1RKUA

Crystal structure of thrh gene product of pseudomonas aeruginosa
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
206
structure length
206
Chain Sequence
DMEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDIQEVIATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSDRVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHAPENVIREFPQFPAVHTYEDLKREFLKASSRSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The thrH Gene Product of Pseudomonas aeruginosa Is a Dual Activity Enzyme with a Novel Phosphoserine:Homoserine Phosphotransferase Activity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords homoserine kinase
total genus 78
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rkuA01
3.90.1470.10 Alpha Beta Alpha-Beta Complex thrh gene product, domain 2 thrh gene product, domain 2 1rkuA02
1N9KA 2IOHA 5AK6A 3MPOA 5AVVA 2X4DA 5AW7A 2OBBA 1RQNA 2RAVA 2G80A 1ZJJA 2JARA 3IJ5A 3FM9A 4UAUA 2HEGA 2B1RA 3IB6A 3N28A 3PGVA 3VAYA 2R8ZA 3L0CA 5AW1A 3L0BA 2G09A 3QUCA 5ALDA 5AVXA 3E81A 2I7DA 4Y2QA 2GFHA 2FPWA 1QYIA 2JAWA 2P69A 3PDWA 3M9LA 3OCZA 2P27A 4DW8A 5AIAA 1RLTA 1T5TA 3ED5A 3P96A 2QLTA 4RESA 3MC1A 4EENA 3A3YA 2FUEA 3AR7A 3DDHA 4I9GA 4AS2A 3QU7A 4HAIA 1Q91A 1Z4MA 4BKMA 1Z88A 5AVTA 1CQZA 3OCYA 4ZEXA 4UMDA 4ZEWA 3WKBA 5A3RA 4EELA 3EPRA 4Y2JA 4BEWA 5ALVA 4RETA 3WKDA 3U26A 4YCNA 5AVYA 3ZVMA 3ESQA 1RMYA 2B8JA 5AW0A 5AM5A 3ZUPA 2WM8A 2W43A 2I6XA 2B82A 3WK6A 4EEKA 3L8HA 1NF2A 1YV9A 3QU9A 2HI0A 4C4RA 3L0YA 2YN4A 2Q4RA 1RLOA 5AW4A 3UMGA 1FEZA 5AKZA 3DNPA 5ALXA 1PW5A 4XE5A 2HOQA 5AVSA 5ALGA 3BA6A 3ET4A 1U02A 1VFPA 4G63A 5AVZA 5IS2A 4JB3A 2G08A 2I55A 1Q92A 2AH5A 5AW2A 5AK3A 5AKYA 5AVUA 1ZRMA 5AW9A 5AHXA 2FDRA 2WF7A 3SLRA 3QXGA 3R4CA 1L8OA 1U2TA 1XP5A 4UMVA 2WF9A 4GXTA 3ZTWA 1RKVA 1YMQA 4EZEA 2ZBFA 5AKGA 1RKUA 1ZD4A 3SKYA 2CN1A 3SKXA 2WF5A 4NWIA 4OFZA 4UMEA 1L7MA 2D2VA 3S6JA 4OHFA 4UW9A 5ALRA 5ALZA 1Z4OA 3PGLA 3E8MA 4QQFA 3OCVA 4NAVA 2WF6A 4BYGA 2ZG6A 3ZI4A 3W5BA 2ZXEA 5AI6A 4CF4A 2YMQA 2I54A 3L8EA 1TJ3A 5ALOA 3AR4A 5AICA 5AESA 4HGRA 3AR5A 3BWVA 2B1QA 3ZWDA 2GMWA 2FPRA 3AR2A 4AP9A 3OPXA 5AM4A 1U7OA 3I76A 4PNHA 1WR8A 3UM9A 3U19A 4BEVA 2O9JA 2WF8A 2FPXA 4XPZA 3KZXA 5FP0A 3NAMA 1L7OA 5ALNA 4Y2RA 4BNDB 5AK5A 4Y2YA 4UU0A 4NFLA 5ALLA 4UASA 2YFYA 3R9KA 3AR9A 2VKQA 1J97A 3WKEA 3W5AA 1JUDA 1YJ5A 5AI9A 5ALEA 4CF3A 5AM0A 1ZD3A 3OCWA 4YCLA 2OA0A 1N8NA 2QYHA 4CE6A 4HGOA 4BX0A 2W4MA 3WK5A 1J8DA 3QLEA 1T5SA 2C8KA 2FPUA 4UARA 3ZWKA 2BY4A 2YMPA 4UU1A 2B8EA 2GO7A 3EF1A 2O2XA 3NUQA 4L57A 4L6AA 1Z4PX 3EWIA 1Z4NA 2FEAA 3SF0A 2ODAA 4J2TA 3L7YA 1U2SA 2OYCA 4UM5A 5ALWA 3KOOA 4YCMA 5AVRA 4BNDA 5AIBA 5AKLA 3MMZA 5AW5A 4AS3A 3QGMA 5AM2A 2HSZA 4KYTA 3SMVA 1XPJA 2IOFK 4B6JA 3W5DA 3QU2A 2ZBDA 2YJ3A 2G07A 5AI0A 2CFSA 2W11A 2FUCA 1KYTA 3A1DA 3WKCA 3WKAA 4BX2A 1YS9A 4EX7A 3U7FB 4QJBA 1Z5GA 2C88A 1IWOA 2ZBEA 4Y2UA 1YDFA 1YNSA 4FE3A 2YY6A 4Y3UA 2AMYA 4YGYA 4F72A 4YIHA 4NV0A 2C8LA 2YJ5A 2HO4A 2HDOA 3QU4A 3HYCA 3B8EA 3WK4A 2FI1A 2EATA 2Q4TA 4BBJA 3NALA 3ZX5A 4Y2XA 5AKEA 3SHQA 4IG4A 4KNWA 1SWWA 1ZRNA 4UAVA 2HHLA 3GYGA 1U7PA 5E0OA 3TLMA 3MN1A 1Y8AA 2BDUA 1RQLA 2P9JA 3L8GA 4FYPA 4YH1A 1LVHA 2FPSA 3QUTA 1L7PA 3W5CA 3NIWA 1LTQA 1VJ5A 3ZTYA 4UM7A 4DCCA 4OCZA 5AKJA 1TE2A 3KD3A 5AKIA 1O08A 2PR7A 5AW3A 3ONNA 4IFTA 1RKQA 1RPZA 3OTQA 4J03A 5AI8A 3L8FA 4F71A 3B9BA 5AVWA 4UATA 5ALMA 4CF5A 3DV9A 5A3SA 1RRCA 5AI4A 2NYVA 3UMBA 2BDEA 4CNQA 3UMCA 3L1VA 1NRWA 3FGOA 2IA5A 2R8YA 3E84A 4KX5A 3WK8A 4XQ0A 3SD7A 2PKEA 1Z4KA 3QUBA 4C4SA 3L1UA 3WGVA 2I34A 2RB5A 5AVQA 4HYTA 3ESRA 2CFRA 2WHEA 2B0CA 2OM6A 3QU5A 2C9MA 5ALIA 1Z4LA 2HCFA 4HGPA 3A1CA 2R8XA 4OD0A 4HGNA 3AR3A 4KNVA 5ALTA 2RBKA 1EK1A 4O8CA 3I1YA 5T41A 1L7NA 4XOUA 3N5KA 3QUQA 4L6CA 3DAOA 5ALHA 2AGVA 5ALUA 5AK4A 5AKKA 3RFUA 2PQ0A 1O03A 3N8GA 2NO5A 2YJ6A 1S8OA 4KX3A 4EX6A 1XVIA 3IRUA 4DWOA 3AR6A 3FPSA 1QQ5A 1EK2A 1Z4IA 5ALQA 1L6RA 3ZX4A 3ET5A 4E88A 1CR6A 5AM1A 3WGUA 4Y2PA 4C4TA 1TA0A 3J7TA 3EF0A 5IT0A 5A3QA 5AW8A 3OCXA 3NASA 3I6BA 4Y2SA 3KBBA 4Y2TA 3WK9A 1RMTA 3NANA 1ZS9A 3M1YA 3ZVLA 3OCUA 3KC2A 2P11A 3ZW7A 3CZ4A 3N1UA 4H1WA 2G1AA 3AR8A 2MU1A 1K1EA 3QX7A 1NNLA 3NRJA 1ZOLA 5ALJA 3QNMA 1WZCA 2HF7A 2YMMA 5ALKA 3QYPA 1AQ6A 1RMQA 1F5SA 2RARA 2GHTA 1QH9A 2MSNA 1TJ4A 2EAUA 1QQ6A 5ALSA 1SWVA 3D6JA 2ZOSA 5AI5A 1Z4QA 1Z5UA 2YBDA 3K1ZA 2HF2A 2JAOA 4Y2VA 3R09A 3KDPA 3FPBA 4FFDA 4GIBA 1SU4A 3L5KA 1RLMA 4I9FA 4UMFA 1ZD5A 2I33A 5ALYA 3U7HB 5AM3A 2G06A 2GHQA 2IYEA 1L8LA 2WFAA 3A1EA 2JGAA 3E58A 4BX3A 4MWOA 1T9ZA 1TJ5A 5AKHA 3U7EB 2YJ4A 2DQSA 1VJRA 3U13A 3FVVA 3B9RA 4ZEVA 2HX1A 3ZU6A 1Z4JA 4G9BA 5AKXA 3ZVNA 2Q5EA 3HLTA 2IOFA 5IT4A 4MUMA 4KN8A 2NO4A 1RDFA 1ZD2P 1X42A 2R8EA 2G0AA 3F9RA 2JAUA 5ALPA 2YMLA 4YIKA 3WK7A 4NABA 2EARA 2B30A 3CNHA 1WVIA 5ALFA 1MH9A 2C4NA 4HGQA 1S2OA 3FZQA 2ZBGA 3I28A 3U7GA 4DFDA 5JJBA 3N07A 3PCTA 1RC8A 1QQ7A 4JDPA 5AW6A 2AUTA 3RF6A 1WPGA 2CFTA
chains in the Genus database with same CATH superfamily
2IOHA 5AK6A 3OJCA 3OTGA 2AUMA 1L7DA 2X4DA 1J2RA 3G5TA 4PIPA 3CLSD 2AQIA 5FTJA 2BGRA 1UK9A 2C9ZA 4U6QA 5CCDA 3EXHC 1O8BA 3COZA 3NHZA 2C82A 1N5KA 1AHNA 2XVXA 5FV7A 2JARA 1ECFA 3BIXA 4I9NA 4K6GA 4LVNA 2GCPA 4B85A 4ZI7B 1XZMA 3DWEX 5HQ3B 1XDBA 4TTSA 4LCBA 1PR6A 1QIGA 2PBZA 1UDCA 1YQUA 2R7MA 5CH5A 3HUEA 1OB5A 3I09A 2OC9A 3LDFA 4GECA 4ME6A 2FPPA 2I7DA 5EZ5A 4GWKA 2GFHA 5J5CA 4RTLA 1P61B 1ZW1A 3K0FB 2VXCA 4ZIRB 4DLKA 1RXVA 5F64A 4LAFA 1T5HX 1GZVA 4RVUA 5JVDB 3AKDA 2CZQA 5FQNA 4YMGA 1TK9A 1ZN8A 3GQBA 1HYHA 3FY4A 2H06A 3ED5A 3THWA 2J0EA 2Q4EA 2XWPA 4LOJA 3WGMA 4BUZA 1BGVA 3TR6A 3G8CA 2O5CA 4TWAA 2G1JA 2F1IA 3G7SA 4BNUA 1FUUA 1K27A 2ODEA 4AS2A 3QU7A 3OEHD 4TPKA 1GA6A 1C3LA 1RIIA 1O95D 1QWSA 2R79A 3D4IA 4A36A 3NATA 1DARA 3GEIA 3MJ4A 3ZBTA 1H2AS 2XGOA 3M2TA 2GJ9A 3SVTA 3D6AA 2GN1A 4RMHA 1H2WA 1LSOA 3AEKB 5KSZA 1WNTA 1JT2A 4MYHA 2XNDA 4Y9DA 4N12A 3G0IA 5TQ0B 4I55F 4BGDA 1RMYA 2LE0A 2ZBRA 5HUQA 3B48A 2Y1GA 5IDVA 2GPTA 4YUWA 4MUAA 3DBLB 3WL4A 5SYAA 2NTNA 4HQFA 3S28A 3VO8A 4NBNA 3L0YA 4MWSA 1QO7A 2BLLA 2XB4A 1PJBA 4RL6A 1IJEA 2JIBA 2VZLA 2AOWA 2FPPB 3DOOA 3GUCA 3P4XA 4JC5A 5FR2A 2I7VA 3X1JA 4D2IA 2OKGA 4LGYA 2FSPA 2V6MA 2XYGA 4PIMA 5LC1A 2UYQA 5ALXA 3PWKA 1U6JA 3DXXA 3AV0B 4Z49A 2J6BA 1MB2A 1H2EA 2XSZA 3WB2A 3ITEA 4WY5A 1HYEA 3BA6A 3LUDA 4MUXA 3BRWA 4V0NA 4QM6A 4Q01A 4BP1A 2O57A 3SVLA 2C0CA 4R6WA 4XVCA 5AW2A 1F4LA 2I8AA 5F23A 1AX9A 3QIVA 5AVUA 3THYA 2HQRA 4O2LA 1L7AA 4EITA 2YVLA 4E1BA 1E89A 1K4YA 4KE7A 2CJFA 3IOYA 3H42B 1LF0A 2XWQA 2BOVA 3GJ0A 1CIVA 1DC6A 1P5FA 4FKZA 5FYQA 2HHHB 2AI2A 3OD5A 1KORA 1BWRA 1FYXA 5AOBA 3DXZA 1SC9A 4KITB 1WM1A 4JIGA 2IBTA 3GFFA 4LCJA 2P5YA 2WVJA 3WGIA 3QXJA 3SKYA 4CKCB 1XQWA 5BURA 2BEUB 1A0OA 4XOIA 1RLIA 4QXPA 2D2VA 1G8YA 1AGRA 4FFSA 4ENTA 1PWHA 1E2IA 2PIAA 3ROXA 3CEPB 2ZPTX 2F55A 3PJEA 1EE2A 3I8SA 4QOHA 5SV2A 2HMAA 5CYPA 1KMNA 4KBFA 2D0PB 4X65B 3W5BA 3ZG6A 1SXGA 2SKDA 3GNQA 4JJKA 1PZEA 1Z2EA 1LPPA 4GKVA 4BVEA 2WJ3A 4ND1A 4F8EA 4MIKA 3AR4A 4WCDA 4YJ2A 1HDCA 1Z0SA 5K2MA 1KJZA 1W4AA 5CNMA 1E62A 2IIQA 5F2OA 3FZYA 2VDLB 4G24A 3H11A 4HXFB 1GPJA 2OESA 4LUCA 1KMQA 3QEAZ 5T4HA 4F56A 1EFKA 1OAKA 1OYVA 1JF8A 4LZZA 4KHPB 3TZHA 3AERB 2R97A 4B2IA 1CZHA 3AKYA 5AOCA 3IPXA 3F5DA 4PZAA 3P20A 4EPXA 4BEVA 1N6KA 1USKA 1E8MA 2R8BA 3DE7X 1TTTA 1U0TA 4QEDA 2OBFA 4XPZA 4HDSB 3RC3A 3HBLA 2VYCA 4KP7A 4W7IA 4P3PA 2BRUA 4YAIA 2G04A 4MP6A 4RH0A 1XNRB 4D8XA 4V03A 5G4LA 3OU7A 3ROPA 2YW9A 3H6HA 1I24A 2YRXA 2A0XA 2PH7A 2XKAA 3S2EA 3EOBI 3R3UA 5CHEA 1LK0A 1U28C 1CUAA 2H0RA 5FTWA 2R6FA 2VF2A 3MTQA 1YJ5A 4DQUA 4RO0A 1N2CE 1VG8A 2EJCA 3UBTA 2A7XA 4JJ4A 3WISA 1OH6A 4TMTA 3IP5A 3GVXA 4GP7A 4LF9B 1LDBA 1ORRA 1RJGA 1VJ1A 4DR2B 2YVUA 4DB4A 4BFYA 2X6TA 1G7TA 3O2NA 1WDMA 4FCVA 1TZKA 1Q0QA 4ZVNA 5CDFA 2PUBA 3AB3A 1SCJA 1F6BA 3NW9A 5HGJA 3ZHQA 4V0MA 2EGGA 1ZGGA 4DAEA 3QBJA 3ID6C 3TLGA 2FSGA 2B8EA 3W7BA 4J9UE 5KYUB 4S0XA 3L84A 5A1JA 1YR1A 8GPBA 4OU4A 1KDZA 4EBBA 2WHYA 4QPDA 5KDOA 4FFOA 1R6TA 2JCGA 2X5OA 3RUIA 4AZTA 4E5MA 3GRKA 2I87A 4P2GA 1IDOA 5REQB 1GUZA 1C3OB 2PNFA 2VJBA 1XU7A 4P32A 2ZRAA 1OIXA 2V97A 4GG1A 4UOQA 4AX4A 1MF7A 4K9RA 3R3ZA 3ZDAA 1GGHA 4H27A 5ICSA 1VSBA 3DQZA 1BH2A 4X9XA 4B4UA 1W2HA 4XLTA 3FOEC 1G41A 1QB8A 1YDHA 1QHSA 2ZK7A 3H4IA 3N70A 4BX2A 3D8HA 2PUEA 1XRLA 3F67A 1BCRA 1XZKA 3AI7A 1X8XA 3B1YA 3C39A 4WECA 4KXWA 4MA4A 3WIVA 4MS1A 1XROA 3QWBA 3T7DA 4LJRA 1SOUA 2A6PA 3CLTC 3E7PA 4X0EA 2AJTA 2P8JA 4YXFA 5K0FA 4WLFA 1HMYA 4YIHA 2XT9A 2ZJBA 4C2UA 1E7QA 3WNZA 5KBYA 2QPLA 1QHIA 1BGXT 1ZAYA 4XB2A 3EC7A 2Z58A 1T1SA 4WFJA 3H2YA 2PKQP 3Q8MA 1IHOA 2VYVA 1NTOA 3O8QA 4KPUA 1Y48E 2N42A 3NONA 4GI3A 2GN9A 1RU3A 3IA7A 1B00A 1UDBA 2REBA 3AUTA 4EW3A 4UDYX 4MRSA 3ZHOA 3JALA 1I4DD 4ARIA 2D7JA 3PFWO 3ZXSA 4KQMA 5HKLA 2XKBA 3VZPA 1Z33A 2YTZA 2H31A 3FCUB 2UUCB 3O1LA 3HFGA 2OK8A 3BMQA 4DOMA 5LZ2A 3Q40A 2FZCA 1EFRD 4R3NA 4IQ8A 1XCJA 3DO8A 3SQOA 4DSTA 2XAAA 1TM5E 1XQ1A 4LVUA 1V5WA 4ARZA 3PFIA 1U3CA 2WB2A 1PU2A 2QYSA 2OPHA 1QGED 1X7GA 2JAHA 1X6VA 4ZCLA 3H05A 5B30A 3HJUA 1MJGM 1W36D 2J9GA 4MKHA 4GKBA 2J9FB 3M3HA 2J8ZA 5EVCA 1F38A 4EG6A 1TAUA 1DHTA 4YO8A 3VUEA 2ASVA 2QRUA 3GAZA 3TVDA 4B17A 3AETA 3BCRA 1Q0TA 1VJ5A 4R40A 4N41A 2QDKA 4RYLA 5F4BA 3MIZA 1VIDA 4W8OA 4DS3A 1E2HA 3FW1A 5A4AA 2VQEB 1GZ7A 5AKJA 4QXRA 3DHWC 2JLRA 1GTZA 3BB1A 3ZW9A 4ZZ1A 5C5CA 3B13B 3I8OA 3AC0A 4L7QA 4NPAA 3RBZA 2F59A 3ONNA 4F3NA 1F7UA 4ZU1X 3N6XA 5DNEA 1YR3A 3P0JA 1YU6A 3PKZA 1C3VA 4KV9A 4MGKR 3ZEAA 1L7BA 5M2QA 2DPMA 4CGZA 4PM4A 5E1DA 1MFPA 2VPYA 1E1DA 2IY8A 3BE6A 4ENPA 3PT5A 1WPQA 4FSHA 1FMTA 5BNWA 4X71A 1QCDA 1CV2A 3BTSA 4NCXA 2GCGA 2ZIUB 3ZE7A 5GJCA 1XVAA 4HQ0A 1XTRA 5HTKA 1ETHA 3RTBA 1MJHA 1XALA 3E84A 4WK6A 3IAM6 1VSQA 1XCGB 2GKSA 1P77A 3FMGA 2YYAA 3UT6A 4C43A 5JXGA 4KQ6A 2ECOA 4LQLA 3SD7A 2H5JA 1NVWQ 4ODIA 4CQJA 1DAMA 3TI9A 4RLQA 3BAFA 4LFAB 2X1HA 5ER6A 2Z04A 3KFLA 4IHQA 4M8SA 3RBVA 1QVRA 5EI5A 1S2DA 2EW1A 4QYXA 3WLIA 2BFOA 5ALIA 2Y1DA 2BFEA 2OBYA 3DSRA 3VHXB 2BCEA 4GMGA 1CDZA 1PJSA 4HGPA 4LW8A 3RI3A 1ODCA 3ABQB 1PR1A 3LBIA 1V43A 3PPIA 4QU9A 3ZWMA 4UTPA 3ZJVA 1IN1A 4HH4A 1UANA 1W47A 4HWKA 4FLFA 3IBTA 1SRRA 2IELA 3U4IA 4DIFA 5JAOA 2BSAA 4JR0A 3BX1A 3O73A 2FN7A 3ES9A 5F77A 5CVEA 3C3KA 2FG7C 3ETNA 2W2PA 3HKCB 3UF0A 4NEHB 5IAGA 2PS0A 4LXUA 3ND7A 4H7HA 5FWYB 4PGHA 1LC3A 5LB4A 5JECA 2GQ0A 1AUXA 1XE3A 5JO0A 4N5HX 1PZHA 3UWOA 3U44A 1YJCA 1EEHA 4AD8A 3V46A 2Q3JA 4P7JA 4EYOA 4BNIA 3U3JA 1ZIPA 3UAGA 4E51A 4DIMA 2IFTA 5CA0B 4TVBA 3LC0A 3KJZA 3NM5A 5J4VA 1GG2A 4PV7A 1RHQA 2FSVC 1B8UA 2R47A 3MWLA 1T3ZA 1A9PA 3HMQA 4WZAE 5T5QA 4BRZA 3T1HB 3UOGA 4BQOA 1MC4A 2QXTA 1Z4IA 3TB6A 5J2UB 3W5HA 1L6RA 1VG0B 4E88A 1QOZA 3K30A 3O7WA 5LOVB 4UM9B 5AM1A 4WKBA 1P7PA 2ZRKA 4FMBB 4XIIA 4UNRA 1RYNA 2XGSA 3EZ7A 2A3NA 2PSJA 2QUBA 2UVDA 1ECLA 1BSVA 1YFKA 2CE2X 3CXRA 4QUAA 3SBXA 3N8HA 4FOTA 3QVUA 2WLTA 5F12A 3ZXIA 1KFEB 1TK3A 3LCRA 5C8DA 1QB7A 1JDBB 3DMNA 1W5AA 3R41A 1EG2A 2FX3A 5BSTA 1OX6A 3OCUA 3B3JA 5P8WA 3J81A 3RJZA 5BVHA 4H1UA 3KFVA 2AX3A 5DBFA 4JI5B 3AR8A 4ZFNA 1SIBE 2HSWA 3QX7A 5J23A 1WZCA 3A4MA 4O4IB 1JFRA 4ND4A 2PXXA 1DKPA 4QGBA 1G8SA 1N7IA 4ROTA 1O54A 2YXNA 1SZCA 4G5SA 4UUOA 4R2HA 3B8HA 2GHTA 4Q9KA 2B61A 2ZSUA 3D64A 1Y7PA 3DHEA 3G8BA 1AC5A 4G1EB 2IHZA 2PUVA 4NICA 1J8MF 4OGGA 5H3CA 4BNHA 2F4VB 1M1NB 4JBYA 3HP1A 4DPMA 4QGSA 3AJ8A 5KQPA 2WYOA 2NXEA 1ZKMA 4L73A 4M9QA 3TRJA 4R83A 1KQFA 3TW8B 2VSOA 2JFQA 5FBHA 4M89A 3M5CA 1KSGA 1XDUA 4X24A 4XB6B 2A0WA 1Q1BA 1J21A 3JQFA 4OEHA 4Y2VA 2NAFA 1XMVA 1P3Y1 4C78A 1ZPDA 1Y63A 4P7FA 3ZDEA 4ECEA 4E7PA 4K6FA 3H7IA 1WIWA 3DF7A 1COWA 4YACA 4NDNE 1RAHA 1XDGA 2XLBA 1F0YA 2IYPA 1I7LA 5D00A 4OLAA 1SFRA 4UBLA 3I04M 3IIIA 4TRRA 5ER9A 3ZCVA 3H97A 3KU4A 2MYTA 2BZGA 4TM7A 3EDRA 2I5PO 3Q41A 2G7MC 3OKPA 4ZV4A 2VSQA 4X6LA 4ENRA 3TZQA 2WKSA 2VBCA 4HAOA 3AKCA 3MT7A 3VNVA 3ZNPA 2Z1NA 2NYRA 3D8RA 4OHOA 4QPZA 1P4JA 3PC7A 4BVLA 3EN0A 2O06A 4LECA 3HVKA 3C5WP 3N0XA 3MUNA 4XEHA 3WLJA 3FVVA 1P1RA 2X2EA 4ZZIA 4Z3OA 3OOYA 3IEMA 3ZVNA 3K53A 4RKWA 3B60A 4HK4A 1P0CA 5ICGA 4L76A 4E0BA 4KN8A 3VGPA 1AQLA 2V6GA 2XMZA 5CX4A 1R8YA 3KM0A 3RYTC 3WOVA 1NU6A 2CLKB 2R8EA 4UVGA 2PE5A 3A4YA 2O6LA 1MNQA 1P9OA 3MTBA 3TSCA 4E03A 4P4GA 1V3QE 2PIDA 2VJPA 3AHIA 5H80A 3NVAA 3R7SA 1NW6A 1RJFA 4Y7CA 1C1HA 4URUR 2O3RA 5JQGA 1IWBB 3PQ8A 3HMKA 4QOIA 5LPNA 2JEOA 4M53A 2GBLC 4EFDA 4UEKA 2C3MA 2FWAA 2OV1A 2O1XA 5G2OA 1QE0A 2SKCA 4CN9A 3WJ2A 5E95A 3HM2A 1V2GA 1YRWA 1G0OA 1T13A 2G1PA 2VF8A 4MI1A 5ISMA 2HIMA 2AC7A 3CF0A 4RD0A 3EGXA 4UHEA 4QQKA 3K73O 4H4EA 4TVOA 3FWPA 4DMRA 4II7A 4IP0A 3PDUA 3NRBA 4PPFA 1YASA 1YAHA 2PT6A 2WD8A 4GHWA 3HVUA 5SZHB 4AN4A 4B3RB 1FX0A 2YFHA 1DBWA 3CJRA 4IZIA 4LRYA 1QK3A 1U4NA 1W9MA 3HEBA 4TKVB 4TZTA 1R8SA 4WESA 4YQFA 3DOEA 2EFCB 2Y0DA 5BRJA 5CCEA 1XTTA 3M6IA 4WGGA 1PWXA 4BZZA 3BBPA 3VXKA 2ZRDA 1ADCA 1PVDA 2Y68A 3HKCA 4Z99A 1DCTA 2J9RA 4EUNA 2B5WA 2BF7A 2E1RA 3LPCA 4JA0A 4MQFA 2HRRA 4TXJA 5B6IA 4BE9A 2P7HA 3EGEA 1FP4A 2P7IA 3FZGA 3PRHA 4X8OA 2QQ5A 1Y6FA 2GN2A 4BVHA 2YUTA 4IMPA 2WKPA 4V0RA 1RLTA 1NURA 4KMRA 3U49A 1T29A 3ZWBA 2EF1A 1TAGA 5EXTA 3MC1A 421PA 2R5WA 3PGKA 2RHWA 1XRSB 1NTRA 1X1AA 2Q0SA 4V3BA 2XGJA 4EM6A 4IINA 4Q4CA 2Q9BA 5I9LA 2LVBA 4DDUA 4BGEA 1K89A 1KY5A 2DLDA 1DTWB 3OCYA 4FTWA 1TUGA 1AQIA 3Q7PA 1SOWA 1E2LA 4HDSA 4R31A 4X8MA 3WQHA 5K8TA 2JH3A 1TXGA 1KDVA 2XWSA 1SPXA 1XEXB 1NT4A 3SF8A 1N2CA 4Q9LA 3TO5A 1CJKC 5B7QA 1P1KA 1PS8A 2D4HA 4RVFA 5GMOA 2FSIA 2B0JA 3QWAA 1H5UA 1QLWA 1YGPA 9ATCA 4FN5A 5LUBA 1DPGA 1I7NA 1NF2A 2JIRA 4C0AC 1EJBA 3KRTA 4ESVA 3JAWB 1TGYA 2GK6A 2QJFA 3A9SA 3PI7A 3RYHB 3VOSA 4W1PA 5KQSA 3FKSA 5DRTA 5AUOB 4WEQA 4RZ3A 3UMGA 1UDWA 1UINA 3GGGA 1L5WA 3LF2A 3QUAA 4QBIA 5E4YA 1F51E 2W6MA 1M3SA 2JD1A 2Q2OA 1RZRD 1SBTA 3D6MA 4GR9A 1Y4UA 3KOZA 3M0EA 2AH5A 3NPMA 4N49A 3RT7A 3KVNA 4AY4A 3W9BA 5ESDA 4X93A 4TKUB 1EVEA 3N59A 4QQRA 4X60A 1ZUNB 1LX7A 3NPAA 2IH2A 1JHAA 1GNSA 1E1QD 4I1UA 3N2ZB 4DWJA 5K0NA 1V5GA 3TD2A 2UYCA 1YU9A 3R4CA 1RP7A 1LDEA 2RG1A 4GXTA 4DY6A 2A9QA 3B6MA 3GNLA 1P81A 1K97A 4ND2A 5TNXA 4EZEA 5UKDA 5AKGA 1S96A 3BH7A 3N8NA 1FNMA 2XDWA 5K0GA 1ZINA 1XDSA 2V54A 4DLVA 3M8KA 4OHFA 2ZGVA 4IGEA 4C7OB 4FLMA 3P9ZA 4JODA 3VU1A 3CLSC 5KMGB 1YZLA 4D92A 4A9AA 5CGZA 1GAWA 4ZRMA 4QNNA 1UXGA 5AK0A 1PQYA 4IDEA 3DULA 3MCWA 4HDRB 3RUPA 5K9ZA 5DNWA 4LXIA 1XMJA 2FUKA 2JAXA 2FZ5A 2L19A 2CL0X 2JASA 4Y6OA 3FYHA 2PBRA 3DXFA 1D09A 3V8VA 1U0EA 3OFVA 4EKGA 4UOZA 1P29A 3BL6A 4CFZA 1S2GA 1GZ4A 3PC4A 1IXYA 3AR2A 2A35A 3HNOA 1WHTB 1ZA2A 3KE8A 2IYQA 4OM7A 1I1OA 1QKJA 3FWYA 2B69A 4KKXB 5J59A 3BOSA 3HA7A 4EARA 4G67A 1W88A 1P4AA 3VPHA 1F8XA 3HCAA 2I4TA 3T0FA 5JI2E 4YBRA 5D8DA 1O96B 2GFQA 1Z2PX 3E9MA 4M1MA 1IB6A 3IERA 4QE3A 3UJDA 1IC6A 1M8KA 3CH6A 3GD7A 2GBLA 4UASA 4BUJA 4CIDA 2I3ZA 3JQPA 3PPYA 5DBHX 4MOWA 5CK4A 4MVJA 4YV0A 1BKYA 4HWGA 1N1EA 5BT9A 3U7IA 1A5ZA 4CF3A 3NLLA 1ZD3A 4CZ2A 2VDUE 4REOA 2GLUA 1RPJA 4HNAA 5A9SB 3AW9A 2H63A 5BP7A 2VTBB 3D7RA 3BSWA 3ICPA 4L6IA 4D9EA 3WA7A 2X7XA 1O87A 5FEMA 1C3XA 3O5AA 1RADA 1BG6A 4AZWA 2B20A 4KWHA 5KVAA 5EIOA 1NONA 1RCFA 1XAGA 1QIJA 1EM8B 4RS3A 5EFZA 5DASA 2BY4A 5KJCA 2E9SA 2YMPA 2ZM6B 5HJEA 1OWNA 3WZ2A 1FTQA 2CCGA 2WICA 1L5HA 1S0UA 1Y8ZA 4L5BA 4P4UA 3CRQA 5AJTA 4K46A 4C20A 3MQ2A 1N6HA 3OE7A 5J4LA 4GL2A 1CKEA 1M2HA 2ODAA 3PUKA 4F7WA 1QV7A 3T5AA 4BUCA 1AGXA 4NCIA 4U39A 4Q7QA 4ZYWA 2KS6A 2QRGA 1RQRA 3VJMA 1H1TA 2HRCA 2W2KB 5JDIA 1JIUA 1LY1A 3O2JA 4IIBA 1GKYA 5EGNA 5CJPA 1DIBA 4CF6A 1V8BA 1BDHA 1XPUA 1YKSA 2COUA 1FSGA 2OUKA 1NMYA 1SBQA 3BK2A 3G0DA 4B3SB 3FN4A 1S1MA 2HDHA 1JHZA 1PHPA 1UXIA 2EFHB 1CRQA 1CFJA 2RGBA 3D6TB 1JR3D 2FUCA 2XMQA 3WKCA 1VLLA 1QE5A 5JSZB 4AYTA 3FOBA 2YYYA 1EDDA 1OLSA 3FNRA 4I4TA 3U7FB 4Z7JA 4E07A 1HKHA 1C30B 2YASA 1VE9A 5G40A 4MCAA 5FUWA 8LDHA 1I36A 5T3YA 5HKKD 4GX2A 1JQ3A 3V1MA 4MWEA 3SEFA 5LP6B 3T3OA 2HJWA 3CO5A 4FHDA 3ZGLA 4LWOA 4A2WA 5EUMA 4D57A 4DRXB 3QU4A 5B12A 1KF0A 4BO0A 2QKYA 4S12A 3D7NA 1YONA 3TX2A 5CLFA 4JXKA 2JLXA 2HDNB 3WK4A 3N76A 1KQNA 1JG7A 3TBHA 2G67A 3ZV7A 5GJBA 1IEQA 1UK7A 2WJ6A 1GQRA 2C9DA 3L6OO 5HFNA 1SXJC 4QDKA 3QXSA 3U4HA 4M6WA 4PTLA 3MXOA 2HWWA 3IR5A 4OFXA 4BDTA 3RF7A 3SHQA 2K87A 4KN9S 3SSMA 3U3MA 4FGJA 1BWPA 1FVFA 1T4MA 2VK4A 4A8HA 1COWD 1SAYA 1Z7YA 4X66B 2FHSA 4OTZA 5BOVA 1KP3A 1TO2E 2I7TA 1MN6A 4ALJA 1MC5A 1T6XA 4LRUA 1JMVA 1UPTA 3MILA 1HEIA 3BIWA 4MTLA 4D8WA 1U8AA 2NV2B 2Z4TA 3G49A 1OJLA 2FN8A 1D9ZA 2IEGA 5BSWA 5FWNA 3RK4A 3QX9A 4DMLA 2VUUA 4IVRA 5JNSA 4LE2A 3SHTA 4B73A 2DC1A 1IIRA 1I51A 3ELDA 4U6NA 4D3FA 5KYTA 5LL6P 2QRMA 4GAEA 4O2AB 4R9VA 4UJ3A 4ND6A 3FMIA 4UTOA 2Q3FA 4M38A 1FFSA 4URYR 3WMFA 2MCFA 3CF4G 4D0SA 2EKLA 1NC3A 4C0KA 1MCZA 3W6OA 3BMQB 3WLSA 4DJJA 4EGAA 5IPFA 1Q0RA 4CU2A 1YFLA 2KSQA 1LSJA 4S2UA 2P2ZA 5ENVA 3VYVA 2VHYA 1U98A 2HQBA 4HSGA 4EMUA 1KEWA 5J58A 1J7JA 2I6FA 5M3BA 1HUQA 3IEXA 3TNJA 1DRKA 4EK9A 1OA0A 2FXIA 2OLEA 2C83A 2OECA 2ZSBA 3KT0A 2IEZA 3OZCA 4P4TA 3W9YA 4YRZA 5JW6A 4FFRA 2PUTA 4I5GA 4KUHA 4L5AA 4HNQA 3ZJ4A 4YLYA 4OHCA 4RYDA 3I64A 3C7KA 3FVQA 3G5MA 3PHBE 1REQB 2G0TA 3E05A 3L9WA 4BMXA 1GUBA 1X2EA 1QZXA 2YWBA 1E79D 2ENWA 2IX9A 4J0FA 3AVPA 1W2WB 1THMA 3GBSA 3GWZA 3PGA1 5I9TA 1KK2A 1MVLA 1VCOA 4Y9TA 1JYSA 1ND6A 5DHSA 5FX2A 2N75A 1PJ2A 3NORA 4Q47A 1EGHA 2FUG6 4M87A 1XGKA 4GPIB 2X15A 1N0VC 2WHQA 2P2SA 3F6BX 1D4FA 3NDPA 1U5AA 1AV6A 2Q5FA 4KQFA 1X15A 1GZ6A 2PX8A 3DW1X 1E32A 4CM9A 3C98A 2IYZA 3HU3A 2O52A 3ZQJA 3OSZA 4F4DA 4H6WA 1XFAA 3MLAA 2V4ZA 4WJZA 1YMVA 1SGWA 5DN6D 2JGKA 2PT7A 2QSJA 2FW9A 1E5LA 1GWNA 4RVSA 3P8ZA 4PYRA 4ATNA 3O4JA 3Q3CA 1S2MA 3SIXA 3SLGA 5JZVA 4WXRA 4OI1A 5K51A 1U7ZA 3GY0A 3DCIA 4BLRA 1Z47A 1ZL2A 3D3JA 3T7SA 5AKKA 4JT4A 2GARA 2VHUA 1JLLA 5EERA 4KQXA 1B2LA 3L7OA 2ZCUA 2YJ6A 3ROKA 4B2YA 1PT5A 2DQYA 3A6HA 3GJ3A 3OQ1A 1T4DA 2O05A 4EX6A 3CH5A 3FDZA 3DOJA 4TTQA 1I4OA 1VMEA 4TSKA 4I8IA 1YOVB 1E96A 4AJEA 1N5MA 2ZI6A 1Y89A 2X8AA 1KGSA 4JP3A 2DP4E 4LEIA 1JIQA 1U4OA 1W94A 3JTEA 4QA9A 3RD5A 3UXEA 2G1UA 4NE9A 3HLYA 4ER5A 3U9LA 4IXMA 3FYDA 1MG0A 2WSIA 5GTDA 1KVTA 1I6MA 1E3MA 4RD3A 3FYSA 3LIIA 3MJCA 4ZVQA 3U44B 2BKUA 3MCZA 3RASA 1THZA 2GYWA 2QRKA 5DXFA 4LNAA 5KOJB 2HTFA 3WIDA 5LKAA 4D9GA 5K3EA 1HURA 1E64A 4FJ0A 1OLUA 4BL5A 4EZIA 2EKZA 4MVCA 3JYPA 4OHWA 4H77A 1DIOB 1M74A 3BKXA 4XARA 3FYTA 2G7ZA 1RMTA 1ZS9A 4JC0A 2DYKA 2VHJA 4CPDA 2OGUA 2H0QA 1C8BA 5LJLA 1NZFA 2FF5A 3UXHA 1SHJA 4BLWA 4I1OA 2W70A 2RFLA 3TTVA 3O4FA 1JQ5A 4LOAA 1NSTA 1Q57A 2O3UA 2VDWA 3CW8X 2HF7A 5FA6A 1FPMA 4TVSA 4J0DA 4FBLA 3OTHA 1DX4A 5ESWA 3AESB 1DI0A 2ZQYA 2G40A 1HV8A 4C03A 4KHZA 2QTMA 2XWBF 2QQEA 1OBFO 3IDOA 2BGJA 3RVKA 5K6TA 2QMQA 2XTNA 3WLEA 4ACBA 4BBAA 1GTRA 4WNCA 1ZGZA 2X0NA 2YVKA 4HDCA 3P7MA 4N48A 1A2OA 3HRIA 2VP4A 4OYYA 2PJZA 2O48X 3KEMA 3TW0A 2CGEA 4EW2A 3ICCA 3L6CA 2B4RO 3OPMA 1N7GA 1D2RA 1HT2E 3G82C 2P2CA 3AF1A 1B3RA 5H82A 1GGNA 2XYQA 4OHMA 1JSCA 2FX5A 4ZPJA 4PLHA 1Y37A 1IFXA 1OX4A 3KAKA 2P90A 5DHPA 3UT5A 1E7WA 2HV9A 3UWKA 2YY7A 1T0JB 4KH0A 1Z2AA 3FF4A 2GYUA 3BWEA 3JQ9A 2F1HA 3OJOA 4L0CA 4OJMX 1A2QA 1I14A 1ULZA 4MQUA 3KP1A 5EHGA 1FNNA 5EUBA 1GPAA 4GIBA 3ZU3A 3I9V1 5B3AA 4O4JA 1KR2A 5CA1F 5EHIA 5FBZA 3C6QA 4Z3KA 2YV5A 4F91B 1J1UA 5C34B 3GIWA 3QKSB 3U7HB 1L3CA 1DKQA 2IYUA 2ONYA 4NEGA 1VA4A 5EZ6B 1I2CA 5E3HA 1U8ZA 3S7ZA 3IUEA 1HNWB 1O97C 1L6IA 3FH0A 4FYIA 1D7AA 3TPZA 3LYLA 1A98A 3B1FA 2BEVA 3TUJC 1ZM7A 5TMBA 5JVDF 3F5SA 2ZR7A 3CW2A 4MPRA 4M8KA 2PJUA 1O8CA 2XQKA 1DXYA 1S9HA 4H7KA 4JJ7A 3GO4A 3W6UA 4CCAA 2V3VA 4Q6WA 1QK5A 1SHKA 3OOWA 4LY9A 4D8UA 3IJRA 5ARBA 3JYHA 3UHPA 1K2WA 4RPKA 1K6JA 4NYIQ 4OMCA 4F06A 3VZQA 4D4JA 2RHHA 1VI2A 2QPTA 3D8BA 4MVJD 3VVLA 1L8AA 4OF4A 2EL7A 2WWGA 1KYXA 2YMLA 1I6LA 4FR0A 4FYYA 1U0HC 3F74A 3IT3A 4QQ8A 3DS8A 3AFGA 1D0SA 1KHHA 2C5FA 3HGQA 4FONA 5LQMA 1BHJA 1CUBA 2RHLA 5JWHA 1OILA 2XPCA 3CW9A 5EHNA 4HAUA 4DA6A 1PK8A 1AS3A 5EJGA 3A3OA 3E0QA 3SE0A 4ZI7A 3E82A 4Y7DA 2HK6A 5EE5B 3IO3A 4UBJA 5CIWA 5HKBA 4DFDA 2DWOA 1H5QA 1GGVA 4YS6A 2QN1A 1IZZA 2QL5A 3MLBA 3LPNA 3K72B 2BKEA 2GETA 2WSMA 5JI3E 1XMIA 3E70C 3M1LA 4XJVA 3N2KA 2D5AA 3VQTA 2UZ0A 4FC6A 5JJIA 3NWPA 3A06A 1NNEA 3PP8A 2R85A 2JJYA 1N75A 1UJMA 4DV1B 3L82B 5LIPA 2V8OA 1J24A 3B2QA 5LDDC 2J3KA 2HSEA 4FGKA 2JDIA 1M34E 2ST1A 2XRMA 3LUFA 4HVAA 1NLYA 3LPAA 4I1YA 5AVXA 2XSZD 4WGFA 5ALDA 4URVR 5KQLA 1FFEA 1SKAA 4A2PA 5ADVA 3GGCA 4X1IB 5CYFA 4M7WA 4NULA 1KJIA 4DT1B 4NQZA 1XZDA 3EPLA 1UBUS 3IVRA 5LQAA 3MJHA 1IVSA 2PKQO 2Q6IA 1X0XA 5BNIA 3PFKA 1EDOA 3HXPA 5KWIA 5HQJA 1E2UA 5HRUA 3EXAA 3I9KA 1S7GA 4R1NA 1RZ3A 4RA6B 1WZ2A 4RJ2A 4MQ4A 3UK0A 4Q4AB 1W6RA 3RFXA 3GLTA 3VR5H 2ZSFA 3VNSA 2JHGA 3L7LA 5FQOA 1E6UA 1NKTA 2YINC 1JQEA 4J75A 2DKOA 1S8NA 2HCBA 4UEOA 1T0IA 3DUWA 4EEXA 3F3SA 2BUCA 3LSYA 3IVMA 2QX6A 1PVVA 1ICEA 1KSHA 3WBBA 5C1PA 2WIJA 3FFXA 1JSZA 1W9HA 3NBQA 3SSAA 2R1VA 1S3SA 2OAP1 2A33A 2A4MA 3DJFA 2DPHA 3UG6A 3VH3A 3V8RA 4H3VA 1E7SA 1LX6A 2B8JA 2V59A 3PHGA 4GQIA 4HS9A 3RCBA 2QU8A 3UK1A 2GN6A 4CCYB 2Z4RA 5SZIA 1RZUA 1G7SA 3U48A 4GS5A 4H7JA 1G3UA 1N2XA 2HI0A 2QI9C 4M36A 3TQOA 2FW1A 1GEGA 1SXPA 3VHLB 1ZSVA 3AKZA 3KL4A 6REQA 1W76A 2JEYA 2O8NA 2F1OA 4MPTA 4NV1A 3WWOA 4Q3BA 1P9NA 2AC2A 5TEVA 1RE0A 1QZZA 1CUFA 2E3JA 2J7PD 1YL7A 3HZHA 16PKA 1IIBA 4I36A 2Q6KA 4YUVA 5JAQA 1E9VA 4PBRA 3VDXA 5FTLA 1A2KC 1EX6A 2NPOA 2RIRA 3AXSA 4PTYA 5F7ZA 1GU0A 5LU8A 4KTTE 3IE1A 4RMJA 2B4AA 1U0NA 4W9MC 2G76A 1KVRA 2OMKA 4MQ6A 3ER6A 4R9RA 3SLRA 4B71A 1QX4A 3RVQA 1FJGB 5EP3A 1EFDN 2O0KA 1JQDA 4AF6A 1DBPA 1DT5A 2MOKA 1GN9A 4H31A 5JHGB 4UMVA 3VYRB 4RK5A 3ZTWA 2F17A 2ONJA 4U8GA 4BMYA 2PGOA 3AEQB 2X2FA 4EG4A 4F86A 3AERA 1J7KA 3HCOA 2GD0A 4DV6B 4TWJA 2O54A 5EIBD 3CUYA 2W00A 1SUBA 3T9DA 5GOTA 2BEWB 2H59A 4TKUA 2WTUA 2E6KA 2RBGA 2VK1A 5ALZA 2W2XA 5BN4B 5EN4A 4BTVA 3FWKA 4PZLA 3WNDA 4R7GA 5JSZA 4Q7KA 4YDQA 4D80A 3DPSA 2CXTA 2QAJA 3KLBA 3UOAB 2C2OA 4CF4A 3OQJA 5I4KA 2F9LA 3RADC 1UBTS 2FWBA 3I53A 3ZY6A 1NW4A 3TNFA 3PA6A 4U7PB 5C52B 5FAXA 4PN7A 1DJQA 4CMIB 2BC9A 2NAPA 3VJKA 2VP5A 3Q3GE 2HHCA 1X3LA 1FY2A 4PRLA 6AT1A 4MUFA 1BU8A 3CG4A 4EDHA 4EFKA 1ORTA 3UATA 2PZEA 2Q0HA 2Z2ZA 4RV9A 1E6LA 3EXG2 1JEEA 1M2GA 3WWEA 4FT2A 3I32A 1EVLA 5E0KB 3H0EA 3LHDA 1N7JA 3U19A 1YDMA 1PL6A 3R9XA 3WTBA 5IK2D 2P1ZA 4F4FA 4K0KB 4JLJA 1ILWA 5TX7A 3DKRA 3ZQKA 3OECA 2X4LA 4BNDB 1KI8A 1HQDA 1AGYA 1Y9JA 1XLVA 4RK7A 5LR6A 3RRZA 1DMRA 3SEQA 3TVTA 4U7HA 1R0YA 1Q83A 2PUHA 4RENA 1R66A 2V0NA 4HQRA 3JV7A 3RJTA 1N5IA 3KIPA 4J3JA 2ZFUA 4Y0NA 2CFOA 2FOLA 3KOMA 3EXEB 3NTQA 1YTUA 1OY1A 3RVRA 1PBTA 3I4LA 2FPIB 4U5XA 4X97A 4G85A 1SHTX 4U3JA 1CY0A 4L5IA 2CYAA 4WH0A 3ZYCA 1XYYA 1CR4A 1Z36A 4GMHA 3A9VA 2W22A 4DG8A 3PXUA 1GTG1 2DFDA 2YZ2A 3WC4A 2JVIA 1O94D 4G0YA 4J49A 2ZKLA 4MITA 4QAJA 4YP6A 3WK5A 3AEZA 1H0SA 3WA6A 3CQ9A 2FFHA 4LSGA 3TECE 1TM4E 3VZCA 4EWLA 2IQIA 2O2XA 3SN6A 1NW3A 1XG5A 2O0LA 3SIRA 4FDUA 4E2WA 4XA8A 3ECSA 1F8UA 1NRXA 1UDAA 2IEBA 2EHDA 1A71A 4ZOAA 4NESA 1UQUA 1I3CA 1R18A 1LUAA 3R3YA 3TIGA 3KSAC 3R3WA 1YQDA 5ALWA 2DT5A 4EJ6A 5LZ8A 4BJ5A 3D59A 1GYQA 4CEHA 4YCMA 5E7QA 3RYFA 3HM9A 4H7DA 2DU8A 1MGPA 3X1ZA 5JH7F 2WEKA 1AHHA 1II8A 4CRWB 5H59A 4KYUA 2HSZA 3W1WA 3HY3A 3O95A 3W5DA 1GRRA 2OBNA 5F33A 2XEDA 2G07A 3N75A 2R8RA 1ORVA 1HYGA 4GZ6A 1P0MA 4TN1A 4GFDA 4I50A 5A03A 3QVSA 1SD2A 3PJGA 3WL5A 1B74A 4PFSA 4XQGA 1SHZA 2C88A 2ILVA 3V3KA 3L7KA 4UZSA 4IO1A 3OTOB 3S1AB 5ITWA 4KPEC 1E92A 1S2NA 3CPEA 3FCYA 4V0QA 2IY9A 4LOLA 3R6TA 1PD1A 4BCCA 1T36A 2ZYVX 2A86A 1TT5A 4RF2A 4MR9A 4JBWA 1KO5A 3UMFA 2P2YA 3DUFB 4JJZA 2QTCA 4DV7B 5GM1A 5JLJA 1NY6A 3CYFA 1Q2UA 2V7QA 3KTFA 1W46A 1SBHA 1DEOA 3T7AA 3IBSA 1Y3BE 3JY6A 2D2EA 2NADA 3PUYA 1W30A 4BJ6A 4I0WB 4B5KA 1ZVKA 2AHRA 2P3QA 3WRWA 4DBVO 3FBGA 2GN0A 1TJYA 3WRVA 3M6FA 4FYMA 3WGNA 4O25A 1B6RA 2AJBA 2WR8A 4FFPA 4MNTA 3STWA 4LMRA 2IHJA 3WMRA 1E2FA 1C7EA 2GPAA 4M0LA 3RYIB 1VL5A 1E4EA 2WU1A 1IJKA 1PUXA 1JJIA 4JOCA 4JFAA 1ZCJA 4YUZA 3MBKA 1Z6GA 3LQ1A 2GVZC 4M6WB 2FN3A 4BLSA 1OWPA 4C7VA 5J3JA 2BYTA 4IEIA 5IJWA 4O6VA 2ZRQA 2WJGA 3DTVA 2J1LA 3DE4X 4Y98A 3U31A 5FOTA 1XZPA 1SG6A 3DEIA 4HB4A 1TE2A 3FFTA 5C4GB 4BNZA 1OZFA 5DM0A 1Y4DE 3IAEA 4JH0A 4KBGA 1M7HA 2ODBA 5COBA 4Z4GA 2XXAA 2XYVA 3GJZA 4IOMA 2ATCA 4GRDA 4JC4A 3QBTA 1FF9A 2VRWA 1YC5A 1STOA 3QHAA 4ZD6A 2W4QA 4WIAA 5TMEA 4HHEA 4ZCRA 4WDRA 2F8TA 3K0CA 1M8GA 4N5MA 4NBRA 4LDAA 4M7OA 4X95A 3W2TA 3QF4A 4ZICA 4JX8A 1KQ3A 2J9XB 3UMCA 3F1KA 2V5AA 1G3MA 2ZT6A 4IICA 1E5TA 2EX4A 1W85A 2Y2VA 3LKVA 4GT1A 4K0RA 3TSZA 1K7SN 3RT1A 5C0OE 2R8YA 4K3VA 3CY6A 3ZU2A 1M7BA 1DQPA 1A77A 1O9HA 3PKJA 5JASA 4WHMA 4L3WA 3WRXA 4DHWA 4M83A 2OAQ1 4HFNA 4EKNB 4FDLA 3QUBA 4BU0A 3AVXA 1P1HA 1UT5A 1GL3A 1V5EA 2I2DA 1IHUA 2I34A 2O50A 1M7GA 2ANBA 5IAAA 3A26A 3AWDA 3K4HA 4CLRB 1O4VA 1XX6A 2QA5A 3WNBA 3UEOA 2AXPA 1UBMS 4IBOA 3H9JA 4JJGA 2JDID 4YK7A 4FGZA 3ZDRA 2Y1LA 3DZGA 2GX6A 3R3XA 3EGOA 1GGKA 1YOBA 3H8WA 3MWDA 3UFXA 3EJ6A 4MJ7A 1Q17A 2D2XA 5LOVA 1LSSA 1EUDA 4Z7OB 2HU2A 2F4NA 4HLNA 2IGTA 3JQ9C 1DBRA 4UUNA 3TIIA 5CB4F 5H3HA 1L7NA 1DXOA 1FFXB 1UQTA 4MI9A 4C0JA 3N5KA 5EIXA 4AG3A 4L6CA 3SU8A 1UXJA 3GDWA 1BXGB 1SELA 2P9EA 2R96A 2Y0PA 3ANMA 3ZOKA 2IHUA 3OZEA 3L43A 1XDDA 4F5DA 1TQ6A 3AHHA 5KTPA 3KQUA 4TSFA 2NQTA 3NTOA 5CRIA 1W85B 1LBHA 2AVDA 4UC0A 5KNDA 4LC0A 1K68A 2O7QA 2AXEA 5A0FA 3PCXA 5TVKA 3KPUA 3P2OA 4ZQGA 1NIJA 4X54A 3EOAI 1MTOA 1W4BA 1EB8A 1T1IA 1IY8A 3TEMA 4RGVA 4U7JA 4GUDA 3STHA 3ZHZA 2XCRB 1GITA 2VNIA 2VWQA 1UXOA 1NBEA 1XD8A 2J3LA 2VDKB 3AF3A 3MK31 4JIMA 2YZNA 5ERYA 2FP4A 3MOIA 4E11A 2NVOA 3VVCA 2D5IA 3T61A 3AV3A 3NR2A 3JYQA 3EWNA 1CP2A 2PBFA 3HVHA 4ZT7A 3A8TA 3V1KA 2WUWE 3PSAA 1P9RA 5DP1A 4WKOA 4UOEA 4DQVA 3IUJA 2HH9A 1RI3A 2ADOA 1B23P 2ZWPA 4B46A 1MU0A 3ECCA 4JU8A 3TSOA 2WJ4A 5DYNA 3RSGA 4AF8A 3PUHA 1RM0A 1N6RA 1G5RA 5HZMA 4BFZA 1JDUA 2C7RA 3TDMA 2CLMB 4ZO7A 3RAEC 1TDJA 3A10A 3HKBB 4R9SA 2H7VA 1LXCA 2DAPA 4PSKA 2J7PA 4S1TA 1VMDA 4B6EA 1WUJS 2A84A 3M1YA 2GZ3A 4F4HA 3UPUA 4PQGA 3ZW7A 4CV2A 1G19A 3RLFA 5ICMA 1E77A 3N1UA 3SOPA 1IQPA 1SQ6A 2A5LA 3O3MB 2HJGA 1GSHA 3MTJA 4WVFA 4Q4HA 4LQ4A 3AONB 3VPXA 4CKYA 2RHMA 2Q8PA 1MB9A 1HY3A 4G5GA 3BD8A 2AB0A 2CJWB 2ZANA 4LHVA 1ZSYA 4IUDS 4OM8A 4DQXA 1TB4A 4QOGA 1KYZA 4JP5A 2BP7B 1FP6A 3RSLA 5BMVF 1KAGA 4CWAA 3UTDA 4N0PA 3MINB 3ZWCA 2GBFA 1AZLA 3PL5A 4MAMA 3HABA 3JTMA 2AFVA 3S81A 4K2HA 1P4GA 2W5UA 3FUXA 1H6DA 1DAOA 1M5TA 1ADYA 2E21A 4GMKA 4KW7A 1VFNA 4BFUA 5HUHA 3LP5A 4C0XA 1OFIA 1QHYA 2G82A 3E6AA 5BMOA 4NP6A 4MYCA 3LO5A 4D4IA 2DOKA 3GLIA 2OQVA 2NX2A 5IAJA 4JLNA 2NP6A 1E2BA 4ND7A 4C1NA 1UJ5A 1QHXA 3N2GA 2IPOA 2RSLA 2QTVB 4X7PA 1FZTA 3P2MA 1QVZA 2WHPA 4X7MA 4CIBA 1MOSA 1RWWA 2ZSJA 5C46F 2X2OA 1RLMA 2QK4A 1ZU4A 5DCYA 2GSWA 3DL7A 1JLKA 5L3SA 3KYCB 2J33A 3IMKA 3JQ7B 3R24A 4P2BA 1SBZA 3GVCA 4MWCA 1G55A 1XDZA 2QD2A 2YW2A 1GV0A 3MGKA 1WULS 4WBXC 2O8FA 2JIOA 3CWQA 3GQVA 3UA3A 4G65A 2O20A 3DEFA 4B7ZA 4EG5A 3U7EB 2XGGA 1PZXA 5KTKA 5A5EA 1LRKA 1OC4A 3B9RA 4DIBA 4QG3A 1YO6A 2NU7B 1Z4JA 3RDPA 1E18A 5KU7A 1XF9A 3T4XA 5TMDA 3RYCA 1UC5B 3ZD9A 5IM4A 5BWOA 5JBQA 4FWTA 3OZRA 2X0DA 2FMXA 1OGJA 4NVRA 2K2WA 3HPRA 4AC9A 1NSFA 1HWYA 4BNKA 3D6FA 3Q0IA 4KXNA 1YS2X 1ZISA 4M0EA 3I52A 4QLBA 1H93A 2IT1A 1RKBA 3OCJA 2H4XA 4N7MA 5CURA 1B0UA 5B1EA 5YASA 1II0A 2WJHA 3IIKA 4KE8A 4ITRC 3GHHA 1EB9A 1HLFA 1V7QA 5I01A 2H7CA 5A0VA 5HEKA 4FZRA 4BLPA 5ALFA 1IVNA 4TLEA 3RC9A 1PBNA 3WV4A 4B7UA 4Y30A 1ZH8A 3H4VA 1TJPB 1T9HA 2JFNA 4HGQA 1XAJA 2EP7A 4Q7MB 4G5HA 5HBGA 1I0LA 3A1NA 1L4KA 3EXIB 5E6RA 1CUGA 3KHKA 4DCMA 3N07A 4RK6A 4QFMA 1PYDA 2GM5A 1W2GA 3WYFA 2CBXA 4ALMA 4C2BA 3WLTA 3HDYA 1DPFA 3GELA 5FIUA 5IAKA 3UJNA 1CVIA 3A2KA 1XRPA 1O7JA 5LQDA 5AW7A 2C59A 1WF6A 2E4AA 5LQRA 2FLKA 5C9ZA 3OJ0A 3EA0A 1WSAA 3KJFA 1G21B 1V4NA 2SCUA 2AYYA 2E48A 4U2DA 5GONF 2FZGA 2B1RA 3N28A 1NFFA 2I1VB 2JHCA 2R8ZA 3L0CA 4ZALA 3IVAA 2F6RA 2NUPB 5AJZA 5K3CA 5JIBA 1BMQA 3ZY5A 1CHDA 4J0EA 4CLHA 1D2NA 1JR3E 4P22A 3DV2A 4Q3KA 4EKDA 3L49A 4LZJA 5JH7B 2GEUA 1CY7A 2FWRA 2CB0A 2LWIA 2C57A 4G4JA 5G4KA 1LRLA 1IZ9A 4B3CA 4BASA 4P5DA 4J1TC 1XEWY 1YZ3A 2C0PA 2E4WA 3GT7A 3OCZA 1TRKA 2GHIA 1JJBA 3BXHA 5D6NA 2ACWA 1CETA 2OCXA 3NEYA 1XELA 2I62A 4J4BA 4RESA 2EKDA 3BDAA 3KLPX 4JL8A 2VWGA 3RTCA 4H6XA 1JLRA 1MB4A 3HSYA 4PFJA 4GMFA 4D1YA 2DJ5A 4R2XA 4IKOA 1Z4MA 1WCXA 2C3YA 1AKQA 2O1SA 1YWGO 5ED0A 1PQWA 1FK8A 1FRNA 3GXBA 4Z5XA 1OB2A 1I94B 5A3RA 3H9EO 4FGSA 3DZDA 3EPRA 1U6KA 5C53B 4D7AA 1RWBA 3NGXA 4UTRA 1RWQA 5HKAA 1WF3A 3KNZA 4MPPA 1GGMA 2ZTSA 3LX6A 1ISMA 4J76A 3ZUPA 4YV7A 1GYRA 2I6XA 3WK6A 3TZKA 1G5IA 3K0FA 2IEAA 2BFDB 3ZKWB 5CB4B 2A8YA 4R1TA 1T25A 4NU6A 5TB5A 1PV4A 4EA6A 2BDTA 4NMHA 4YNBA 4E3WA 2QT9A 3NVDA 1E98A 3QKSA 1ORDA 2SNIE 4N18A 3L4BC 4P92A 2VKTA 3D4LA 3O31A 5B7GA 2ZXFA 4N6GA 4R54A 2D2IA 4JWKA 1J00A 4RZIA 2G4VA 2V1UA 4EGQA 5E2BA 4RVNA 1VPWA 3TIVA 4Q9NA 2GEJA 1SU8A 1YZHA 5E1BA 1RWPA 3WSVA 1M6WA 3L4BA 3SC6A 4QLAA 3SYKA 1VP9A 4GKJB 2X8LA 5AW9A 2B2XA 2DBYA 1T24A 1MLDA 1W0KD 4JSRA 3QA3E 5E3IA 1ODIA 1YL6A 3PR1A 4HX2A 4O4LB 4W5JA 1VZ3A 1V45E 1MABB 1UJBA 3JRXA 1QR2A 3KWLA 4LZLA 4TYPA 3EPKA 1XEAA 3ESZA 3UQYS 3WFJA 1XP5A 4AMGA 5B55A 1ZY2A 2B1GA 1DKLA 3MOGA 4WD3A 3D8SA 5HRCA 1J39A 2VAWA 2HWXA 3QEMA 3V4ZA 2PO7A 2CL6X 1YBFA 1MIOA 4MKZA 4AMZA 4EPWA 2DTEA 3T3MB 3ENWA 4J0IA 1I2AA 2QX7A 1P2SA 1YQEA 3IEVA 5JXJA 2P4QA 2VQFB 1EAYA 4P81A 5A6SB 3FHTA 4X1KA 3DFUA 4N47A 5BNZA 1AURA 3NTVA 4TWIA 3SQWA 4H59A 1H85A 1Z83A 2ZXEA 2WTXA 1E59A 2G25A 3M9XA 2FLVA 1RI1A 3JQAD 3KB6A 4YRJA 1J5PA 4E32A 5C51B 2FETA 3EVAA 4IDBA 3IRVA 4ZWNA 4EY5A 5H16A 5C31A 1FSPA 2HAEA 3OHPA 2I3BA 1G3QA 1PJCA 2BMFA 2TS1A 3BWVA 2E87A 2G0NA 3E7FA 5ICCA 4OGKA 3Q6NA 1UBHS 1GLGA 4XUCA 1M6YA 3PXCX 1CS0A 1A1SA 1MRSA 2P78A 3KQVA 2VI5A 3KV1A 3JYOA 4PNHA 3V9PA 3E9NA 1CJMA 1XK7A 2A2ZA 1SVLA 1SCIA 3EVCA 3V8PA 5A62A 2FFBA 1W6UA 1CU1A 1CEXA 2DWPA 1JG3A 2JGJA 3CO0S 3K0KA 4V0SA 2DULA 2XBLA 4WNIA 1EA5A 2XYRA 4V39A 1OTYA 1XB2A 4Y2RA 1ZH6A 1LDMA 1DAKA 1EK0A 5CH8A 1JAXA 3P27A 1XTSA 2HWUA 1M1YB 5KNCH 4OKIA 3T7TA 5TT1A 5IMBA 4DZZA 5K01A 2VKQA 3I04A 4KTVE 1ZL0A 1KTVA 2B78A 2PLNA 3DLAA 2HLNA 4LY6A 4E22A 4D96A 3X2FA 3H65A 2OYRA 4Z54A 3LKBA 5KHAA 1NX6A 3RS4A 5LXTF 3DMYA 4BNTA 3NC1C 4YP0A 2BGLA 4NENA 1ZLYA 3UAOA 1OFVA 1M2FA 1SUDA 2CHEA 4IIUA 4PR0A 4BQSA 3HRHA 3FUCA 3OMXA 1R0BA 4GOLD 4OQMA 1PYOA 2FN9A 2P1DA 2HY7A 4JLSA 1WX1A 1UM9B 2QLNA 3WX0A 2FDCA 2OO3A 1Y8CA 3B1WA 1U3FA 4LXXA 3SM3A 2QRHA 4DANA 2QVYX 1A96A 3K1YA 1CXZA 2XVZA 4I6EA 1DKOA 2O3QA 4MW1A 1IEVA 2BFBA 4RD1A 2GAIA 5J2TB 3SXPA 3TUZC 1Z4PX 4O4JB 3RRNA 3CR8A 4R16A 1QC5B 2CCJA 4Q7EA 4B6RA 5JH7A 2GK4A 1QF9A 3N2EA 3Q87B 3G68A 3GRFA 2AKAB 2P9FA 1R6XA 4JA2A 3U0VA 3ZBQA 3TFOA 1LKZA 2NTEA 4JD5A 5IVHA 4P08A 2ABWA 3OY7A 4BFVA 1T2AA 3MMZA 1G291 1EKXA 3DDUA 2VUHB 4GBED 4N0QA 4RNCA 1BOFA 2VAXA 4IIHA 2BFAA 5DP2A 3SHVA 4E7OA 2RGNC 5JSYA 3KEFA 2XQJA 2ZBDA 1TTPB 2WUVA 2AOUB 1K6XA 3DBIA 4O02B 5KYWA 1K8XB 2XR1A 4GSKA 5FBRB 2KMLA 1AXEA 1E7MA 1KNQA 1YT5A 2BJWA 1FMJA 1FS4A 3OLZA 4E6PA 2TYSB 4PWZA 1M0WA 3HYTA 3ETLA 4NSNA 4INOA 4JI3B 4KSCA 3OWOA 2BR4A 4MJLA 3JARB 5DMXA 2XF8A 3G5LA 1V8DA 4IX9A 5H0IA 5LMUB 1SCAA 1O9BA 4GP9A 4LX0A 1CNMA 1QAMA 4OLBA 1WDKA 2B4KA 2HUNA 3ULKA 4QX6A 2A9FA 3WLOA 2YJ5A 3MTEA 3E1SA 3KO8A 4I8XA 4TLBA 1G2QA 5IABA 1ZK2A 4LCEA 5E6UB 4WT7A 2CLCX 2ECKA 4HVCA 2J6HA 2ZBUA 2J3QA 2FJ0A 1ODSA 1CWUA 1X80A 1JB9A 4MVXA 1F9EA 3TINA 5EHXA 4BMCA 1CZUA 5C18A 1J8QA 1O5OA 1CY4A 1I0IA 3HWSA 4M1ZA 4P82A 1UZAA 4W8GA 3PE6A 3S2GA 1QAOA 4DYHA 5I8PA 2ZT5A 1KI2A 1SWWA 2AYZA 3B20A 2GEKA 3HNPA 4G0PA 5IDXA 3AHCA 3QKRA 4NBUA 2WTAA 3GYGA 1KE1A 2DMRA 4G07A 1L2TA 1D4OA 4KEAA 2PX0A 2R7LA 3ZLBA 2KYRA 4G5QA 4HAXA 3B5IA 3MB8A 2GZDA 3JXEA 1BA3A 4ACAA 4EB8A 1I5EA 1ZJ4A 5HW0A 3CINA 3FUUA 4UTVA 4O4HF 1M6EX 4OP3A 4HVLA 1UOQA 2Z6UA 1ZN2A 4Q24A 4DCOA 1Q95A 3PQ4A 2PUGA 3EEBA 4BKRA 3NYIA 4MRAA 3H6GA 3QEKA 2GZAA 3EX7C 3IUYA 4LNUB 4AB1A 4YFYA 1PQPA 3FG9A 2ZJ0A 1GKLA 3FUVA 3PLRA 3QEMB 4J7AA 3HJBA 1FYVA 4GKAA 4CUJA 4F3KA 3IIJA 4YECA 2GXQA 4AVYA 3I83A 4CVNA 9LDTA 5HQTA 2IV2X 1RPZA 1Z68A 5KQGA 1IUKA 2WQ7A 1HQYE 2KBFA 3OPNA 3VBCA 2FZLA 5AXDA 1E4EB 3WL6A 6ADHA 2D5LA 3WBJA 2YS6A 1W48A 2Y67A 3EGIA 3HUDA 2C97A 2A0UA 3TEJA 4D3DA 1VHDA 5DM1A 1BXRA 4M22A 5KVCA 2J59A 3IPYA 5IKPA 4XAQA 1N32B 2DUJA 5A2QA 4G0VA 3FNQA 5F3DA 3ZV6A 4KFCA 1N4AA 2QTHA 3I8XA 2Q1UA 1QVAA 2VP2A 3DA8A 3PPXA 1Y7IA 2PKEA 2CJYA 2XODA 2HLDA 3BICA 3GDFA 3GFVA 4LOKA 4LS3A 4UBMA 4DUGA 1FBNA 1LPAB 3WGVA 4YT2A 4JC8A 3LVFO 1ATZA 4N01A 4YCCA 2H08A 4LDPA 2JIMA 3E2IA 2M9MA 2HHJA 3GBVA 4FPXA 3I9MA 1GZSA 1NJ6A 2VS1A 1I13A 3I4CA 2REOA 3VR3A 3TEFA 5LYYA 3NM4A 3R5XA 2R8XA 5C8ZA 4U1RA 1QJCA 3DMTC 3HVJA 3IKLA 3PTZA 3R6DA 4KQ2A 5JLAA 4AULA 4DJ5X 3ZD8A 4ESEA 1LI5A 2IDJA 2YR0A 4IRXA 1CB0A 3JQFC 1CY6A 1TVEA 4TLMB 3STXA 2OK7A 4A8JB 4FILA 4DIEA 1OI4A 2M1XA 4PQFA 5KU1A 1NI3A 3BBLA 3JQ7A 1SA0A 2QGFA 1ZJYA 4XJSA 2FQYA 4U6SA 1KZGB 2WWFA 3GMDA 5IARA 2GCOA 4B09A 3V2UA 3ABZA 3KR2A 1Z15A 2NO5A 2VOEA 2QUZA 1ZKDA 5B4TA 3TRKA 1C0EA 2B2CA 4US1R 3SC3A 1RRMA 2I6QA 3VOAA 4TROA 3PQ3A 4AJ4A 3S1LA 2P5UA 4JB0A 2Q99A 3A6FA 1Z2DA 2A1TR 4HJXA 5DYYA 2FN4A 2QDXA 5CFPA 1IBKB 2C2WA 2CMGA 3HHEA 1MC1A 1L5SA 2BONA 4X63A 4C0WA 4BVAA 2YNMC 1J5EB 3ZX4A 2P0AA 3G1WA 3KXIA 3J7AC 1NDUA 4HH3C 1WAMA 4DM3A 2H1SA 1D2CA 2WQ6A 1XO1A 4J4HA 1QYCA 2P4UA 3BHNA 1XRRA 1X38A 3ETGA 3PPVA 4G5FA 4QUBA 4GW3A 3UCXA 1VBNA 2HF8A 3C85A 4JN6B 4TUYA 1WVMA 4U2KA 1WBDA 4V1CB 3LVQE 4A27A 3KVYA 1BX0A 3D5QA 2AT1A 5DW0A 4XDGA 2QGZA 3ZGVA 4J0CA 5EXSA 3L7JA 3IBGA 3KT6A 3AFOA 2ZZKA 3H4TA 2EC5A 3PGXA 4JT8A 4Y2YA 2AR9A 4CTNA 3KWMA 1JZTA 1T1JA 3NANA 1KI1A 2HJHA 3REOA 4GPD1 4QYWA 5SYNA 3QPCA 2P65A 1YB4A 2EJWA 5SICE 4OKNA 3X2SA 3D8TA 1N34B 1ATIA 4G8JA 1LFAA 1HZZC 1RWXA 3D1LA 1UPCA 4PLGA 3UWPA 3KXKA 4M0UA 1SU7A 2YVAA 3FPJA 4MUBA 1E0KA 1Y4AE 1YCDA 1R5NA 1P0QA 4EYEA 5I7HA 1OVMA 4GX0A 4ZGWA 1GZ3A 4NMWA 4C6TB 3WJ1A 1Z7EA 4WOBA 3DYVA 3V4FA 2LDXA 1E4OA 3KWFA 2ET6A 4WX2B 3VR2A 4KO2S 1IRXA 1KBQA 2AFIE 4ROSA 3SPXA 1XZQA 2OHVA 3JQGB 4Q3AA 5G3ZA 3EDMA 1QFXA 3OX1A 1VIMA 3A3NA 4L8WB 4M8IA 1XU4A 4S1NA 1Z4QA 4TRJA 2YN2A 2I3DA 3B3AA 3AF0A 4TX1A 3VR6A 4JUIA 3U81A 1WB9A 1E3QA 1PIWA 4Z8XA 4A8JC 3TFWA 3R5TA 2P6UA 4DRZA 3BN3A 1B76A 4OHVA 4J1TA 2JAOA 3FETA 3COPA 1BKDR 2AW5A 4C01A 3PL1A 4QJ4A 1JKJB 2JFWA 2V7XA 1ZRSA 2WYVA 2C4WA 3VAAA 3L5KA 1KRHA 3HY6A 3LWZA 2I33A 2Q46A 2YFKA 3KD2A 2XIQA 4QOSA 2CB9A 5ALYA 2XADA 4D8YA 2VT6A 4Z53A 2LUOA 1V41E 1JTEA 3C7DB 2XHEA 4P38A 4AI6A 1HE4A 1QHFA 2WV9A 2Y2UA 3VKUA 2WG1A 4O2RA 2WFAA 3Q85A 1HSZA 1ORHA 1QP8A 4RVOA 2JI4A 3PYXA 3TRDA 1RW4A 3TBFA 5I45A 1P6QA 1QZUA 2M1ZA 4MS4A 5G0UA 4N40A 5IT4A 3CZAA 2PCJA 4ZAYA 1YA8A 4JT9A 4HQ6A 3AF5A 1NY5A 3CVUA 2C00A 2RHJA 3SZRA 3NZEA 4QT4A 2IYVA 4BKQA 1OH8A 4QARA 1T10A 2GZ2A 1OXMA 5EE3A 1O57A 2FR1A 2P4EA 2VRNA 2WDPA 3HUTA 4AQDA 3T3NA 5JTTA 3JWEA 3BRSA 3ZXUB 4WA7A 3C7TA 3BG5A 3WK7A 1JI3A 5F21A 5KOJA 3N74A 3E1KA 4KSYA 4NZMA 2BTEA 1XL1A 4LI0A 5AJWA 1PE0A 2BGMA 2NU7A 2WE8A 5BW4A 2YWJA 5E9QA 3BK1A 2YHSA 5ADWA 3AM1A 4O4LA 1ILEA 1CZNA 2X5XA 4PAWA 4QHTA 4ZANA 1Z6AA 4QU5A 4EP1A 3TI7A 2R2AA 4IW3B 4ARCA 1GSIA 2DCUA 5FKJA 3M83A 3OM1A 2C96A 1YR8A 2H54A 4ZMSA 4F8YA 2FMHA 1E2DA 1FQKA 1A9YA 1QFZA 4LOHA 4QYSA 2GPNA 3OT5A 3PK0A 4K1LA 3VDMA 1KRWA 4EO4A 4C4AA 1HX7A 2Q27A 5F73A 3GJTA 3Q12A 1JXAA 1ZVVA 2I4MA 4LSZA 3ZZ0A 4BTLA 4UBNA 1EM8A 2PMCA 3GCDA 3JASB 2Q28A 4K8RB 4U7WA 4FOOA 2HMTA 1XZIA 3S8EA 3WZMA 3OC6A 2JFHA 5KJEA 3THSA 1THGA 3QLVA 4AL4A 5JNRA 3X44A 4PG5A 2J5RA 7MHTA 3BE5A 3ELUA 4HGYA 3WGTA 5LLDA 4UUMA 1RRFA 1V1MB 3OIYA 1OE0A 2YRFA 5AIAA 1QCZA 3FJ1A 3O4VA 1C7FA 1EFLA 3H2BA 4RF5A 1Y1LA 1CF4A 2RIPA 2ZYGA 5EMLA 1KIAA 3EEFA 1GKKA 3CIFA 3O2SB 2Q6OA 4OQ4A 5LMZA 1DWOA 2WABA 3AK4A 4HAIA 1GVNB 3TK1A 3VKVA 3DPIA 4JXJA 2FSSA 4HYEA 1CDDA 1Q21A 3OA2A 5I48A 5CFMA 4LISA 1T5OA 3FBTA 1EDZA 1LCIA 1YCGA 5EKSA 1TCVA 1YQQA 2FZVA 3VA7A 2QRLA 4G81A 1JDBC 3CX7A 4ZCMA 1QG4A 1M34A 5CXSA 1M10A 2VHVA 5I8WA 3DKPA 1DKUA 1T1GA 3Q3VA 2BRUC 3HUFA 4JYCA 5AW0A 1BS2A 2HCRA 2E7ZA 3ST7A 4IMRA 3P2JA 4AG6A 3QKTA 4QXOA 5EEGA 1NUTA 3DR3A 1ESMA 4EKYA 2Q3EA 4GWLA 4RIHA 3VHRA 5A6VA 3IALA 2Q4RA 4DB2A 1UWLA 1V8OA 3NEJA 4TV8F 4BNYA 2CUZA 5AW4A 4JHXA 1DO0A 1FEZA 2IZ0A 2FDXA 4IRMA 3H9CA 4N6NA 5AKZA 5JD3A 4AAYA 2H52A 1Z5PA 2HOQA 2H57A 2VPWA 5FWAA 4JR1A 1Z5ZA 3BREA 4E1VA 5BVGA 2AKEA 4BWGA 1VFPA 4G63A 1C7IA 3RTEA 3FBWA 3C6XA 4Q3NA 3O94A 2DHDA 5E4TA 4R81A 4FR5A 3OCCA 1JDNA 1UK8A 3NIDB 3O74A 3K2EA 4OAOA 1EUDB 3O91A 1V4BA 1H9BA 1YR9A 4WNAA 2DPXA 2W2TA 5IUJC 5K6AA 1V1RA 2PVSA 5A02A 3BWYA 2PSEA 1EHYA 2NGRA 4PZPA 1QRDA 4TL6A 3SF8B 1L5MA 3AM3A 5EXDA 4CKEB 4LSMA 4CTJA 1L8OA 3CT6A 2C0QA 1BWQA 2BBWA 2JI7A 3T9EA 1J2EA 5KI6A 3USCS 1EXVA 1F2UA 2DWUA 2Z83A 3L4KA 1RKVA 4IIDA 3LUHA 3V7NA 2PRIA 2CNNA 2G36A 3N7TA 1OWMA 3K4PA 4MQMA 3V55A 4MLZA 3W6PA 3MCAA 4HGZA 1EE1A 3NJ8A 4F3RA 1NZJA 2GEFA 4YXWA 1KI6B 4XX1A 3WY9A 4EFLA 2COEA 3SVZA 4HVTA 2LD4A 2B92A 3HA3A 3ZXXA 2Q29A 5KCZA 3BH0A 4YI3A 3VKFA 5IWAB 3DBRB 1F3OA 3QV2A 1DG1G 2I54A 4GPAA 4DSZA 4M88A 3HCFA 4Y18A 2RI0A 3EDOA 4MGZR 3SC2B 1B1AA 1IHDA 5AICA 1YRAA 1NW8A 2IP2A 3L8MA 4G2NA 3RB8A 1EXWA 2H1CA 2ZZNA 1WCV1 5EUCA 2VHXA 3DKIA 3RIYA 2UZ4A 1DFHA 5L6MB 2FPRA 3L8DA 5ENZA 3VPGA 4FHFA 3VR3D 4CHTA 1OWLA 5JFOA 1QQAA 3TLKA 3HV0A 4D26A 1Z0KA 5EIHA 3SY8A 2X8BA 3V97A 3RG8A 2GD2A 2XQGA 3ZJTA 3UY4A 1NQAO 3MTAA 4LN1A 1N2HA 5EJ8A 2JGFA 2ONZA 2YJTD 4J7CA 2GPBA 5FP0A 5K0ZA 2IF2A 3NC0C 2J4CA 1GL7A 1SVIA 2X2PA 4BJ1A 3C1UA 4EGJA 1MEOA 1VIAA 2CVHA 221PA 3A9CA 4OXKA 5EVJA 4YWJA 4D9CA 1TM1E 4HV4A 5FTNA 5HJ5A 3R20A 4CU5A 3DE1X 3OZFA 3V7WA 4AROA 4HFJA 1ZH4A 4MWDA 2BKAA 1PR5A 5C3MA 3IILA 1J2UA 4HP8A 5AI9A 3T4PA 1M2VB 2VBFA 3AEXA 4Q21A 1ACMA 2F3QA 2O2GA 3TTSA 1AQJA 3MQFA 5EZYB 4MVJI 3UNXA 1VKZA 2HBQA 5TV2A 3GP3A 3PEEA 1F48A 3PYLA 5KWJA 2QYHA 4HQOA 4LTMA 5JS8A 1JDPA 1MC8A 3PQ2A 4MRVA 2GBGA 1QV6A 1VYHA 3OQ6A 3WDKA 2H7XA 3G9UA 1JG6A 3A7EA 3SYRA 4GI2A 2EFJA 2FPUA 3DMFA 2C8JA 3KZOA 1T0HB 1NVAA 1S3GA 1S7CA 4PYIA 2FA9A 4A6XA 1JFLA 4RJLA 3SS9X 5BNFA 3PVCA 3QV1A 4BQEA 2IUFA 2I29A 3RSOA 3DKVA 4TTRA 4PWYA 2PQMA 2DRIA 3CZCA 4NU0A 5I4IA 2QMEA 2W37A 5DIZA 1VG1A 1XJWA 4UFNA 4WPGA 4GZ5A 4Z9BA 4BP3A 4UM5A 1G98A 3KAQA 4YMUA 1JG2A 5DWDA 1VRCA 5FOXA 3V33A 3JRNA 2JFPA 3PDCA 4GNKA 1W59A 4C1BA 2ZXUA 3GUHA 3QPBA 2QN9A 5AIBA 5AKLA 5LN1A 1W1WA 4PX3A 2D7DA 4JLOA 1O9GA 1TFUA 4TZKA 1MO2A 4RHTA 2II6A 1FP1D 4JQCA 4DV2B 1TA4A 3ONFA 1DB3A 1V8FA 1VHLA 2HWYA 2W2LD 4ARSA 2VPPA 1XPRA 4H7FA 4PC6A 1I4EB 2RGGA 3K5HA 1YB2A 3I37X 3NHLA 5HOEA 2DFVA 3GLHE 1YD7A 4G4IA 4RSHA 4TT8A 5H81A 3THRA 1JE0A 5CW2A 3TW4A 4CMKA 5DM4A 4D79A 4F0JA 4DPLA 1XLWA 1H9CA 1GAJA 1VL1A 2CBGA 4PLTA 2HDOA 1KH3A 3IXMA 5T64A 2FR8C 4F45A 1BCSA 2Y71A 5ELMA 2PRKA 4CGYA 1XTVA 5KC9A 4G0WA 3B1XA 4BKOA 2ATEA 2DCMA 4YAWA 4NOKA 5AHKA 4ZOEA 3UJ6A 1SZDA 1MX3A 2POCA 5LBUA 5CT5A 2CMFA 1UFQA 1A7AA 3BGOS 1BD4A 2ERXA 2KW5A 4QGGA 2AKYA 3U9TA 4B4DA 2Z3ZA 4F6RA 6GPBA 4HATA 4ZQFA 3CE6A 1WDWB 1V47A 1C9NA 2ZREA 4GEGA 1KC3A 4YJ2B 3CUVA 1U9ZA 3MMNA 4IHKA 5GAJA 1QIMA 3PHIA 3EFHA 3LZDA 4ZHQA 1XSEA 1UMDB 4K05A 1ZOSA 3FTNA 1DCMA 2QSYA 1ULUA 3IPAA 4WMLA 5CU7A 4AJLA 3EVFA 3D81A 1XR3A 4XWTA 2FFJA 4YH1A 5JJCA 3HH8A 2OHFA 2HK8A 4QT0A 4F46A 2IHVA 4HUJA 2HXYA 4HYYA 4L8LA 4QJ5A 1U2GA 4N6OA 1XAHA 1XVVA 1XZNA 3FE2A 4J16C 4YUAA 1G5PA 4Z4IA 3AI3A 1APBA 4ZEOA 1J2JA 1A88A 1N1DA 1F2UB 1NW5A 1B2RA 2DTXA 1SMKA 2O2SA 3HN6A 1VL0A 3B70A 4AECA 3LX8A 1FL9A 1QO9A 1XWIA 2JZNA 4MEAA 4KYIB 3V4OA 4JNKA 3VKHA 4G09A 1YZTA 1Z3CA 4I2VA 5AI8A 1NN0A 2FEMA 3FTQA 2ZJ1A 3QLUA 1T6YA 4CLRA 3CWZA 3H5LA 2RH4A 4PG7A 1R8XA 2QMOA 4LJAA 4RV5A 4V02A 5CNJA 2G5CA 2V6FA 3H5VA 1YBHA 1EP2B 3KR1A 4F92B 3N0WA 4F2GA 2QE6A 1AK9A 3ZGOA 3BPSA 3E9ZA 3ZY4A 2PNJA 5C81A 3IS3A 3PNSA 1FYEA 2A1UB 2D5BA 4DMKA 4TL8A 3BEOA 3U1VA 2AG1A 3DMTA 4WA8A 3CT4A 4O3FA 2BM1A 3FTPA 1R6BX 3A3KA 5HQ3A 4NXNB 2OAGA 2ZITA 3Q3JB 3CZQA 3WSTA 1AXRA 3VKWA 3LTNC 3QSYA 2B8TA 1XV5A 3TUIC 1YA6A 5ELXA 2OGWA 1WXWA 2PL3A 4YPFA 2AWOA 2OCGA 2QQGA 4O0MA 3TDKA 5FRDA 2O8DB 4NMLA 4PONA 2WUEA 4OGLA 5F5XA 3RE1A 1B8PA 2ERYA 2UXCB 1TC2A 3HJHA 1KEKA 3QG1A 5EIWA 4H60A 1SUAA 1ZITA 1OGIA 3QNWA 5ALTA 2ZRMA 4IFBA 1WQ4A 4PRYA 1Z29A 2HCJB 3NDBB 2Q6TA 821PA 1VE1A 5FR1A 5HS4A 1ZRHA 1LWOA 1LLUA 2ECQA 2ZWOA 5LBTA 2FW7A 5A71A 2AGVA 1Q5PA 2E37A 2HEIA 4FHZA 1OI3A 5J2TF 5KDLA 4JVMA 1FDVA 2OCLA 2PL5A 1WQ3A 1O03A 4I2NA 1K86A 4MGHA 4L4YA 1E9BA 2Q5QA 3HRKA 4NYJR 3ZY2A 2BELA 1W36C 4JJFA 3L5OA 3I4FA 4KK4A 3RUCA 1W5FA 5BW5A 5K05A 1KMCA 1OT5A 3FPCA 2X0FA 4E94A 2J32A 3CNNA 3K71B 4QTZA 4OHBA 1GHTA 2DPLA 4DLTA 1Q7BA 3OZXA 3QJ5A 4IHJA 3USZA 3RO7A 3RS9A 5DCLA 1W49A 1ZM4A 3H0KA 3M6XA 2GJ8A 1RYMA 2AA3A 2YV4A 5HIMA 3TKYA 5IJ0B 1H6BA 2XUPA 4KXVA 4C87A 1RI5A 4B33A 4ER6A 4I9UA 5M34A 5C7YA 2CLEB 3BFKA 1B41A 1EXMA 3UJ8A 1ZIDA 4CETA 5JTUA 1YB1A 4GYJA 4KDEA 4HWPA 3EE6A 4MCJA 1QO0D 4PYOA 2J3EA 2AK2A 2PUDA 2AN5A 3PUZA 3AHEA 2FHPA 4AZ0B 4URZR 2Z8ZA 5IT0A 4BV8A 2C9BA 4EJMA 3WMWA 4HBZA 2WMDA 2W90A 4DJEC 4KREA 1PZGA 4KR3A 4AURA 1WMDA 4U02A 3WNCA 2AV6A 2JI8A 1LPNA 4UD6A 1JV2B 3I6BA 1EBFA 4Y2TA 4B79A 3HB5X 3GLIE 3EK2A 1VPVA 1GNQA 5ICEA 4Q37A 1M2JA 5JEDA 1KSJA 1GPUA 3TLAA 1K6EA 3T3GA 4HXYA 2YY5A 2BJHA 3QEJA 4NJEB 1JHOA 4JXZA 2OCYC 3OLCX 3Q0EA 1MRZA 1SURA 1U0JA 1E3SA 2R3SA 3AETB 4ZVPA 4X62B 3KJHA 3X1XA 4CMEC 2FW6A 3SJUA 5D1HA 3GEGA 1WKCA 4X41A 4BMVA 4TL7A 3ZWWA 4RGYA 2HLHA 3QYPA 1XNGA 4FMCB 2FF7A 2RARA 1QH8A 1M2WA 2QTWB 2MSNA 2HZ7A 3BD9A 2LCQA 4OFWA 3SLKA 1ENYA 4KGVA 4ALNA 3AYZB 3HKEA 4EJ0A 4UVDA 3SZMA 5HKKA 2EL9<