FA 2JEOA 2LW7A 3A3KA 1PZHA 3P0RA 1IJFA 2O2EA 3L79A 3L8MA 1H66A 3BICA 1QQ7A 4C04A 3AJ8A 4ZREA 1C0IA 3K15A 3W1VA 4GL2A 3QWIA 5ITWA 4HATA 4OQQA 1XVVA 4GSYA 3ZS8A 1QIJA 1VPEA 4EVQA 3PCTA 3TBKA 3ZYZA 1RPZA 2DQYA 1XTQA 3P2OA 1MQ8B 2CMDA 1YRQA 2RGNC 2AWNA 3F96A 2HO5A 4JJEA 3HCPA 4DGSA 5IASA 3AI1A 3LYHA 2C98A 5FCDA 3LGXA 2ZIVB 3N5CA 4JLDA 4J4TA 2WYUA 5LQAA 4J3JA 3HUEA 1MD9A 1YQWA 4ARZA 4A5SA 4CV0A 3EGEA 2ZRHA 2IXFA 4F4JA 2IQ5A 4U3JA 2WTEA 3KAPA 4NZOA 3T0IA 2FFHA 2WUEA 5JAQA 3TOXA 1LCIA 4BZZA 2H2DA 1TQDA 3EC7A 3DB2A 4I3HA 1UT6A 2VPYA 2WU3A 2A67A 3PNKA 2WG2A 3D4BA 3EWNA 5FBRB 2Y1FA 2JFNA 4UUBA 2ADMA 1E5XA 3CW8X 4NCJA 4AAYA 2H00A 2QZZA 3DQQA 3GJ4A 3UTCA 2FWMX 4CIYA 2X9NA 4OJYA 2IH4A 5K3SA 4DJJA 3UJHA 3AJRA 3MC1A 3RTGA 1HT3A 2C3OA 4GPTA 3OZIA 4PRKA 3A6EA 1Y3IA 1NF9A 2IEGA 2ZB8A 1XZFA 2ZANA 3IAEA 3ILYA 3UGQA 1EQUA 2JFUA 4ECEA 5JAMA 1NQWA 1G42A 3P20A 1OH6A 3I76A 3IAS6 3C16C 2O54A 1UDXA 2G9ZA 3JVDA 4AJ4A 4PYQA 4Y1RA 1JLLA 2A86A 3G8YA 3IDAA 3T8YA 4X92A 1RWNA 4CG3A 4UMDA 5B2ZA 2P8SA 1K5GA 4B2PA 3D8RA 2J3QA 4WEOA 8MHTA 1I7DA 1HWYA 3EZNA 4M7WA 4B7XA 5BW4A 3PQEA 3SF8B 2AFHA 3IEUA 3WYGA 4PYIA 3BKWA 1TO6A 4NMMA 2DPMA 4B0OA 3PXAA 3SBXA 5I8PA 4NBUA 1H8ED 2W5UA 3IESA 4WXYB 2JAXA 2HHLA 2W7TA 1G66A 2WF9A 3RYFB 3QWAA 3BGWA 4IICA 3SQWA 4B8WA 4A36A 1L7QA 2PX2A 4PX3A 4DL9A 4DCTA 5LNK6 1JHRA 2BMFA 4D98A 2JB9A 5C32A 5EI5A 1E2NA 2OWEA 3HJNA 1C1YA 2A88A 2PX6A 2NU7B 4YCJA 3RLIA 4K2HA 4O4HA 4C7BA 4X91A 2PIAA 5BVGB 2O3JA 3T7SA 2CLCX 3I28A 3ML1A 1UCFA 1JS1X 1VJDA 3FKJA 3L4EA 1OI3A 4J7XA 4PSAA 3H2HA 4WA7A 5H9WA 2YHIB 2Q3LA 4Q66C 5I4KA 4R2XA 3I1JA 2PRSA 3W5UA 4RKFA 1YOVB 5IDYA 4DV1B 2AOWA 3OIGA 4PCLA 1XXHB 3V1TC 3FFBA 3WBJA 4EFNA 4US0R 1JQEA 2B4TO 4ZZ0A 3PF8A 1FDUA 5EMNA 1SKYE 3SJCA 4RMGA 3ZJ5A 3EBPA 4DKJA 4FM9A 4D42A 2PZBA 2CMFA 2QM8A 3E5MA 4EY5A 4YCAA 2Y0BA 3WNQA 4KGZA 1M1YB 2PT5A 1T6YA 1O0CA 5CXQA 3PP8A 1SB8A 1KSJA 4BV3A 5K0JA 5EINA 2Z6AA 3TNFA 1MGPA 5EYPA 4W1QA 1A69A 2HWXA 2BKUA 1U2TA 1J06A 3AINA 3CTMA 3IB3A 3DL4A 4W9NC 4JI5B 2RGDA 3R7DA 3KXPA 1QS0A 4UCWA 4MP6A 5DIFA 5AIAA 4Y30A 4QPNA 4TVKA 1PWYE 5SZKB 3KT8A 3P0IA 4Y6QA 4R1PA 4DMKA 1S2NA 2PBZA 1NJ5A 2ID8A 2IYZA 1XF1A 3DV9A 2J4CA 2OOSA 2VHJA 3WWYA 2QR2A 4BB0A 2OQIA 5F7OA 3LQ4A 2IHTA 2X58A 5JFOA 4GGMX 4PR0A 4TYPA 3TMKA 1V7ZA 2GVZC 4JT8A 3T5BA 4EA8A 1WTCA 4I55F 4MLZA 4WSOA 3TDNA 3KSBC 4HAVA 4O4IF 2RHWA 5BYJA 3TLEA 1O8BA 1QWSA 1ZSYA 4H6XA 5KNCH 3BS4A 4HL6A 1O9HA 2PXCA 1DELA 1WXDA 2HRCA 4JUDX 1RZRD 2IYSA 3OECA 4KXLA 3E1SA 4LXXA 3TOZA 3NHKA 5I7HA 1E5LA 3R3JA 3HDHA 3D7RA 2DZDA 2W6CX 2BFFA 3KU1A 4PU0A 1ONNA 1YQUA 3IUJA 2YXLA 2IUUA 1RQXA 2OK7A 4XPIA 4BLPA 4FI3C 1E2HA 1L3BA 1FYXA 2OP0A 1ESDA 1PFYA 3M4XA 1BCRB 1M6EX 5F35A 4ZWNA 1FBTA 1QYXA 2NNLD 3DAGA 3G9XA 4QLOA 2WB4A 2QTNA 1D2HA 3AM5A 1D1SA 4RFLA 4Y2TA 5IAGA 1ZH8A 5DK6A 3CZMA 1QXSA 3AILA 5COQA 3BFVA 2HD4A 2OZLA 1G3IA 3GVXA 3KJHA 3ANTA 4EI2A 5ADHA 3KHTA 1RABA 4P5PA 4FYPA 2JJMA 5FO1A 3COZA 4J0QA 1UFRA 2VK4A 1O97D 5TQ0A 4H3VA 3RS7A 1TJYA 4JUCA 1DKUA 2CD7A 4JLMA 5KJ6A 3HRKA 4ZEOA 3TEFA 3IURA 4Q4HB 3F7OA 1XTKA 2A78A 2R87A 4UMVA 2BPOA 2F9LA 2PH3A 3DVRX 3NIBA 3U4QA 3IPCA 2MYTA 3BHNA 1VXOA 2EJTA 5EJAA 4ZVLA 3O92A 3H7AA 5BSUA 3UK7A 4X64B 4I9GA 5IULC 1ZI8A 3QH4A 1WMDA 2I54A 4QJ4A 1QH1A 2JATA 4BLOA 1KTIA 3QPDA 3R3XA 4XCVA 4NXMB 2K6GA 1SBHA 3KCNA 3OQVA 3P96A 1JAZA 5DHUA 2JCVA 3EVBA 5LQNA 5DGCA 1JR3A 3JZIA 2C54A 2F1KA 3UG6A 3O8CA 4TTTS 1DJQA 2R48A 4GI1A 4PNHA 3NAMA 3F8TA 2IS2A 4IDQA 3JQBA 4DPLA 1S9DA 1SQ5A 1YBHA 2IY7A 4AURA 4RHXA 3ZWBA 1CF9A 5JT1A 3AIMA 5BMVB 5JYEA 4AI6A 4UREA 1IXYA 5F9MA 1I24A 5FOSA 1XEXB 2GNAA 2ZUDA 5E8JA 1J00A 2B4KA 4YUWA 4BIMA 3MWGA 1QVZA 3I5YA 2ZG6A 4CG2A 1QG6A 3FSEA 4NBKA 3AF6A 4P2GA 4NNPA 1CY8A 4BPRA 3QSGA 1VZ3A 1GPJA 1UPFA 1P1JA 3LXRA 4ATNA 1DKRA 3AUXA 3KKPA 4WZBA 5BSTA 3WTBA 2Z5FA 3C14C 5EZQA 4KR2A 4TZ6A 1AOXA 3L43A 4IXMA 5EUCA 4B9AA 1CJSA 1DEXA 1U80A 3CGGA 4RVFA 5F1KA 4R84A 3TBHA 4ZYVA 5J2TB 2EGUA 5FULA 2VP5A 1AV6A 1Q22A 4LNUB 3EEFA 3NANA 4X7BA 1MEOA 1GO2A 3TQQA 1UDWA 4DR4B 4GRAA 2CB9A 2I2WA 2H07A 5BV2P 4JLOA 3CQ9A 2QOEA 2H1VA 1ZJZA 3HJBA 1WXGA 2J32A 2OQ2A 1I4WA 4OK5A 4IM7A 5BRAA 3OEWA 2PXAA 2JFBA 5KJFA 5L3QB 4L0MA 5CVUA 1T91A 1IOWA 2R4UA 4NMWA 4GO1A 3KXKA 2HX1A 1Q14A 2W2TA 1YR9A 3EZ9A 2ZBQA 4NZYA 5D1NA 5FAKA 4K88A 4LG1A 2BFBA 5DPMA 1ISMA 5TVKA 3UXMA 2NPOA 1ILEA 4PPGA 1L7OA 2ZAGA 4IGAA 3L4JA 1RT9A 4O8CA 3AXTA 4OFXA 1F20A 1U8EA 1BMFD 4XFKA 5TRTA 4DA7A 1UBKS 1K8RA 1HLGA 5D87A 2RARA 3L9XA 5SY9A 4JI8B 1EFUA 2R6AA 2BFCA 1DBQA 3H84A 4FKMA 4R1OA 3TRHA 1SXPA 1JDUA 3JAWA 3GR6A 1XRMA 3G0OA 3HACA 3DBVO 2ZJOA 5AI8A 3PL1A 4C2TA 4Y6GB 2QMOA 3WP0A 2YV2A 3O2SB 5H82A 3F47A 4LBWA 1NBAA 4CKBB 5K8VA 2ACKA 2C3MA 3BXZA 3P9YA 3QVVA 3V7YA 1CDOA 2LUOA 4C7OA 2IW3A 2YRXA 1OAAA 2AG6A 3GU3A 4ETNA 3G82C 2G1PA 1E6KA 2J5BA 2QUBA 5IN4A 5TPWB 2C29D 4EI9A 1UM9B 1THMA 1NUTA 2JC3A 4G8DA 4GLLA 5GPBA 1E6LA 3VH4A 1XAIA 2LIVA 3T3GA 3MUNA 4LKOA 3UK2A 1Z39A 1B23P 3KM0A 3TQTA 2X4GA 2YYAA 4EG0A 4F2HA 3ZHZA 4H77A 2IY8A 2A5GA 1KF0A 2FPSA 2PTHA 2A4KA 1ESCA 3HYCA 3KT3A 3OU2A 1JBQA 4Z3DA 3FF1A 2XB6A 4YAGA 4YIHA 2CXXA 2PZKA 1BMTA 4L4UA 4ZTZB 4QIHA 3MWEA 3LV8A 3OZXA 4FNOA 4AJ9A 2ON6A 5CM2Z 1SG6A 3BXFA 5YASA 1OZGA 3PG5A 3VI4B 1XQXA 3U3OA 5DNYB 1PLKA 1T0JB 1VQ1A 3DBLA 1ZH6A 3ITNA 4RD4A 4ZT6A 4JSYA 3VAYA 5EOVA 2E5FA 3K6KA 2W58A 5E9WA 1F6DA 1Q21A 2E6UX 1BFUA 1EDZA 1RWVA 2KLHA 1XLTA 2A0XA 2Q2QA 2NXEA 2QRJA 4FFLA 4WCFC 3T95A 5DYTA 1E58A 1A7JA 1SHJA 4CI9A 5KDLA 3ZBTA 2VZ9A 1DUSA 3K6SA 2BGNA 1IHYA 3WGKA 2WYHA 1DHRA 4ZDIA 1XZLA 2FW9A 2V4UA 3EIUA 1YB1A 5BXQC 2W93A 2Z08A 4RDCA 1I3KA 1KFJB 3ER6A 4HDOB 5F9HA 3A2LA 3SICE 3VOSA 3O73A 2XB9A 1UAYA 2IXBA 2R2AA 1D4OA 4QUJA 1YK1A 2EX1A 2VCHA 2CL5A 4J7AA 2XMDA 5C8YF 3LFUA 2PMKA 5HDQA 3AR5A 3HN7A 2Z9DA 5JQGB 4XYBA 4FYMA 3TJZA 4J0FA 1CQPA 3OA2A 2DP4E 2O8NA 3ZNNA 4Z3OA 2HXSA 4DV3B 4IDGA 3SR0A 2JLZA 4CYMA 5DLEA 3TMAA 3THXB 3EZGA 2II6A 4S1VA 5EHZA 2Z3VA 1WCIA 2UZ3A 1JYFA 3FOBA 2DAPA 4GRDA 3PGVA 3ESXA 3PEEA 2KHZA 1YBFA 4CCWA 1RRCA 1PFUA 3FVRA 3B5IA 3NBFA 3O31A 3Q85A 5AI0A 1CVRA 4PLHA 3RSCA 1Z8NA 4F5ZA 2AVDA 2C2OA 5A9TA 1N8TA 4YJGB 1PYOA 5TQJA 4ZJYA 2E49A 5JAHA 1BS1A 2OA0A 4PYNA 1Y8RA 4A8JA 1XKTA 3R7NA 1XUOA 2QR3A 3QJ5A 3N7TA 4ENUA 3OY2A 4WJZA 5GJCA 4JL6A 3H7IA 1Q83A 3UWOA 4FPXA 1KWGA 4QM6A 3ZYCA 1R16A 3G2NA 2BKEA 3CH4B 3AIOA 4L22A 3WRVA 1U4NA 3M5WA 3MWJA 3NUGA 3ORHA 4JODA 4LQCA 3JARB 4H7DA 3WB2A 3PTZA 3Q98A 2P2SA 2ZAYA 4QC2A 5LZ5A 4C22A 5EXDA 1JRLA 1NAIA 2DKFA 3TZ6A 1IQ0A 2R3SA 3O7MA 4IH9A 4O4JA 1FFXB 5AJXA 5CH5A 1X9HA 4H4EA 1XDDA 1T2EA 1F6WA 4KO3S 1XDWA 2ZIZA 3UV3A 1Z74A 2BGIA 2GJAA 4RY0A 3ZX5A 3MQ2A 3MAAC 2PX3A 1IOVA 1TUBB 2ACEA 2DVMA 1TLTA 2R8YA 3I04M 1ADJA 1FRNA 1P1BA 4BO9A 3JQFC 5EE3A 2YICA 4PQEA 5BSMA 1XAGA 1Z29A 1VRVA 2N42A 2Y99A 2B5WA 2YWGA 1DAPA 2BGWA 3IQHX 4GZLA 4C0BA 4CU2A 3OC6A 3BXPA 5FQOA 4M9SA 5AKXA 3RW9A 4ARCA 4P08A 5DISB 1D6MA 5T4FA 3A3OA 1Y1KE 4GW3A 2Q9UA 5K09A 4GICA 2P6RA 3A6DA 3LY9A 4UM7A 3EC1A 4TM7A 4EDHA 3AR6A 1VHJA 1NJSA 4YS6A 3V34A 2X9VA 1NBME 2BKAA 3H9GA 4F11A 4U2EA 1RZ3A 1SU8A 2GCOA 3QVXA 1XMIA 3RAJA 2GO7A 4OXIA 2Z43A 3PUYA 3EXEA 2NWQA 4IUDS 4HGNA 4F9EA 1PHRA 2XMZA 1Q17A 4NK4A 2QM7A 5K7SA 1U6IA 1W4AA 4BVJA 2W2LA 3HP1A 4CN8A 3PPXA 3S7ZA 3NCTA 3LVRE 3SSAA 1S6YA 3TS1A 5FBQB 5IMBA 1P4GA 1CEXA 4BMSA 1FW8A 3H83A 3P9KA 4HVAA 4KGVA 4CTOA 5B3JC 5FEUA 3KB8A 3E53A 4OI4A 1TVEA 3QF4A 4FYJA 4FI3F 1PK8A 3B36A 3WLFA 3GT7A 2Q99A 1XZJA 1KP2A 2QTMA 2RHLA 4OA8A 3U7IA 1O6ZA 1JMVA 5CIQA 3V4RA 4YTEA 4ZIRB 1PK9A 2BL4A 3COWA 1FVFA 1S2OA 2IP2A 2TMYA 3AVOA 1GJRA 4K28A 3OFND 4Q00A 2FR0A 2WMDA 2FPGA 3QV1A 4GBMA 4WY5A 2OENG 3W78A 4EY7A 1G5TA 1Y8ZA 3I2GA 5GJWC 1F3OA 4W7HA 4TV8F 1IUPA 1MIHA 1R6AA 1LPOA 4NBRA 3STHA 3H11B 4BC0A 5JAUA 1GZ4A 1XL0A 2AHOA 2FFQA 2VAPA 3DYVA 4EECA 5ALVA 4JFRA 2C9ZA 3FJ1A 1T9AA 4M7PA 1U6KA 2B6HA 2K7ZA 2P0EA 2PX0A 2QZJA 1ZN2A 3QLTA 1DI0A 4EYEA 2GLUA 3MPOA 2VXCA 4P3XA 2QT0A 1VMAA 1LNSA 5FUVA 2P4UA 1Z7BA 3BL8A 3COPA 3NUQA 1MRSA 3PR3A 2ZIUB 1PS0A 3PNVA 4JSTA 4YJDA 3S40A 1PEDA 4O2AB 1XVTA 1NU8A 1USUA 1CQIA 2PWPA 4Y1EA 3UOGA 1RJDA 2OCKA 2K5UA 2RKWA 2WLSA 3JASB 4QSMA 3JQGA 5AO9A 2UAGA 3NBMA 3D1LA 4G1EB 2I6GA 2C9MA 1A5TA 3LLMA 4L9WA 4WAUA 4X8OA 3VISA 1L6IA 2WHYA 3V1NA 5KTRA 1VSTA 1GLVA 3DXXA 5AHXA 4AECA 2X13A 1DIRA 2Y0CA 3G2QA 5E6UB 1QMPA 2DBVO 2Q6TA 3WYFA 5C80A 4J4BA 3GAZA 4C0QC 5J2UF 1R8XA 3M5CA 2YJTD 4K9RA 3M6UA 2ZQZA 3K9GA 1FVOA 1WKBA 3O0DA 4P7BA 1K3UB 4L6IA 4QBHA 1QE0A 4KWIA 3Q3VA 5L3ZA 4CUJA 2BHTA 4M8KA 5LFAA 1OFUX 1SQSA 4ML3A 4YIKA 2ISCA 3LDFA 2D7CA 1UZNA 4F21A 1M6VA 1GY8A 3JZFA 3OPMA 1NQTA 2XAAA 1RWXA 121PA 1F51E 3MUFA 1ZCBA 4C7XA 1EJ6A 1Z5OA 3IMEA 1ZS9A 2O1XA 5SY4A 3QX3A 3WQSB 3JTMA 3V7NA 2DFTA 4M9XA 1GSOA 1DAKA 5BV7A 3WQHA 3PNMA 4KPYA 1VI6A 5C1DA 4L3OA 3IAHA 1XWWA 4DLXA 4ZZIA 1NLMA 521PA 3QPCA 4B0PA 4RKYA 3ZOKA 4MHSA 2QDXA 4MITA 1K8ZB 3P2MA 5ADVA 1RLJA 1WKVA 3WMEA 5SYMA 2Q1TA 4RFVA 3QUSA 4KO2S 3GNQA 4HB0A 3LA6A 4P4GA 1W581 3SSNA 1NC3A 1BKDR 1ZJYA 2AWOA 5JC8A 3OTHA 1QLJA 5I7OA 2DCMA 1TC2A 4AMUA 3ILSA 4L02A 2ATEA 1GFZA 4FGKA 4X1OA 1C30A 2Y93A 3UV6A 1NW5A 4EYGA 4E30A 3ZJUA 2CNBA 3MTQA 1VDZA 4OQPA 2GXQA 4YLGA 5KYUB 1R66A 4FONA 5LDHA 4UNSA 2GPAA 1F8GA 1YOBA 5IVKA 3CEAA 4FHFA 2C5EA 4DLLA 1SC3A 1ANKA 2WTBA 4AN4A 2EG5A 4XGNA 3N8IA 4CKWB 3G2MA 4RPHA 5I9LA 1RACA 4EZIA 1R0CA 2DPLA 1G20A 3KZVA 1SFRA 2LDXA 1D0SA 4N6NA 3G2PA 2CXSA 2XUGA 1X70A 4JWKA 3TL6A 2ZIEA 4A15A 4PCVA 3E1KA 2QRMA 4E6EA 3TW4A 4MPJA 1T1EA 5ERXA 3S6JA 1HH4A 1ML4A 1GPH1 2XA1A 3GFRA 4A8PA 4EJSC 5A7HA 1YA8A 1KI6B 3FNQA 3RKUA 3UYLA 1CNEA 1J0AA 1N6KA 3T3DA 1ZMRA 2P7IA 3S2SA 3EA4A 1H5UA 2HIMA 3CW9A 3OICA 2F48A 4MEAA 3RVPA 3UB3A 3OIUA 1YT5A 3A10A 5TF4A 5IF9A 5CU7A 1Y3CE 4CT5A 2ONYA 4UVEA 4K0RA 3K70D 4ARAA 2ZUCA 4I1PA 4KRFA 2AC7A 5BQFA 4OMCA 3ZHUA 4RMIA 1IHUA 4GECA 2W6MA 4F06A 4TWIA 4OA5A 1G8AA 1IXKA 2AFVA 3BHIA 3PD1A 2RHCA 1VCOA 5KVCA 2WA2A 4JR2A 1G21B 4WKNA 4YO7A 5I6DA 5T8KC 1NX9A 2JZCA 4HSGA 4QQNA 2IYLD 2YJ4A 2ZJ5A 4LX8A 4G86A 3T9BA 4EAAA 1C2YA 2XB2A 4BVLA 1MC5A 2DSNA 1CUBA 1B74A 1QOZA 1LLQA 1QTIA 1S2DA 3GVIA 4NZZA 1UBTS 1W44A 1I4DD 3EVDA 3CVUA 3EIHA 3JQAD 2CNLA 3RSLA 2GZRA 4HEJA 3LCRA 4Q39A 2R6DA 4OYRA 4BWFB 3X2EA 3M81A 1UBJS 4GT1A 5D84A 1P29A 4PRLA 2XOKA 3RYIB 2AJBA 3DEKA 4HGOA 4OHKA 3ONNA 4D8UA 1W36B 4G1MB 4GZMA 4NESA 4ZQIA 4DXHA 3T5GA 1ZVQA 4FHEA 4AC9A 3SX4A 2YIJA 2FPPA 2SKCA 3BAZA 4P93A 2GWHA 2QRHA 4QJ5A 2QTHA 2ZWPA 1ZW1A 4YX9A 2BIFA 4ZHSA 5KB3A 1OJLA 2OHHA 4X7PA 1N2CA 2Y8EA 3ZDRA 3O8QB 1Z62A 1TJPB 4RHUA 5EJIA 2AKEA 4OUDB 1KI1A 4QYXA 4TSFA 1C1DA 4IH4A 3G7SA 1TVKA 1W85A 3SZGA 3E35A 5NLLA 1NG9A 1KR2A 1XGKA 2Q9AA 1XMPA 3FRIA 2J30A 4HFNA 4JITA 3RSFA 2WAMA 5JMPA 4I3GA 4PBSA 3UY4A 4RJTA 5CFRA 5AJHA 2HTFA 3LYUA 4QRHA 3A32A 2LR0A 2PX8A 1C7JA 1NF3A 2CWDA 1OROA 3F9IA 3LWDA 4MWGA 5JYDA 1Y7HA 1QOQB 4ZQHA 1MAHA 2R47A 2AQKA 2JAQA 1ATZA 2VHQA 3N2LA 4MVXA 2A3NA 4W7SA 4LKRA 2VWPA 3WOVA 1OW3B 2REOA 2V0CA 4TWZA 2MOKA 4DLNA 3RUIA 1D8AA 4XGIA 3KT0A 2OV4A 4GE0A 4PQRA 3ACCA 3CEJA 3TQRA 1KU0A 1B0PA 1Q0HA 1N8SA 1M2OA 2VHVA 3UBMA 1SXJE 2YWXA 5KNDH 1HNXB 3W7BA 3AY3A 4OH7A 4ANFA 4OBWA 2ANBA 3QKWA 2PPVA 2OLKA 2PD3A 4F5DA 4IPTA 2DTEA 3CEMA 1O6BA 1Y5IA 3GAMA 3OQOA 3FMOB 4KQ1A 2H1IA 4OXKA 4DCVA 2OCLA 2DBQA 2VH2A 5TGZA 5AW2A 3AKZA 5BUQA 4V0QA 4HPXB 5EJ4A 1XTBA 2QX7A 3M83A 1ECPA 1H1LB 1XZMA 2L69A 2W6ID 2RJNA 4QLBA 1FOEB 2WJ6A 2CMGA 1QIHA 2WT4A 3IVRA 2HQSA 1JJFA 1FQJA 4G0OA 2IHZA 2OCPA 2H1CA 3JAKB 3LRPA 4IG9A 4LV6A 4QBTA 1FXWA 3BVPA 4AKSA 1C9KA 4I9UA 3VR5A 1E3EA 4KN9S 3IAFA 5KVQA 2BFNA 3GHHA 5KYWB 5K45A 4MRMA 1AMNA 2DX7A 4FQ7A 4RTJA 5EKUA 4OLBA 1FYWA 1UZUA 1GL9B 2RGEA 4LY3A 1GQFA 2DFDA 2E0IA 2OV1A 1RP1A 4CQMB 1EB8A 1B00A 3KUKA 5KREA 4ZYWA 1R10A 4O8ZA 4XIFA 4PN7A 1VSBA 5H7XA 1SU6A 1ZVJA 3P2YA 1H2WA 4JBWA 2W90A 4MEBA 1VXRA 2EFYA 5DTIA 2VG8A 3L7LA 2K2QB 1QYDA 5F76A 3LUHA 4BKUA 1J9GA 4E08A 3AVVA 1GNRA 3PGKA 1JQKA 1UK9A 3TECE 3DE1X 2VS1A 2J7PA 5HQJA 3E2IA 1ZX1A 2H85A 2HCFA 3MIIA 5AOCA 1EUQA 3QLUA 5L4NA 1SHUX 4UXJA 2CFCA 1TLFA 3ZLUA 1ZNXA 2FW0A 2AMYA 2AYXA 2WD8A 4INOA 4QFBA 4U5QA 3T7CA 1SBTA 3ZCVA 2CFIA 2DU8A 3RU2A 3TBFA 3VYWA 2FCRA 2VP2A 1WDTA 5MN5A 2B1GA 3B1XA 4FCTA 3KPJA 5IBCA 2HF7A 3L0BA 5LBIA 4WDRA 4Q1AA 4BKPA 2AMLA 2JLWA 5E6SB 1FP6A 3UJAA 4HGPA 1IEVA 2F17A 2IPNA 2NW6A 1Y5MA 4A2WA 2PLAA 3FIUA 2L42A 2EIHA 3OJEA 4Q3AA 5L3VA 2VHCA 1CVLA 1YF3A 4D9CA 3R0JA 1M2WA 3Q88A 2DG2A 2JLVA 2TRSB 2GTIA 1YZFA 1B2RA 2VJKA 1TMKA 3LC1O 2VBGA 5MDHA 4D5GA 5AKLA 3CO0S 1T9ZA 4H08A 4I50B 4HXFB 4I6EA 2JBHA 2DHRA 2ZXFA 3AGQA 1F6BA 2DBYA 3AYXB 1GTZA 3OPXA 4HDNA 3WWCA 4LZPA 1B7GO 3FD8A 4D3ZA 5B36A 2QAIA 3A0RB 2CKMA 1EXMA 3HP7A 5JHGB 1F2TB 2OCGA 3DFIA 1FP2A 3IIEA 4YBZA 5ALOA 3NVKI 1KYWA 1DFHA 2QT1A 3DNFA 5F2NA 2ZDHA 5LUAA 4D82A 1UZMA 1E7MA 1O54A 1FNNA 4JX8A 3K0CA 4M1SA 5A05A 4NZMA 5ALFA 1TZJA 3EYAA 4LI3X 3TFOA 4BX9A 3OQMA 5TPZA 2YJ5A 3GEIA 3BFKA 3EEQA 2GX6A 5GMOA 2NZVG 1K0UA 3C5VA 4RLFA 1BNCA 2WMOB 4NZNA 2BMWA 4KN6A 4B75A 3T54A 1E89A 1G8FA 4L0DA 1EFHA 5ICEA 1G6KA 2EKQA 5HRAA 3QU2A 1QQTA 3DCNA 3VTAA 2RBEA 3IIIA 3CJQA 5IG2A 3OQIA 5IZCC 5I7AA 5BURA 4DV7B 1WQ1R 4Q4AB 4ESHA 1AGXA 1O57A 3B1ZA 1WW2A 1EQ2A 2JI8A 2YBEA 4QRDA 5ICFA 2GCGA 5I3ZA 3KCQA 5HCNA 3A1VA 2P77A 4Q02A 1DT3A 1P9NA 3EIFA 3EB9A 5TS3A 4LGVA 2VDWB 3LT4A 1YRWA 1GTJ1 1DJOA 2BE7A 4MINA 3WK5A 4BL5A 4DS3A 5NULA 4MNTA 2YC2C 1ZUWA 2HDHA 4GVPA 3LW7A 4HDRB 1LBQA 3MTEA 4JLVA 2MSDB 4WN3A 4CCAA 3DEHA 1Z5GA 4P31A 4UTNA 4JA0A 1AGPA 2D06A 4B3GA 3HVJA 1DRJA 1Z4PX 2C2ZA 5KC9A 1DOHA 2LDBA 2XYVA 2A0FA 5DB4A 2P7HA 1LWNA 4LISA 5G0TA 1C3OA 4ALKA 4BNLA 4ER0A 4YV1A 1D9XA 3LRXA 4V1CB 4HLCA 2WYOA 2JNWA 4X6YA 4LJ7A 2BFPA 4ILEA 1I14A 2HA3A 4RHEA 3TUIC 2O52A 5JWOA 1OHHA 2Q2VA 4DUPA 3RV3A 5FUMA 2ZYVX 3V9AA 4LHYA 3WLSA 5KAMA 1ZIDA 2DQKA 1JVBA 2Z2JA 3RRFA 5AXCA 1DZIA 4HEHA 4LXQA 4DDTA 3CEHA 3QMMA 3FDIA 1SVSA 4BRSA 3TW6A 3SVZA 2QS9A 4F56A 5GGXA 3VU1A 2FUNB 1XPOA 1NE2A 5I5EA 2H2WA 3U61B 4ARVA 5FPYA 1NN3A 4O63O 4M1KA 2PE5A 1C4WA 1ZD8A 3O9VA 5FPSA 2QYSA 1E4EA 4FW8A 5I7WA 5EUQB 4BLRA 5DNAA 3CCCA 2WU1A 3GN1A 4AZ3B 3DM5A 1KDVA 3M2PA 3CX3A 3I37X 1E20A 5A0FA 1IJEA 1TADA 1OKKD 2XRFA 5HIAA 3DV2A 1BFDA 5LMNB 3CRZA 3FNRA 2ZI6A 1XLUA 3EBLA 3JCZA 1KMIY 4FDMA 1VJGA 3VKFA 2JARA 3LCUA 2VPIA 4QEDA 3K9FC 1PDVA 1NRWA 3L5KA 3AIIA 3NIWA 2APJA 4AZWA 4H0CA 3EQZA 3T3NA 1D4FA 2HGSA 1GQ2A 3SQXA 4OSEA 1SXQA 4ZVOA 4ZVKA 5LIRA 2Q07A 3BE4A 5C4GB 3LP5A 5K0ZA 3R3HA 1SOAA 5GZ3A 4C5CA 1W4CA 4F45A 1I7NA 5ALMA 3QMWA 4G26A 3GUZA 3VPSA 1FDOA 1SU7A 4NDAA 5FBZA 5FL7D 4MR8A 3KPWA 4UNPA 1XK6A 2XSZD 3A4MA 1RWQA 3DHWC 4Z0TA 3ZCTA 3EXHC 4DSOA 2Z3ZA 3SM9A 5IARA 2JAPA 2AS0A 4L72A 4YNBA 3TJMA 2FSHA 3P9QA 2HK7A 4KUHA 4MVCA 4US1R 2Q1XA 3HKCB 1LV8A 3WLTA 1Y8QB 1I4OA 1PR9A 2FUG1 2UUCB 3KE8A 1S2IA 2RK3A 3FWYA 5SY6A 4MRAA 2XUPA 1JIIA 5JY1A 3FFAA 5HOEA 3C48A 4PZPA 3I5XA 1W73A 1BWPA 2QNRA 4NYMQ 3TXXA 3DL7A 3VNRA 3AJ9A 3HBLA 3C5HA 1UP7A 3ZE9A 1I7LA 2YWCA 4OGGA 5CX4A 3WAKA 1V8ZA 2MJLA 1H0SA 3B6JA 1GNLA 4GKVA 4DUGA 4JVMA 4DQXA 4XUCA 2JRLA 3TIVA 4PR3A 1CZOA 2VPWA 4B8ZA 5T4EA 1OX4A 1YBMA 3HB4X 1OI7A 1P33A 3MB8A 3NC0C 3GX1A 1M0TA 2OGTA 4V3BA 1AV7A 2F9FA 1MOPA 1EUCB 2NTEA 1PCXA 2BM0A 1SRQA 2OLEA 3FCSB 3KXIA 4H3SA 4IIJB 4U6SA 1U5BB 4DLUA 2Z8YA 4J2OA 1J6UA 1MZPA 1KL7A 1U8TA 1W1UA 2XHEA 5F73A 2DY1A 1MB0A 1KO1A 1ZLYA 5E38A 5AW8A 1A7KA 4GR5A 1XXHE 4BX2A 4FZVA 3WBKA 4EFLA 3C39A 1NUHA 3OCZA 2RIRA 3PQCA 1KEEA 1OFUA 4FN5A 2ZVJA 1CPYA 2J6HA 5AJWA 1GKUB 3VDRA 5JY6A 5KVAA 4TRRA 4LX0A 1IBSA 3IRVA 3PPVA 3HABA 4J0HA 3QBTA 3NHWA 3VMFA 2ZPTX 1KPIA 5LYJB 3D3NA 1H4SA 1YA6A 2Y0DA 3UWKA 3NTXA 1M1YE 4NU0A 1OAOA 4LIPD 4N7JA 2Q5EA 5K05A 1GRCA 1K89A 4L07A 4L5CA 1XD8A 4LDJA 1U28A 2C1ZA 3WQBA 1LNZA 3MIZA 4XJSA 4AY3A 3AGPA 5GZ1A 2GLTA 4DVJA 4REQB 1EHIA 1Z45A 1OFGA 3H8JA 4HQ6A 1ES9A 3C1TA 4PE5B 5DFAA 3PEWA 1COWA 2W2OA 1Q92A 3JW8A 4QGHA 1EX1A 3IKMB 4KK4A 1LS1A 2MINB 2UVPB 3QOFA 5FJIA 4FGZA 1XDGA 4YT8A 4HWSA 1ZD4A 3AB7A 5A04A 4ZAWA 2C7GA 3FAZA 1ZEJA 4XE5A 3BCUA 3R44A 2NNWB 1X42A 1OTXA 2C04A 4UU1A 1L5HB 1RMQA 4IFBA 3INGA 5DHQA 5LOVF 1QU3A 4RZXA 4IDNA 2OORC 1T4BA 1RC1A 2IYTA 5KU7A 2PJDA 5HW0A 3BH0A 2X3YA 2WVAA 4E70A 1RLTA 1XMJA 3I61A 5BUCA 3FDZA 4JQOA 4NOKA 1CEQA 4EPYA 3DLBA 1FEZA 1TJNA 2J0VA 5AWFC 1Z0UA 1NQAO 5DBEX 3GGGA 4ZEVA 1IN7A 5TGDA 4F2DA 3TNDA 1K06A 1AK1A 1YGYA 2BD0A 3LHIA 4EATA 3CR8A 5CFNA 8AT1A 1HURA 2CL7X 3LCJA 2BY4A 3ORYA 1T6ZA 3U1TA 3M6IA 3OTIA 4QVKA 2YX1A 3UOWA 2R8XA 4DT1A 3JXEA 1ATIA 1C4XA 1OLSA 3ZWVA 4ER7A 4LYFA 2Q5FA 1AY0A 5ECDA 2UYOA 1KFCB 1CUEA 3L0YA 4I4IA 2PYDA 1X86B 2ALJA 4JU8A 3WDMA 2Q3FA 4U7GA 2DXIA 4YLEA 1BGXT 3L1UA 5FFNA 5KEIA 3BJZA 4YRNA 2G80A 3B52X 2AYYA 3I8SA 2KW5A 1GG9A 2EP7A 3E7PA 4M1QA 1KVRA 1EWVA 3HR8A 4KXUA 1MHPA 1SXJC 5DHSA 3DF7A 1PTKA 1YB2A 3NUZA 2I9KA 1QFMA 1FLAA 1DPFA 2WSYB 2ZUTA 4BLSA 2ZBPA 3JALA 2BTEA 3KSRA 4Y98A 1XHEA 3DT6A 2EZ8A 3ABSB 5C5CA 4D43A 1V5FA 1JPJA 2C1XA 2BCJQ 2XVZA 2R66A 3O84A 3QXSA 3FHOA 4M1EA 5IVDA 3FG9A 4R98A 1PG5A 2ZSBA 2XUDA 4K6CA 3W79A 4B7ZA 4IDBA 1N32B 4X93A 3GH1A 3D43A 3QKRA 1FP7A 3UK0A 1H23A 4F38A 5FJJA 1M66A 4DMGA 2RH5A 2YOHA 3FXAA 4RSHA 2X23A 5EIFA 3WNVA 3WLJA 3AHHA 3RTCA 5FA5A 1D0IA 1AKNA 1ZKMA 5CDGA 3D54D 2EYQA 1IY1A 1BE6A 2B1RA 4IV0A 4XWTA 1WCYA 3INYA 2DT8A 4G8JA 1WSAA 3STWA 4N3BA 1RWOA 3OHSX 3R5XA 4KXVA 4AROA 2WV7A 5JYBA 1AN9A 4IDAA 3N53A 1ZN9A 4WK6A 2WKPA 4NPHA 1AQJA 2PS3A 4D6XA 2B8EA 3OTWA 2WSBA 1QFJA 3K92A 4HX5A 1EB9A 4N01A 2Q0SA 1LLDA 3F4KA 1TM3E 2G9RA 1O94D 4WFIA 3HCAA 4TL7A 1YHYA 3NALA 4N1AA 2OT3B 2V9CA 5TS2A 2P9YA 2E21A 1VPTA 1TLLA 1XTJA 1DCKA 3CH7A 4I4NA 4C07A 1T2FA 4X7MA 3SS8A 3NYIA 4COKA 4E2WA 3PDIB 5E3HA 3FDJA 4NEQA 4IJ5A 5E2BA 1M73E 1R37A 1P5ZB 1XVIA 2FF7A 2GDZA 3LKVA 3ZU3A 4ALNA 4C08A 5KYXA 3FSGD 5LSAA 1FDTA 4HP8A 4RZHA 3U7GA 4DMHA 1LPNA 3K20A 1LSOA 1PGPA 1RADA 2F1OA 3GK3A 4FFVA 4TV9B 5DT2A 3DDWA 3TRKA 3QVGB 5KUTA 1AD2A 2F3PA 2ZSKA 4JJ6A 4M22A 2IC5A 4MUAA 2ZREA 4BNJA 4C6SA 4YY3B 3QOYA 4IJQA 2JGJA 2YNMC 4HWKA 2G08A 1T15A 1GP2A 4FGSA 3NBZC 1R12A 4JQZA 3K5IA 4BVFA 5IYZA 2IHBA 5IANA 5G2OA 1JIKA 1LBTA 4FYXA 5ALWA 1F3LA 4RXUA 1R8QA 4XWGA 4YUZA 2MSNA 4M0LA 5EIHA 4FOOA 5EHGA 2RDMA 3CXUA 4JEHA 2BFAA 3MEQA 1E3DA 1XB2A 2O2CA 1QG0A 1E0SA 1TFUA 3RAGA 3BMCA 3WGHA 2EJUA 3LC0A 4K6KA 4I9NA 3KQSA 3HY6A 5GJVC 2H57A 4WADA 1ZSNA 3GEEA 1BXGB 1JFLA 3CR7A 1EVKA 2QLJA 4QU5A 1K8YB 1W5AA 2BJWA 3RFUA 1OVMA 5DGTA 3HNOA 3P97A 5EKDA 5ELMA 2Y67A 3C3XA 2H54A 3BB4A 1Z37A 5AIBA 1K7FB 4YAKA 3MINB 1YC5A 4ZU3A 5AVUA 4PV7A 1QIGA 3BRQA 1GKYA 3NU1A 2QPLA 4Y2GA 1UDBA 2OD2A 3JQ6A 1U2ZA 1SZJG 2CLFB 4IEFB 3F98A 1ZL2A 1ULHA 3WQRA 1ZGGA 3N0RA 2H9AA 4IYJA 1IWOA 2ZU6A 2OZKA 1DAOA 3TVYA 1BDMA 1MT0A 2DFLA 1QRAA 2IS6A 5HVNA 4RIGA 1HYGA 4H1UA 1F5NA 3FOZA 3DOUA 1V5IA 3EAQA 4ZRNA 1RCUA 2IZZA 5D3KA 4H1HA 3ITDA 1Y98A 4XX1A 3Q87B 5ANRB 2VAWA 5GWXA 1T2DA 4MROA 4YFVA 1FFEA 1KZ4A 2DFPA 3H9JA 3Q6MA 3T94A 4AJKA 4ZO4A 3FCXA 4R0VA 4R1MA 4AKTA 3VYRB 3FMFA 1WP4A 3G1WA 2P9JA 3NHLA 2C7BA 2BBOA 2PFGA 1UBCA 3AJDA 4KE7A 4BFVA 2NT3A 3AWIA 3G7NA 1ADGA 1EX6A 1QYRA 2FZ4A 2R00A 3FPFA 4O29A 1QLHA 2VRWA 2RBGA 1ZKDA 5C3MA 1L4NA 2I67A 1GN8A 3GHYA 3KTAB 3F7TA 2VJMB 1XL1A 4NAUA 4MMXB 4OGWA 4BLTA 5EJ2A 3E22B 3EIEA 3G1UA 4Z0HO 4TRNA 5B7NA 2ZZMA 4JBGA 4UBMA 3SQDA 1L9XA 1PNOA 3WDKA 3OKAA 4WFJA 1QFXA 1GITA 1YL7A 2HBRA 2ZXEA 1DKNA 2OBYA 1D09A 3DWEX 3ZV3A 5KQRA 2NSLA 1EG2A 3GARA 5IM5A 2NXNA 4KLAA 1RXIA 4OJTA 2R7KA 2VTBB 3HJCA 2Q28A 1PZMA 3I01A 1ZM7A 4S2UA 3TR5A 1E1KA 3IPLA 2I8LA 4HUJA 1MKYA 3HKDB 1BJTA 4QAQA 2ZIGA 2JVKA 4TOIA 2X4IA 3E4DA 4XRRA 4CV2A 2AW3A 1FTNA 3UAVA 2IYPA 4B6SA 3HL4A 4K26A 2GD0A 3E9NA 3NH9A 1ZWLA 5HDBB 4DDVA 2C5SA 1VM6A 2G6TA 3BQ9A 2RIPA 2YZMA 1R4MA 1W0JA 3HM2A 5J40A 4DHEA 1IXSB 5LP1A 2ZWOA 3PGA1 1MENA 1NVDA 3QQPA 3ZY2A 4P4LA 1F4PA 3D5EA 1G3UA 1J33A 3B60A 4M8SA 3QRWA 2CXQA 4J4HA 4OEHA 4TRJA 3ASUA 3VAZA 1YU9A 2R751 1KYZA 1JDVA 3EPJA 4BRUA 1H8HA 4ZEMA 4GRIA 3T5AA 3K1YA 4Y8VA 1QO7A 5LXTB 3AESB 3B6MA 1QTQA 2CL6X 2Y2UA 3VPGA 4DNXA 4MYUA 1D1TA 1P3Y1 1UBMS 4PIPA 4TT3D 5KTNA 1NFQA 2VJBA 4OAQA 2C9YA 1V1MA 1L8LA 1U9CA 3UHAA 5JH7F 1V7PC 2BTQA 1UWLA 3LUFA 4U7WA 4QUDA 4IIUA 4EKYA 2R6CA 4LQ4A 1ZIPA 2QMUA 3WDLA 5CEJA 1CRWG 1EE9A 4GPAA 4UDOA 5DLDA 4BE7B 4MTLA 2ABWA 2HT1A 4PZYA 2XTAA 2GM3A 1NVGA 3HE3A 4Q37A 1WUTA 4L78A 1CETA 1X6VA 4U4AA 4ZCMA 1VCNA 4XOUA 2ZU0C 3SNKA 3IELA 4DN6A 4DSTA 1QH8B 5IF3A 2ZRLA 4RZSA 2KBFA 3EVAA 1U8ZA 4UAGA 3PNQA 3K0AB 3V7UA 2A9PA 1N0UA 2HA6A 3CT6A 3MGCA 4EGJA 1X3SA 3Q3EA 3U4HA 4U7JA 4NJEB 3N8DA 2JW5A 1WU7A 3CHYA 2C0QA 3CUSA 3ENWA 3FYHA 3NHZA 4JR1A 2HAEA 4YREA 5EZSA 5D8DA 3ZCXA 5BO5A 2WWGA 4XB6B 2GZ2A 1ID8A 3COSA 1RAIA 2H1SA 3PQ4A 4RYDA 4X66B 1SIWA 1X2EA 4BMNA 1Z2CA 1SEVA 5CFZA 4D9KA 2O2ZA 3OMLA 2FDXA 1X0VA 3TLCA 1CUVA 5JFTA 1NVBA 5G4KA 2G4LA 1EA5A 1JLRA 1JQ5A 3DDNA 3DMPA 3MLEA 1U8CB 1E1RA 3GIDA 4O0LA 3DM9B 4OF4A 3WBBA 3K9CA 3PEUA 1SUAA 4R0MA 5B4VA 1Z22A 4HNSA 1RHRA 1T5TA 1XNQB 2VP4A 4HN9A 4F9GA 5DM1A 4Z9FA 1KDZA 1JR2A 1LS6A 2VXYA 3C15C 2XOKD 1YZYA 2ORED 2YHSA 3D6UA 2WJ4A 3THYA 1I01A 2QP9X 2WTMA 1YR3A 2V4ZA 3BZUA 3IQWA 5ERGB 1NYQA 3N59A 4UKDA 5F21A 1KQFA 4KB5A 2IY9A 2WQ6A 3B7WA 5IXYA 1PL8A 3AW8A 4YT4A 3N2GA 2JRCA 1KDTA 2R6JA 4LE1A 4WWHA 2ZYRA 3REQB 4DYDA 3EW9A 3OU7A 4HVLA 2IBMA 3D3WB 2HY7A 1LZLA 1QIFA 1GIAA 4FYVA 4UNIA 4F96A 2GZAA 3I12A 1RBZA 4RVUA 1AU9A 4AJ2A 2J3HA 2PU5A 5CH3A 4ZAZA 5L7TA 4NV0A 4HN4B 4QG3A 4PSCA 4HXGA 2ZPUA 2MYUA 4E51A 1GXSB 2PKQP 4MUXA 2ILVA 3SXUB 4PNPA 4Z2AA 5JNVA 3ZXIA 1RRKA 4AB1A 3R9IA 3E9CA 2AJTA 4PIMA 1G38A 1APBA 4J76A 4UNNA 1RZVA 4ONEA 2IVZA 2YFQA 2DFKB 4Z4GA 1N6IA 2J0UB 1FP4B 1X92A 5BW8A 1NASA 2CLOB 1E96A 5KWSA 2CE7A 1M7BA 1N7JA 4WFKA 3JD1A 5L6MB 1OI2A 7GPBA 3VR2A 1ZP6A 4OGKA 4P2BA 4H0NA 1Y6GA 2P8JA 4CF7A 1JJBA 3DFUA 1BKYA 3O8LA 1T2VA 3EEYA 3MJVA 4NYIR 3QI7A 4HJRA 1FMCA 3ETCA 5A6VA 1UBEA 1L4MA 2PA3A 1KEWA 2RC5A 3F2IA 3IBCA 4RK5A 3RIXA 4DANA 1Z0IA 3CG0A 3L01A 2NO4A 5KI6A 2KWIA 3GZNB 1KOFA 2WIBA 4OYHA 1W88A 5FOUA 3LQKA 4XXHA 3R5KA 1YNSA 2NAPA 4A16A 3FPCA 4KXNA 4Q21A 2J9YB 2OFFA 2JI4A 3JQAB 4XJVA 3T1TA 4AX8A 3OZAA 1TF7A 2IKQA 2EKZA 2HPVA 1QHEA 2PUHA 2W4MA 3VJKA 2I80A 2KS6A 3Q6NA 3SKXA 3KWMA 2IEDA 3Q7RA 3QFRA 5DP1A 4YMUA 2IYUA 3RVLA 4HY3A 2A0WA 1U2QA 1GTG1 4UHBA 1KO8A 1Q0LA 2XCQA 2QX4A 4Z3KA 4X84A 2VDQB 2C2HA 3FYUB 3HBJA 4XLZA 2Q21A 2XRYA 2ZOSA 1GDHA 1NNLA 1KO7A 1NY6A 2CXUA 4JGIA 4UTVA 2OZEA 2OAEA 2WTUA 1E6MA 3KOXA 4R3WA 5G0SA 1JI3A 1U0LA 3G5MA 1GLNA 3IAAA 4GOXA 4HWPA 4IYRA 3LWBA 3KQQA 3UNXA 1XZNA 2JIMA 4I99A 4AZSA 1QHYA 1AF4A 3A6JA 3G85A 4X6UA 5CLLA 5DBGA 1MV8A 5DNDA 4G8BA 3NKVA 3AXSA 1ZVKA 4QYWA 1GGEA 4IZIA 5BP7A 2H2GA 4RTRA 4FXOA 3SZLA 1P2SA 1LBHA 4C30A 2QLBA 1N2BA 4BNHA 3EOBI 1QSGA 1BEEA 4BMOB 1KIAA 1UKEA 2OK8A 1BH6A 3DW1X 4FCCA 4JMPA 1E3SA 2G67A 4UM8B 5KS2A 4H17A 5JDIC 2PRKA 5EMKA 1H2AS 1R2QA 2CYAA 2WWRA 3ZLBA 1JTFA 3NC1C 1YZKA 4OU5A 4RVNA 1N6LA 2PT7A 3GFSA 3TSWA 2LD4A 4JEUA 4XQEA 3E9EA 4ZI7A 5K9ZA 2R6GA 3ND7A 4Y2SA 1KK0A 1VP9A 3DPSA 2EBWA 2ODTX 1O03A 2AN1A 4BFSA 4MI1A 3FLBA 4CTKA 3IR5A 3C3WA 1WB4A 4OHMA 5KYKA 4W8OA 1IZ9A 1WP9A 1HSOA 3KZ1E 4RH3A 4XIIA 3P9CA 4NECA 2JEYA 2P2CA 2JCBA 2ANCA 1L6RA 1ODKA 1VKHA 3H2ZA 4FLEA 4KG7A 3STYA 1YS1X 1LDBA 3NJRA 3VPAA 4ZN6A 4GC5A 5FX2A 4KO4S 2BM1A 3IUNA 1KS9A 5CTAA 3VV3A 5FTNA 1Y9AA 1EUZA 1KI2A 1MAWA 2HH9A 1X7YA 3NWBA 3W06A 7REQA 4ZVVA 4AMYA 3FTQA 5ALNA 4AZVA 3FCUB 3PFKA 3ZWDA 4BGIA 3RPEA 1MB4A 1BIFA 3DKIA 1R5BA 3E5HA 3LK7A 3MM4A 4Y0NA 1A1VA 3T1YB 3R9XA 2BGRA 2OHXA 1F2VA 2MU1A 4EPTA 4M1TA 2R84A 3NASA 1NQOA 4RLSA 2B69A 3I9LA 4L7VA 5TPZD 2PANA 1P2VA 3CNEA 5AFSA 4NABA 4A4DA 4Q7LA 2XH8A 1QTNA 4CTMA 4D0SA 3PBKA 4JOSA 4E0BA 4DMMA 3RAEC 4NICA 2LCFA 4AJEA 5JWHA 4PX2A 4D25A 1JT2A 1KBQA 2I66A 5DGIA 5SYNA 3S44A 4ZP1A 2YR0A 5FH9A 2XJ9A 4KBYA 1CRZA 3G9ZA 1O89A 1IHDA 3GRZA 4AP9A 4B3HA 2BTOA 4EENA 3QVWA 1LJUA 5F7JA 1H2YA 2X41A 2H16A 2CSXA 3OIYA 3RYTC 3VTZA 4FT4A 3VR0A 2J9FB 1GGFA 1A82A 2AOTA 1UBRS 3ODGA 4WIAA 4M86A 1N3IA 3A9SA 1Y33E 4W4TA 1Q0PA 5I7EA 2B5VA 4GOND 1P2GA 1BX1A 3ORRA 3IC5A 2PWAA 4PHCA 3IOEA 2PXXA 5IJWA 3TXAA 3D64A 2EFGA 7ADHA 5IC4A 1BTOA 4B6FA 3L7CA 1E9FA 2R96A 4D45A 4Z53A 1FVXA 3D3EA 1KVQA 1QCZA 2GYYA 13PKA 3EODA 4GI5A 4KPGA 1Y3DE 1V45E 2Q4EA 3WISA 2ZXUA 3OCXA 2ZE5A 3FH0A 4K05A 1C3XA 1YZTA 3UG7A 2H59A 3GLGA 3SC2A 3QNMA 1WPXA 1X15A 4AZ0A 2YY6A 4MKRA 2YY7A 1U1CA 1WPRA 2C9DA 2QJWA 3DKVA 2AUTA 4DDUA 4M0CA 1Z6GA 1EE2A 3KLNA 3PYLA 1MCZA 3QX7A 5GIPE 2C57A 1P1CA 4LHEA 4JV5B 4KR9A 1ACLA 4V0LA 1VCHA 1X1TA 5K0EA 5FADA 3WV4A 2PSFA 4X45A 4ETIA 1OA1A 3NM5A 3QKIA 2IIVA 1L4LA 4HLQB 2H1HA 4DLBA 3OPQA 4J9VA 4B3CA 5C81A 1B2LA 1H42A 5KKNB 3L5OA 4N3GA 3U1VA 1RC8A 4HAZA 2GGSA 5CLIA 1G8YA 1O87A 2CJYA 4N0MA 4FEYA 1U04A 1X7XB 4NBLA 1TZMA 1D2RA 1DV2A 4LJSA 4MKFA 4B3MB 3IO5A 5JZMA 4K86A 1SR8A 4LHWA 4CPDA 3BH6A 3OO1A 4G0ZA 2VUTA 5JS2A 1QQ5A 2Z8YM 1YE3A 3EEOA 2OO7A 3GJ8A 3ON5A 1SUPA 3USCS 4J1TA 4JJZA 2DJIA 2FSVC 4GWGA 1JG6A 2C4KA 3KQTA 3E82A 4G4JA 5AMXA 4XPIB 1FF9A 5F64A 3CLSC 1CZHA 2NQTA 3U31A 5KNCD 1OX6A 4QDJA 4MUIA 1NHWA 3E3AA 3DUFB 4M0DA 4ESEA 4I4CA 3CSSA 3PI7A 3S2YA 1N2SA 1XTIA 3WGNA 3F2VA 3CUYA 3FZYA 2XZDA 3ANLA 5IUNC 2H7CA 2I4IA 2JFYA 3A1TA 2E1PA 2W8BA 2GBFA 4HS9A 2I03A 4MKHA 2EZ4A 2VYCA 4H3KB 4DCNA 3A3NA 3D1JA 3W3AA 3T6KA 2ZZKA 1BX0A 4X1IA 2XDAA 1S1MA 3KSDO 4CDNA 1DCMA 5IDQA 4NENA 2Z9BA 2RGYA 1Y63A 1NWHA 2OC9A 4RF4A 1OC4A 5I9TA 1GQRA 2GN8A 5REQB 5K8TA 8ATCA 5FWXB 4P8RA 3BEDA 3W5DA 2KSQA 3BMOA 3PYMA 1Y81A 3H6GA 4K1LA 4K9KA 5AVVA 2AR7A 2BGUA 4DCCA 1HI9A 5MGBA 1ZMBA 5DE3A 5ALTA 5C1PA 4B7AA 4RFSA 4TZ0A 4WRRA 1LK0A 1E7SA 1TRKA 3RHTA 3NEAA 3AOGA 2EAUA 1W34A 4LZJA 4S1OA 3NVDA 2OKGA 4DOMA 4IUYA 2GOYA 4RLHA 2VJLA 4CM3A 3TLKA 5TMPA 2Q3BA 2HRDA 4I7EA 1QWOA 3RVMA 3PIRA 1P0CA 3ZHRA 5AVRA 2BOVA 4W82A 3ETEA 2HHHB 3C8ZA 3RR2A 1OWPA 4BMDA 2C95A 2H4FA 2ZP1A 4RIIA 1R0LA 3ICVA 3L6CA 5F3RA 4W99A 4G65A 2O8BA 4ON9A 3PQ2A 4RM2A 5EMHA 1JDBC 2J59A 1SD5A 3S2FA 2LGJA 4YRGA 5I4BA 5GADl 5CLGA 3GWZA 3L1KA 1AB5A 1PZXA 4UARA 4WZBB 5JBQA 5K2OA 5HM8A 3O1IC 5JJCA 2OBBA 3PLRA 3EXFA 3WFZA 3H5OA 1JF8A 2GPNA 1U2RA 3RCBA 3CWQA 5TX7A 4IZ6A 4Q9IA 2CVOA 4FGWA 1O8CA 1KO4A 4KTTE 4CLOB 4YDRA 2CMHA 4F1JA 2EKPA 4MVJI 4D8WA 3NOQA 2QI9C 3PFGA 4GD3Q 3V4LA 2XX3A 3M1LA 4QHYA 5CDHA 5LZ4A 4CFYA 2GPBA 5HUHA 2JFZA 2VWQA 1N5RA 1HBJA 1A95A 5LQMA 2Q45A 3THOA 1DXQA 2CLHB 1G5HA 4J8PA 3R7LA 1E61A 1NULA 4KDEA 1N8KA 2VNKA 2GKGA 2UXCB 4MCIA 3FIJA 1BDBA 4K6MA 1C81A 4HLUC 2PWYA 2X7JA 3GA0A 4CEHA 3USES 421PA 1U8YA 3P0JA 1ORTA 4NOMA 5IKEA 2PH1A 2WU4A 3BWBA 4NBVA 4U8HA 4GKKB 3AYZB 4OHZA 3KFXA 5CB0A 4LRUA 2GA9A 4QOJA 3S29A 1OYOA 3B3QA 1NOIA 3DOIA 3DHEA 5I5GA 3UGTA 1ZIXA 4KR3A 3NMUF 1SBYA 1C1XA 3L40A 5JALA 1D2GA 2C2GA 2EFCB 4HNHA 5BY2A 1HMPA 3LX5A 4YPOA 4UD6A 4C7OB 3W8FA 4PICA 2NM0A 1U9ZA 3JQRA 3EDOA 4MVJG 4X1KA 2CBXA 1M5UA 3VX3A 2ZRAA 2WWWA 3AERB 1LFAA 4JYCA 4CCYA 4AY2A 3V4OA 2CVPA 2OPBA 2B1IA 1CP3A 3HTXA 3G5UA 3NDIA 5B4UA 2GN4A 3DTVD 2WYIA 3F3KA 2D0OB 3VHRA 3GBPA 3OOJA 1SPBS 2IEZA 3WIDA 1XAJA 2ODPA 3AK4A 4PQYA 2FW6A 4NCIA 1DXYA 5GV8A 3K5WA 4C0AC 1CE8B 4CMEC 4I5IA 1II9A 1OIWA 2C1EA 3QPAA 4ZHQB 3T3OA 1XOIA 5JS7A 1UMDB 2D7JA 2X1LA 4ND4A 2V7GA 1ZRSA 2R7LA 3U60B 4TPKA 2PFSA 4RA6A 3MWEB 4XYGA 3CPHA 1VSQA 2Y1KA 2X86A 2CLMB 4LZZA 1TEZA 3EN0A 5ALKA 5DN6A 3UHOA 2PUVA 1QFYA 1VRWA 3LC7O 3V80A 3ZBQA 5LPNA 2HLNA 4POAA 5F12A 1TMGE 1E9AA 4UDYX 1X1BA 3W2IA 1GQYA 2JGEA 1EWKA 1G4AE 3EFOA 3Q7TA 3UUWA 4LTMA 2IQIA 1QHIA 2ECOA 2LBPA 2WNIA 3BC1A 4HGRA 2GEFA 4P3OA 3SMVA 2D1TA 2Q0XA 3B51X 1W9MA 3E9MA 1SXHA 2WI8A 4K1XA 4Q1EA 1QIIA 1EFRA 4QYSA 1DT5A 1U9YA 3R2JA 4QT0A 1SCNE 1U7ZA 2XITA 1NATA 2A9OA 3JX9A 3QJGA 3ABRB 3LVFO 2PCJA 3STUA 3IMCA 3V46A 1JWAB 3MG9A 2YDXA 3SSOA 2YZ2A 4BS9A 2PZ8A 4BO5A 5IUJC 5JMWA 2VDKB 4BV8A 4L16A 4D92A 2VJNA 3QY9A 2AF4C 1LRKA 5TF0A 2PDAA 1J8QA 1SK8A 3MRVA 3CVVA 1HNWB 2HNBA 4V3CA 3H3JA 1N3BA 1RS0A 2XY4A 1BN6A 3CSUA 1VJRA 1ZQ1A 2I3ZA 3O8RA 2X4DA 4AG5A 2C8JA 3BRWD 2PGIA 2OR3A 3U7QA 1PBTA 2F3QA 3CNBA 3BEOA 5JIBA 3PKJA 1Z12A 3D2BA 2BCEA 4E1VA 1YRBA 3EZ2A 3TUJC 3HWRA 4FGUA 4LYYA 1UR5A 2YIDA 4MR9A 4S2EA 1U4OA 1JX6A 4WK0B 5ECGC 4JLUA 3TR6A 5HQ3B 3CUKA 4H27A 1I7QB 2ZYIA 2IWHA 2WHPA 4DSNA 4DR5B 3M33A 1VG1A 1IZZA 5EMLA 3U7FB 1SWWA 1JEYB 1OLUB 3H04A 5HJ2A 2AJ8A 3X2FA 1QVWA 2ZRJA 4NIMA 4A82A 2OFOA 5BV8A 3LGSA 5EHQA 4CMJA 5CAEA 2VDLB 1PGQA 2X9GA 1NXQA 2AE1A 2P1ZA 2WKRA 3BTOA 1U3UA 3CURA 1DIHA 1JEQB 1KJJA 3QVTA 4XUDA 2XXJA 3V2IA 3NWEA 1K0FA 2R97A 1KJ9A 1E64A 3VPXA 1I30A 4FIZA 3GWGA 3KB2A 2BM8A 4LOHA 3QVKA 1MB2A 2Q5LA 4BQRA 3ZHBA 4B3RB 5KYTA 1BQ3A 2XZPA 4INAA 4TXJA 5CDTA 1UFOA 2EKBA 5T5QA 4PPFA 4DCOA 2V3CC 1A97A 1OJ7A 3EDRA 3EULA 3GGSA 4HLDA 3ZWNA 1AA6A 1RE0A 4FFPA 3LFHA 2Q7OE 3JRWA 2Y76A 1TK3A 2H9YA 2F2TA 4QTUB 1V35A 2JCSA 2FPLA 1L0BA 2AL7A 4YRFA 2W70A 5JRDS 2QN9A 1V1RB 2RJ3A 1XJCA 4PFQA 4QOEA 1FNCA 2EV9A 2VF4X 4LOLA 3I01M 4KMRA 4XR9A 5GVRA 4G0WA 2A9JA 3GRYA 5JEDA 4Z0PA 2A1IA 3MUEA 1Q84A 1NOJA 3KK0A 3NV9A 1OYVA 4IXWA 4TWJA 2WP0A 1TQHA 4LFAB 3H1FA 5JPIA 3P0HA 1FFCA 2CJWB 3SS9X 4C3VA 1FCJA 5D5HA 3TLGB 3LX8A 5FLYA 4JASB 2YUTA 1D1PA 2C96A 1DX6A 3EC2A 2YW2A 3MMXA 4MIOA 5JNLA 3A58B 3AB8A 3R7WB 3QSYA 5AYVA 1XO1A 1DKLA 1EFPA 3MTBA 4HDSB 4BVGA 4C14A 4YR9A 2JLBA 4FHZA 4ZRDA 3RJ5A 5CW2A 1WZIA 3HDQA 1JB1A 2B2NA 2V5AA 2JFFA 5K0SA 2A5YB 1WBDA 2FN7A 2E4UA 1DLJA 3QF4B 2ETVA 4F5YA 2D54A 1BW9A 4F6RA 1ZJJA 4BJ3A 3BK7A 1E1CB 2O2SA 2A9FA 5JQGF 3PPWA 2W2KB 2OWDA 4NYJQ 1JV2B 4M7OA 1SCKA 2NUBA 3EVNA 1U0GA 1ZCFA 3NEJA 3CZRA 4JVSB 2YMQA 3B48A 1W5BA 3GMDA 4M1WA 1Q0ZA 1GFSA 1PUXA 2QUKA 2VF5X 3BL6A 4UOQA 5A4MS 1JQJC 1XN1A 2GBCA 1DTWB 3A1NA 2Z6UA 4ZK6A 1J7KA 1NNSA 2ZUWA 4MA4A 2ZRDA 4LJ5A 3N0XA 4NS1A 2NU9B 5IAAA 4V0OA 3P32A 2HCJB 2Z5VA 1E62A 5TGTA 4BQOA 1IOLA 2QP4A 4BNGA 4A91A 1G59A 4AU1A 2B92A 3BGDA 3H5TA 3DMTA 3DE3X 3FMIA 4JC8A 4M0PA 4MR7B 4NTZA 3AR9A 3OMWA 1Z06A 5HP4A 3Q9SA 1QRSA 1TGYA 3Q2KA 4ARIA 5JPCA 4UXIA 1KMHA 1L8QA 4FGLA 4CF3A 1N9ZA 2ZJZA 4OAOA 3HR4A 5UKDA 3VBCA 4GP6A 1IWBB 5TE9A 5IHXA 1O4WA 1QYIA 5JC1A 2YQ4A 1PR4A 3NHAA 2COEA 5DSXA 1VG9B 3PCXA 1TX4B 3PNLA 4I55B 1SUEA 2AN3A 4O4IB 3IJRA 4LC1A 4NNJA 4D4KA 2AD5A 4Y7CA 1NMEA 4QG7A 2EF1A 1KZ1A 3NX4A 1T4CA 5DCWA 4FWBA 2PUJA 4IJUA 4YHBA 2FU5C 1N2GA 2I1WA 3WRYC 4D0LB 4D57A 4NMLA 1B0AA 2IOHA 3IVXA 4V0SA 4F2GA 4RCYA 5A1TA 5E1OA 4PBTA 1JEOA 4YP6A 5JZBA 3UT5B 3L77A 4UMFA 1WDWB 3WNDA 1I6MA 3TRJA 1B15A 4S0ZA 1ICEA 3VYUB 5CP8A 3CBQA 3IH5A 3IKJA 1GAXA 2QTTA 3PIIA 3G17A 4EG6A 1OXUA 3R40A 1KRHA 2HN9A 3HDJA 5J59A 4P6VF 1IMJA 5JD3A 4YRJA 4DIMA 1B8UA 3OMXA 2O2GA 3X1KA 1ZICA 1M6VB 4H7JA 2QRNA 5ESDA 2YFKA 3UPUA 1K27A 3PX2A 5DCLA 3W9BA 1N6OA 1L5GB 4HH3C 1XRNA 5AOAA 5JSUA 2F3SA 5H4HA 3AHIA 1ND6A 3I09A 1GADO 1BU8A 4MUBA 2P9EA 3T9CA 1GNPA 2YH2A 1SPXA 3UMFA 2H3EA 2QI9F 3GJQA 3K9BA 3PUZA 4HEA6 3AFHA 2VBCA 1RWBA 2BMVA 1YQGA 4CLEA 4WKPA 5A4IS 1FFAA 4F46A 3HFJA 3ADKA 4ZYUA 4B32A 3DYBA 2NXCA 2VH5R 4QGFA 3T1QA 1VGRA 3LQYA 2HMAA 4PFKA 3EAFA 3GCXA 3ND9A 1Q15A 4MAFA 2VK2A 4OQNA 4BP1A 4ZC1A 2G9QA 3TTSA 1TRHA 4Z4HA 1IUOA 1QHSA 1AX9A 4M89A 2OCYC 2VHWA 4KRGA 2O2YA 1YR7A 1FLNA 4W5JA 3INRA 2ZT8A 1CLEA 1M8KA 3W1EA 1M5RA 3U3MA 1ULUA 5L8VA 1Z82A 3RFTA 3ZV4A 4MV3A 1AM4D 4I5DA 3EGXA 2FN8A 1ONPA 1RAHA 2OOKA 2WSIA 3H2KA 4J90A 3FFTA 1R0KA 4MIKA 3VO1A 5I51A 2QBYB 4C4TA 3WGGA 2JLYA 2X8LA 4KQWA 1CP2A 3CRRA 4QOFA 1TQ8A 5D01A 5F1OA 2XT9A 5AP9A 1E7YA 1PWEA 4YJFA 4DB2A 1QFZA 4AIRA 3T4EA 4CI0B 1Q1EA 1RNLA 1GG8A 1TIKA 1V43A 3HN6A 4AFNA 1CR1A 1J9ZA 2XB8A 3D0KA 1G20B 3WIOA 4KR0A 4LTNA 4DT1B 2PL5A 4WLUA 1J25A 3L6UA 1IZ8A 1XCBA 1FX1A 1RWWA 2QY6A 2HMSA 4XR4A 1EQAA 3H2JA 3NBKA 3ND6A 1JIVA 1LH0A 1ZLXA 1VBMA 4DRXB 1HYEA 4LMPA 1Q7GA 3EF1A 4GEKA 3NBUA 4LBYA 4C3ZA 4YCLA 3HJGA 3CKKA 1PS9A 2NZJA 3EGDA 4W9RA 5BT8A 1P72A 4URFA 4O2AF 3HXMA 1H2ZA 2L17A 4MV4A 3UZUA 2RAFA 2DUMA 2PU7A 4HNAA 2WT9A 3OJWA 4LNHA 3TTWA 4ED9A 4PAQA 4LRSB 2GYVA 4GR9A 5CCDA 5DM70 1YB6A 1VLLA 4RPCA 1H22A 2R8PA 4O3FA 4WH0A 3VR2D 4XYLA 2JJ8A 3K72B 5JI3E 4HDQB 5D1HA 3K70C 1PHPA 1AE1A 3RFCA 4HCJA 3VKUA 4AMGA 4DGQA 1PSZA 3ND8A 2A5FA 2VDOB 4TUYF 4Z1MA 4AQYB 1EJBA 1OWMA 2O2JA 2XB4A 3BSWA 5JROA 3V8NA 3TOSA 2BSQA 1CQXA 2NTVA 1OXBB 2B25A 2ZSDA 3BJIC 3GUYA 3PRKE 1ENOA 3AZQA 3WNCA 2Z5GA 1FNBA 1QPBA 2CFOA 3S8EA 3I72A 3GOQA 1QPZA 4TKVA 2X0JA 1G7CA 2IDKA 3JRNA 3M1YA 3IFSA 4JD5A 5IBQA 5IN5A 3QI2A 2G63A 4BGUA 1A3CA 1GZDA 4BNDB 1K4MA 4D4JA 2YV1A 4K0KB 1USIA 1QQAA 1C14A 3KLOA 1FBNA 1PX2A 2DECA 3TAXA 4E46A 4EVIA 3F1KA 3ICQB 3E9YA 1FIUA 1Q7RA 5D5QA 1VMDA 2A57A 1YONA 4LNAA 5AVXA 1GZ6A 2I71A 1QAQA 4WGGA 4JBLA 1VI5A 4EB8A 4G97A 2DWCA 4IWYA 1JAXA 3FBGA 2OKCA 3CUVA 4ZQFA 2LCIA 4NZPA 4UUMA 4X5OA 5EC8A 4UTPA 2BEUA 3HADA 1WNTA 3KJGA 4A92A 3L18A 2YTZA 3C3EA 1EWRA 1W85B 4NL4H 4B47A 5FLKA 2QL5A 2WRZA 3PFFA 3TIIA 1GZ7A 1XWIA 2ZBDA 4QU0A 2ZDQA 1JG7A 4B4DA 3LKBA 1WPGA 1VL8A 2EG9A 4HC4A 3EVFA 3KKNA 5DTEA 1J2EA 5EPOA 3RKSA 2PUBA 4WTOA 3WYCA 3PRYA 2FUKA 4MB0A 3CZ5A 1V3QE