1RKQA

Crystal structure of had-like phosphatase yida from e. coli
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
271
structure length
271
Chain Sequence
SLAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAVDNAIPSVKEVANFVTKSNLEDGVAFAIEKYVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of NYSGRC target T1436: A Hypothetical protein yidA.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yidA
total genus 96
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 3.1.3.23: Sugar-phosphatase.
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 1rkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rkqA01
3R4CA 1ZRMA 4UMFA 2AH5A 2PR7A 4JDPA 4FYPA 3ZVLA 4IG4A 2EATA 4XQ0A 1VFPA 2WF9A 4CF5A 5AVQA 4YIKA 5ALNA 5AI9A 2CFTA 5AW5A 2ODAA 1YNSA 4ZEXA 1RC8A 1RKUA 2ZBFA 4NAVA 3WKDA 4HGRA 3UMCA 2HCFA 2RARA 2C8LA 4EENA 3AR4A 3SD7A 2Q5EA 1TJ5A 2WHEA 3KZXA 1Z5GA 2B0CA 4KX5A 4YCLA 4YIHA 4QQFA 5AVWA 2YFYA 3IRUA 1QYIA 2BDUA 2FUCA 3ZU6A 2HI0A 5IS2A 1S8OA 5AK3A 4B6JA 3P96A 3QXGA 3W5BA 4UAVA 3SLRA 3A1CA 1Z4LA 5AKHA 4FE3A 1L8OA 1T9ZA 3ET5A 3DDHA 5ALUA 3SKYA 3U7GA 1WR8A 5AW4A 4UMDA 2VKQA 3OTQA 4CNQA 4G63A 4MWOA 4O8CA 2FPUA 2YY6A 2OBBA 2RBKA 3F9RA 1U7PA 2JAWA 4EX7A 1EK2A 2YMMA 3HYCA 3NAMA 4EZEA 3QUQA 5AKIA 4HYTA 3SF0A 2I7DA 1L8LA 2HEGA 3N28A 3N8GA 2G08A 5AM3A 5AKKA 2FPWA 4C4RA 3GYGA 3J7TA 1RLMA 2HHLA 5ALHA 3ZW7A 1RLOA 1RDFA 3UMBA 5AW6A 2JAUA 4HGPA 1NF2A 3IB6A 3ZVNA 3MMZA 1QQ5A 4HGNA 4IFTA 5AVUA 3MPOA 3A1EA 1NRWA 3WGUA 4EELA 1EK1A 1AQ6A 3M9LA 3WKBA 5AM0A 2ZBGA 1Z4MA 2EAUA 4L6CA 1XVIA 4RESA 5AI4A 2RAVA 1L7OA 3KBBA 4BNDA 3PGVA 2HO4A 3L8FA 2WM8A 2P9JA 3CZ4A 3FVVA 2CFRA 3PDWA 5AKXA 1U7OA 1N9KA 5AW7A 2GHQA 3OCWA 3FPBA 5AVTA 5ALJA 5A3RA 4BNDB 3NALA 4QJBA 4KX3A 2YJ3A 5ALSA 4NABA 1Q91A 2IOFK 2IOFA 2W4MA 2I33A 2YMLA 2YMQA 3R9KA 3ZVMA 1KYTA 1U2TA 3L8GA 5ALMA 4Y2QA 5ALVA 2HX1A 1O03A 1LVHA 1ZS9A 2PKEA 3L1VA 2EARA 5ALKA 4DCCA 2R8XA 1WPGA 1Z4PX 2IA5A 4J2TA 4UMVA 5AK6A 1XPJA 2HDOA 2B1QA 4ZEWA 1ZOLA 3K1ZA 5AI0A 3U26A 5AK4A 5ALFA 2WF5A 3DV9A 3E58A 1VJRA 4OCZA 5AICA 5AW9A 3OCVA 3NIWA 3OPXA 3AR9A 5AKGA 3FM9A 4YH1A 5AVYA 1RRCA 2YBDA 3QU7A 4UW9A 3I6BA 4L6AA 2G0AA 4MUMA 1CR6A 4NV0A 1WVIA 4YCNA 3B8EA 2O2XA 2OA0A 2P27A 2G06A 2ZOSA 1QQ6A 2QLTA 4J03A 2FPSA 3AR2A 5ALQA 4Y2UA 2W11A 2NYVA 3QU4A 3WGVA 5AVXA 3EF1A 3VAYA 5AVSA 3OCUA 3HLTA 1RQLA 3QNMA 4EEKA 1YJ5A 4CE6A 3ZI4A 3QLEA 1Z88A 4DFDA 3QU2A 4Y2YA 5AKZA 4KYTA 4BX3A 4HGQA 2Q4TA 2I54A 4UU0A 4EX6A 1SU4A 3UMGA 2NO4A 5ALOA 3M1YA 3RFUA 2MU1A 4DWOA 1PW5A 1JUDA 4UMEA 5AIAA 2YJ4A 4BEWA 3ZTYA 3WK4A 2P69A 5ALZA 3U7HB 2AUTA 1TA0A 1YS9A 4L57A 2B8EA 2HSZA 3OCYA 1T5TA 2GHTA 3MC1A 3B9RA 4UM5A 2G1AA 1FEZA 5ALLA 3WK5A 5AKJA 1ZD3A 1ZD2P 3TLMA 3WKAA 3ZTWA 5ALRA 1WZCA 2YJ5A 2FI1A 3BA6A 5AVVA 5AI6A 1YDFA 3ZWDA 3L5KA 3W5CA 4ZEVA 3A3YA 1RMYA 2WFAA 1J97A 1Z4JA 1MH9A 3OCZA 4Y2RA 3E8MA 2OM6A 2YN4A 2JGAA 2HOQA 2WF8A 1QQ7A 1QH9A 4HGOA 2G09A 5AKEA 2CFSA 2R8YA 4Y2SA 2ZG6A 1Z4NA 4FFDA 3N07A 1RMQA 3DNPA 2B30A 3WK8A 1U02A 5E0OA 1F5SA 2O9JA 3ZX5A 3ZWKA 4C4SA 3I28A 1RQNA 3WKCA 4RETA 2BY4A 1Q92A 1RPZA 1ZD5A 1T5SA 3WK6A 2HF7A 5AHXA 5ALWA 1SWWA 3CNHA 2D2VA 3IJ5A 3UM9A 5ALXA 4Y2VA 2P11A 3W5AA 2C88A 3FGOA 3NANA 1YV9A 4F71A 1Z5UA 5AVRA 3U7EB 1X42A 3B9BA 2B82A 4Y2JA 3WK7A 3MN1A 3SMVA 2I34A 3L8EA 4BEVA 1ZRNA 4NWIA 4UU1A 5ALEA 5AESA 2JAOA 2ZXEA 4YCMA 4PNHA 3EF0A 2R8EA 3ED5A 4BX2A 1Z4QA 1K1EA 1YMQA 3EPRA 4UASA 2BDEA 1J8DA 2QYHA 4AS2A 5AW0A 1TJ4A 2B1RA 4E88A 4YGYA 3FZQA 2C9MA 3E81A 1L7MA 3AR5A 1S2OA 2DQSA 3U19A 4OHFA 4HAIA 1NNLA 3ONNA 3AR7A 1RLTA 3ET4A 1N8NA 3BWVA 3U13A 1U2SA 3KC2A 5AIBA 2WF6A 3FPSA 2FEAA 5AW3A 1ZD4A 2C8KA 3U7FB 4AS3A 1L7PA 4GIBA 4UARA 4C4TA 5AI8A 4KNVA 4AP9A 4Y2XA 5ALDA 1TJ3A 3PCTA 2IYEA 3QGMA 4I9GA 2JARA 2IOHA 5AVZA 3I1YA 4DW8A 1RKVA 3RF6A 2ZBDA 3QX7A 5AK5A 4BYGA 4BBJA 4XPZA 1Z4KA 2I55A 1XP5A 2AMYA 5AM1A 5AKLA 2X4DA 3ESQA 1TE2A 4KNWA 1SWVA 2GO7A 2C4NA 4I9FA 2G07A 5ALYA 3S6JA 4BKMA 4CF4A 5IT4A 2B8JA 5ALTA 1L6RA 4JB3A 2FDRA 3I76A 4NFLA 5AM4A 1RMTA 3AR3A 3AR8A 4F72A 3ZUPA 4UATA 4OFZA 1Z4IA 3PGLA 3ESRA 2FPRA 5AW2A 3NUQA 4H1WA 2MSNA 3QUBA 3QUTA 3A1DA 5ALGA 4XOUA 2GFHA 3R09A 4KN8A 1VJ5A 1IWOA 1Y8AA 5A3SA 2HF2A 4G9BA 3QUCA 3N5KA 2I6XA 1RKQA 3ZX4A 5T41A 5AW1A 5AM2A 3L0CA 3DAOA 2ZBEA 3KD3A 2Q4RA 3N1UA 3W5DA 2GMWA 3WK9A 4Y2TA 3L1UA 2NO5A 4BX0A 4UAUA 5ALIA 3SHQA 4Y3UA 4GXTA 3QYPA 2YJ6A 3SKXA 5FP0A 2PQ0A 3D6JA 3L0YA 1CQZA 5A3QA 2FPXA 4OD0A 4UM7A 2RB5A 2WF7A 3KDPA 2G80A 3OCXA 5IT0A 3EWIA 4Y2PA 3E84A 2FUEA 1ZJJA 1LTQA 3AR6A 5AW8A 1Z4OA 2AGVA 3QU9A 3KOOA 2YMPA 5AKYA 5JJBA 3L0BA 5AM5A 2OYCA 3NASA 4XE5A 5ALPA 3NRJA 2CN1A 4CF3A 3L7YA 5AI5A 3QU5A 1L7NA 2W43A 3WKEA 2R8ZA 3L8HA 1O08A
chains in the Genus database with same CATH superfamily
3ZHQA 3R4CA 1C7QA 3WWCA 3FY4A 1BKYA 2QD2A 2PZEA 3SHTA 4MKZA 3O8NA 3MB5A 4Z4FA 3A4LA 4FFMA 5REQB 1ZONA 5L7YA 2JATA 3QBJA 4K26A 4UHFA 4KITB 3OOHA 2W7TA 1CEXA 1ZITA 4H7HA 5TMBA 4YASA 5B55A 3JZMA 5AVQA 1QKKA 1WUYA 4X7PA 3FETA 3JASB 1L5VA 4RC9A 1FFGA 2ODAA 1NQVA 3P5SA 4DM3A 4R2IA 1DC4A 2NYRA 4NAVA 1SMKA 3VPCA 3KSDO 3DFUA 1UT6A 2JAHA 4WFJA 5T3UA 2I4OA 2JDIA 3RROA 4DMHA 5A2QA 5HHTA 2Q5EA 4IIBA 5IXJA 4HAOA 4PONA 1DKMA 2G88A 1OAOA 2A67A 4PU0A 4YCSA 5E4YA 4UC0A 1N1DA 1LDYA 1FTWA 2BFMA 4MUHA 2QBYB 3DHVA 3ICQB 2HXGA 3O8QB 1QRTA 1JA1A 1WCXA 2CCGA 4QQFA 5HF9A 1JFVA 1D2AA 3SF8A 4II7A 2O3SA 2VNKA 1LW6E 3H5OA 3MGBA 1UXHA 2F90A 4MUGA 3X1YA 5JMOA 1L4GA 5JEEA 2JI4A 4GR9A 4QBIA 2O5EA 4YA6A 4NONA 2JJ8A 4JNKA 2QNRA 2VA8A 2NIPA 3V4LA 2V03A 3VXKA 3ILVA 4BFVA 4D8WA 3A1FA 1NNUA 1XD8A 5DSZA 1Z4LA 2M6SA 3B53X 4QLOA 3TD9A 3OESA 3Q1LA 2XVXA 3I9OA 1JYSA 2YFHA 3G59A 3GDOA 5DW0A 3SJAA 3L6UA 3PR3A 3I0NA 4ZYUA 1WS6A 1GZHB 2GBGA 2ODBA 3DH0A 5HS6A 3U1VA 1RBZA 2EFCB 4Q4AB 4R2HA 3DMRA 3O91A 4OGLA 3KYCA 5K0SA 2CVOA 2Z2KA 3G5MA 3T35A 1WETA 1HXHA 3A1NA 2XCUA 4GDFA 3IPCA 3DL2A 1PS0A 3F9RA 1OLXA 4JJKA 1NF8A 2P9EA 3TZHA 3VVLA 3AV3A 4D26A 1I36A 2E4XA 4RHEA 4EZEA 3H9QA 3IQHX 3BJEA 5EJ2A 3O84A 4OBWA 5AKIA 1P77A 2I6GA 4MJLA 5CT5A 1UJ2A 2FWIA 4DCOA 4Z7OB 1NIPA 1LZKA 3U37A 1BX0A 2NMVA 4PZDA 2WOJA 3LY7A 4BMYA 1EVZA 3HE3A 1BC5A 4N7RA 3HU2A 4K9SA 3RJ5A 5A9SA 3T7EA 4MYTA 4E51A 1PR5A 1S02A 3MGCA 3NZEA 2HA6A 1OU4A 3I53A 1ADBA 1ESDA 1OI3A 4FFRA 2A84A 4ZCIA 1QVRA 4KB5A 2FWPA 1YHZA 4IPTA 4FFWA 1NF2A 3QEMB 3IUJA 5EJMA 1ZNYA 3L0SA 1FMCA 2NAFA 2BMAA 3ST7A 3VBEA 4TVKA 1G5FA 3BD6A 1QG0A 4DLRA 2OZVA 4RGBA 4B6SA 3CEAA 5T4BA 2AOUA 2RK6A 3DTNA 3M9LA 2G9UA 3MG9A 2GBLC 2YWXA 2X7JA 4ALMA 2ALJA 5IANA 3TD6A 4WIAA 1XQYA 1HT3A 5IDQA 2G1JA 2PLWA 3SHOA 3E2PA 4DT1B 4N12A 1T8YA 3D31A 5LQMA 4OQFA 2Y1DA 2FV8A 4KH1A 1QDEA 2O6LA 5KYTA 4RACA 3ZDBA 3M34A 4F3TA 1F51E 3BXGA 2WFMA 1Z2PX 2JBAA 5DYGA 4EARA 1I5RA 4DJJA 3R6TA 2PZ8A 4MI6A 2V7BA 1U94A 1DJOA 4CIYA 4AWXA 1BDHA 1FW6A 1E2NA 1SQFA 2F43A 3AVUA 2Z8YM 3WLIA 4NY1A 3AETA 1DIHA 1UPUA 4K9MA 3O38A 4QELA 3SIXA 3A4YA 4E15A 2BDTA 5MFZA 1Q74A 3RUDA 1XCPA 2DT5A 4KQIA 5HTOA 2UXBB 3CCCA 1CW2B 2OCDA 3GLUA 3N2ZB 4RCYA 1V4BA 4EL0A 3PNMA 5ALMA 3P0HA 2YQZA 3IOMA 2C3PA 2OVFA 4I6GA 5B1HA 3HCFA 3BGWA 2HX1A 3CIFA 3I23A 3RW9A 3TQTA 3UJ3X 1IPHA 2J7PA 3VVCA 5K3BA 4P34A 1CLEA 2PTHA 2P9FA 4IXMA 3CU5A 3OD5A 4RZ3A 1VYHA 3PNPA 4EJ0A 3OKAA 1IB6A 4B73A 5LIRA 4L95C 2IW1A 1QYVA 3F8TA 2C2BA 3PNOA 4KJZA 2R1TA 2R6R1 3B3JA 1M67A 5E7JA 3QVWA 3OJLA 3QW2A 1S1MA 3AF4A 2ZVPX 3EFOA 2WTBA 4F6RB 1IDN1 4YLEA 4DARA 2JS7A 1FTYA 1WCIB 3STUA 4OF4A 2G7MC 5I7SA 4ACBA 3KR2A 3B9PA 1RW4A 3KOZA 1CUCA 3LUCA 1MO5A 4ECEA 5F64A 3FNGA 2QMUA 1X92A 2Y99A 4MYHA 1X7GA 4RE6A 3VKFA 4EY7A 3QU7A 1GRRA 1XR3A 4REQB 1WHSB 4RKEA 3V34A 4KMMA 5EZQA 4D0SA 2JLYA 2DHQA 4CV0A 3HJTA 5CITA 2QUZA 2ZBVA 2HWKA 5BSUA 4FU0A 1LWNA 3RU9A 4YQFA 1GJRA 1FFHA 1PJZA 2VF4X 3CEMA 2FPSA 3EUFA 4KIFA 3V80A 5BV1A 5J4HA 1VCHA 1VL5A 2A9RA 4RTMA 2QPOA 1HNZB 2J6HA 4CKBA 4B5LA 4DGSA 2C5HA 2C59A 3IHTA 2HRDA 1YZNA 1GUZA 1S3IA 3HNRA 5DT2A 1GKUB 1AA9A 1GU1A 1RQLA 1UUFA 2WYOA 3GGCA 4IJKA 3WRWA 2A5GA 1YC2A 3MWFA 3PFCA 1ORDA 3LA8A 4YCDA 4ZVUA 4II2A 4JBGA 2Z1MA 1HZJA 3A7DA 3G2NA 4OK3A 3DTVA 5IU6A 1C3VA 2OFWA 1AH2A 1KOJA 4U0KA 1GIAA 1O6ZA 4HGQA 5K0GA 3PTLA 1XTSA 2XNCA 1ESCA 5SYNA 1DWQA 3L0DA 1WXEA 5D87A 5EWLA 4QKQA 3LT1A 4UJ5A 2V9PA 4DYHA 3ZLJA 3BTSA 2I3BA 3ZHUA 4L15A 1G16A 2NG1A 3L0IB 3U7QA 1NQUA 4EVSA 3AVOA 3LC7O 3ASVA 5I8WA 2X9NA 2QYOA 2WU3A 4L9SA 4LY3A 3HFSA 3D3NA 4OHZA 3SC2A 4FZVA 2PX3A 3UBTA 1TZCA 3PEEA 3VHXA 2HU8A 1NBMA 2VP0A 1C4OA 1ULBA 4Q0MA 4AWAA 3KALA 4EEXA 3EY9A 4YNBA 1YB6A 1QR2A 1YL6A 1SHUX 2IVFA 3LQQA 1NRIA 3UUWA 1UIRA 4NU0A 3C3KA 1ZHFA 3AW9A 3H9CA 1S2DA 1WB5A 1ZH4A 4QOGA 2VH2A 1ML4A 2IXFA 1L3CA 1SCUA 3RIYA 2OO5C 2RHRA 4LRUA 2I7VA 1UM8A 1M8JA 4TVOA 3MSXA 2EX1A 4XVRA 4H3SA 3JQDA 4Z3OA 4MUAA 1ZH0A 4ZKEA 2IV3A 2DPYA 2G9RA 1H22A 2QD1A 2O14A 1BJTA 2XYVA 4J7AA 2I8LA 2NZ8A 4JYMA 1F2DA 3HB4X 5E6UA 5LC1A 1NUUA 2IU3A 3I2JA 3RWMB 3BDIA 3AJRA 3LYLA 4BX8A 5GIOE 3CX6A 2JCYA 3E22A 5DJ5A 1FX0B 3E3NA 2FQQA 2CNBA 1N33B 1KEEB 1NMXA 2OM6A 2X3YA 3R2JA 5LU9A 2OZKA 1YRYE 4LYAA 3HDTA 5ER9A 2D13A 2CF5A 4BZPA 4RFSA 3NCTA 4I9UA 3JQAD 2ZDGA 3LQ4A 4TOIA 1PL7A 4FCTA 4C5AA 1NAHA 2WHPB 4NENB 1T3LA 3DMNA 4MKGA 1NJ8A 3DNPA 3OFND 3GLGB 3SZ3A 3LJKA 2HK9A 1Y8QB 2YXDA 4JVLA 5C7OO 1SXGA 3T5DA 5KTTA 2LGJA 1BGWA 1HORA 2W58A 1AK9A 3THXA 4OQNA 3P2JA 3ZCQA 4RETA 1SBZA 2FF5A 4LOLA 1BRMA 3ITDA 4K28A 4Q4HB 4MCAA 1RBYA 2PSEA 2QAGC 3F49S 1RWOA 5EQFA 5CLIA 1SUFA 4J3NA 5BNFA 3D2AA 4HEA6 1U3DA 2AG6A 3QQPA 3RK0A 4DIOA 5FH9A 1E4VA 4D0GA 4PGGA 3M1AA 5KMGB 1GZUA 1ODJA 1LRJA 1XDWA 2ET6A 2H4XA 2AQHA 2IPLA 1E69A 1W93A 3AHDA 3OPYI 4EI2A 1Y5IA 2PGJA 3SCZA 4RKYA 4JVSB 2V45A 2WDZA 1QH0A 3LX8A 4H4CA 4UXHA 1QIGA 4XIGS 3ZWQA 2PRIA 4DBVO 4JXXA 3EB9A 1Y3AA 5A4FS 1Z7YA 2Q46A 4EKEA 1XMOB 4KVFA 1XMQB 1FLVA 5H82A 3TIIA 2B82A 1ZGCA 3RAFC 3CWQA 3NG1A 4TXJA 4X84A 1J0AA 1KAMA 4OXQA 4YBRA 1W36D 4H7KA 2IGBA 1E2GA 4EPVA 1OYOA 1ZYUA 2I62A 2X22A 5H4GA 5IYZA 2RHCA 4PHHA 3SQMA 3WTBA 2H2GA 5EE9A 16PKA 1FRNA 1QK3A 3EZ2A 3L04A 3QEBZ 2GCGA 4PCUA 3L6EA 5LYJA 3ED5A 3OEEA 2QYTA 4F6RA 2J4FA 1UFVA 3GJQA 1QCDA 4BNKA 1J7KA 1OWNA 4LTDA 4XGNA 5BN4B 2XJ9A 2JH8A 3PFIA 4DV3B 2X3UA 1J0XO 4YDQA 2QSJA 4FX2A 5CT4A 1D0IA 3DZHA 4HSEA 4TT8A 4K87A 1V39A 1JZTA 4G8BA 4KJXA 2CV1A 3A4IA 3RHZA 5FEUA 1DCFA 2DYKA 4X20A 3HFRA 4Z86A 4EHIA 2XX3A 3SX2A 2BTQB 1WHSA 1QZUA 2ZB3A 1PHRA 3NIDB 5DEOA 4D9EA 4UVEA 5I7OA 4XXHA 5GONB 3THSA 5IVHA 5IKPA 2AUNA 1T4CA 3MOSA 3RD5A 2JLUA 1GTRA 5L3QA 4MVXA 3SVTA 3F8SA 1RLTA 1LRKA 3AUUA 2SKEA 3BWVA 1L7DA 1V71A 2JFBA 2J41A 3DXZA 2B98A 3WDSA 1WMAA 3C3BA 4M1KA 3IP3A 1LTHR 4NEHB 4F84A 3KWJA 1JB9A 4MV0A 4LRWA 4UTOA 1F6DA 3TPFA 4P4TA 4HB3A 1IY9A 3ZWNA 3VH4A 1YIDA 2C42A 3HQ4O 4M7OA 3BKXA 3SG0A 3MJ4A 3O4JA 3U31A 3PCTA 4MR9B 4EHFA 1PFVA 1MB2A 2ZAOA 1MVLA 3OSZA 1QV9A 3LNCA 2AFRA 2QRHA 4JU8A 4M0UA 2NYUA 4JBHA 4OHMA 1PS8A 2QX9A 3K8OE 1L5OA 1UBUS 4JR0A 5DK4A 3HO1A 1QHXA 5DCWA 1O8BA 3ZWPA 1FMFA 4UTVA 4FCCA 4FSDA 1FFXB 1YB5A 3S44A 1B3BA 5DB4A 1TU3A 2EX0A 2HIAA 5G0VA 1YNOA 5MN5A 3HPRA 2IXDA 4J2OA 5DHUA 3BSYA 1SVSA 3RVQA 3PWKA 3RTBA 2O3UA 4KPUB 5ALYA 5J2UF 2YZKA 4BKMA 3HSYA 4RE5A 3RYCB 2GS9A 3K9LA 4RSRA 2WJYA 3H75A 5FWXA 3T3MB 3I05A 4EGQA 3H83A 1DTWA 1M1XB 1RRPA 4MMZB 1FTGA 4A16A 1JPJA 3MUEA 1XELA 3SC6A 2W6ZA 4G0VA 1IZZA 4FS3A 1QRUA 4M9UA 2X6RA 4ROTA 4QOFA 2BGNA 1VIYA 4KXXA 2OQVA 1E98A 3ITKA 1Z4IA 4F38A 2HA5A 2HCJB 5CT6A 1PL0A 2LCIA 4GKJB 3D43A 1OIVA 2HMTA 4XJSA 3OQ1A 4YMSA 2NSJA 3ANNA 3KVVA 1TL7C 1XOIA 4IINA 1NUPA 3LUJA 1RJGA 4ZQEA 1VG8A 1YCFA 4PFQA 3JPYA 4PVDA 3BK1A 1DFIA 4EYOA 1GPDG 3CF4A 2JKVA 5B3AA 2XCTB 4IVPA 2EL7A 1E3QA 2DH5A 2V7TA 2ORWA 2XVAA 4YCJA 4LF4B 3E5RA 4H1TA 3JQ7A 2ZIFA 2JG3A 3SSMA 1D2RA 1QFZA 1IB0A 2ZJBA 3FTDA 2YHAA 2FWRA 2JJQA 2XZOA 3ABRB 3URKA 2XADA 3MWEA 4EG5A 1NE2A 5KAPA 3SHQA 4NENA 4ZDKA 4YUAA 3I2KA 3QKRB 3I62A 3GLGA 1QHHB 1EBBA 3TZCA 3THYB 3HO8A 3GVHA 5KSPA 3B1WA 4B8YA 2GBCA 1TQHA 4KBGA 4PC3A 2DY0A 3MERA 1HRKA 1EH5A 3S2FA 5I51A 5EERA 3N05A 1E3SA 4A6EA 4QDUA 4QTTB 3BWCA 3O0DA 1KVRA 3EPKA 3PXDA 2JGLA 3PTAA 1C50A 1NW7A 2JFOA 3QU9A 3AWIA 5GPBA 5FPTA 1IPFA 3JPWA 3ZGYA 3QX8A 3GJ5A 3GEGA 1UKAA 3IHKA 3K3PA 3MRTA 1H6DA 4P98A 2FSHA 3ROGA 4F2GA 4PRLA 1AGXA 1XCJA 2ZSUA 3FJ1A 1A9PA 3MJRA 4V0QA 2FW7A 2J3DA 4DR7B 1Z07A 2A3RA 1EFTA 4ALNA 3A6DA 2CNDA 3WKEA 1JDVA 1WNTA 2RGAA 1A5AB 5LQJA 3L8HA 5KVSA 1CZKA 2A59A 1SGWA 3OT4A 3I6QA 3PQEA 3Q2IA 1E7RA 1ACMA 1GCGA 1YJQA 3G9QA 5D3MA 1P8JA 3RVBA 1WV1A 1FTNA 2C2XA 1E5DA 3G5AA 2P4SA 2PH1A 3SXUA 5F2EA 1I1QB 3GLFE 1W85A 3BHMA 2GJ8A 5JDCC 3V8NA 1OWLA 4HH0A 3ZV4A 3ROFA 3A0RB 1RXEA 4MCHA 3ETCA 1ZD9A 5C35A 5IYZF 3IAS6 2HT1A 3OTHA 3RSOA 1C4XA 5CG1A 4XR9A 1DU4A 3I9NA 4HYQA 5GZ3A 2PAFA 2P4QA 3GF4A 4I3HA 3DT8A 1EUZA 2W00A 4PSUA 1M73E 4XGQA 5BR1A 3W5UA 4GPIB 5AW3A 3MW8A 5IHXA 5LQCA 1E7WA 3U40A 4FZJA 3GLIE 1K6IA 1TM1E 2ZSFA 3E0QA 1NLMA 2C8JA 2ZI5A 4FGUA 5EIOA 4WXHA 5ES4B 4D02A 3VDNB 4EHDA 2J07A 1WWKA 1CJMA 2C0CA 4EG8A 5JCXA 1E6CA 1WKBA 3WDMA 4R3WA 1RLIA 5LDHA 3BHNA 4B6JA 2ZIGA 5FV7A 3P96A 1ECCA 4IZIA 5DDIP 2E4VA 3QXGA 4BE9A 4JQOA 5IDYA 1NNSA 3FWKA 2VHTA 2IQ5A 1KWGA 4C7OA 3OPNA 3R3HA 3U4MA 1KHTA 3IX7A 4HWTA 5LOVA 4PAOA 3CIOA 4WVLA 1EXWA 4NV3A 1GUBA 3LBHA 1E9VA 1XYYA 1XZJA 2W2NA 3MJSA 4QASA 1DAOA 4MHSA 2SKCA 4ND5A 1WD5A 5JNLA 3TJMA 4FDVA 5I9BA 4D4IA 4C87A 3VTKA 5EP3A 2FEMA 3N8NA 1QNFA 3TQIA 3VZRA 1JT9A 2UZ1B 3KJQA 4FB4A 1E64A 2J5RA 2QMYA 4JI5B 1SO8A 2XBLA 2ZAGA 5DW3A 1WPQA 4CRWB 4J3FA 1GQRA 1JEQB 5LXTB 1RLUA 4QM7A 2OAEA 1T6BY 4NLLA 4R6XA 4TYYA 4JBIA 1BQ3A 3N8GA 3FNQA 5KPJA 3KZCA 3C8MA 3JQEA 4DLWA 3OA2A 1CR2A 3M9XA 3PPXA 1LFDB 4X45A 4MP6A 4BRUA 1CNFA 5HYVA 3HWWA 2PUJA 1FJ2A 2R9VA 2OB2A 1FDUA 3GYGA 4XOIA 5JDIA 2AE2A 2BGRA 3EHEA 4BLVA 1N2GA 1JKJB 2P4HX 1ZISA 3KSZO 4G26A 2GH1A 3PL5A 3TR6A 3T34A 2QNIA 4MITA 3DZDA 1OGJA 5HFNA 3HZHA 4BWYA 2XMRA 4KHZA 3OM9A 4WK2B 2OFFA 2GEFA 2DSNA 5IBQA 4PPGA 4FOSA 3ZIUA 4BWGA 2CJYA 2HQ1A 2XMGA 1NRWA 4RF4A 1XNRB 1I8TA 2KB0A 3M1IA 2QJTA 2C7QA 1VBMA 3PHJA 4J1TA 2OK8A 4JR2A 1YDHA 1VLJA 1L7OA 3HYTA 4IDGA 1NHGA 3JSXA 1U3WA 4FLEA 4HJXA 1XZDA 5F52A 2NXJA 1EUDA 2WV9A 2IZ0A 2GHIA 5IP5A 3C14C 3D5EA 1W4BA 1HT1E 1B8UA 3L1JA 2PUAA 3G5UA 4Z0PA 3FFWA 4FB5A 3LP5A 3ZLTA 1HE8B 1KTVA 4C2UA 4DSTA 1B0ZA 1OFTA 1QQAA 2VWGA 1QHHA 3S7ZA 1XZLA 4JWKA 3WS7A 1AVTA 1Z2CA 3F5DA 2ORYA 1U9IA 1TJNA 3N3BC 1I5EA 4NABA 3HA3A 5ALSA 1UZUA 4JLAA 2Z0MA 4HDKA 3RSZA 4AW9A 2KX7A 1FDWA 2D1QA 2JIPA 3I9V6 4EFMA 4KE9A 5CEFA 4CEJA 1PGOA 2DSTA 1L7VC 1POWA 2GEUA 2FF7A 1I01A 2H2HA 3NBMA 4S2UA 4KFCA 2YCBA 4R3UC 2P3SA 4BMPB 3KPWA 4HH3C 1BXGB 1Y0BA 4JR1A 2ZSJA 4F45A 1X77A 3NYIA 1H4QA 1E9FA 2DU8A 4XQCA 2NXNA 2FPKA 4I4LA 3NMUF 2C9OA 4AMUA 4J2TA 2C9BA 3GI1A 4CTMA 5IT5A 3AWDA 1AZTA 1GGJA 2Q6OA 3MMPA 3ETNA 2W37A 3OBBA 5FA6A 3PEYA 3PQ4A 1YACA 2UDPA 4OXRA 2OCLA 3A9TA 2PVPA 2DMRA 4M8LA 4UTXA 3DV9A 1JAYA 1VJRA 4GMFA 4F7WA 2IDZA 2Q5QA 2GK3A 1WULS 4D92A 1FXSA 4WLVA 4DL9A 2J5BA 1N2JA 3RYIB 1TTPB 3G2QA 1I51A 4P1ZA 4AUMA 3MTAA 3A9VA 3DNFA 1O6GA 1XMXA 1KY4A 3WGLA 3KEGA 4KK4A 1AQUA 3PWSA 1RJ9A 1O9GA 4WXMA 4CMIA 1ZJ6A 4CEHB 3I04M 3DEFA 5FFMA 1HMYA 2P27A 3EG9B 3OE7D 2RFLA 3K09C 1N2XA 1EDEA 1F6BA 1PX0A 1WX1A 1XGKA 2VPWA 1AT1A 5C34B 1UDAA 5KVCA 2AOVA 4KN9S 5AJXA 4E2WA 3ZY3A 4BZWA 3FOFC 3VDQA 2NU6A 2BZGA 3BREA 1PWEA 5C8YB 3DLCA 3B6JA 3IMFA 3IT0A 4CIVA 2J30A 3KKEA 3GLIA 1DHTA 3QNMA 2ILVA 1KYZA 2BKUA 2X4IA 4HYEA 3A70A 3ASZA 4YT5A 4CKWA 1Y1QA 4ND3A 2MHCA 3AVYA 5ULLA 1XU4A 3U16A 1FVXA 2MSEB 4MVJA 4D46A 2B69A 4FE4A 1Q1EA 1Z74A 5E6RA 8ADHA 3AU9A 3ASYA 4S0ZA 2HHAA 4HAUA 1RD4A 1O57A 3LE8A 5CW2A 4W5OA 2UV8A 2H17A 3FUCA 5COAA 1IM8A 1CF2O 2H3HA 2VPQA 2W2OA 4EPYA 2QB5A 2GYUA 3C1OA 2IYVA 3M2TA 3WNDA 4WKGA 3JQ6A 4ZVKA 2P69A 4ZGBA 1HR0B 4BP1A 3WOHA 4DNOA 2XDQA 1XIVA 4PO8A 2B8WA 1JYEA 3RUFA 2VBIA 5H1YA 5AFSA 4C3OB 1F8YA 4FN4A 821PA 1M6EX 1QO7A 1J99A 1N2OA 1DRWA 1L7RA 1QE5A 2PN1A 2VUHB 3KJGA 1COZA 1R3DA 4I1PA 3PFGA 1EUQA 2FWJA 4NARA 1JE1A 5EVJA 1T8PA 4Q5IA 3VV2A 4LGCA 2DCMA 1S2MA 4X7BA 1NXPA 2V3VA 4JCOA 3T4UA 4GMKA 1PR3A 1E3IA 2HYDA 4C7VA 4C0SA 1XWFA 2UYOA 4PGHA 1UQUA 4EF6A 2HDWA 2RG7A 2CFOA 1XVTA 5K3SA 3Q7QA 4E33A 3NHWA 3PDIB 5K6RA 3OAAA 3ZTWA 2X9LA 2H16A 3NNSA 4ND8B 4RTQA 1X94A 3I83A 4ZYWA 3E48A 5E6SA 4BHTA 2HSWA 4S12A 4WN9A 1TEZA 4XARA 4D4GA 4PYOA 1QF9A 4ARZA 2LIVA 1BXRA 3OLVA 4KN6A 3DZKA 3JWIA 5EEHA 4KL8S 1Z4JA 3NXSA 3NUZA 3FTEA 3TLEA 2VDMB 3JWJA 1APBA 4UM9B 1KQ3A 2Q50A 2R8BA 1QFYA 1E5XA 1Y9ZA 3UH1A 4YHHB 1Y6FA 1ST3A 2Z58A 4IOLA 1ZN7A 3RU7A 4IGFA 1UKEA 1GM5A 2Q5CA 4CQMD 2HWUA 2ZZKA 4QE3A 1DQZA 1G4HA 5A7FA 3GA5A 4LMBA 4MWDA 2Z3VA 4PR0A 5CDTA 4UBLA 1HGXA 4J0CA 4FFDA 2WWIA 2B30A 5A4AA 1U02A 3NNDA 5LKAA 1PZGA 1C4WA 4B9EA 1M1YB 4K9RA 5TY0A 4F85A 1SU6A 3TNDA 1VI6A 2GK7A 3AM4A 2EJWA 4RHYA 2GI4A 1XEFA 1WXHA 1U7DA 1NZDA 3SK0A 1KRWA 2I4MA 2J9GA 2VPPA 4O4IA 1LJUA 3AB8A 3GVXA 3G0DA 3QH4A 2WG0A 5KSYA 4PPNA 5L3VA 1SVWA 4X91A 1YJAA 2G04A 3FROA 4GOXA 4NCIA 2JLCA 1J1UA 1M6VB 4XSGA 3ABOB 3CX3A 2JFGA 4IIEA 5CX1A 4ZT5A 3ES9A 3B89A 2W6IA 2QRLA 2VSFA 4ZAGA 4MWTA 3A1SA 3QEOA 1MBZA 1ZW6A 3LXUX 2GVZC 2V7VA 3B78A 4WY8A 1P0PA 3IQEA 1RPJA 4LZJA 2O5VA 2OV6A 2P11A 2A0XA 3ZNQA 2FX5A 1CIVA 1GFZA 2FR8A 4JEHA 5TF4A 2P9BA 2C5AA 3T3DA 1YR7A 4IR7A 4PSKA 4R9RA 2Z04A 3ULKA 2Z1NA 3WNQA 4XEUA 3HXPA 4DREA 2I3AA 2O8VA 3C3YA 1Q7EA 3HEMA 5CT8A 1OT3A 5EE1A 5F4BA 4HI0E 3WMXA 2VYCA 5HIMA 3H2IA 1UBNA 3KLOA 4M54A 5HX7A 2A94A 5EIAA 3GLVA 2IIBA 4M53A 4A9AA 1TCVA 1USGA 3PI6A 3SHFA 4RIIA 1CJCA 1MJGA 4O4HB 4TSRA 4GQBA 3SYTA 1SIUA 4DC9A 5JROA 1DIBA 2Z8ZA 2ZEJA 4GZLA 3I52A 4LCEA 4U9HS 1ZH6A 4IIHA 1P2DA 1YHYA 3Q5GA 3ETDA 3ZY5A 2NO9A 1Y34E 2GWRA 2JL1A 2XE6A 5A4IS 5FOQA 1FSPA 2YV5A 4X8MA 1LRLA 1ESNA 2ZWOA 1HDGO 2PKCA 1YULA 2CCKA 5IC5A 2E18A 1EVLA 3C5EA 5EZ5A 2Q6LA 4D25A 2Q5HA 1HTBA 1SXJE 3A06A 2GLTA 3MT0A 4L9WA 1DI0A 2WMYA 4X5OA 2JIOA 1CUVA 1HLPA 2A30A 1IXZA 4MQLA 1KI4A 1GXSB 4JIMA 2WFZA 3GPIA 3Q7PA 1U8CB 2PKYX 2JI8A 3ET4A 4GMDA 1JI3A 4ZTZB 1WDTA 3FF4A 1C30A 1OFIA 2X6TA 1L4YA 3USZA 1HSZA 3G0GA 4FBMA 5DIZA 1ESEA 2BR4A 3KB6A 3WVNA 3GROA 4K2AA 1OXBB 3D3KA 4ZV9A 4BNMA 1USVA 3FTNA 2X0KA 4ISBA 1KJZA 1J07A 1OX5A 1CUYA 1JEYB 4KYUA 3CF0A 1PNRA 1CP3A 2BFBB 1K7YA 3HXKA 2PJZA 3NHAA 3X1ZA 5AJUA 3D3WB 1LTKA 5FTJA 1ABEA 4TKLA 1Y9AA 1PT5A 4PC1A 1UBMS 2G77B 2E4WA 2PEYA 3M9WA 4S0XA 2WFLA 5CM2Z 3T12A 4AN4A 1TFRA 4YRBA 2WSYB 5HFAA 4BYGA 2Y76A 4RPGA 3P9KA 2FFRA 1P44A 2XCSB 1H69A 1DKOA 1X8XA 4FEEA 4RVNA 5CJPA 1TE2A 3S3TA 2E21A 2XDQB 2ES4A 1FLDA 2G82A 1I6MA 1FDIA 3LY9A 1FYWA 4HEA1 5FOVA 2BYTA 2J3EA 3ICEA 2OAQ1 1DAKA 3EH1A 3LLUA 4UBMA 5T64A 2Q8NA 4PQEA 5EESA 4FZ5A 1ZDMA 3K9CA 1FBTA 1QKIA 1NVVQ 2C1ZA 3AR3A 3I09A 3MFQA 4G5FA 4HX5A 5AM4A 4H2DA 1ZVVA 3AJ9A 1K6EA 4O0MA 1JH9A 3ZIAA 3PE3A 4BUJA 2BKVA 1ZN2A 4RY9A 4D57A 1E3TA 3BT7A 5I9MA 3CNNA 3WHPA 5JBIA 4L07A 3E18A 4IJ6A 2Z3WA 5TR9A 2CB9A 1DJLA 4LYHA 4K1XA 5EHIA 4BP3A 1NATA 2Z30A 3BSSA 3A26A 3IAS1 5E3JA 3BFJA 2F1KA 1Z3IX 1BXRB 4LJ8A 4R4JA 1R16A 1RHRA 3L6BA 4FJ1A 3UFXA 1IBRA 2OZLA 3LWBA 3HU5A 4Q3OA 1XTTA 2WILA 2Y0EA 1ZVKA 4M99A 3JQBC 4ZVVA 5C53B 4KTVE 2JLAA 1G38A 4C2AA 2AX4A 2XUDA 1F3LA 2WRZA 1N6HA 3HY3A 1D1SA 4K9NA 1JXAA 2B78A 2XYQA 1NF3A 3DR5A 1RC1A 3ESDA 1TZMA 1L5SA 4FX5A 3TLXA 3OLYA 3O47A 1MRZA 3T7CA 3VSEA 3DLHA 1EB9A 3MGKA 1IIRA 4Y3UA 4GXTA 1KVQA 2OTCA 3QYPA 1ODKA 2YJ6A 4HUQA 1TVMA 5JXJA 2PS9A 4KGZA 2NZWA 4OJYA 2RB5A 4UU8A 3S2YA 3VMMA 3W2EA 2XUFA 1CDDA 2O4UX 1YZYA 3AIOA 3EWIA 5IJ9B 1XVAA 3K0CA 2ADOA 3GG2A 3PLNA 1LTQA 4RZHA 4EYEA 1QOQB 5KTOA 3U4IA 2EZ8A 3OICA 1SBNE 3KV1A 5BVHB 3BHIA 1XRJA 3M49A 4YC7A 5BN3B 3OLZA 5CX1B 2O8EA 4IH9A 2XE8A 4FM9A 3L0BA 1ZGGA 2JGEA 5C4GB 4NCAA 1PIWA 4ZVOA 5REQA 3SSAA 2JD0A 1P7VA 3IQFA 4MQBA 2WU4A 4U3JB 1AKYA 2YQ5A 1CUGA 1CY6A 2H11A 13PKA 3CH4B 4BNYA 4YUZA 5J4VA 1G6HA 2YC4C 4IDEA 4B6RA 1GVHA 4IRUB 1WXGA 3LZ6A 4PR3A 2R4TA 4RO0A 2NPOA 4JU9A 1KS9A 1OAAA 1BMFA 3LS2A 2WE7A 1A2BA 3EQZA 3PXBA 3LQ1A 4FFPA 5J4KA 3ROZA 1KDYA 1YA4A 4UMFA 1GQYA 4R83A 4QUHA 3GLHE 4P5PA 4WVFA 1RZRD 2ZTLA 2W6QA 3KZOA 1L5HB 2ZI9A 5FL7A 5DH9A 4C30A 4LSGA 2ZR9A 1ZK2A 3IVXA 3TNFA 4GGPA 1JLLA 4ASUD 3DMHA 4H4EA 2H2IA 3S2ZA 4BVLA 4D5GA 1CV2A 3C48A 3E1GA 4M1EA 1I5OA 4MI3A 4W7IA 4ZJPA 4UVIA 1GSAA 3SF8B 2AEJA 5D1HA 1P1KA 5IBRA 4QATA 4ARSA 4M0KA 3ZD8A 2YIDA 1RKUA 1BMFD 1NM5C 1SPXA 1SZCA 4QUIA 1J33A 3BWYA 3DMYA 4RZIA 3QV2A 1I2DA 3WHLA 4FEAA 3RSSA 3AVPA 4LTMA 4YYEA 4HS4A 2WKWA 4QUKA 1PUXA 2N46A 3L06A 1CPYA 1YRBA 1E8DA 4O29A 2DFVA 4O4IF 5CK5A 5AR1A 4A23A 4CV2A 3DOUA 2D5IA 1UC4B 4HCJA 1OBHA 1NVVR 1Z5GA 3MK31 4Y6SA 5AT1A 3ROEA 1OREA 4N6OA 4OFXA 1HDOA 3H2ZA 3UOWA 3EBOA 4P31A 5EIXA 1MW8X 2JRLA 4P93A 4BQNA 1OB5A 1N7JA 2OC4A 1OILA 3TFQA 2C31A 2F6RA 1V5IA 1OZAA 1E8NA 1VPWA 4FS8A 1J21A 1Q1AA 2BGUA 2OK7A 2WYUA 3M3HA 1U0LA 1JLKA 2DWCA 4FE3A 4RPHA 3VR0A 2A57A 1OPXA 3M6UA 1KH3A 3HTXA 2LTAA 4JLKA 1CNEA 4B3CA 2ZIVB 4IW3B 1NMZA 1P4GA 4BNLA 4IDFA 3NRCA 2YZNA 3P97A 3D3WA 8ATCA 6Q21A 3H4VA 2YOGA 3LVRE 1P2SA 4OM8A 1YZLA 1KK3A 1KJYA 1PNTA 3AILA 3FLEA 3IIEA 4N65A 3PCRB 3TQQA 2WWWA 4LF5B 2JZCA 4LGMA 1W5BA 3ZY4A 4V0KA 1ETHA 2GETA 5KDLA 2PKXA 1XZCA 5C4IA 4EX7A 1ODTC 1U9YA 3HU3A 3ORYA 4REMA 4HGYA 2A1UA 1N9GB 2QRQA 2WNIA 4IY1A 5TPZD 4A0HA 5H16A 1I2MA 4MKFA 3SF0A 1JU3A 1EFLA 3ZGXA 2XCIA 1O5OA 3GYBA 3PEFA 5IKMA 3CW2A 5CVJA 5EJ9A 4O4JF 1F0PA 3AGPA 1G19A 1XZQA 3VZDA 3EEQA 1VG9B 2B1JA 2CNWD 1BIFA 1DZ3A 3CRW1 1P33A 2NZVG 3TKAA 1SC1A 2VTBB 4EA9A 1ZJWA 4FCWA 4KDRA 3HVUA 3VYUB 2GM4A 4KXMA 4HBZA 5JVDF 4JI7B 5BV7A 4BMDA 1P73A 5FFFA 2HHLA 5CRIA 4HLUC 1NI3A 3IELA 4BKPA 2WR8A 3LT5A 1W5SA 1XXLA 1UPTA 3X1KA 1L4MA 1XDZA 2ISSD 3I3SR 3PDCA 4XTRA 5JH7F 4AJIA 4HGNA 2POQX 3A32A 2DM6A 4B48A 2A9OA 3EXIB 3A11A 3ND5A 3NXKA 4ZFNA 1AQ6A 4KDCA 4WBSA 5BORA 3SVLA 2LRHA 4TV9F 3PSHA 4PZZA 4ZAYA 2A9KA 4D6YA 2QE6A 3DHEA 5F51A 1DT3A 2ZR0A 2JD1A 1M1ZA 2ID9A 2ZTMA 5KAMA 4DUZB 1ZUWA 1XDUA 2P9JA 1E79D 2AJLI 3B82A 4U7JA 4EB8A 4RTLA 3HBMA 4ID3A 4P3NA 3KKMA 4F5EA 5J2TA 1DO8A 1C1YA 3NCHA 3LUKA 5I5EA 3COYA 1E2QA 3DP9A 3VZQA 3AH8A 4JJIA 4WBNF 2IV7A 1YRQA 3CXRA 2GX6A 1NONA 5HMMA 3N2GB 1LPBB 2IEIA 2QW1A 4V24A 5I8ZA 4M8NE 5CIYA 3O26A 4GX2A 2BEJA 1KZ6A 2HU2A 1SEPA 2JA2A 4AJPA 4LI0A 5HILA 4ZZIA 4JS0A 1K5DA 4MMXB 2PLAA 1QIEA 2IOFK 3L43A 3WGYA 2WHYA 3HEBA 1YDWA 2C2YA 3ICWA 5DOZA 5BP7A 1PGNA 1HE2A 1J42A 2BUCA 2JGNA 1UEXC 5F12A 4BB0A 3AUKA 1KK2A 3IBYA 3OZGA 2B92A 2QGZA 3NKFA 3ZXUB 2XODA 2SECE 3Q88A 4LV5B 1PV2A 1XQ9A 2PFKA 1LBIA 5JAQA 3STXA 3ZPXA 5JRDS 2BGKA 2ODEA 2EIXA 2BV3A 4P4NA 5GP1A 5ALKA 1FL9A 2AWOA 2I2XB 3RU3A 4F2WA 1HEIA 1NP3A 1K9VF 1X87A 3OUZA 1X3LA 2BBTA 3IT2A 5IMSA 2LDXA 1QIIA 1R8QA 2VP6A 4GD3Q 4GGMX 3K0EA 3CRRA 3VM6A 3U26A 1ZOLA 4D9KA 5TT0A 2H1IA 3FOAA 4CMCA 3VR5A 1CB0A 5FJIA 4ZKDA 4KFTA 3M6VA 4QXMA 2G8LA 1PG5A 1W1IA 4CGYA 2EYQA 721PA 3STWA 4YAGA 2BCGY 4NCJA 4DM7A 2IKQA 2FG5A 2H1RA 1O97D 3AR9A 1TECE 2DLNA 1V5EA 1ZKMA 2AC4A 1IUKA 1ZIXA 2V4ZA 4HTFA 3T5GA 3ZHBA 2HT6A 2QTHA 3ICPA 3WLPA 3HUTA 1YZGA 3CEHA 1E1KA 1E6EA 4PCLA 1XEWY 2DC1A 4TS9A 1EJ0A 4EGFA 1C9NA 3FUUA 2R97A 1U3VA 2ZBPA 2G0NA 4U7TB 2ZI7A 1H65A 2C5FA 3DTVB 4QFMA 5DCUA 1SJ9A 2ZB8A 1K8ZB 4H31A 3PUJA 3LKZA 4IF6A 3ZBPA 1WXFA 5DP1A 3CV3A 3Q98A 3NTRA 1VMIA 4Y2UA 5H59A 3OHMA 1TI7A 3IV7A 3KVRA 3D7RA 1K7FB 4LGVA 4N3GA 4WGGA 3RIEA 3OCUA 1SCQA 3HLTA 3U7QB 1GAWA 1FVHA 1YJ5A 1OD6A 2CVFA 2FSFA 2P1RA 3B1YA 3DFKA 4LTNA 4QEZA 5TJ9A 2RDMA 1V35A 2OECA 3SC2B 3NHBA 3H4MA 5H0IA 3OLCX 1XF1A 4XEHA 2NQTA 4YRSA 4FHCA 4CV1A 1H3NA 4F4IA 1DOZA 3ZWOA 3GRVA 4NULA 4C22A 3AEUB 3SEAA 1JIIA 4ABYA 2IHTA 4LF7B 1J39A 2HSGA 1U1DA 1N8KA 5AIAA 2MIIA 1H1TA 4Q6WA 1NC3A 3EZ7A 4QFBA 1AHHA 3GDGA 3HCRA 2DTEA 5JAZA 1DAHA 4HNQA 1LZLA 4QOHA 5FI0B 1T29A 4XIIA 4CM4A 3T7RA 3AVXA 3E0XA 4G41A 4RD1A 5CNKA 1Z75A 2CLLB 3R0VA 2FW8A 1PZMA 4ZEOA 4ARUA 1OLSB 2BGJA 3QBDA 4R8SA 3MCUA 3A2KA 1CQJB 1T5TA 1VE6A 1ZCZA 2XIQA 3H84A 4O2LA 3PEUA 2J9YB 3COJA 3UC9A 4LW8A 4C0KA 2QX6A 4MV1A 5KJ1A 1N9GA 2HV8A 2WA2A 2ZRCA 1N5IA 3NI2A 2XXBA 3LWDA 1M1NA 3ADPA 2XBMA 1EAYA 3EUWA 4CIWA 4P5DA 3WK5A 2VNJA 3HKBA 3BE6A 4B4KA 5KWSA 1G1MA 4LXHA 1BVYF 3GOHA 4OG2A 1WZUA 4GICA 2ATXA 2RB4A 2Y77A 1D2MA 4Q39A 2GGSA 2WHPA 2I8AA 2XH8A 1KZ4A 3BXXA 3G0IA 4AJEA 2D74A 1WCWA 4PAQA 4HLUA 3TLZA 4A82A 1ND5A 2PZKA 2VZ9A 3RT1A 3ACBA 3MSCA 5A5GA 2ZJ8A 2RMKA 3MBIA 5ITWA 3B5EA 5HWSA 4QAQA 4RQBA 5LL6P 5CLGA 2QU7A 4B4DA 4Q4HA 1X6VA 2FZ4A 2KW5A 4PN3A 1GGFA 1IBCA 1IZ7A 4EB6A 2PWAA 4KFSA 1M7BA 2JGFA 4S2EA 1U3CA 1KP3A 2E7ZA 4F2PA 2EQAA 3U6BA 1CYDA 1IEQA 2D1YA 1HDYA 4UHDA 3D4BA 1HNNA 1F5SA 1PAUA 3USCS 5AQ1A 5KOHB 4W5NA 3B52X 5KMGA 3K30A 1KZ9A 1W4ZA 1IVNA 5FO1A 1Z5WA 1OBVA 1RXSA 1GO2A 2XI4A 1S7GA 2JFPA 3PL1A 4B7CA 3T5CA 3D6HA 4HXFB 3HJRA 4I1VA 1F0NA 1XPUA 2E85A 2I4NA 3NJ4A 4E46A 3RS0A 1D04A 1SC6A 5DI9A 4RTOA 2ZUEA 4K6GA 4YECA 3S1AA 1B76A 1BWPA 1EKXA 3FXAA 3PVCA 2VHYA 5JWRA 1ZI6A 3ZLVA 2PZJA 1N77A 1ODCA 1PJTA 4ZVPA 3ZG6A 3W8DA 1XZEA 2VQFB 1GAEO 1EI9A 3ELUA 3BUSA 4Q3KA 1ZCBA 2R6DA 1XLTC 4EKDA 4TKUB 1KA9H 4CQJA 4PHTA 4NG4A 1B16A 5B1YA 8AT1A 2IE0A 5FAXA 2JDID 4N5LA 4BVHA 1JNYA 1MF7A 3M1LA 4MR8B 4JLSA 3SMVA 4BATA 4D9HA 4UU1A 3ANLA 1IJEA 4B79A 1WQ3A 2ZXEA 1NU6A 3ME5A 2ZZMA 3VZPA 1Z5NA 3V7FA 1FQWA 2J3KA 1Q84A 1XDBA 3EE6A 3ETLA 2IYQA 1Z2DA 2VYVA 3M0EA 1GP2A 2PQ6A 1DO0A 2WWTA 4N01A 1KR2A 4WY5A 3PHBE 2TECE 3SR3A 2ATEA 2O48X 4OAQA 7YASA 1WE2A 2NUPB 4QXQA 4R8MA 2H2FA 2R84A 1MLDA 4G09A 4ZRDA 3LSYA 3SBEA 5EN4A 2C9MA 2QN7A 2XUIA 4KWIA 3A31A 3AR5A 4N6GA 4NJMB 3TNLA 7GPBA 2LZ0A 4Q7KA 1EDDA 3DE4X 4ZCSA 2JGIA 4EAAA 2AJ8A 2XOXA 2IEGA 1AQIA 3KKQA 1G8YA 3ONNA 4ZHSA 4LXQA 5DBFA 4IP0A 4C03A 3MWYW 5L40A 4IEFB 4DZZA 2GK4A 1AMUA 1K89A 1EFAA 3G89A 1Q0HA 1T9BA 3HYSA 1UC5B 1OXVA 4QDJA 1D7AA 3ZJ4A 4DLYA 3CUKA 2P9CA 2PZBA 3B5IA 3ZHRA 4BO7A 1XQXA 4ZAXA 1TO6A 5DNYB 5F1OA 3GRFA 2VDPB 4YAWA 4W5TA 2HJVA 2HK8A 5JS1A 4PLGA 1V2HE 3DBIA 3KYCB 4KDFA 2RGNC 4TS4A 4EZBA 4KPUA 1E1LA 1H8HA 4QU5A 3ZWXA 1BA2A 2AMJA 4PRZA 4DCMA 2Z5VA 3F8WA 5FWXB 2CBXA 2WKPA 4TZ6A 4AMGA 1OLXB 1ZPDA 2WP0A 3WWDA 1SC4A 2NM0A 3BEOA 4QWMA 3QPBA 3V8QA 2ZJ4A 2CXOA 2VP3A 2X4DA 3GJTA 5K8UA 4S04A 2G4LA 3NKLA 4RWZA 4JC5A 2ZT7A 2SICE 5FIUA 4KDEA 1SWVA 1VRCA 3I6ZA 5LUBA 5M29A 1L4HA 4WE3A 4BUCA 2QR2A 4H7EA 5B1DA 3D6AA 1QKJA 4R2KA 4KR2A 2OG2A 1QP7A 1X80A 1CZLA 2XB4A 2XTZA 3L77A 4IOJA 1TM4E 3GARA 3AHHA 5CBKA 1XLVA 1FSGA 2UVDA 3B1XA 4EGSA 1NVBA 2OKCA 4JB0A 2JK0A 2G76A 1DP4A 5AXBA 2JI9A 4PXYA 5A9SB 4RQUA 3FKSA 5EVCA 4YJDA 3QBTA 2FMFA 1NQOA 1W73A 4K8RB 1BO6A 3U5ZB 4N18A 4OFZA 1LW7A 2VL7A 1KSGA 1S6YA 4AC9A 3WAGA 2HWWA 3FMOB 1SOUA 2ZDHA 4KBFA 3JQ7B 3HKBB 3QJGA 5E1BA 4FGSA 3LCUA 4IX1A 1A8IA 5BUSA 2J9ZB 2AVDA 1XZHA 4X62B 3PFNA 3R4VA 2XUOA 4GHWA 4XLLA 5SZJA 3X2EA 1Z7BA 3SXJA 3QKRA 3SOZA 4R1UA 1WW8A 2VRCA 4IKPA 1FDSA 2IK8A 1E2FA 2HF2A 4G4GA 4GZMA 3W6NA 1GWNA 1WEHA 2O06A 5CP8A 4JLWA 1Y1TA 4I99A 4MVJD 3JWPA 2D8AA 4MW2A 3LAWA 4TL8A 4FXOA 1VLQA 1V11B 3ZE9A 5U4XA 2R44A 4BX0A 1E3EA 4RPIA 3UXEA 4TGLA 5JD6A 4IIDA 1JFLA 1ULTA 2VS1A 3ABZA 3IMGA 3DTYA 3IB3A 2B7LA 5KOHA 5GGYA 4YCBA 2GCPA 3HJHA 4F4FA 4EJFA 3C6MA 3WICA 3IMKA 1WUIS 3T1HB 2GKOA 4YT2A 4ZAFA 5H70A 3LQYA 2YIMA 4OATA 3OCXA 1C8VB 4HRYA 3VO1A 2HNKA 4C5BA 1YSCA 5CHYA 3WP1B 2E5LB 3TB6A 3AR6A 1DWOA 4JLNA 3GGJA 3NHYA 3FH0A 3R7AA 1G6OA 1QV6A 4NOKA 1Z4OA 1N5LA 4C0QC 3Q3CA 1YR9A 3A2LA 5HKBA 3PA8A 1KE1A 3SFVA 1UAYA 4V3BA 5LR6A 1UWCA 2ZYUX 4AZ0A 3JAMA 2Z9DA 2FPPA 3DWIA 2BMEA 4RTJA 3NTLA 3QOYA 1JDBC 4GEKA 3UOAB 3EVNA 2PL9A 3PQ3A 1NIJA 4H7FA 5DPMA 4BUZA 1U2EA 4FDAA 1Z0ZA 3GVCA 1X7XA 3STHA 3QSGA 2X2EA 2YN0A 4WPGA 5ERGB 3W9SA 4AUKA 3DE5X 4EA7A 4OYLA 2AYYA 2R6GA 3P2IA 4MV3A 1A7JA 4C2BA 4CIBA 1WCIA 1MTZA 1AQJA 4C0LA 1JH8A 1ZRMA 3M3DA 1SOMA 5BRJA 3DV2A 4JLVA 3AFGA 4GFDA 1EU1A 3R0IA 5CBPB 5LWQA 3ZD9A 1T9GS 2CXQA 3E9RA 4W1QA 2QW8A 3QG1A 3KAQA 2JFXA 3D7LA 4PLHA 4F46A 1TCCA 5K8LA 4RV9A 4Q3BA 3PGKA 1ZNQO 1ZOPA 4IQFA 1DOAA 4B43A 4N7JA 3VR5H 3WKDA 2GVNA 1F9AA 1MV8A 4G1MB 2GJ4A 3I9LA 2Q3BA 4A0GA 1J5XA 1GZ6A 2XMPA 2CJXA 4UVHA 2DPLA 3LFHA 2Z2ZA 5HJ2A 3L9XA 4HNTA 4KE6A 2AHRA 3CVVA 1V4NA 3BS4A 1CZRA 4UCFA 2W6OA 1XRNA 2JIQA 4G37A 1ZK1A 3X1JA 5F5LA 4BFCA 1HK7A 3GGGA 2RD2A 4NOLA 3TS1A 2FRDA 3IRUA 1QYIA 2OO7A 3SEFA 4FI3F 4W7SA 5JC1A 4S3MA 1RU3A 1R0KA 1P5RA 4QBFA 4HL6A 5GOTA 3DFZA 3EXG2 2AWNA 1RR6A 4GRAA 5DRYA 4X85A 1XL0A 5LZ7A 1VE3A 1G2IA 2H2DA 4M0CA 2BMDA 3NFYA 5EWLB 3UW1A 4TYQA 3ET5A 2HPHA 3BK2A 2J31A 2R87A 3B1ZA 4HB2A 4EECA 3NWBA 5GQSA 5ERYA 4UZSA 1X2BA 2VPXA 5G40A 1S89A 5AHKA 2TSYB 2V1XA 2GAFA 3CSUA 5D1NA 1RRGA 2QL7A 3FSJX 5SZIA 1PNQA 5TV2A 5WRFA 2Z6QA 4R2WA 4RHFA 3P2EA 4A2PA 2YY6A 4C76A 3KQWA 3K2QA 3PGMA 3IMEA 3N8IA 4BC0A 3GW8A 2CNLA 2Q0QA 2XEDA 3BCSA 1ZNXA 4YS6A 1O94D 4Y6QA 4ZAWA 3FZGA 5HJ5A 3B6ZA 1QC5B 3FMIA 3QUQA 3GLFA 1JLHA 4RZXA 4BQQA 1PT7A 5B30A 5TF0A 1GZVA 2JLQA 4EJ6A 2HEGA 1JTFA 2QMQA 1ZSYA 1LFAA 3E6AA 1TT5B 5BYKA 2R6JA 1X80B 5PGMA 5AM3A 1CUHA 2QRNA 4KIGA 1TMYA 2HBYA 2ZRAA 2XAUA 3KYDA 2YY7A 3IKMB 1MOZA 3ENNA 3WYFA 4DCPA 1MJHA 5HF6A 1XAHA 3T52A 3EVBA 4M7PA 3AOEA 1GNLA 3BG5A 2OPHA 1M9NA 3E22B 2YVKA 2V9CA 4WXRA 4R01A 2J6BA 5EFZA 1CB7A 1EUDB 3PC8C 3PQDA 4F6LA 1E1RD 4ZI5A 1WTAA 3GZNB 1IZYA 2YNMC 3ONVA 3RGGA 4ZJZA 2QDXA 4XD7A 3QX9A 2B0JA 3H8SA 5L4NA 1H5UA 1PKEA 1GTZA 2R3SA 4OGWA 1UFKA 4P7FA 3BIJA 4L1KA 1OU0A 3G2HA 4Z9BA 4B82A 3QEJA 3UAXA 2IF0A 1LLQA 1I3LA 5DWDA 2UAGA 2W8BA 3GJXC 3OE5A 4RJ2A 1EFRD 2HO4A 3LM8A 1HM5A 5DEIA 1C8LA 3JD3A 5CR9A 5EKDA 4DKXA 3BKWA 3SJBA 2PKQO 4BLTA 4I5DA 3MQ4A 5JZOA 4RLSA 4A8JC 4HDKB 1IONA 1SXHA 4TL9A 1Z35A 4HN2A 2ZIAA 1U7OA 4UUQA 4WLOA 2AG8A 3DHNA 1V11A 2BKAA 4JKIA 4F91B 2G1PA 1H3FA 4MP3A 3R75A 4NBWA 2NUBA 2YHUA 1A5SB 4RJLA 1E8MA 1V5FA 3RODA 5JADA 5JMTA 3FPBA 4DF3A 1T2CA 4KVZA 2LP4Y 2I3DA 3MTEA 2P77A 3W4IA 5KNBD 4D8YA 2J09A 5EC8A 3FFBA 1F1JA 1ZGJA 4CMGA 5F1YA 3NWJA 4H77A 3FYCA 2PGXA 1JHVA 3DB2A 4I1SA 4BPBA 5FNVF 3NPAA 5I6DA 1I9GA 1Z9BA 3ZVMA 1LPMA 1RRFA 3L4BC 1XWWA 3LIIA 4UEQA 3SEZA 1E5VA 3BD9A 5BSFA 1OHHD 4ON9A 3UV7A 1OKKD 4MV4A 1N3YA 4OP1A 2PKEA 2YWGA 4WHMA 5AMXA 4LXUA 2P9QA 5TQVA 1DEXA 2FQ1A 5IYZB 5FCDA 1WW3A 1DLJA 2XCQA 3NVAA 2V0NA 1Z5PA 1YUNA 3GZ4A 2RSLA 3F5SA 3E5HA 1I4LD 1TM2A 2B1QA 4OL9A 4BGUA 1K0FA 2XVMA 2IHKA 5FD8A 5DTMA 1D4OA 3B51X 1O8CA 4TYPA 4GKAA 3OJOA 1FZTA 3CE9A 3E58A 1I13A 3I9FA 1FJHA 2VUUA 3ID6C 3Q0EA 4FGLA 4M1TA 2H65A 2N1MA 4R2MA 5CG2A 4JP5A 1K5GA 2ZJ1A 4E12A 1JQDA 1AUOA 2DOKA 2X5XA 4QC2A 3TZQA 1AG9A 2IPAB 2A4MA 4X9XA 3VR5D 2G9NA 4YH1A 4G86A 2FEXA 2Z98A 4UDYX 3PE6A 3C3AA 1WBDA 2NU6B 1BD4A 4RW0A 4BC1A 1SVUA 3HVIA 4X20B 5SY9A 1PR9A 4L6AA 3VDRA 1ZN9A 1R6TA 2ILTA 3LP8A 3A25A 1CR6A 4L73A 5FBWB 2N9UA 4D7AA 5LQRA 2WM9B 2RH9B 3EGWA 4KIUA 3ZDRA 5CVTA 4YCNA 3Q7RA 4TZKA 5IWCA 2M6LA 2NSYA 4WCDA 1GKKA 1QQ6A 5GVSA 3OZDA 1YJ8A 3CO0S 4PSDA 4WJZA 1JEEA 3T5MA 3QLVC 4HBGA 3E5NA 1IHXA 2BM0A 4IYJA 3TEFA 3K70B 3QLUC 2RHDA 4ARVA 4KXFB 4H0NA 3COZA 3ZHSA 2UUOA 4NZZA 3AFNA 3A36A 2QMHA 3QV1A 4BP8A 1Q0RA 1MDFA 2ADMA 3V3KA 1YGPA 1XJQA 3OZ7A 1MJFA 2HIMA 1E59A 1Q7CA 3T1QA 1SUIA 5LN1A 2XECA 3WLNA 5FDFA 4DFDA 2FE1A 4NAUA 1CJUC 2JI7A 2YVUA 3V8VA 3KWMA 2Q4TA 2I54A 4A03A 4UHKA 1L9XA 1AK1A 2ORVA 1CEYA 1O9HA 4HFNA 2PZLA 5K0ZA 4MHTA 1AGNA 3RFUA 3W1WA 1MN6A 1K7SN 2ZWMA 1G8GA 1N2SA 1PW5A 2TMYA 3A3NA 5IBPA 1EZ1A 1EIWA 3TTUA 1G9SA 1F12A 2XYHA 4WDRA 2BGTA 4GRIA 4TS3A 2XWPA 3DXFA 5CK4A 4KR0A 3FHOA 3SN6A 2G1KA 3MPUA 4ND8A 3RWOA 1KEZA 2NT4A 1FUYB 4W4TA 3IHWA 4UU7A 4ARZB 4HWPA 2CLDX 3UAWA 4KU4A 1SVKA 3NDJA 1IOVA 2G17A 2W2KB 3EVGA 1RYMA 4MRNA 2Q2WA 3KJZA 4X8OA 5DASA 2YBEA 3ED1A 5KHAA 3T95A 4KXQA 2ESRA 3OHPA 2QAGA 4JVOA 1R4MB 2BONA 1IIBA 3QWBA 3S2UA 3GUYA 1KQFA 1W19A 3WGGA 1SQGA 5ALRA 4A8JB 1K9SA 1TT5A 2YJ5A 1ZIDA 2HHJA 1MP0A 1ZCJA 2DPHA 4RA6B 4Z99A 3NVDA 1AUQA 2KBFA 4ARIA 4YO8A 3LHFA 3LIPA 4KUEA 3SIWA 1P1IA 2XOKA 3D8UA 4IF4A 4IUBS 1G63A 1J97A 2XUKA 3NONA 2IP2A 2IYXA 4PYRA 4XH9B 1N4AA 3RARA 4UD2A 4YRRA 1MH9A 3GFTA 4CMBA 1RAEA 2E6UX 1MEOA 5CFOA 2QW0X 4EKYA 2Q62A 1KI2A 3JAKB 2MOKA 3LCMA 4OH7A 1Q7GA 2AG1A 2H9YA 2C84A 1QG6A 3MWEB 5ED4A 5F3WB 1Z4NA 2XMQA 4PTZA 5JSQA 4Z0NA 5TEWA 3WLFA 5T6BA 5CDUA 1T1SA 3UWMA 4OAOA 4J0EA 1OIWA 1QFJA 3ZQ4A 1TZJA 3BFXA 3Q8MA 3FJOA 4GNKA 4JSYA 4MUIA 4ZO8A 2F3TA 1P4JA 4NH4A 1YFJA 2OUIA 2NU8B 1JDBB 3WJ7A 3RAGA 1XF9A 2OP0A 1XJWA 3FCUB 4UZEA 1L5MA 3WK6A 5K6TA 1RYZA 2W2VA 3QVOA 4BZZA 1NW6A 1AZLA 3PPIA 2R1UA 4TUYA 3GR6A 5BW6B 1IY1A 4LV6A 4N82A 3S1SA 1E2BA 2D2VA 2F3UA 4F4JA 1GHTA 2P3OA 2L19A 3EVEA 1U0OC 3IH5A 3D6MA 5ALXA 3BRWD 1XX6A 3EZLA 3BGOS 4RHUA 3ZE6A 3EISA 1A3CA 2C2OA 4P92A 5EIFA 3AHEA 3O8DA 3Q85A 5CEEA 4R41A 3L3BA 2C4MA 2JAXA 3RJTA 3TNJA 1HZZC 2FHPA 2ZZNA 4GWKA 4TN1A 3CRZA 2AZ4A 1FS4A 4EJ2A 5IEBA 4GKBA 1UPBA 2H31A 4W1RA 5ISMA 5D3MB 5M04A 4MW6A 4L22A 3NC4A 1DJNA 1LPPA 1C1DA 4RD3A 3SR0A 3RVDA 4YCMA 2JJMA 4PNHA 3MIIA 4DG8A 5JOQA 1NPDA 4EI9A 3BRWA 2VEDA 4TTIA 1TCBA 2UZ4A 4EQZA 3JQRA 2B2XA 4EFNA 4J2HA 4O0LA 5HUQA 2FDCA 1HDRA 2CD7A 5KKCA 2OFXA 1SVLA 2G25A 3HCNA 3P27A 3R40A 2EDAA 4NZ9A 5L7TA 3FPGA 3HBJA 4DA4A 2SNIE 3HDYA 1YFZA 4RDIA 1M8GA 1QV7A 5CH5A 3DQZA 1C1XA 3DBOB 3QKSA 2OYRA 1IHUA 1RJDA 3FZQA 1I4EB 1YR2A 1PK9A 1YZQA 3INGA 1SIWA 2I4LA 4KAXA 2HLNA 3QEAZ 4H6VA 4I8XA 1PT8A 1K4YA 1C9KA 1N6KA 1Q1NA 2GJ9A 2XLCA 2HCBA 4L02A 5BV2P 4U2EA 1E20A 2PGDA 2B21A 3EEFA 1UM9A 2HJRA 4YJ3B 3GPDG 3OZFA 4RMIA 3VTFA 5TRTA 4IIXA 1K2WA 3NYRA 4NCKA 1N9ZA 2W98A 4HNRA 1P4HA 4OHKA 4TM8A 4Q37A 5JNRA 2R62A 2JLXA 4LHSA 5C9ZA 1RAGA 1U8UA 1UCFA 3TIVA 4BGIA 2XTJA 4D3XA 5HM8A 1N78A 2BFFB 4QLBA 3D1VA 3PG5A 2C3OA 4RVDA 1E4EA 1XK7A 2DH6A 2FPGA 4Y2XA 2COUA 3H19A 2QU8A 3FTPA 1MAUA 4HAXA 4L75A 4AU1A 3ZU2A 1VMAA 4I66A 1LNSA 3KEOA 1WXDA 3CLSC 3L1KA 3ZCPA 1ZGBA 4JQYA 2QVLA 4L9RA 5FOXA 5BN5B 3LDFA 5CM8B 3UJAA 3W6ZA 4IV0A 2VT6A 4DV5B 4G0NA 2FU5C 1VZ2A 1ENZA 1WD7A 2K5UA 3NTUA 2UZ1A 4DOMA 1TGVA 3BQ9A 2IX3A 2MINB 3QMVA 2O8CB 2WW8A 2CE2X 1EXNA 3RJZA 5IMBA 1J8MF 2PY6A 1JLMA 1SAYA 4HAYA 2FN4A 1GRNA 2H5LA 3BVPA 3ITNA 4PZ9A 3PDJA 3EPJA 2ZBUA 3ZCSA 2CW5A 2WG1A 3FDXA 5T6MA 2Q9CA 1G2QA 2V7WA 2I7TA 1SELA 3DEJA 1M7HA 1NUTA 1U65A 1QVAA 1YJCA 2RAUA 3T1NA 4WKNA 3RVPA 2WMNB 2VNAA 3CB2A 3ESBA 2E37A 1EFCA 2A9JA 2QLFA 4G1CA 2H2AA 3RFCA 3OU6A 1DBWA 5I7FA 5JPCA 4JP8A 1F20A 3LXRA 4RJKA 2BT4A 4J75A 1R4MA 3KX2A 1FFBA 4QHYA 3AUFA 2FRVA 4JI8B 3VGJA 5BV0A 4EATA 3CLUC 4FQ5A 2NTNA 3UY4A 1L4EA 4K9LA 3RIHA 1VE5A 4CKZA 2IF2A 2C2HA 3KXLA 4DDVA 1SQSA 2ISQA 5G0TA 1IWOA 1GZ5A 1L7BA 1LQ2A 1Z5OA 5EJ6A 1YAHA 4G9BA 2XZTA 3GN2A 2QD3A 3GP3A 4XZ3A 4YN3A 1V0JA 2B35A 4ZXFA 5CCXA 4FOOA 2ZJ2A 4FDTA 1E7SA 4ZOQI 1C0EA 5ILQA 1JECA 1SCAA 4OOFA 4DIUA 2FVYA 4JK3A 3VO8A 3WK9A 3L1UA 1GARA 5CA0F 1Z8DA 2CWDA 4Y9TA 5TLSA 3VDMA 2XWQA 1VIMA 4E03A 1OH7A 1TIBA 4R9VA 4NJEA 4G67A 4H1HA 5CLJA 4RVCA 3UXYA 4WERA 4LDNA 2NUTA 4PX9A 1TCAA 1EA7A 1WQ4A 1CQZA 1P0IA 1PGQA 2X5NA 2C54A 2AK3A 3MUFA 2HA4A 3N0WA 1ZR4A 2V3CC 3BK7A 2WF7A 3A28A 2C00A 3A10A 3O4FA 3VPSA 1DDIA 1DPGA 3IULA 2YJGA 3F6SA 1A27A 4Q02A 4K05A 1KK1A 2NU8A 3UJCA 2FVXA 1E0SA 2ZRBA 2JD2A 3R3XA 1U5BB 1DQYA 1EZ4A 5ENZA 2H0AA 4RBNA 4XX0B 3HP1A 3AP1A 3CSDA 1RCTE 2VT3A 2GN4A 2HC9A 3CWCA 4MW7A 2ERYA 2JCGA 4QTYA 1FVOA 2NOAA 2YC2C 2DKNA 1L5HA 3KU1A 4CFYA 1VG1A 4I0WB 1OH5A 3L6OO 4HMPA 4JXZA 5CVCA 2O0HA 3H6GA 4EUNA 1JLLB 1TTTA 3CVXA 1PJLA 2XB9A 6PFKA 3TSWA 1IQPA 2PSHA 2W43A 3EWNA 2Y1CA 2H3EA 1B3RA 2XMBA 3WDKA 1OTXA 1RI2A 3HY6A 4Q21A 2R4QA 4RXUA 1JBQA 2HSJA 3IAUA 2Y67A 1PLJA 2RBGA 2RHGB 1PR0A 4RH0A 2VQEB 3O2NA 2WDPA 4G0PA 2Y1XA 5EG5A 1Z33A 3NVMB 3H65A 3O8LA 1N4DA 1DC7A 2E5WA 3FKQA 5AXAA 4B7AA 1ZK4A 3BMXA 3VVMA 3G7UA 4B3FX 3QI7A 1B14A 5AW5A 2FDXA 2QUKA 4R0NA 3IKVA 1RJ9B 2FRDC 1R3UA 5H4HA 1P31A 1CUUA 1QB7A 2AV6A 4H16A 4Q93A 4RSHA 4RSMA 5KU7A 4IJVA 5HXAA 3A6HA 3C24A 2H7YA 1AJEA 4N7MA 1VECA 5I4IA 1G3IA 3Q72A 4W1PA 3QKSB 4W5HA 1TJ5A 4U00A 2RC6A 4N48A 3N39C 2H9AA 5EL0A 2UYYA 2OHJA 2O59A 4M37A 3PFBA 2B0CA 4XCQA 1AU9A 2XGGA 3K15A 4CQMA 3ZHYA 2YFYA 3QE2A 2YYSA 2BDUA 2V96A 3VKGA 1FSFA 1UM9B 1J09A 4RK4A 5ESDA 4EPWA 2D7JA 2EP8A 4GH5A 4JJ6A 1DEKA 1Z0UA 2V58A 4QTUB 3ZV3A 1UQTA 1FRFS 5BT9A 3WYEA 1QU3A 3T7JA 4M22A 1C7EA 4UHCA 2WQZA 4D98A 1PK7A 4POAA 5U1PA 1ND6A 4PTLA 3WAKA 2BFFA 4XYLA 5BWBA 4MVJP 2A1UB 2EHJA 1WR8A 2FPGB 3JZIA 2XYGA 4HRXA 1RHUA 3PNSA 4I55F 2PL1A 3U39A 1T3GA 5F2KA 4ZQGA 3V5NA 1L7QA 2CNKA 3KWFA 2F1OA 3WIUA 3U4HA 3WWPA 4AKIA 4J0FA 2W2XA 1G8AA 2EJTA 2C7VA 4GM0A 4ETIA 3KFVA 2Q1SA 3B8HA 3E9YA 3SLGA 4Q4CA 5KYWA 2OGSA 1DPFA 2GFIA 3ZV7A 2DLCX 4HMOA 4G5QA 4XVHA 3RRXA 2ZR7A 4XWWA 2AEFA 2O8CA 2R48A 3MGGA 4OH1A 2QG9A 1MRNA 2PX4A 3ND6A 4MIOA 3TW0A 2QJOA 4UQLA 1JLRA 1H0RA 1XNGA 2Z5FA 2I7DA 4UTZA 4GWGA 3RIMA 4BFSA 5AUPB 4B3MB 4DSUA 3WWEA 4DLBA 4B6EA 2EWMA 2GXAA 4PNEA 2PGOA 1C9JA 3O4VA 2HK6A 1GRCA 3C3EA 3VDXA 2IS2A 1RLMA 2ID4A 2XY4A 1AKRA 2W6CX 3UJDA 2D5LA 1JJ7A 1Z22A 2QQ5A 1JT2A 3OHSX 2JAUA 3UMBA 5I47A 2JBWA 3T1OA 2R66A 3JD0A 5KTMA 2A58A 3AM5A 1R8SA 1DRKA 2BFOA 4BGVA 3EQ7A 4DG9A 3ZNNA 1SULA 3HN7A 3H5VA 1H6CA 2V9ZA 5BSMA 5KJEA 3BGDA 1T5BA 2Q8QA 5AM0A 4C6TB 4UULA 1EPUA 5LQUA 1PJ8A 4A0FA 2O2YA 3OO1A 2D2XA 4CIXA 4JEIA 2QTBA 4TWBA 3V42A 2CV0A 1M1YA 4I8DA 2HNAA 3ZE7A 4PQYA 2WM8A 2V6JA 2ZYAA 4IFEA 1UZNA 3M6XA 4QBGB 4EYGA 1POXA 2PXAA 4UVDA 2BOVA 5EZ6B 3WSTA 4JJZA 3ZC3A 3MXOA 3UK2A 2WP8J 5ES3A 4ZGGA 3E15A 3N87A 3V7NA 4HQNA 2RGDA 1BEEA 4R1MA 1DJQA 2UKDA 1MC4A 4RVUA 5AOBA 3UCEA 5AW7A 5ECYA 3DEIA 1JGTA 1HQKA 3L84A 4IRXA 3S81A 1KKMA 4CIAA 3GRPA 2GDJA 3WLQA 3I04A 1V1RA 1SXIA 3WNBA 4QJBA 2OO3A 1I7NA 4C06A 4K6FA 3REQB 4FOTA 5L4SA 2DFNA 3OU2A 2IOFA 2Q9AA 2BM1A 1JHQA 3Q3HA 1S3SA 2YMQA 4PLCA 1T8RA 2P5UA 2GPWA 4LJLA 4UHEA 3TXYA 1H2ZA 1U5BA 1LSUA 4WINA 4RK6A 2HCRA 3ZZ0A 3UG6A 1R8XA 2H5JA 3QMWA 3FLAA 5ARBA 5LZ9A 1W0KA 1V7ZA 5HBRA 2YCLA 2O2CA 3UMVA 3FWYA 2OV3A 2R8XA 4FD3A 4KR9A 1KR5A 1A9YA 3GWGA 4LVUA 1U2ZA 4YP7A 1HTTA 3A04A 1OVMA 3WYDA 1NKTA 3F1KA 1OKKA 3E35A 1G6KA 4BLWA 1RI4A 4TLDA 3AUTA 1WXQA 1PJ4A 4FKZA 3M8KA 4CQMB 4BX9A 1RQ7A 2A1TR 2C29D 2VF7A 5K20A 4LFAB 1IM2A 4XVQA 4Q1BA 3SKVA 1FP6A 1KORA 3ZI7A 4EY3A 5ELXA 2XKKA 4EHKA 1Z68A 3HCEA 3L7BA 4QOIA 1HC7A 3EVZA 2H7CA 2C97A 2GQ0A 3JRWA 4KZKA 2XMZA 5L45A 3DZCA 1SURA 3PD7A 5HPYB 1ORIA 4EP1A 4C4XA 3HBNA 5KYUA 1ODSA 1FS5A 1QSGA 1KJQA 4B09A 4B5KA 1WXXA 1QPZA 3I12A 3PUXA 3UHOA 1P1RA 1E1CB 4OV6B 4NBVA 1JJVA 2GLUA 4AJ2A 4LYJA 1PVDA 3H2SA 1N3IA 3AXTA 1DARA 1U7HA 2C77A 2W11A 5K3FA 1BH6A 1KQOA 1NXXA 2XQGA 1GZDA 1UXIA 3MT9A 1H0HA 2R751 2QNBA 5JARA 4GEGA 2JB9A 4R71A 4IDDA 1I2BA 2CYBA 1PV4A 1DAFA 1E9EA 3IP1A 4YMVA 4MVJF 2I8CA 2VH1A 4QUEA 4IWNA 4DWWA 2J4CA 2EW2A 5DIFA 5C81A 4LEIA 3BBLA 4MO2A 1CQJA 4ZQCB 1NZJA 1GYPA 3CY6A 1QVZA 1OF1A 5IKXA 3CLKA 3HLYA 3K7EA 5HOEA 4TTAA 1M1NB 3VR6H 3ZXXA 1W0JA 3T0FA 3U7HB 4LXXA 3T99A 5DHPA 3OUTA 1A8HA 1WMSA 5HBGA 2RK3A 3BXEA 1QYXA 4MQEB 5J59A 2VA9A 4MHOA 3CH7A 1YB1A 1GKLA 2OL4A 2VF5X 3RLFA 1UPCA 1U0BB 1CUAA 4ZYYA 4HP8A 4C7KA 4L8GA 2ICAA 1LLUA 5K0EA 4WNIA 3I9MA 2G1AA 3OKPA 3TRHA 3HMQA 4Q1DA 1Y1PA 5IC4A 4DIBA 4ZQIA 5A62A 3JD1A 1YR3A 4AY2A 4U8GA 3O4GA 1J70A 3BA6A 3SE0A 4IQ8A 5JNTA 3KQUA 4ZPXA 1JMYA 1OXXK 3CW9A 1NMYA 3NT5A 2HDHA 4BGEA 2AUMA 4IQGA 1QAQA 4OEHA 3AL2A 3AXSA 3UFXB 4CHGA 2V1UA 4BFZA 1KVSA 2FSPA 3DOHA 3MEQA 3KKOA 3W2IA 3E2IA 1IQ0A 4DJEC 4MJ7A 4UUOA 4Q9LA 4CL3A 4E2YA 3BWEA 5K0JA 2WAYA 3M5PA 1NBWB 3ZDYB 1QH9A 2GD1O 4WEQA 2UYGA 4E30A 2EWVA 4ZYXA 2BELA 4AKTA 1OZFA 1P6XA 4R54A 5B2EA 2C04A 4B3RB 3ZZNA 4DNXA 3ISJA 4PQFA 4RZ2A 1NQTA 1T4BA 3V48A 1EVEA 4HUQB 3S1AB 5KS2A 3ZX5A 1RIIA 3C7DB 2I78A 2CHFA 3IAM6 5ABPA 421PA 1QQBA 3QPWA 3DOOA 3GNLA 3I28A 4ZODA 2H1HA 5IJ9A 1HDIA 3OIUA 4IQ0A 5FA5A 4EO7A 1UWKA 3DYVA 3IJEB 3KK0A 1IMOA 3LGXA 3UGKA 1K98A 1KYVA 4YMTA 4LWQA 2AIRA 1MQSA 4QUBA 3RH0A 3KZVA 4TTRA 4BMXA 3BBPA 1CFJA 1T5SA 4PLTA 5ESXA 3UATA 1NURA 1L4FA 2VJOA 1T91A 2WUFA 3UANA 1P2FA 2W0MA 3IS3A 5BW4A 4WFIA 3NC0C 1SRRA 1A5BB 2EJBA 4XGIA 2ZB2A 1XEXB 4MR8A 4AJLA 1V1RB 3V6LA 2X0DA 2PFSA 3VTZA 1XTJA 2CLHB 4LJ6A 5F4ZA 1YASA 3E7PA 3WADA 1DIRA 3H0EA 2OCYC 4QODA 4U6SA 4MIYA 3R7SA 1TD1A 3RKUA 3FOEC 3GVIA 1Z0KA 1B0UA 4ENUA 3KOMA 1YZKA 4WKBA 3A2NA 3LUPA 4B17A 1IUPA 4KWCA 4H60A 3KOUA 2WIBA 1Q2XA 4L8WB 5GOZA 4YXWA 2M6RA 1S2LA 3VU0A 5ALEA 2JAOA 2C3YA 2KSQA 1VIAA 1GGVA 3HA2A 3MCZA 4K9DA 5DTIA 5BMVF 5DNUA 5F7ZA 1H4VB 2ZRGA 1V6CA 1SXQA 3STYA 5CH3A 1H1DA 4E2ZA 1QVWA 4AIRA 1NI5A 3CMMA 2AXPA 3EPRA 2AFIA 3DKPA 1DMSA 3E9QA 3OT1A 1JWAB 3NO4A 2DWPA 1E5LA 1X1DA 2VWHA 3ICCA 5HZGA 2ZSHA 3AB7A 4Y0AA 3QXSA 3O94A 5JZSA 4IMRA 4WCFC 4X41A 3QVXA 4IIYA 2B1RA 1EP1B 1F06A 1PJAA 2FPLA 5TC4A 2EKBA 2O7RA 2M1ZA 3KZKA 4F6CA 3A58B 3NV7A 1XC7A 2Q5FA 3FW1A 4PF1A 1GRQA 1TYZA 2D59A 3OVMA 1DUSA 5BUCA 1H2WA 1Y82A 2QXUA 3ZNPA 3FBGA 4KE7A 1GQSA 2YYAA 2AF3C 3B7PA 2PDAA 2PLFA 1AKEA 1BOOA 1NNLA 1NMQA 3DVQX 3MRSA 4O4LF 3WLEA 2NADA 2EFJA 3N6XA 1P61B 1YQGA 4N6NA 5F77A 3KC2A 4NYMR 2ZRKA 4Y6LA 3RHFA 3FFTA 2WM2A 2E82A 2FSVC 4DMKA 5LP6A 4H4DA 5K3FB 2WIFA 4QYIA 4D3FA 1CK4A 4RV5A 4HSGA 4PZ0A 4W8HA 1ECBA 1W34A 1R0BA 3X0DA 3AMVA 1KJNA 3P9IA 1QAMA 4QGAA 2F55A 2ZIUB 4L3VA 3JQGA 3NDIA 3WYBA 4FWTA 4WK4B 1UOQA 3ZHVA 5H3HA 1Y9EA 1XJ5A 2W2LA 1XLWA 2LR0A 2WYWA 3HCWA 1Z38A 4TKZA 4A27A 1B0AA 2WT8A 2KYRA 4GKVA 4RAQA 1HNXB 5JG7A 1ZIYA 1UDBA 4MLZA 3W1VA 4YV7A 1OA1A 3DM5A 3LPLA 5JTTA 1A8PA