1RL1A

Solution structure of human sgt1 cs domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
SKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor of G2 allele of SKP1 homolog
publication title Human Sgt1 Binds HSP90 through the CHORD-Sgt1 Domain and Not the Tetratricopeptide Repeat Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein degradation
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1rl1A00
3QORD 1WH0A 2WJ7A 2Y1ZA 3Q9PA 3VQLA 4YLBA 4YE0A 3VQMA 5LUMA 2MNWA 3Q9QA 3W1ZA 3L1EA 3EUDA 3IGFA 2KMWA 3AABA 1WGVA 1WFIA 4JUSA 2CR0A 2K8QA 4YDZA 2N3JA 4ELDA 3GUFA 2N0KA 2O30A 1SHSA 4JUTA 3AACA 4PBDA 2CG9X 5DS2A 2XCMC 3QORA 3N3EA 3J07A 2JKIS 2Y1YA 4I88A 2Y22A 2RH0A 3QORC 4PCKA 1EJFA 1RL1A 4M5SA 5DS1A 2KLRA 3QORB 3GLAA 4M5TA 1X5MA 2BOLA 3L1GA 4FEIA 4YL9A 4MJHA 3GT6A 4RZKA 3L1FA 4ZJ9A 2WJ5A 4YLCA 1GMEA
chains in the Genus database with same CATH superfamily
3QC5X 5I1HH 4Z8FL 4YSQA 1BIHA 1NCOA 1BX2B 4QHNA 1B4LA 2F68X 1ECZA 2O1AA 2IANA 4Q9BA 1IC5H 4N8PA 1NM4A 3AS3A 3L3OC 4U1JB 4ONHA 4X98B 5HGGS 2PWDA 3SE9L 2LGNA 2ZSVA 2LHAA 1AIZA 4IJ3B 2Y0SA 1ETJA 2LOEA 4JGNA 2OKMA 4GO9A 3THML 1R24B 5ID0B 5DDHA 4J3VA 4PTTA 4UTBH 4WGWB 4OQTL 2BRQA 3P02A 1I1FA 2PYED 3MCYA 3QARA 3RVXC 3E7JA 3PUUA 2YSSB 1D5XB 1AQKL 3UIZA 3VFVB 2AF2A 3JTTA 1I7RA 4CILA 4EF3A 1S46A 2X4TB 4D8PB 1L9SA 4YX2L 2OTWA 4ZOBA 4UTCA 3VGAC 1IJNA 1MI5D 4K9JA 4NQEB 5AVWB 3V52H 4TOYH 4PU2A 4IU2A 5LWYH 2H3XC 3DX9B 2WBJA 4QHLA 4AKPA 2P5WD 4XHJC 4P46C 4DGIH 1HCFX 5ICXA 4JZJB 4MMXC 2WINB 3RJDA 3KYNB 2VLKE 1HZKA 4PGDB 5TDNA 2ZPKL 2ZKHL 1IAOA 4MYWB 3BW9B 4EN2A 3HC3L 4MMXB 1GIGH 4JPQA 5BMFL 8FABB 1V7ML 5D2NA 3EOBB 2V8MA 1WP6A 2EYTB 3T4AC 3F7PC 4C83B 2L04A 4PLJD 4JM4L 4NZFA 4YDLC 2EE0A 2NNAA 3X12B 1TITA 4ZFZB 1CU4L 3MBEA 3X13B 4PV1C 2N3JA 2BNQE 1CGSH 1HCVA 2UWEA 3OXRB 4YDLB 2PTTA 1NCAH 3VW3L 4YHPB 2ZZUT 5EO9B 5B22A 3NBNA 2A6JB 1MKFA 5C6TH 2CA4A 1UXWB 4HW6A 4UINL 4X0KB 4BK5A 5A3IC 1KBGL 4LDCA 5DHDA 4Y2OA 2OL3B 4XNZB 1YJDC 4KMTL 4ZXBC 3LEXB 4Q4IA 4ZJ9A 4NX0A 4ZXBB 1ADQL 3V6OA 5T5FH 2X42A 4Q9CA 3U4AA 1ADQA 2OR7A 5GS0L 3IFLH 1FIGH 1T1WA 4GBXB 1A4JA 4G6FB 3IDXH 2BJMH 4XN5A 4B9FA 3T3MF 4XP5H 5C0FB 5EU6E 2J6EL 3SZ6A 3C5ZD 3WS3B 2J6EA 3HBZA 4XT1C 4WCYH 4YBLC 1TKWA 5DK3A 1NMBH 5CKGA 4PJAE 3IVKA 3GNMH 2KH2B 1E8XA 1FNGB 4XZUB 3NFNB 2FO4B 1GW0A 1T1XB 2NZ9C 5ANHA 1WA2X 5FF6B 1ODAA 1OKEA 2NY5H 3BPOC 3G6JA 4RSYA 5KJRH 5EEWA 2IQ9H 2DKSA 2FSEB 2YRPA 1P6AB 3CFEB 3JVGA 1IFHL 1JFHA 1GOGA 2DYPB 3FH8A 4N0FA 4YZFF 2YN5A 3IJ8A 2AMUA 3SPVB 5KW9L 4I0PB 1M2OA 4R9HA 1IGJB 1WT5C 1TTRA 3Q5TA 3V4PB 3I9GL 4PJ9C 5DS2A 4GIPD 4AEIH 1XAKA 4Z3FA 3SJVD 2IGLA 1M6OB 1NBZA 1R6VA 2DQTL 3KPRD 4WU7A 3Q8EA 1PZBA 4OD2B 1JZDC 2LLLA 1A7OH 1GJUA 5KVEE 1KG0A 1LJMA 4Q2ZB 1K8IA 4ZMLA 3FPYA 2V9UA 5IHHA 1RZPA 2LABA 1CWVA 3WY1A 2GEQA 1MCBA 1S7TA 3IGAB 4NZTH 5DJZB 4O9HL 5HHPB 3U1QA 1PX3A 2BNRB 5E8EA 2XPGA 1QZ1A 1R3IL 1AHKA 3F62A 3ZO0A 4KGJA 2RFXA 2ZWNA 1UT2A 3I50H 5E8OB 5FOBA 1KENL 1YYLL 1U92B 1TJIH 4XNAA 3KM2A 4GUOA 5J6HB 3F12B 3IDIB 1F0LA 2QGCA 4WTZG 4AVJA 4XI5C 2D7PA 2EILB 4P99A 3P30L 4B3VA 4M62L 2XG4B 3LKRB 4ANKA 1PDKA 4FYQA 3FHAA 3MRJA 2BVTA 1T6WA 3JYBA 5IT2L 3KPPA 2JCCF 5E5UB 2A77L 4Y88A 3D6GA 3WI9A 2EYRB 2FVNA 2YEVB 1H9VA 4W6YB 1U8IB 1FN4A 5AKSA 1XFPA 4BRJA 2JSFA 4H0HB 1KIUB 4M8VA 1DLFL 4NQVB 2WVVB 3QQDA 1PGRB 5D1XD 1B0GB 1U8JB 4H26B 5DFVD 3BFQG 4N6RB 2VR5A 3D3VA 3MRHA 2KZBA 1G9NL 5FDYA 4ZFOL 2KLSA 5MHSD 1A6AA 3MQIA 3ARVA 4XO4A 5TE4H 2F0CA 1YNTA 4AVIA 1JHTA 1RKRA 4FNSA 5J13B 1OT2A 4AIEA 2Y7SA 3RGVB 5CLYA 4XHQA 2A0LD 4JY5H 4ZAKB 3X3FH 3STLB 1U2CA 4OBRA 1MLBB 2VXQH 4ZMPA 3WFEH 3GSQA 4JK0D 3KYKH 2HJKA 2O6PA 4K8RD 4IGBC 4XPTL 4Q9QH 1S9YB 2VLRE 3HN3A 2KZWA 4F7EA 4Z6AT 3CLFL 2IXQB 4P2QA 3U30C 2EVHA 3FNKA 4GUPA 1DQLL 1AC0A 5HHOB 1BMZA 3LV3A 4LLDB 3BN9D 5A6LA 1UOVA 4JFDB 4WK2B 4CKQA 1IARB 1C5CL 2E9IA 4QXTB 3FSVA 1CXFA 5LGJB 5EA0H 3AC0A 4Q6IB 1IIIA 4OI9A 3SDXF 3ZJAA 4XCFH 5EMYA 3LS4L 2X4NA 4PB0L 4ZRGA 4LSPH 3HE6B 3BESR 1U6AL 4OZFG 4YXKH 3IJYB 4P5TC 3PAYA 4ZW5A 2KPNA 1RH8A 1NFKA 3CHSA 4P3DB 3WIHL 1LP9A 4KH9A 3V4LA 5CHNA 4BUGA 3MRPA 3AXLB 5LCVL 1BAWA 2NNRA 2XWBA 5DJYB 1KEMH 3NMEA 3HPLA 5AUMB 1EQWA 1C08A 3MRQA 3VI4A 4HZLA 5AYTA 1JNNH 4OZ4B 1CF8H 1OTSC 2WXOA 3NPSC 5C08B 3CIQA 2C9PA 3MV7D 5FYJH 4I3SH 2YMOA 3NCCB 3QQ9C 2GEEA 2OBGA 2VZ3A 2WPGA 2YO3A 2MQCA 2L3BA 2J43A 2RCSH 1YJDH 4I9WD 5B1JC 1R1CA 3BLPX 2YC1A 4QRPA 4HWBH 2PXYA 4QOKD 1E28A 4DVRL 2JIXB 5BZWB 3DV6A 2B1AH 5KVGH 3FN0H 5JIDA 3B9KA 2ZD0A 3P11L 4BFFA 1HZHH 1MZZA 2ICWI 1UWYA 4Z7UF 5B39B 3KPOA 5K59F 3MZGB 3QRFM 3CD4A 5A6MA 1MFEL 1KJ3H 2P1YA 1NLBH 3QZWA 2ZXGA 4AE1A 4PY7A 2ZXEB 12E8H 3TJHD 2N7AA 5E2WH 2OMXA 3M1CA 4LOFA 3SYQA 1ZVSB 2E47A 1ZV9A 4ODUA 1QBBA 1T03H 4EIGB 3BFOA 3QWNA 5T1DH 2WVUA 4U1NA 3AS1A 3QYCA 2UVFA 4IMKA 1U8PB 4Y4FB 4L4VB 2HN7B 4YDVB 3RTQB 3HUJF 1COBA 1YQVL 1J1XH 2DQIH 3ZE2E 2D7OA 4DN3L 4F3FB 1CDIA 5EZOL 4NSKA 2DBLH 4TV3A 4K5LA 5I0ZA 2YGQA 2YUWA 4GW5B 3JWOC 4Y7MA 1OP3H 3SKOB 2K8QA 3KEDA 3F2LA 3CXDL 5IY5B 1RIHL 1NCCH 3VE0B 4F91B 2AABH 4PP2B 4LLVA 1P6WA 3VA2C 4QWWD 4JKKA 2KI6A 4IDLA 3RX8A 4FQIL 1NSNH 4BQ6A 5E9DB 5I17B 3MRMB 1A8ZA 1J1PH 3PCYA 3U36B 4POYA 4NC1C 5DQJB 1QSFE 1H3TA 2B4CL 1LM8V 2ZKXA 2AXFB 5EOCJ 4OCSL 4XNXH 3CFBA 4OJYA 4P4KA 2C1PA 5AVTB 1BM7A 2R8SL 3QA3B 4RFNB 4KBPA 4B3EA 1J48A 4XVSH 4E41E 5EU7E 1LO3L 4XRCB 5E2VL 2Y5EA 4BZ1L 4YSAA 4LHUD 4BZ1A 5IB3A 1NCDH 2R2HB 4G7YL 2Y3AA 3BUQA 3F7KA 3IXAA 1XSJA 2YAEA 4ABWA 1DSYA 2PYFA 3W5NA 1MCEA 2B08A 2FJHA 3FB8A 1A6PA 4N2IA 4AG4L 2DIAA 3ZKXC 5E24E 2OSYA 5I8CB 1P2CB 2X1QA 1EH9A 4APQA 1NLDL 5DD0L 2W80C 1OZUA 4JO4H 3SCMD 1C12A 5A2JH 1H3XA 3NP4A 5JPNA 2M2DA 4EI0A 2FX8L 4MXVE 5JW4M 1WFNA 4HX1B 1BQKA 4A6YA 1TO5A 3AAZA 3S35H 4C57C 2QPFA 3CSGA 1HDMA 1HIMH 4S1DC 3KW8A 3BGMA 4NEHB 5F89B 3HNSL 1QBLH 3MRFB 4LARH 3QQ4B 2QDWA 2WKOF 4PAZA 1QFUH 2Z1PA 4NP9A 3OKYA 1NAML 2HJLA 5DZVA 5H2BA 4OF3A 2HUEA 2IG2H 3D0VA 3APDA 1BLNA 4ZW6A 4NCC2 3WLWD 3VXMB 3NJIA 1TZAA 4FHKA 2JJSC 2D73A 3ABGA 3PV6B 1AOZA 5KZCD 1KLUB 2DWEB 3QEQD 3SDDD 4AYBA 3D0LB 3RVUD 1YC7A 3LN5A 3TIEA 3UP1A 1UATA 3DVGB 1YNKL 1UZ6F 3GSVB 1T7WA 3L2NA 3QIBD 4RZCB 5JA8B 4N2FA 2R29L 4XBPB 2GK2A 5EZJA 3KDMB 4OIIH 3AG3B 3MRBA 2TSBA 3MOBL 1SVZA 4ZD3L 4P07A 1JZ5A 3GMOA 1YC8A 3UDWA 3ECBA 3I6GB 3QDGE 4LLWA 4F8NA 1OE1A 3KXFE 5IK3A 1FLRH 3T0ED 5GGUB 2VDKH 4PLOB 1IKNA 1YPZF 3V5HA 4EBQH 2VOTA 1QLEL 3RIAF 2WXQA 1T21A 5HHNA 1EXGA 3H2QA 2R9HD 4KNUA 1U8MA 4M5TA 2GTZA 3DX7B 4ZDHB 2BSEA 4J3OF 2MKLC 3GO1H 3ZBMA 3FUHA 2LFEA 2BFVH 4GSXA 1HH6B 3QJXA 4Y5VC 2JQAA 1SUJA 5FKAB 3AREA 4IBLT 4LCCB 1RULL 3BUYA 2MOVA 4FN0A 1ZPLA 1I1AB 4LLQA 2W0PA 2WMPB 4AE0A 4DCQA 5ISZE 1JHLH 1YEIH 3BIBX 2VO8A 3C6LC 3CZSA 3HLAA 4D3CL 2ZJSH 1NIDA 4ODSL 4YNYA 3V7AG 1KN4L 3B7TA 4ZFOB 1W2KT 4OTXH 3CFDA 3GIVA 3IDJA 4FQQA 5IKCB 1KDJA 2IH3A 2XN9E 5PAZA 4Q52A 4K15A 5DO2D 3SE9H 2QSCH 4YSOA 1QP1A 3U1SL 4JRXD 2HTLC 4J8RB 4BA8A 1C8PA 4Y5XB 4ACTA 4NWUL 1UOLA 4U7SA 2PO6D 2EXSA 2Z0UA 1ROWA 2Z4QB 2O6FA 2YXMA 1H6UA 4O51B 2VLKB 2I7SA 4GKZA 4OF6A 5AW6B 4HEPA 4LP8A 5D1QC 4KK5C 5ANME 1CE6B 2GHZA 1OSYA 4Z7WE 5TE6H 1Q72L 3AWFA 3DOHA 4I77L 6FABH 2QLYA 2ZX8A 1AGCA 5C0AD 5JZ7D 2BNQB 3NSYA 4XCCH 3BWAB 1JRHH 3TPUA 5EU3B 1JUFB 2JE8A 3FU6A 2CKBA 5BXFA 4C56D 1GGBL 3SD2A 5CWSA 3CZJA 4ZX5A 3S96A 1UJTA 3OC5A 4G6ML 3Q5OA 5F3HA 3KYOB 3VFPA 4BSVA 2PPEA 4DEPC 5ESAB 4XZ4A 1I9IL 4B5ZA 3I2CL 1CVRA 2LQRA 1W72L 4F7PA 5JIPA 5TE7L 3KCPB 4YJZL 3MRDA 3ILPB 3KPMB 4YS4A 2ITEA 3EYVA 1F2QA 1TEGA 3JWOH 1SN2A 1BLIA 2V8LA 3H7BB 1Q0EA 4HC1L 3U4KA 4XP9L 1PIGA 3NEEA 4MD5A 5E9AA 3P3RA 3ZKMD 5EU6B 3MACL 5JHDE 5INDB 4NN6B 1ND0B 1AGEA 1ETA1 5GHWL 3IE4A 1FBIL 2BSTB 3JWNG 4GRWF 4UINH 5C0CE 3QG7H 4Z78B 3WEAA 4PJAB 1DTUA 4PGBB 5EFIB 4G6JL 1MUJA 2BCKB 1AXIB 4BH8B 1KXVC 1JYXA 4CDHA 3BSZA 4GAJH 5FM5O 1KYAA 4BQ9A 1HILB 3MLUL 2AHIA 4CMHC 2OP4L 3ARDA 4TMPA 3FL7A 4G43B 2F5BL 4KVCH 3EJQA 4KTDL 5I1LA 2WO3B 4M93B 5E4OA 5CD3B 2WO4A 1WAEA 4KVNL 1MY5A 5F7NC 5JOPD 4M5YL 1WTLA 2PW1A 4NM4H 3OKMA 1WIPA 4PJCF 3UZVA 4ENEC 4XPFL 4JBSA 4J3XA 2HSIA 5D1ZA 5F6HJ 3BPLB 1SXAA 1ML0A 2D7QA 4LL4A 5GS2D 2JXMA 1BD2D 1YAZA 3L3HA 3PG2A 2F54D 1YMHB 1BV8A 1WFUA 2FB4H 3GB7B 5I66A 3HRZB 3LSOA 5SWZE 3WKPA 1I7TA 4GRLB 5AAMC 1Q9WB 2PETA 5CJXA 3GSOA 3OGCA 2OR9H 1VFOA 2G75A 3UGXA 3NQKA 4HJ1A 2EUXA 3U2SA 1EWHA 3IPEA 1S78C 1T2JA 3ZDZE 2Y5QA 4MAYD 2IDQA 4AXWB 3RG1C 3Q44A 4JFYA 4PJHF 5HGAA 2J3SA 3L1EA 1A0QH 1CICC 4TRPH 5HY9A 4WW2C 1OP9A 3VWKC 5IGXL 3MUUA 1CIDA 4HIEA 3GHBH 1GS6X 3N44B 5I1JL 3NCYS 3VWKB 4I2XA 4MA8H 5BOPA 1MDAA 1RHHA 5L4FA 1GW6A 3MC0A 1ID2A 3FQYA 5J3HC 3C60C 1BM3L 4GQ9H 3UTSA 4KKPA 4X80L 4N2HA 3T2NH 3UABA 4GKNB 3C60B 4H8HA 4PEEA 4LT7A 4MLIA 3SQRA 3NESA 1CFSB 1SOKA 1INQB 1WK0A 4S11A 2FO1A 1Y07A 4EIBA 1YYLH 2AXGB 4WI8A 5IFJB 5CP3A 4FQ2L 5B8CA 4P9MH 4YMPA 4UTAA 2WYHA 5JDSB 1X44A 4OD3H 1T83C 1A1NB 5DJ2B 3HI6H 2XVKA 4Q74A 3RAJH 3RNQA 3QUZA 4U1GC 1G5GA 3ZT5A 1ZHKB 5IREA 1R0AL 3PJLA 2H0FA 2O5YH 3BEVB 5D93C 3DUUB 4BFNA 2K9UA 1LEKB 1KZQA 1ZS8A 2XBZA 5IT2H 1P7QB 3G3LA 3VRJA 3U9WA 2BO0A 1UB5B 3ESOA 5E70A 2J73A 1AR1D 3V0JA 4PN6A 3PUCA 5ITFA 3GZOA 1LXMA 4HK0A 1TLMA 2KZ1B 4HK3N 5C0DB 3ISWA 1J9SA 3WN6A 2OPCA 2V7HB 1P7BA 3CDZB 4PD4K 4PJ5A 4DK6A 1FVCB 1X3DA 5D5MA 3A6BL 3BGFC 4ONFL 3MGOA 5I6KA 2VLRB 4KQ0A 3OZLA 3ARFC 4IMLA 3P3TA 5EDSA 5D6CA 4YBHA 1W0YT 5A16A 2EEDA 3BQUB 2WNXA 4OZIA 3MODH 3CXFA 4IK6A 4U6XB 1BA9A 2EXWC 4A04A 4XBGB 2F8OA 1NAMB 3OB8A 1QATA 4UILL 4Y2DD 4TNWK 1I3RB 1BOGB 1N5YH 1N4XL 1U3HB 4C55A 2HT3C 2VSKB 4ZX6A 2X70B 5F7KC 4FXKC 3TXAA 5DJXB 4WNQB 2OX5A 1MH5A 3IMVA 2ATAA 1FZMB 4I0CC 1TF4A 3RUGF 3ZYJA 1KGJA 5FA4B 1G7JA 3QXDA 4JY6A 4NI6A 1NCTA 4OZHE 4WFEE 1JV2A 5DUBA 5I1DB 3KS0J 3VX0A 1FJ1A 4RWHA 3AQYA 1BJ8A 1WLHA 4W9CC 2BHUA 5FWQA 3S3BB 4U31A 3BVTA 5JIKA 2V5TA 5JLZA 1E3FA 3EJYC 5BJTA 4JG5A 2WXLA 3ULUC 2ED8A 3GHPA 1J0HA 5DR5L 4RISL 4B0MM 1WAPA 5AOJA 1T5XA 2H9GB 4LSDA 5GGRB 4M7JH 3BZEB 2RH0A 2UY7A 3EJTA 5F7WC 4KRMB 3RVVC 5BUGA 5J5EA 1U6AH 3O0RH 1N7ML 1QLEB 1BQHG 3L5XH 4XO9A 5FYKH 2QEJA 4FFTA 1XGUB 1YN6B 1QR1B 4CC4C 4WUKL 2AV7B 3ETBF 4M8UA 2P8MA 1L9OA 1NANI 1YMME 1N64L 1G0DA 4FL4B 2OTPA 2G5RA 4Y4HD 1UJ3A 3UBXI 2ERJC 2WV3A 1MFDH 3CH1A 4QNPF 2KYIA 4WHDA 3I75B 4LRNL 2ERJB 3TS8A 3OBAA 3W0WD 1IU1A 4F9PC 5KS9F 3C2AH 4JQVA 1R5WB 2BSSA 1QASA 3B2VL 1EMTL 2DL2A 3DGDA 2NY2B 4TS6A 1UM4H 3P0YL 5FHAL 1HHKB 1L6ZA 4OZGA 2YK1L 2D03H 3K5RA 4L1HA 5FK9B 1UVQB 4Z76A 2VR3A 1GC1C 1ZOXA 1TFHA 3OKKB 1Q0XH 4KKCC 4LEXH 2PWFA 4GB9A 4Z23A 5JOFA 3IDUA 1D2PA 1FZJB 4RESB 4PRDB 1H19A 4X8GA 1QEXA 1E8YA 1HHIB 3CSTA 1S4IA 4L37A 4YR6B 5FHBL 3TASA 5ECJE 3VXSA 1F58H 3L1OL 2FL5A 2XKNA 3DYOA 3GBLA 1OWWA 1RJLA 4NC0B 3FFCA 5INCB 3ZR5A 1E2ZA 1N10A 1HYRC 2DLFL 3ZE2B 1Z32X 4WO4A 4UBDD 2DLTA 3O0LA 2CD0A 2BINA 4IKNA 3MRCB 5DZAA 5T3XE 5J6GB 2AK4D 2ZSWA 1E8ZA 4FQXC 4L8CB 3MV11 2EABA 3D51A 1H8OA 4FQXB 1TQBC 5LNDA 4YHMH 5D2LA 1P4UA 4MA7H 3GUTA 1TQBB 2QGDA 1OT4A 4D9LH 5I8KL 2R4RL 1IIKA 2DMBA 1QSFB 5CZKA 2DMCA 3ABZA 4WFGE 4FNRA 5IR1B 3BAJA 1GCYA 1EEZB 4GI9A 3QHTC 1YQVH 5IB5A 2LAGB 2F5AH 4IBTA 1F1AA 3UAFA 4DN3H 2HH0H 2EIMB 1HE8A 3JYCA 1T0NA 1JGLL 4OM0H 4MWFA 4UI2A 5C8JB 1W72B 2F7RA 2ZOOA 5IQ9B 4BFRA 5IB4B 4Z77A 4PJBA 2NXYC 4XNBA 5I8OL 2XIDA 2QPDB 3QDHA 3QI9D 3BD3A 4FJYA 5E5MA 3EH2A 4JFWA 5HDRA 5BQ7B 3LEYL 1ZE3H 5E2TL 4A2DA 2B77A 1I85C 3E9UA 3W11D 5J11C 2NYYD 3O41B 3TIDB 1TDQA 2QV4A 2YKLL 1ZD6A 5IMMB 4NPYB 3CLWA 3KBFA 4ELMA 4L9LA 3IPBA 3VTMA 1HI6B 3WE6A 2HFFB 2P43B 5EUOA 3V95A 2GQHA 4UV4H 5FB8B 3QPXL 4UT6H 2FJFB 1OF2A 4FNQA 3O3EB 4R7DB 5CU5A 4B9CA 4J4PA 4C4KT 3QE5A 3DHPA 2V2TA 5DD1H 4ETQA 2K3TA 2HTKC 4GRMA 1NM9A 4DKFL 2Q5BA 3BAIA 3EUDA 2BP0B 1IQWL 2OJEB 2UZXB 2GKIA 4O2FB 4HSCX 3K46A 1IAII 2EDEA 4BA0A 1MZYA 4K71B 2ZXAA 2VXTH 3SOBL 3QUYC 3L4XA 4NDMB 4WWNA 4LAQH 3U7YL 4IRJA 1EJOL 3QJUB 3G6AB 2BSRA 4MJ6B 1XGTA 2VR7A 1S5HB 1FH5L 2YAPA 3UXFA 3WY3A 1SVCP 2WQXA 3LRSA 2GIXA 3VXNA 1ZCRA 2FWOB 3RDTC 5IVZA 4BFOA 1V8HA 3VFNA 5C6PB 2HXAA 4LU5H 4WHTA 1OGAD 3MJ6A 4PRIA 43CAA 3T77B 1CYXA 5AZEH 1E8WA 4QTIH 3D85A 1MAKA 5CO1A 3QZOA 4HV8A 5K39B 4QRTA 2H6UA 1WIUA 4XPGH 2DZEA 3VWJC 5IWLA 4EDWH 5LO7A 1RZGB 2DQUL 1GZHC 1HJCA 3QEUB 1KCRL 3LVTA 4EQ3A 1DQQA 4UZGA 4OKDA 1AJ7L 4PREB 5DJ0B 3QDGB 1E27B 3N40P 3KXFB 1MFBL 5CEZH 1PCXA 1TEYA 3WUWA 1QVOB 3QUKA 3A4DA 4WW1A 1CE1L 3RWJB 1ET5A 2NY1B 1CFQB 1Z9LA 1IBBA 2ZOKB 2YA1A 4TXVB 4MHHG 3KAAA 2FBRA 1F3JB 5I1AB 4FNPA 4QGTA 3L81A 5C9KA 1OSPH 4JLRB 5TQ0H 3KCWA 3D2UA 5DS8A 1SEBB 4U1LB 3S5ZA 2BOLA 3FQNA 3NJNA 3DSNA 1RI8A 3O45B 5ISZB 4TLUA 1TVBB 4FF9A 5T1KD 2F7IA 3EYQD 4JFHD 3A4AA 1CGTA 2X2YA 1P4BH 1JHKL 5JPMA 1RZKL 4QAMB 4HUWA 4JFXA 4MJIA 3PXLA 3A67H 3GUFA 1Y1DA 4AEHH 4JPIB 2XN9B 1KB5B 4N22A 3TVMD 3R4DA 4ILDA 1RP8A 4I18C 4NPJA 4QEGA 2H32A 4X99A 5JW3L 3T5WA 2BVEA 4NBXB 4HLEA 3MNZB 1WQVT 1R9FA 5E8PB 3OG6B 4HD9A 5HHME 3EZ8A 3V0IA 5I0VA 2VISB 4PGEA 2HT2C 2IPTL 3L4CA 5FO8A 4CGTA 4X6DE 2NXZD 1S7UB 5KSAC 2K1MA 3U0TA 3IDYC 3KHQA 4JM2B 4X5PA 4ODSH 4R4FL 4E0RB 3VH8B 5B4MD 5ILTL 5T3XL 3WCYA 4OZFA 5ANMB 5HHQB 4Z7WB 4FERA 1K3IA 2CRZA 4EEEA 4TTGA 2B8OT 1Q4NX 4EPSA 1T22B 4JPVH 1MCIA 1UFUA 1XTMA 4RGOL 2WXGA 4G5ZH 1WJ3A 2FUTA 3KLAA 1XXFC 4GT7A 4JREC 5AL0A 1KOAA 1G9HA 3SDCB 3WY2A 1UD4A 1DSFH 5D72L 4JREB 2QMKA 1I3GL 3H54A 2QDVA 3ARGD 4Z7NE 1HXYA 3BUIA 3L95B 4FXGA 5E5RB 1V3JA 2VAAB 4KRPB 4RIRA 3L9EA 4ZUWA 4AW7A 5E6IC 1TEFA 1RZJC 3HBQA 4KKRA 4KNQA 5DJCA 4ELDA 1IVTA 4I77H 3P2TA 3I9AA 2DF3A 3WXWL 4B9ZA 5JHDB 3FTWA 2WXHA 1HTYA 2YKKA 1MRDL 3W9DA 2OMVA 4KC3B 1U2YA 1VEOA 1U8CB 1BQUA 2YD0A 1VLXA 4N6QA 2VMCA 2LAAA 2VABB 5C0CB 4EN3B 5IHWA 3E80A 4IRZH 2DQ6A 2CXKA 2EDHA 3P4MA 3RL1B 2ATKA 4IJTA 5DRWB 4YWGH 3GMMA 3CJJA 3WTWA 4P3WA 3BT0A 1JPTH 1KGIA 3DVNA 3F6JA 3EG9B 3FQRB 1D7BA 3DPBA 3D48R 4GAYA 3VVWA 4DK3A 5C0EA 4I89A 1FI8C 3FXIC 4X5QA 5E2UH 1G7QB 5SWSA 2AQ3A 5I74C 1Z6JT 3IFOB 4EI6A 3MACH 1IEBA 2WSKA 4J39A 5F96H 1LO2L 3GRWL 3CCHB 2VITA 3MRLA 4OFPA 4NKQB 1T0OA 3QUMA 3S3JA 1YYML 1WWBX 2XNAA 3QAZB 1DN2A 1IM3B 4JFFD 1XO8A 3B2UC 3LXAA 4WDIA 2EXTA 1Z9PA 1ZWIA 3RE0A 3T1FB 3FU5A 4NO0B 1P84J 2HJFB 3TFKD 5T5NF 5CNHA 2XQYK 3QO1B 1VGKA 5LQBL 2ZCLL 4IOIA 4KKBC 4N2EA 4YPGB 2CG9X 4RBPH 3ZDZB 5K9KA 5K9QG 1I8MB 1P69B 3VSVA 4FKKA 4XN8A 2BVPB 5F1NA 3RIKA 3WNKA 4R5VA 3A23A 4PUBL 4U49A 4K3JL 1E9QA 1UD8A 1MFCH 2XFXB 3QNXB 1HL4A 1UCBH 1SJMA 2Y2WA 4HA1A 4YE4H 4XODA 1MIML 4WY7H 3SBWA 2R69A 4S1QH 1KFAL 1PD0A 5E7BA 5CGBA 1KF9B 3POHA 2FATL 1TZIA 4A39A 4ZQKB 2UZYB 4PWEA 4IRSD 3PAZA 2P42B 5DFWH 5DGRA 1HINH 1RK7A 1SY6L 1R5IB 1QEWA 3EJUA 1SF3A 1TZHB 4MZ3A 2R2EA 3VDCA 5F7BA 4G2AA 4ODHH 3SSGA 3BISA 1V55B 4KX8A 3QDAA 4M1DH 1IBZA 3F64A 3O8XD 3SOTA 1M3IA 4RGNE 2MCMA 1MPAH 1QACA 3H7LA 4FTVE 2CU9A 1NCIA 2CJUH 1CR9H 4H25A 2CCVA 3LH2H 1VZHA 4QRUB 4D9RD 4DQAA 2DB8A 1ZXKA 5EF2A 3SGKC 3KZ8A 4DUWA 1JNHB 4GUQA 1E9PA 4LEOA 4HKBB 3HG5A 2GT9A 5IHZB 1MWOA 4ZTOL 1MHEB 3KPLB 3QIUC 4HS8L 1OGTB 3MLWL 4HWUA 1P4LB 3HFMH 3P1VA 4NENA 3IDMB 3QIUB 1FVEA 4FFVD 4GSUA 3HKFA 4TUJA 1S7VA 4MNHB 5DYFA 3T0WA 3QQXA 3IJEB 4GW1B 3GJFH 5E9NA 1DP0A 5D7LA 3Q1EA 2QZ5A 2E7LC 3Q3GA 4WWOA 1HESA 2G2RA 2A5UA 3M86A 2YD4A 2C1OA 5IG7B 1Z5HA 4JAMB 4LCIH 4OKVB 1N6UA 3K6NA 4ABUA 3QNZA 4Z7AA 1KB5H 3AY4C 4OJFL 1NCBH 3GXFA 1J05B 1MREH 3FOMA 4IBVA 3GGWB 4F93B 3VD2A 3UJJL 3NRQA 4RMSA 2B3IA 2CO7B 3P9MB 5E2JA 2HT4D 1MCHA 2R15A 2E6PA 1ZA6A 5KYYA 2G3ZA 3FSWA 4NO5A 1XF4B 2CJTA 3FCUB 4QHKI 3WO4C 1OF0A 3AMKA 3FS9A 3GPEA 1AOHA 5CU9A 5C2BH 4YDKL 5I6NA 1WA1X 4Y1AA 4OZHB 3WFHB 3BHBA 2AI0H 3DOSB 1VGEH 1JXFA 3R0NA 2PUQT 4UV7L 3TO4A 3QPQC 4BCXA 3U6XA 3RZCB 1RU9H 4IS6A 4PI0A 1KNOB 1PQZA 2VDOL 3LKNA 2IAAC 4JN2A 5KBMA 4WV1A 4C59B 1NDMB 5EBGA 3QUXD 2QVIA 3BVUA 1HSAB 4JPWH 4P3CL 2OMZA 1SYSA 4HIQA 1ZK9A 2V7NA 1UFGA 3CV5A 1L0YA 4BSWB 3VD4A 2HFGH 3UYRH 3QORC 1MI5E 4YIQB 4IKJA 1YMMB 1PJ9A 1RZ7H 1U41A 2LFGA 3PHOB 5DD5L 3MV9D 3K71A 1MEXL 2OJZL 1D6EB 1RZJH 1UTDA 5ID1A 3CPUA 5HHVH 4NQCD 4U4IA 2FO8A 2GBVA 1S8DA 3QCUH 1G4MA 2PNDA 2VQ1A 4GEIA 5C0IA 3UX9B 2NY4D 1PY9A 2AQRA 4LVHC 2YGNA 5ESVB 5D4JA 3TWYA 1DFBL 3QBTB 1N7MH 3CUPA 4LVHB 4E9SA 4NUPA 2W9DH 2AJSH 3L5JA 3B8SA 1WFMA 4M3HA 2WP3O 1NPUA 1A6WH 2JKSA 4KI5C 1G9ML 3FQXB 4XVJL 3UTQA 1IVLA 2ESVA 3MLVH 4MS8D 4PJ8C 1SLUA 4Z0BL 3L6FA 4MJHA 3U4BH 1F6AA 1YEJL 5DVLA 1NCNA 1KEGH 4MA1C 3FUNA 1F4XL 1O7DE 4ZSOB 5JXED 1D9KB 1K9TA 3QO0B 3B2VH 4MA1B 3SB3A 1EEYB 2CA3A 4O00A 2QVFB 5D7JC 2ZE0A 4FAAB 3B9EA 4WNJA 9PCYA 2JJTA 3R8BB 4ODTL 2WZ5A 4S0TD 1WBXB 2MQ0A 4TQHA 5D7JB 3TN0B 2HG0A 4EI5C 3PL6C 1KWGA 4ZO7A 1OOAA 3ILDA 4UQBA 1AHWC 4FG6C 4FOMA 1SXBA 3QXWA 5HPMA 2CGRL 4A7QA 1OXYA 1UD2A 3HG4A 1MAML 2Z35B 4JN1L 1GMIA 5C2UB 2BK8A 2V6HA 2ZAGA 1LD9A 15C8H 1Z9SB 4I9XA 5H35A 2XWJB 2A38A 3C09B 3WL9A 4TSCH 2EDDA 3LNFA 3VYNA 4E68A 3RQ3A 5CINH 3B5TA 1KLFB 4ISVB 2EICA 4HDIB 5DHVA 1PD1A 4QTHB 4R90L 4A2HA 4IBQA 32C2A 4RAHA 2P5PA 2QQKL 4YQXL 1JVKA 2FJGB 4MGXA 3HE7A 5HYQB 2LVEA 3SJVE 3GLAA 5JMRA 3F3HA 5I16A 1DE4B 3PPEA 3PGFH 1CB4A 3KPRE 1KXTB 2H26B 2LT9A 2OZ4H 5DTFB 2OULB 2X6CA 4I48B 5JHLL 3DTDA 3D39D 4AGLA 3G6DL 2DV6A 1UQSA 3NACL 5PCYA 2OW6A 4KWUA 5CJOL 5MEND 1EX0A 4EKXA 4KZEL 4Y8AA 1GJWA 3BD5A 5AW7B 3E6FB 4LOEA 1M7DB 2GJ6A 5B1KA 2NW3B 4C58B 3OD3A 1E67A 2VO5A 3BZ4B 1RUKL 3DMMA 1KJMB 3JT0A 3FAXA 1HFUA 2HB0A 1L7IH 4Y5YA 2Y1YA 3ROLB 3S4SG 1F02I 1UUSA 2CGYA 2V4LA 2Y6SC 1DVFC 4YZWA 1AYOA 3PF2A 4QRBA 1TTAA 5GZNC 3V10A 2HPTA 3VB8A 4HHAB 1CBJA 1N5AA 1H0DB 4FFZL 5ELIA 4HJGB 1K2DA 2YKLH 4XWOC 3NCBB 3KWTA 1G7HB 3KWXA 1OT1A 4P5MB 5KEZA 2YXFA 3S3DB 1FORL 1QYGL 4U2YA 3L3DB 3HMXA 3GLDA 3PHAA 4JO2H 3OF6D 3RKDD 3ILQC 1IKFL 2V0AA 1ORQB 1KIPB 2WWNA 1N6QL 4UDTA 1F86A 4YDIH 4LVNB 4GKSB 4TLKA 5IROC 1MW2A 4MNQD 2CMRH 1Y6KR 2CHDA 4HD5A 1OD7A 2J8HA 2Q3AA 3AGWA 5IOKA 4W6XB 3QCTL 5C71A 3FTGA 4LO9A 3ZQXA 2A7BA 4MJ5B 1MCNA 3LS5L 4K7PH 1NKOA 2XN2A 5IUSA 3GKWL 3MXVL 1FZKA 5D1XE 4O4YL 4AV0A 3RVXD 4F7CB 1S9WA 3CFKB 3OZKA 4KDVA 5FW6A 1FH5H 1UZ8B 3WKMH 2BC4A 3NJGA 5EN2B 4JNXA 1FP5A 2F7PA 5CEXA 4DPBX 3LZFL 1JWMA 1EGJL 2PYEA 3FO9B 3OJDA 4R2GB 3TA3A 3QDJD 4MCZB 3WEXA 2GUOA 4TF4A 5MHSE 3Q8FA 2I60H 2DLEA 1AQMA 1G6RL 4QKXB 4XWGL 3M1BB 4F8LA 4QGYA 5CN2A 2IMNA 3FO1A 5JORA 5DVMA 2APXA 4NT6A 2HWZL 2W0FB 5DRXB 2CR3A 4XHJD 3JUYA 4P46D 5GRWA 4PJXA 2E9JA 1TENA 2D0HA 1N6VA 1S7RB 2NMSA 3MRRB 3QIWA 4OUUA 1XGRA 2A99A 4TSAL 3S48A 4AENA 1NGXB 2P4AB 2FBOJ 4PJIE 4XAWH 5CEYA 4MD0A 1JZGA 1PZUB 5I1IH 3MREA 1P5UC 1PZ2A 4AH2B 5EPMB 4Z3IA 4TQ8A 4R0LC 2D0FA 2HG5A 4WI6A 5FYJD 1RHFA 2BWQA 1UWGL 4IDJH 2CO4A 1N0XH 1LO0H 5EU4B 4KQ3L 1BVNT 3KLLA 4YDJB 3RWGA 3MO1A 5A3ID 5IW6A 1TMQA 4ZXBD 4A7SA 3WO3B 2JNZA 3VMOA 3ZL4L 1DVUA 2X4QB 4JFOA 4PG2C 3IJHB 5HHMB 4J3OG 4TVUA 1TZOA 1MWAH 4F33A 1NFDA 4OM1L 3V0AC 1S7QB 3DARA 1DLHA 2JB5L 3TNNB 4X6DB 4R4BB 1A7PH 3WLBA 4LSQH 1A3RH 2MWCA 4N2OA 1I7ZA 4X7DC 1WUNT 4WHYH 2X40A 3WMSA 2GAZA 3HZ3A 4FQ1H 1G1YA 2ED9A 5EOCH 4G3YL 3MV7E 4FCHA 4IEFA 2R0KL 2E3VA 1YNLL 4FHBD 4LMQE 5TK2A 1HWHB 4I5BB 4BHUI 2F8IA 1NC2D 3QG6B 1WWCA 1HWWA 5F1KC 1BPVA 3K80A 3ZDXE 4PRHE 1KTCA 1MCLA 4BELD 5LGHL 2DYPD 2IPTH 5I76B 4FHJA 4I9WE 3ROOA 3JWDL 4LDOB 1BF8A 4Z7NB 1ZT1B 3QZLA 3EOTH 1AG6A 4QOKE 1BZ7B 4K94C 4GXUN 1FNEA 1HT6A 1EAQA 4RDBA 5GGQL 4E36A 3UPRA 5ILTH 4GNKB 1AXTL 3BVNA 2XLLA 4PJ9D 5EBLA 1BQHA 2BZ7A 2CBOA 5DDHB 5C09D 1GGUA 1CJYA 2OMTA 4PJDA 3KHOA 3L4YA 5ERWB 2XA3A 1I7UA 4N2LA 2Q3ZA 3LOWA 1KJ2L 2VDOB 3JTTB 1KTLA 2JKXA 1KJ2A 1DJXA 1FFRA 3LH9A 4GG6A 5HHXH 1BXXA 5A2KH 4RRPG 1EBAA 3GSXB 4X5RA 5JNYB 1DUZB 3KWWA 3NEXA 5G4NA 2WBJC 4AUYA 2R0LL 4I3RL 3O6FA 3K3QA 1XZ0A 3BUDA 3HI5L 5G55A 1UACL 1ASPA 1YY9C 2KS0A 1LL1A 1DYZA 2BY2A 4IIQB 3C08L 4Y9GA 3DNKA 4MCYA 5ES4B 1PVHA 5D2NC 1IEAA 3WXWH 2CHNA 5I5IA 1INEL 2DWSA 2WHVA 4JPKL 3TBCA 2IV9A 1JPSL 1U8KB 3MBEC 4XI5D 2BP8A 4FQPA 3FU3A 2AS5M 3IU4H 1B3IA 5DK0A 1OGPA 1BECA 4N2MA 4WUUD 1MCSA 3LRKA 4U6TA 4BK5C 3H6JA 4OCYH 2WVSA 4DERA 3A6CL 1MVFA 4M6NL 3STBA 3RWFB 5IJKA 3MCLL 5EDXA 1A6TA 3TCTA 4A38A 1INDL 2ZP8A 3CFMA 4LPUA 3V6OC 1KPVA 4TYUA 3FN9A 1NDGB 2UVEA 4M48H 5B7FA 3J2PA 1JCVA 4S2SA 3D34A 5GS0C 1FAIH 4NNPL 2C3HA 4XNDA 3ARBA 2ADJA 5D9SA 3TYFB 3Q2VA 4HJUA 1SQMA 3F05A 3FFDA 4UQ2B 4H5SA 4MDIB 1U0QA 2J8OA 2JK5B 2IH1B 3F7VB 2ZP0T 1D5BA 3H53A 5AG8A 2YXVA 5AZ2L 1KELL 4WWID 3MRIA 5LXVA 5FFLA 2OK0H 4PWGA 5LQBH 3FRUA 3JZYA 4L3FA 3C2SA 3RGVD 4HWEH 1NMAL 1JWSA 4QHMB 3UTOA 1UM6L 4AIOA 1Z9OA 1X5FA 1J5DA 1ZSDB 5EF1A 5GPRA 5IFHL 3JVGC 2E9BA 3E3QE 1H5BB 5BRZA 1MCKA 3G6JB 3K2IA 2KDYA 4K3JH 5E03A 3MUJA 5LAXB 1DBBL 4PJAF 3VU1A 4EUPB 2Z64C 3LPOA 1XF2B 4FFYA 4IGBD 4JHBA 3WTUA 4JHZA 1VCBC 1YAIA 1C5BH 4RGNB 1DBJH 3H3BC 4ADJA 1JPGA 2ZUTA 4FTVB 2X88A 1DO5A 4JFDD 1ZLSL 1KCUH 2K7QA 2WNWA 4ATWA 3BRFA 4WJ5A 2FIRT 2KT6A 4ZFFA 4TNWF 2Z7WA 1PFOA 5FYJU 3T0VA 4BEIA 1JIBA 4GW4B 2Q6WA 1SY6H 4W4NA 1U58B 1N26A 1O75A 3ZRSA 2OMYB 3CHOA 2I26N 1KTDA 4J8QA 1S7TB 3DSFH 1ORSB 3HR6A 3GRGA 2XA8L 4Y19E 4WZ9A 5HVFB 5A2CA 5K9OB 1RZIA 2ZWZA 4HXBH 4P5TD 2XPGB 4KY1H 5TK4A 2CIIB 5EB9A 2NYZA 4KMLB 2VLLB 3RFZB 1WC7B 1T2QH 1KBKA 5D70H 4O5LL 5DJ6B 1URLA 5C08D 5FOJA 5T1MB 4K4KA 1LO4L 3ZGIA 3DK2A 1T3FB 4NO3A 1X5YA 3VNYA 1K4CA 1DQDL 4XN2A 5KSVB 1NGPH 4LP5A 1E7VA 4NKIH 3T8VA 3MBWA 3MJ7B 3QQ9D 2AJVL 4ZFGL 2Y36L 3G5ZB 4HS3B 3WTYA 2ZNXA 3LXUX 3T0EE 3N44F 2DLGA 2QPEB 4JR9L 4X42A 4HPOL 4DO4A 4FQHA 1RUAH 4KKZA 1OSZB 3ZMRA 3W38A 2UUDK 4PI2A 5FX3A 1XGPB 3DBSA 2FQEA 1MIEL 4YK4B 4FMVA 1FN4B 3NSCA 3RU8H 2JELL 3ALXA 3ZTNL 1SN5A 4ES9A 4UF7C 1WRFA 3K8KA 5CUSH 3SDAA 5FA3A 5CMAA 4PSPA 2XZCL 4X6BA 4FYRA 1S7SA 2XXCB 1XIWA 4FLSA 5HYSB 2F1BA 1T20B 1PLGL 4ZPVB 4F8QA 3BP6A 4Z3EA 2ZUYA 4NHUA 4UUJA 2DY2A 4E9VA 4G8IA 2QPSA 4Z7VA 3S36L 1TTUA 1G6RB 4MNGE 1WBZA 2VZSA 3EGDB 4LGRB 4YDKH 3T2OA 3D0AA 3JV4A 4OCWL 4R97C 2WIMA 3IMRA 4P2RD 1S3KH 2YD9A 4JRXE 1MI5B 5B3SB 2YD5A 2VZUA 3FONB 4K94H 2D3LA 2VJ8A 3CC1A 2Q76A 1WIOA 4MKMA 4XMKL 4XP4L 5BRPA 4UV7H 3WIIL 1X9LA 3NJJA 5EZIH 1PYWB 1BP3B 4H2AA 4P57A 1PG7H 2VDOH 1IGML 3NZHL 4ZS6C 3TBTA 3B37A 1FYTD 3E6HA 2YQBA 5E9DD 4UZUA 4P3CH 3VU2A 1WD9A 2HAZA 5C0AE 1SDDA 1IILE 4KUCF 3B34A 3MFFA 3ELAT 3U2IA 2ZWKA 2E46A 4MXWL 1K8DB 4AYEC 2J55A 3ML8A 4LQFL 2I07B 4C56E 1IC1A 2G5UA 3ZGHA 4DZ8A 2Q10A 2DTSA 1YDPB 1U8HB 4OJDH 4QRQA 1B3JA 1TU2B 4JFSA 2X3AA 5CHNB 1MFUA 5IB1A 1P4IL 1BYOA 1SRDA 2UUDH 1VERA 3MLRH 3QJQB 3T65B 1VACB 1J9RA 3HPLB 4M6OL 3RVWC 3MRQB 4B6ZA 1AGDB 1ASOA 2H3NA 1GKEA 3LRHA 2CBPA 1L0XA 4OT1L 2X4UB 1MJ8H 5J89A 5FYLH 1EO8H 1FV1A 5AVYB 2DPKA 4K3EH 3C5ZB 4YSRA 4BBWA 1RJZA 3DTUB 4Z5RB 4Z7IA 2NX5A 1E4XL 5AW2B 4HJJH 1DUYB 3CDFA 4KNSA 1AVAA 3LNGA 4TQEL 4UT9A 3I9IA 1IGTB 1JNLL 2PXYC 1TNMA 3NTCL 3ME0B 3EHBC 4NAJA 3GZKA 1B9ZA 5J9PA 2YPLA 3FB5A 3SCMA 4XCYA 3SKNB 1XR8B 4N0UA 3B9KC 4Y89A 1FO0A 4ODTH 3DV6B 3S9DB 4EZMA 3TT3H 1HXMA 4S1DD 1UA6L 2AGJH 2HMIC 5BVJA 3GBML 2YQ2A 4G82A 4U1HA 3SJVB 1ZHNB 4XVTH 2DWXA 4WJG3 2KZKA 5IUCA 3KPRB 1VZGA 5JW5A 1BD2E 3VXMD 4KFMA 3A6OA 2F54E 4QO1B 5JHMA 1CGXA 4PY7B 1WZMA 1B4TA 1LTXA 1Y0LA 1MHCB 3HC2A 5CXPA 1J88A 1TOXA 1N59A 3QDMA 2PCPB 3UERA 2FH8A 4U6HB 4K55A 2IBBA 2GCYB 4IMKC 4ODWA 4OCRL 1GTFA 1MXDA 4U1NB 4Q0XH 4OU3A 3CPLA 4JJHA 2WB7A 3OHXA 3QNYB 4L3CA 5H94A 2DM2A 1ZV2A 1E4WL 5K9JH 3SKMB 2MNJB 4NI3A 4LIQE 5E5LA 5ADPL 1KTJA 4P59L 4LSVH 3KPSD 3POCA 2WD0A 3QIBA 4N5UA 4NNYA 2CIKB 4ZZKA 2QGBA 5JHLH 4O02A 5C07D 3WKQA 1FG9C 2IADB 3C5SA 1BZ9A 2D4FA 3D18B 2MTPA 4OB5L 4PMFA 5CGTA 4RQQA 3BP7B 3ZE2F 3PHQA 4UQCA 5KJ4A 3FU7B 1U3JA 3DROA 4KKNA 4P23A 3X14A 3KS0H 3IMBA 1C8QA 5E8DL 3M1OA 1JYNA 5IHUH 4P4KC 4N4YB 4HKJA 1MG3C 2VDLL 5E95B 4QJ5B 2B2XH 2X6BA 5E4EC 3CFBB 2GSIB 2VH5H 4OLXH 4P4KB 3BUTA 3HNTL 2PCXA 2C9XA 4XXDB 2O6CA 2GITB 4Z95L 4U1IA 4JKLA 2VLJD 2H8PB 1TJXA 3JSSA 5D1XB 1IT9H 4RFOH 4ERSL 3OR6A 3Q1SL 4M4RB 2X2IA 1AIFA 3HKZA 3V0WH 1LDPH 3SPJA 4APQC 4UNUA 1DJGA 1JXDA 4X8XA 3WTTA 2E27H 3O3BA 5DK2B 1RMFL 5JPNC 3EYSH 1G7IB 2RD0A 2VB5A 1NL0L 2HTLD 1MF2L 1X5KA 1Y1UA 2AQNA 2QPUA 2YUXA 4JB9L 5DLMH 2R1YA 2FYVA 3APCA 3QCTH 2CE6A 2VLKD 4M1CC 3NJVA 2NCMA 2Z93B 3NCMA 4LPWA 3QZNA 3E2HB 4CW1A 3CZNA 2ODHA 3OSVA 4PJIB 4NZJA 3K5SA 4TUUA 5D1QD 4KK5D 1QLFB 4MXVF 2BLFA 1A25A 3AZUA 1RIVL 2JCCA 4X4XA 5LAPA 4GQZA 2BNQD 3QK0A 5F1IA 1EEQA 4F58L 3MLTA 3FB7A 3L4WA 3SZKC 4OD1H 5EEYA 1QABA 2YBRB 5C3IA 3OXSB 4KROC 4WJKB 2VUKA 5DVKA 4AJWA 1NUDA 1H6FA 1Z3GL 3MLYH 5HVGB 4UU9A 5FYKD 1L0QA 2UZIL 3P4OA 4QKTA 4KPHH 4XVUC 4NFCA 3OTTA 1IRAY 3GSNL 1P5VA 5TDOA 4TSAH 1T04B 3ZKNC 4URKA 4U3SB 3LN5B 3SGEH 5FAAA 3MHZA 4BIKA 1X5XA 4FCAA 1MY7A 1TMCB 4XNQA 3LQAL 4WEBL 1ZGLP 4NQSA 1XR9B 3UDWC 1WYJA 2DDQL 4DETA 2XZQH 2EE2A 1ZIBA 2P28B 3ZT6A 1BIIA 3MRGA 3ML9A 3MOQA 2P5EA 1IKNC 2ZOLA 4I88A 3T6XA 1HL9A 4X4MA 5BW7A 3WIFA 5E00B 3B2MA 3MV7B 3N9GH 1QO3B 1MHPL 4J2QA 5ITBH 3NSJA 4FA8A 3DXAA 4MLSA 1MHHA 2IVFC 1VFBB 4BD4A 5DUPL 2VIRB 4OLUL 5HHNB 5MERA 2ZT9C 3ZDXB 4PRHB 1N2RA 1Y18B 2X4OB 4OGYH 4YGVB 1KFGA 1DEEB 2IF7A 2MQ3A 2N7BA 5D6DA 4U4BA 4M56A 1BZQK 3AREC 3TWCL 3STZB 4UOW1 4QOKB 4XXCA 5EC2B 3BT2L 2Z1KA 3KW7A 3B7YA 4ZNCD 4BFKA 3BUYB 4R7NA 3GMNA 5MI0B 3SDXA 2NNFA 4LLQB 3W0WE 2C26A 3SQOL 4LEEA 1XGYL 4X9GA 4F8PA 3VTTA 3DTXA 3SPCA 1X5MA 1DCEA 1Q94A 3MPCA 1AQDA 2A74B 3G5YB 1J9TA 3CFDB 1BAFH 3GIVB 3LEVH 3IDJB 1W0VB 4YC2C 2EZ0D 3VSQA 4G42B 5F9DC 4PGJA 4PRAA 3Q8BA 1ES0B 2WXFA 3FHEA 5J4MA 1XGQA 2BY0A 2Z7YA 1S78D 1UGKA 4U05A 1CBVH 1RSYA 3FO2A 5GGQH 3B9AA 3APMA 4WI2A 1NGQL 3US1A 1FRGL 1DBAH 5F7DB 1B88A 1E40A 3HR5A 1CICD 4MAYA 1L5GB 5JA9A 4LIQL 2CO3A 3KGSA 3VWKD 4HJEA 3SBRA 1EHNA 2ZUVA 2H0EA 2FCBA 2IFGA 4F20A 2I9LA 3IM1A 1I9JH 3L9RA 4DQOL 3OC8A 2AK4E 2PW2B 3C60D 3R1GL 2FUQA 1BBDH 2FE0A 5CSBA 5T3ZH 3FUMA 2FR4B 3D87B 2ZQKA 4JM2F 4NP4L 4X8CA 2OXHA 3NJFA 3ULSA 5C70A 5J12B 1OAZL 2FX7H 3PQYA 3H3PH 5F88B 4Z7WF 2AJZA 4UNIA 1F4YH 2ZX7A 5C0BA 5CGMA 1PAZA 1FGVL 1MJ7L 2BRRL 4E5XB 3T6QC 1JK9B 1K5NB 1DQML 2YD2A 3OLGA 4K9EL 4W9DC 3VFPB 9CGTA 1BG1A 2HX9A 2O5XH 3UBXA 5BQDA 4Z7UA 1REIA 2PP9A 1R3JB 4AMKH 4GSDH 3RA7H 4UNTA 2FEJA 4F7PB 3WIAA 2B3RA 3HHSA 1AD0A 1JZFA 4XNYL 3HEIB 2WLIA 4M5ZH 1G0YR 1P7QD 4LHUB 5DWUH 4MD5B 5AD0A 1DQJA 5B3JE 4LSSL 3EFOB 1BWWA 4JFQB 3BKYL 1K6QL 1AGEB 5CSZB 1YECL 1WEJL 3CDGA 1HC1A 1SHSA 2GJRA 2Y07L 3AW5A 3FQUA 3PLYA 3ZPDA 3U7WH 1NBVH 5EO0A 1V7NH 1TQWA 3HUJA 3ARDC 5DS1A 1WWWX 4H1LB 3TBBA 4BFGA 5KUKA 3MJGX 4PW9A 3G7TA 4UM9D 5CIPA 4OI7A 1W80A 5T5NG 5DSCB 4BXSV 2A9CA 4F57L 5CGYC 1MCFA 5LXGL 5TGBB 1E3XA 5AAWA 4KUCD 3QRGL 5SWSE 1EFXA 3DA0A 4LASH 4L3ED 3UYPB 1U30A 2ZYHA 5F71A 3UTTD 4DKEL 3BIKA 4NB7A 3BZ5A 3BKMH 4LP4A 2C8NA 2EXWD 1ITCA 4PLNC 4XNUH 3GHEH 5CJXC 2A6KB 3CFJA 4CBPA 5CEZD 3FOLB 4A2GA 1AYRA 4UMSA 2VL5B 5ETUB 3SPHA 3ZIYA 2HT3D 5EOTA 2BX5A 3MJ9H 1ZVYA 5DEZA 5FYKU 4A6YH 3TX4A 3WU1A 4Y19B 1VFMA 1QLRB 1OGAE 3KJ6L 3U2SB 2E75C 4U1KA 3CDYA 1FFPB 1J10A 2B1HL 3CSPA 1KT2B 5F7EL 5KZCB 4OFYD 4J23A 3SDDB 5L6YL 1P84K 3ULVE 1MCCA 3LDBC 3TBVB 2AZAA 4CN4A 3NUKA 4JUTA 1ZT4B 4P9HL 3TV8A 5HY9B 2EDYA 3LB6D 2X53A 4B53A 3COOA 1SEQL 5TQ2L 3EFDH 5GS1A 2IAMA 3TEWA 1GOFA 3EJYD 3OKNA 4NKDA 3ZDZF 3ULUD 2RB8A 3PDGA 2WSPA 1A1MA 3CQPA 4ZMYA 4Q14A 1FL3A 2X7LB 3IETA 5GJTL 4MCMA 1EA9C 3O2VH 5DVOA 4KXDA 3N42B 5FCUL 1OPGL 4NQDA 3RVVD 1GAFH 3HS0B 3T0EB 1KY6A 2FD6H 3OKDA 5K33A 3HBGA 5L4MA 2ITDA 3MAWA 5GGRY 2PPDA 4BZ2A 4AL8L 1A4BA 1AFVL 1IC0A 2VRAA 4MJ4A 5IJVA 5KYNA 2X05A 3VCLB 2EDWA 5F0JB 5B8CC 2VDLB 2P24B 2UYLB 2WKOA 4KKLC 2G60H 4TPRL 3QUZC 5EEXA 4M00A 4FLHA 1BG9A 4R5XA 3ZO9A 5I6OA 2NR6A 1O5DT 5FDWB 3QUZB 1DL7H 4GKLA 4BFBD 4F92B 2KUTA 2EIZB 2MCPH 2X3BA 3B6SA 3DV4A 5C3TA 3Q6FA 5D96B 2QGEA 4CUCA 1WF5A 4XX1G 3HAEB 3GMQA 1J87A 3BO8A 2ICWJ 1U8NA 3EO1B 3QS3A 5L9DH 1BWMA 4WO0A 2H2PC 2BS71 2AK1L 4KTYA 4N2DA 5F0PB 4JFHE 3LCYA 1ZEAH 4GIAA 1S7WA 4A55A 4KKCD 4TUKH 3RYMA 3VG0L 4QY8B 2EE3A 4JRYE 4MNGB 2EVIA 3N0PB 1LNUB 4CAGA 1EERB 4QRRD 1R5VA 1E5AA 4HS6B 4R8WH 2N7SA 4YSPA 4JRXB 4WEEA 5DQDL 4Y2LA 5D5MB 2ZG2A 2ORBL 4APXA 2PO6B 5IZ7A 3MA7B 1WH0A 2B14A 2N56A 1HS6A 2Z91A 2WM0A 4AMXA 5KBLA 1YPZA 1UH2A 1HHJB 2L8AA 3APFA 4GQRA 4ZPTB 4LLAA 1A9EA 4QT5A 5FR3A 4ZUUB 4FQXD 3LD8C 2VDNL 5T1LA 3MLZH 2A4EA 4XC1L 3GXDA 3O6KL 2DQDL 2GPZA 5GGSA 2F58H 4UYPA 3NFSH 5C0AB 4X9FA 5CP7B 2AJXH 4KK6C 3RILA 3LZPA 3TO2A 5LBSL 4KTEL 2EIKB 4FEIA 5JW4R 1LK2A 1X7QA 4K23L 5FO7A 4C56B 4A63A 2H47C 2OX5B 3S5LB 4EOWL 2R56H 3L48A 1XSOA 2IGFH 1U91A 3A0OA 3QFJA 5JHBA 1I8AA 4F7MA 4C8XA 2WC7A 4BGDA 5T33L 4LRIA 3QHZH 1U93B 1ZGLB 2NXYD 2A9AA 5EUKB 5DMYA 2CQVA 4HUVA 4IKLA 1GY2A 4Y0GA 3JTSA 4OZHF 5I18L 3MV8A 2CKBH 3D52A 1T5XB 4POUB 3GQFA 1VPOL 3GSUA 3VI3E 3CIAA 4WSGA 2APFA 4OBSA 3DX8A 3DRTB 4DP5X 4X9IA 4P5KB 4RAVB 2YPKB 3N40F 4XP6H 5AQ0A 1UJ3C 1F8TH 1PZAA 1QR4A 2PMZA 2XWRA 1RZ8B 1ZHLA 2Y7MA 3K2KA 4H88L 1CFNB 4ZNEA 1SM3H 2HTKD 4HGWA 2OQJB 2J1YA 3B56A 4H8WL 2PTVA 2X89A 3R8QA 2VXVH 4JQVC 4RRPA 4BQCA 3VFWB 5JIIA 1XBRA 3W2DH 2CLVB 1S7XA 3UTZB 1NBYB 4N28A 3QUYD 4PRBB 2BIIA 2HKFL 4UDUB 4PW4A 4HIJB 4B9IA 3N06B 1FFTB 1BD2B 1DR9A 4N2BA 4TQEH 2F54B 3QS2A 1Q9OB 5AW3B 3TCLA 4TULL 3L5WA 4AT6A 4JFFE 5KSBE 3T71A 3DJSA 3E9TA 4I8DA 2WTRB 1QFWL 3ATAA 3RDTD 1MCRA 3QULB 2LTQC 1K5WA 2I7OA 5EEZA 2ESVE 3F85A 3IB4A 4XN4A 3H0TA 3ZKSD 3HI1A 4DP2X 4AZ8B 1KCVL 4Y16B 2Y25A 5KG9A 3ZTCC 1P1ZB 4UQ3B 5JR1L 2B0SH 5G4MA 2W9EH 3VWJD 3GBMH 4WO4C 4MZ2A 4PGCA 1I8KA 1OAUL 3QJHA 1HVXA 1N9PA 3Q9PA 3QDGD 4J6RL 3U4EA 4ZMNA 1EXHA 3IU3B 3V4VA 25C8L 2YPVA 2F19L 3FT4A 3V0FA 2XG5B 5DMIL 4NQXB 4QXUH 4N90D 1A8JH 1LYQA 4JQIL 3MA9L 3V0VB 5CR1A 4BH7A 1SOSA 4JY4A 3VM5A 4L8BB 1U4FA 1NAKH 1RUQL 1M4KA 4PJCA 2XRAH 5B39G 3NABH 3P4LA 2ZNWA 2WUCL 1A6UL 2AEPH 3IKCB 1O9ZA 1EVUA 5A7EA 5GSRA 2MHAA 2WWMC 3PWPD 2EEFA 5F44A 5LUMA 4H0IA 3HZKA 2DJUA 3ASWA 3GMPB 4PJBB 3SYPA 2OSLA 1IGIL 4HGKC 5BNXD 5ICZA 2ZG1A 3HG1E 1BFOA 3GLEA 5IMLA 2HPOA 3R7RA 5CCKH 2FEEL 4D9RE 1JXGA 4G1EA 3P9LA 4L9LC 4NWTL 1D6VH 5GGTA 1FC2D 1I8IA 2IALA 2JMRA 4LVOB 3BDBA 1TT6A 1F3RB 3CFIC 2LW3A 3TBWA 4PJHA 4B41A 4E9YA 1AR1B 1EV2E 2KBGA 4FZEL 2AQ1A 3HNTH 4J4PC 4JG1L 3ZZSA 3N1QC 4KGLA 5A40E 1MJUH 1HKLH 4QF1B 3HB3C 2QKIB 4XNMA 3KPTA 3GXUB 4GRMB 5KSAD 5L0QC 1CLYL 1MVUA 1N8ZB 1PKOA 4R7LA 1KCLA 3HAEH 5DD3H 5I82A 1Q1JL 1JGIA 3L16A 5D1ZI 1CT8B 4AKQA 2IGTA 2APSA 3BAKA 1XF5B 1SVBA 1F97A 2Y9RT 4IRJC 4LL1A 3WTSA 4X4ZA 3S4SB 5ACZB 1U21A 5BRQA 1KXQE 2BSRB 3W37A 5GIRB 1J8KA 5HDBE 3O6ML 3QJTB 4ZG1A 3WSQH 3CSYA 3LRSB 4R96A 1B4JL 1CLOH 5I5MA 4Y2DB 1OAKL 1FVDA 3M6DA 4H20L 5CN3A 4LSTL 4JM0A 5DO8A 4HEMA 4KRPD 2A73A 1KGUA 4AYDC 4HOZA 1JJUA 4F7TA 2ZWLT 5AWNL 3VXUD 3ZL2A 5IQOA 2CRIA 3CQQA 4PV8B 5IWLC 1GHFH 3BX7C 3MNWB 5E6ID 4YSSA 2EDNA 3NA9L 4HCIA 1AMXA 3P73A 5HGBA 5MEOA 4JZNB 1U42A 3SN6N 5I75B 2XVGA 3G5XA 1D5MB 4HJIA 4PYHA 1FNAA 4B9GA 4QTFA 2NPLX 4ZYKB 7FABH 1LO5A 4P05A 2RBLA 2G9HA 3UAAA 4LCWD 3WUWB 4WW1B 5IV2B 3HMWH 1IBGH 3SHSA 4F37K 4CVXB 4NOFA 3ZYOA 3QZBA 4NJAH 3DX2A 1S9VB 2Z31A 3DYPA 4NBYB 1I9EA 3NN8A 5F6IC 2ZYSA 2EIDA 3EYFB 1FPTH 4S1SH 2QFRA 3GI8H 5F72S 1QZNA 5F6IB 3A3YB 1JVOA 3BQVA 5F7YC 3VFGL 3NGBC 5FKPB 1A2YA 4NFDA 4XE5B 3MV9E 4Y4HB 1EHAA 5BZZA 1MFNA 4NQCE 2YS4A 4ZZFA 1MLCA 4JDVA 3W0WB 1BFVH 4XMLL 4JJ5A 5I15H 1G1KA 3SKJH 5JPMC 3PWVA 1QA9A 2X4RA 2YSTA 4KHTH 1E90A 4N8CL 3BH9A 5DJAA 4AYGA 3RUGA 1NEUA 4NHCL 5E56A 1T1ZB 3WV0A 2OXGB 4HUWB 4JFXB 4W68A 1MCWW 1HAUA 4YXHL 1CLZH 3MMEB 1A3QA 5EH1A 3CVHL 4R7XA 2DQCH 3TWCH 3DO7B 4AK1A 1DO6A 1AAJA 2ENPA 3DURB 3F00A 3BT2H 3EGSA 3MJ8B 4F2MA 5AKVA 1C16B 2P8PB 3SBPA 5FECA 2QQLL 4ETYA 1LEGB 1MFMA 4PS3A 3S37L 4B97A 3BPNC 1FYHB 2ILLA 2A1WL 2FYYA 3GMLB 1JGDA 1QSEE 1WD8A 4WWKB 4W4OA 2WTPA 5I6XC 3PHSA 2R0WL 4Q9RL 3ESMA 2WZ6A 1X9UA 2YXWA 1XL6A 3FZUC 1AO7E 5I6XB 2VDNB 3U9UA 2AK4B 4X6DF 2GC7C 5IP4A 4AGPA 5C0RL 3EBAA 4TTDC 1WBYA 3PU7A 5M7QA 2VXSL 2IIJA 4RZKA 1AKJB 2X0VA 4U6YB 1SBSH 4CN1A 2GBAA 3VFRB 2ARWA 2FZ3B 4FXGC 5IQ7L 2OSXA 2HKHH 4KAQL 5KS9A 1WUZA 5ESQB 1ZT7A 2BMKB 3F6LA 4FMKA 1CYGA 3FT0A 4RIRB 2OMBA 2VW6A 4OCNC 3S8FB 3GIZH 1Q9KA 3BP5B 3R1GH 3U46B 5AZUA 1G94A 2FGWL 4Z7NF 2TRHA 4ODVH 2N4IA 3GZQA 1NWOA 3QI9B 1PEWA 3CFCH 3LH8A 4TUOA 4N1EA 2VSCA 5K5YA 1X5LA 4ESKA 1TYJA 4DP7X 4EXPX 5HGDB 3EO0A 3H9SA 4GG6E 3AUVA 3QIUD 4O2EB 4HUXA 2AMGA 2H1PL 1THAA 2WQVA 2AXHA 3MU3A 4UT7L 3HVDA 5I1HL 3GMMB 3X1FA 5MENE 3WYRA 2XC8A 1DZBA 2DOCA 1IC5L 4XOCA 1QFPA 3LN4A 1JZ2A 4D0DA 3AG4B 4AYFA 3X11A 2GFBB 1CCZA 5IESH 3BGAA 4E9QA 5SWSB 4LLUA 1XSIA 1TETH 3T4YA 2RTTA 5D55A 1AI1L 4X6EB 1F6LL 4NKMB 3BE1H 3MBXH 4L4TD 4AJVA 1VADA 3BMVA 3MRLB 3SD5A 1UWXK 4UTBL 2Y07H 4YE0A 3HZVA 3PAVA 2F6AA 4HCRA 5AW5B 4HG4J 1UOKA 2OMNA 4WDIB 1AGBB 3QEGH 5K1VA 5IEKB 5KOVC 1A3LH 4K7PY 2YJLA 3LZOA 1I8LA 2APWA 3GJEB 3MYJB 4HCFA 4HH9B 3D09A 1S9XB 1M57B 2YGVA 5I6PA 3WN5A 3R06B 1AZNA 4JQXA 2ETWA 1M7IB 1OGAB 2IOOA 1CN4A 3V52L 2GY7B 4TOYL 4MNQE 1KJVA 5DZJA 4DKEH 4DGIL 4JZOA 2DQJH 3SBWC 2SEBA 2Z34A 4AVKA 3JT2A 1RAMA 2WUBL 4UZSA 5E94B 1A02N 3QPQD 1LE9A 1GIGL 2FT6A 3RP1A 4ZW8A 2CKNA 2IPKA 1MCPH 3K6SA 2PLTA 2Y22A 3NCYP 4PWHA 3VXOB 5L88H 4GG8B 2NDFA 2EIJB 3QDJE 1CGSL 4DIXA 1NCAL 2ENJA 1UEYA 3BC9A 3GK8H 4DKAA 4UOW0 4KO9A 2F53A 1VF5C 3KBEA 2YRZA 3PDOB 3QORD 5C6TL 5DMGC 4FI7A 4Y4KA 4HSQA 4EIUA 2G2PA 4ELKB 4FQJH 3M45A 2VE6A 2C3XA 2J88L 3V5KB 1RURH 5T5FL 3A47A 4PMEA 1H15A 1VKXA 5T5FA 2UV3A 3IFLL 1FIGL 4U1MB 3AS2A 2CRMA 2APBA 3IDXL 3DBXA 2BJML 1F4HA 2APTA 2ZONA 4JFZH 4XP5L 3BCDA 2XQBH 3MLSH 4UIKH 5T1KB 4LHJB 4YPJA 4EXKA 1FGNH 5FYJE 3SE6A 1BFTA 2VCOA 4WCYL 3GSRB 5JIHA 3K8MA 4Q6KA 4KI5D 4FGMA 3ZHDA 2HFEA 3MRNA 4N1CA 4JRYB 1J8HA 5E1AA 4AQAA 1T6BX 4AEEA 5I2IA 4PJ8D 4LL9A 3IEAA 2NTFA 4A7GF 4FZ8L 3TVMB 1T5WB 3CZFA 4MJJA 2B20A 4H40A 4WEMB 5I8EB 2W38A 1TQSA 4G8GD 1IAMA 2NY5L 4YHOL 4M4PA 5KJRL 3HZYB 5D7LB 3LX9A 4PS8A 1KXHA 2Y72A 3TN0D 5D7JD 3PFQA 2CUMA 1CTMA 5L2KD 2XZAH 2MKWA 2NXZB 4ODXA 4ANUA 3LAFA 4NO2B 4JE0A 1A7NH 2D7NA 4AEIL 4EI5D 1GYVA 2CO6B 2DMGA 4HKZA 5AVZB 3U0PA 4KI1A 3ZU8A 3VRIB 1NJ9A 1ED3A 1A7OL 2ARJB 5AB2A 1O6VA 1JDAA 3AJ7A 4MMZB 1TJHH 1X5ZA 7CGTA 4P2YA 1DN0A 1EO7A 2WP3T 1P53A 5KYYB 3N3EA 2JB6B 4NZTL 3PABB 3IWUA 3VGHA 3FCSB 4NN7C 3RWHB 5CLZA 4OZFH 3I50L 3BKCH 3TO4C 4G1MA 2DAVA 1TJIL 1GOHA 1LE5A 1S9KC 3B4NA 4TVPH 2DQDH 3L7FB 3ZK0A 5C09E 5F3BA 2H7WA 4WV1C 3ZTJG 1CXKA 2RR3A 1I4FB 2NLJB 3N1PC 2HLAA 5LBSH 2WGXA 3VI3B 3G5WA 4WTWA 5SX4I 2OMZB 2D4DA 3D25A 5E51A 2GIYA 2JLPA 2X3CA 5KYUA 5C92A 3FK3A 4AWJC 1O9WA 3F7YA 1VZIA 3RB5A 3V5DA 4X5LA 4U3XA 4NCDA 3VQLA 4JG0L 1DVFD 2VTFA 1JN6A 4HULB 5DJ8A 5GZND 4W9KC 1X5IA 3QXAB 4M7LL 4X7CC 2PR9A 2XV3A 3FF7A 5EORL 4JO8A 1RERA 3FF8A 4XWOD 4ZTPL 2J4WH 1CGWA 3MV01 3FBKA 4OAWB 1EXUA 2R1WA 1OP5K 4WUUE 1QHQA 3ILQD 4JFFB 2XTLA 4BHUA 3ESUF 5KSBB 4AYSA 1WAAF 5TE4L 1BX2A 4GP5B 2VMEA 2ESVB 2CDFB 3OF6A 5I26A 2NY7H 5IROD 1T7VA 3WHXB 2N1TE 4A68A 4U1JA 4X98A 4JY5L 3X3FL 5JXAH 2VXQL 2QKSA 3WFEL 1KGWA 4OSUL 2JJTC 3OLDA 1D5IH 3HG2A 3KYKL 1R24A 4RX4D 5ID0A 3UAJA 3QUMH 4Q9QL 2AXJA 5AENA 3ZRFC 5KVEH 3O3AB 4JDEB 5F9WC 2YSSA 1D5XA 3KNBB 3VFVA 1V5JA 1NCUA 1QFWH 2Q8AH 4XXWA 1R3KA 2V9TA 3TONA 2X4TA 5TTRA 1A6ZA 4D8PA 1KLGB 1QOKA 5EA0L 4HH8A 1NCWH 3PWLB 5DZ9A 4GT0A 4OF0A 1ZSHA 4NQEA 3ULVH 1KYOJ 4OV5B 4LSPL 3DX9A 5IJDC 2BOBB 4JZJA 4YXKL 2F1EA 3RY6A 2WINA 3KYNA 2R69H 4PGDA 4J6RH 1U3NA 4YHYB 5KBKA 1OCOB 3HE7C 3O8XB 5DHVB 2V5SA 4BKTC 8FABA 1UADC 4W9EC 1KEML 2EYTA 2F19H 4C83A 3WKNA 3TBSB 4KDTA 5LG6A 3P3YA 5DMIH 1ZLDA 4ZFZA 3HG1B 2DJMA 5BS0D 3V4UH 3X13A 1LK3H 1JNNL 1UG9A 3OXRA 1YEHH 4ICWA 4AQ1B 1EDYA 5FYJL 4I3SL 4YHPA 2Q2EB 3VFMB 4HWNA 5EO9A 2A6JA 1UXWA 3DMMC 4X0KA 2WUCH 5IVNA 4QR7A 4ZO6A 2OL3A 4M3KB 3LEXA 4Y5YC 2RCSL 1YJDL 5DHEA 4ZXBA 4FC3E 4Y5YB 2CDGB 4HWBL 5IQMA 3RX5A 2ZICA 3ZE0E 1GGCH 4L9DA 4GBXA 1J9QA 4JGUA 2GK0B 2B1AL 3VD9A 5F1SA 3FN0L 5HI4C 5KVGL 1KCWA 5C0FA 1KULA 3G04B 1HZHL 5TF1H 4HU2A 3WS3A 4Q58C 4DW2H 3MXWH 3TTYA 4NLHA 4MZIA 1YUHB 3NSDA 4HALA 4MAZA 1KGXA 1KJ3L 5GS3A 1NLBL 2IAND 4L1DA 5ALCH 5HDBB 3TJEH 1FNGA 4XZUA 3NFNA 4AQEB 2FO4A 1T1XA 4BDVB 3PV7A 2WCSA 5FF6A 2V2WB 4CVUA 3ZQ9A 5EOQH 1N12A 1NFIB 3RL2B 1IM9A 2FSEA 1W15A 1CLYH 1JCKA 1T03L 2DYPA 2YQGA 5T1DL 5KTEH 3SPVA 1FL6B 4LLMB 4YVUA 1CTNA 4I0PA 1IGJA 4HPYH 1IQDB 1ZV5A 3WFBH 3FTGB 3V4PA 4LSRH 1D7FA 3WFDL 1CD9B 4E9XA 2FSDA 1WV7T 1J1XL 1M6OA 1PAMA 2DQIL 2FNWA 2Q9OA 5KOMC 4W9JC 4QCIB 2DBLL 1EFQA 4N3TA 3TA3C 3KLKA 1B4JH 1RK0B 5I6LA 1JWMB 4Q2ZA 1NCCL 1THCA 3DLQR 2H0PA 5HDLA 4OUOA 2Z92B 3QUXB 4WQOA 1NSNL 2BOCB 1BW8A 1LWRA 2WJ7A 2XXGA 2WBJD 3IGAA 4RFEB 5DJZA 5AWNH 3UMTA 3E8VA 1J1PL 5HHPA 2OMWB 2BNRA 3KJ4B 3X3GH 4YSUA 1QRKA 4YBQC 1YY9D 1LVEA 1UA7A 1TTBA 3QIWC 4XPBH 2R7EB 4ONOA 1J5IA 4P2RE 1EIBA 5E8OA 2HLEB 3H9HB 4NJ9H 4I3GA 4XNXL 1U92A 2DEXX 2WXMA 1KC5H 3MV9B 1NOAA 4DP9X 4XVSL 1F5WA 5J6HA 2D31B 3F12A 4NQCB 1ZDQA 3HNVL 3MBED 5GRUH 4M7KH 1NCDL 2Y2YA 2Y06H 1KMGA 1TCRB 4XTRC 4AM0Q 1FYTE 1E5ZA 3P3SA 2HG5B 2XG4A 1TQCB 5FYLD 3LKRA 4PJIF 1I3VA 4KQ4H 4G7SB 4HUNB 3K6IA 2YZ1A 4JS7A 3VGFA 4KJWC 5TPWH 4GY4A 3B1TA 2BVUA 1E3ZA 3GSWB 4LDEB 3WS6C 2ADIB 5IW6B 4DEWA 1WFTA 1UWFA 4NC1E 4MD4B 1GZPB 2WLLB 3CAFA 1IEHA 4IHBA 3FKUS 4JO4L 4JFEA 4ECNA 1U8IA 4DP0X 1NIFA 1PTZA 1UWEH 1KIUA 4F33B 1KIQB 4NQVA 5CZVH 4XC3H 2WVVA 1YUKB 5BV7C 3PNRB 4M9PA 1B0GA 1U8JA 4H26A 3V6ZB 4L29B 1QSEB 1OD9A 2IDSA 1HEZB 3DIDA 4NAQA 5F70A 1HIML 3S3SA 4L8DB 1XCTB 5KBNC 4N2NA 5F1OB 2IWFA 4MQTB 3M8OH 1QBLL 3K7UA 4ORGB 1KN2H 3V6FA 1AO7B 4F2FA 4LARL 3U82B 4YXHH 5D7IE 4GP4B 3OAYH 1BJ1H 1QFUL 4IEFB 4KX9A 1DANT 1M9WA 4ICXA 5EO1B 4AYID 4DTGH 3LIZA 2IG2L 1CXLA 3J07A 1W8EA 3RGVA 2LU4A 4ZAKA 3I3DA 4BM7A 3STLA 2EUZA 1MLBA 4EQ2A 1VB9A 2A1WH 4FNTA 4LEBA 1S9YA 2NZIA 3UPRB 3QB7C 4OLYH 2IXQA 3BVNB 3GD1C 1NIAA 4XH2B 1SFDA 1NIBA 3ZDXF 1RK1A 1OARH 5HHOA 1F4AA 3KL0A 1WCQA 4LLDA 4HUUB 1N68A 2V33A 3BOVA 4OIIL 5H4YA 1I7UB 5I1CH 5JQHC 4DGVH 4EVNB 5B7MA 1CDYA 4JFDA 3EFFB 5HYJA 1KTLB 5LGJA 3UPCA 4Q6IA 4HLZH 1FLRL 4M3JA 4DSYA 1ASQA 2H2SC 4GG6B 2M1KA 2VDKL 2QQNH 4L1SA 3O6FC 1J7VR 3HE6A 3VH8G 2J8UE 4HIIB 4JANB 1QQDB 5MENB 1M1SA 4ABVA 2HRHA 1XB6A 3IJYA 3JZ7A 4NRYB 4QYOB 4PY8I 1QBML 5LN8A 3VGEA 4P3DA 3ARSA 5DHVH 3RWCB 5EBWB 4OGZA 2QHLA 3FUDA 3AXLA 2BFVL 3L17A 3QZPA 4JO1H 5DJYA 5AUMA 1X7TA 2O6DA 1JNJA 3HPJB 3KPSE 2RGSA 4NUGH 3FRPA 4OZ4A 1EZUA 1R3HB 5C08A 5C07E 3S98A 3AROA 3HCVB 1JHLL 1YEIL 2UXFA 5M94B 3C5JB 4L0YA 5IJKC 2F7QA 3HG0A 3K0YA 4AC2A 1C9SA 2K9FB 4J3UA 3B3IB 2XICA 3LJ3A 4OTXL 5JTWA 5C0BE 3WJMA 3TF4A 1KPVB 2QSCL 4OCXH 2X12A 4NIKB 4C4BA 1KTBA 5EU5B 3ARBC 2JIXA 3L3OB 3MKKA 4MNQB 1AI1H 5BZWA 3FSOA 1X5GA 4FQLH 1LGVA 1KYUA 1ZKAA 5IVXE 4ANWA 3D3VD 3DO4A 4NQUA 2ZOTA 2OMUB 2ICWB 2Z8RA 3BPCA 3FFDB 4H5SB 4A66A 2FIKA 2VLJE 3L1FA 4OQTA 4N0YH 5B39A 5CBEB 3EKCA 2D7TH 3HMXH 3NOIA 3KWUA 2A83B 5J0BA 2XWDA 4JHVA 4O58H 5TE6L 4E42B 4I1PA 1O6SB 6FABL 1DBML 1NZRA 2X4SB 3LY6A 1J18A 2IBGA 3QDJB 1ZVSA 3WDJA 1AP2B 1SQ2N 3LRLA 3Q01A 4XCCL 1JRHL 2P8LB 2BHYA 3NFPB 2FQGA 2BY3A 3GEFA 3VGAB 5LBGA 3NZ8B 5FUOH 3W82A 1U8PA 4Y4FA 4F5CA 1V27A 2EH7H 4L4VA 4YDVA 1MCWM 2WUBH 4P46B 4K8RC 3RTQA 3H2PA 2FJSA 2X38A 1M05B 1BVOA 1WZAA 2IPUG 4F3FA 3S0PA 2WWOA 2VSDA 4CN6A 5I5JA 2W88A 4GW5A 1H3UA 2VXUH 5D1QE 3SKOA 1ZLUH 4YEFA 3PWJB 3JWOL 3FQ4A 3T4AB 3VE0A 5L2JB 5AEAA 1UCTA 3V6BR 3VXTB 3VD0A 2ZUWA 5JYMA 3G5VB 5E8NA 4UB0H 3KLQA 3VDBA 1FCCA 3T0BA 5I17A 2VM9A 3L7EB 4RMQA 1J1OH 1RVFH 3AUWB 4W93A 4KY2A 3U36A 1KTDB 2WN3A 2IC2A 3F8UB 3QG7L 5DQJA 2WQWA 5IM7B 3ZT7A 1OK8A 5CJQH 4HMDA 3ORJA 3K0WA 2AXFA 4JW3A 1MW1A 4WVRA 5FYKE 1ZLWH 4GAJL 2B5IC 2J88H 1QNZH 4N68A 4O2CB 4C54A 3QA3A 1JI2A 4PSRA 4DESA 3QXTA 1RCYA 3GDBA 4H4NA 4KVCL 4YVNA 1IGYB 3SY0B 1P7KB 2DBJA 3PGDB 2RHEA 3K72B 5SX5H 2R2HA 3QCVH 3WAKA 4DNLA 4NM4L 4G8EB 2UY6B 1BMWA 1Z2KA 2GSGB 5FM8A 4R4NC 2QADC 2Y7QB 2AKRB 1D2OA 4X9YA 2PWEA 5EBMB 3VJ6B 4HJTA 4YBLB 1IGCH 1SHWA 3K2MC 2FB4L 1CXIA 5GZOA 5I8CA 1P2CA 4FZ8H 2PTUA 4KO6A 3KLHC 4QRPD 1F00I 2PXYD 5DYOB 1L0PA 3AU1A 1NC2B 4A7TA 2OR9L 3EHBD 4YHOH 5HXMA 3N42F 4QXGL 4X4KA 4GS7C 3UC0L 4HX1A 4ZUSB 2YN3A 3BPOB 3MI6A 4Z0XB 3MNVA 1MRFH 4GS7B 3SDAC 3WKYA 4N85A 2AFNA 2HMID 4NCC1 1QW9A 3U0WH 4X5WB 2YJQA 4IOFC 1XIWC 3GKZA 1A0QL 4TRPL 4NZDA 4PJ9B 4AGOA 2WXIA 3M88A 1A7QL 1P1VA 4BFIB 5C09B 3QQ4A 1PIFA 3GHBL 3OMIB 1I8UA 2EYSB 3GXMA 4MA8L 5H4ZA 4OCLC 4NUJB 5T3ZD 4NHUB 4F80A 4KZDH 2GI0A 4WFHD 3TOPA 4GQ9L 5H37G 1UZ6E 1JF6A 3O2DH 3T2NL 2FJUB 3LMJH 3PV6A 4OQ1A 1KLUA 4CVZB 2DWEA 4H13C 4K3HA 3D0LA 3N43B 4G8FA 2EDOA 5CD5C 3DVGA 3MFGB 3EJRA 3FQTB 1SFHA 3GSVA 3SIKA 4DP1X 4RZCA 2W60B 1GYCA 4P9ML 3LRMA 4X5XB 4XBPA 2AEIT 5DC0A 1QTPA 2RQEA 4OD3L 2UZPA 3HI6L 4YL4A 1KIRB 3RAJL 1Z5LB 1BQSA 4G9DB 2A6IB 4M1GH 3I6GA 3QISA 5I19H 1CO1A 2OTUB 3NDYE 2O5YL 1N0LB 5B38B 4U0RC 5IW1B 2ZTBA 5GGUA 2E4FA 4TN9A 2Q3XA 4WUUB 5IF0B 1IJ9A 1FL5B 2M8XA 2O26U 4F1ZA 4P4KD 4POZD 4ZDHA 4JG0H 5JQ6H 4GO6B 2K4AA 1TO4A 1DVZA 2DIJA 4M7LH 4BZYA 5F9JA 1HH6A 4RH4A 5EORH 5FKAA 4LCCA 1KPRB 1DDHB 3ISRA 4ZTPH 1I1AA 1NGWA 1NGZB 5DEFA 5CM1A 1HOCB 3FU9A 4B9JA 4CNIB 2A4CA 1NBQA 1UT1A 4CA4A 1OAXH 2M83A 4L5FH 4ZFOA 4NS0A 3ARUA 3MODL 4APQD 5KJ7E 4F24A 3C75A 5IKCA 3FHQA 1F56A 1PKQE 1CXHA 1X7SA 4NYLB 4UIMB 2F74A 5DQ9B 1N5YL 4HZAA 1T0MA 3IAGC 4J8RA 4Y5XA 3H1ZA 4OSUH 4M1CD 1OTTC 1E50A 3NG5A 3OKOB 2Z4QA 4XCYB 2B7DT 5EULV 3B5GA 1G5AA 1XCQB 5FUCC 4IGBB 4D2NA 2EUWA 2C7UB