1RL1A

Solution structure of human sgt1 cs domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
b'SKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor of G2 allele of SKP1 homolog
molecule tags Protein degradation
source organism Homo sapiens
publication title Human Sgt1 Binds HSP90 through the CHORD-Sgt1 Domain and Not the Tetratricopeptide Repeat Domain
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1rl1A00
2O30A 2N0KA 2KMWA 3J07A 2CG9X 5DS1A 3N3EA 4ZJ9A 2WJ5A 1X5MA 2KLRA 3Q9QA 4JUSA 3GT6A 2MNWA 4M5TA 4PCKA 3AABA 3VQLA 3QORB 5LUMA 3QORA 3GLAA 1GMEA 2XCMC 3L1GA 3VQMA 1SHSA 2Y1YA 3EUDA 3IGFA 4PBDA 4YLCA 1WFIA 3Q9PA 5DS2A 4YE0A 2K8QA 4ELDA 3QORC 4FEIA 4YL9A 3W1ZA 2BOLA 4YLBA 2RH0A 3L1EA 4I88A 3GUFA 1WGVA 2JKIS 3L1FA 2Y1ZA 1WH0A 2N3JA 2WJ7A 3QORD 4JUTA 2CR0A 2Y22A 3AACA 4MJHA 4RZKA 1RL1A 4YDZA 4M5SA 1EJFA
chains in the Genus database with same CATH superfamily
4N90E 2AJZA 4NKMB 1Q72L 4IBVA 1KBGL 1Q9KB 3EO1B 3G9AB 4M6AA 4AVKA 4WFFE 1JGDA 1HILA 3B9KD 1DUYA 1YNLH 5D1QC 3V2AR 2BNRD 4MD5B 2V7NA 3W9EB 3Q43A 4LZKA 3HA0A 3UMNA 4XB7A 5LBSL 1NBVL 1LP9B 4GP4B 1U8CB 1OANA 4NGHH 5DD5L 1JZJA 1A6VL 5C0GA 4A2MA 2PKDA 1MHHB 5I18H 2YSSA 2CHXA 5FYKL 5TE6H 4LVOB 3GRBA 1OT1A 3I6LD 2YAPA 1H3WM 4HUCA 3CBKB 2WZ5A 2HFGH 4E9SA 2F74A 2QHRL 2Z3FA 3VW3L 3PNWB 4EN3A 1A6UH 3RDTA 2H8PA 2BOCB 4GAGL 3UO1L 4HJJH 5C2BL 2KDGA 1GOHA 2DMGA 2E56A 3ESOA 5DZVA 2GJZA 1JPGB 3LKQB 5AVVB 2DIEA 5DZNA 2HA1A 2H1XA 3EDDA 4QI3A 4UMSA 1MPAL 1ILUA 2ZAGA 3EH2A 4JO4L 2W0KA 3E6HA 4NKIL 2YAMA 3CDFA 2A6DB 4QYAA 3BVVA 4RFOH 3UPRB 2R0ZH 2DQGL 3MGTB 2C9UA 4AGPA 1AQMA 1J0KA 4H13C 4NP4L 5E7FA 2X5PA 3S88L 2PP9A 5K5YA 3F85A 3CE1A 1F2QA 1MIEL 3BKJL 4OCNC 4ZSOB 3SE9H 4JS7A 3GFUA 4M6NL 1FQ9C 2VLKD 1KPRB 5B1CA 1X5GA 2AXFB 1IM3A 1IC4H 4UBDC 4D8PA 3OR7B 5FIEA 4HBCL 4HXAH 4KI5F 3RWDB 2Z31D 4LNRB 4YHKL 1IC0A 4L9DA 3GHBL 1DO5A 4A7QA 3ZVVA 2NCMA 4KKLD 2OTPA 4WDIB 4JFQA 5MENA 4OGZA 3IXAB 5DQJB 5K9KB 1C8PA 3KPSA 5CD3A 3BP7A 1XZ0B 1GC1C 1DQVA 2F5AL 3G5VB 4JO1L 4WJ5A 4JFFD 5ES4B 1LNUA 1XF4B 4G59C 1O5PA 1BJMA 2YUXA 1JI1A 3JTBA 3GSWA 2WAHA 3BP7B 1PD0A 2BSCA 3KL3A 4DKFL 2J3SA 1UG9A 2DL2A 3RWHA 1N0XL 2OCJA 4JJOA 4PCYA 1XGTB 4X7DC 3SYPA 3BDYL 1SYVB 1D6VL 4FE9A 3FF7A 1BEXA 2P7TA 2Y4SA 3ARBA 3LCYA 5SWZE 4YXKL 4ZFQA 4AGMA 4EDWL 2CMRL 3AGVA 1R47A 2QDWA 3UJJL 5ID0A 2E4FA 3ECWA 1NFIB 2FQDA 2Q5BA 3B8YA 1KZYA 5F9WB 3QUMB 3VGFA 4G82A 3MPCA 5DA4A 3GJFA 2ATPA 1THAA 2HRGA 1ACXA 4AX3A 1SVCP 2YN5A 1IFRA 1HFUA 3D0LB 3VU1A 4U2ZA 3BJLA 5D7IB 1IIKA 1MUJB 1XR8B 4DVRL 2E0PA 4KKRA 3MXVL 3OGOE 4FS0A 5GSRA 1Q0YH 3BFOA 4J3VA 5GISL 3GJFB 4ZTOL 4CNIA 2P8LB 4TVPD 1MCSA 2Z7WA 3GM8A 1WIOA 1R5WA 4PTTB 4N9OB 1UFGA 2YO3A 1I3UA 3QDMD 3WEXB 4V1DA 1OHZA 1QRND 2OL3A 4UQCA 3RNQB 2KQNA 1EEYB 4F15C 3D9AL 4CNIB 4E5XG 3NPSB 3NFSH 4PJIB 1KBPA 1PZDA 2NUTA 2XYBA 2NY4C 2VLRA 3TNNA 4NQDB 1EX0A 2OA9A 1B90A 2WZ0A 2HUHA 1E67A 2BCKA 3MLTA 3QDGA 3TBYA 4BBWA 1A4JB 1HHJB 1JPFA 4HUNB 4AITA 2YUWA 3AACA 3OMZA 5HHOB 2HJKB 3ROLB 1D7FA 4L4TA 2HX8A 1AFVH 2AERT 2JELH 4NPYA 4QLWA 1E3FA 3UC2A 5D1QA 1YEKH 5C7ZA 5DJXB 1UCTA 2XA8L 3N6YA 4BA0A 3U9PL 5FPIA 4ZI8A 4IRZL 4IOSA 4ACTA 3LN4B 4G6MH 3RPIB 3UG4A 5AYQA 2V5YA 3R4RA 4M3HA 1LWRA 1M2VA 4UINL 2WYHA 4A1RA 5IQ9B 3LJ3A 3TJHC 4E36A 4UM9A 1KFGA 3U6XA 4NKDA 4FABL 4IBYA 4LKCA 2X41A 1DE4B 5FOJA 5AKSA 3RHWK 4JPIA 2CGRL 5AVYB 5E4OA 4Z77A 3CZFB 5IBUG 4GIAA 1FC1A 1F5WA 4FQJL 4AYFA 5L7XL 4MHHG 3B5HA 4S1QH 4YBLC 1ZV2A 4Z3HA 2E3VA 4ZZFA 1K5NB 4HZAA 3S98A 3ARFB 3O6LH 4KVPA 5CIPA 4HWUA 2I85A 3RTQC 3VSVA 3MBEB 1KBGH 3K1DA 4W9EC 1KB5A 3LH8A 3WHE1 4U1GB 3REWB 3QULB 4BD4A 1RUAH 4HLZH 1S5IL 3LB6C 2YPLA 4N1HB 1OK8A 2DEXX 3KLHD 4F7EA 4NRXB 1H6EA 2LVCA 2QPEB 4FLHA 3ZR5A 2VNCA 4C47A 1S7RA 2IAMA 2VMFA 5D93B 2GB2A 1JIBA 3AWFA 3W5NA 1SLXA 5F7EL 1N3NB 2ILLA 3PWJA 3S5LG 1JZ4A 4I18B 5GGQL 3A0OA 3MU3A 4NI3A 4NSKB 4ZQKA 1KELL 3BIBX 1KB3A 1CFQA 5CS7A 1UD2A 5AZEH 2WM0A 4FOMA 3HE7A 2C7UB 3STLB 3H85A 3I9GH 1HHGA 1EXHA 4JN2B 3L4UA 4XPBL 3N06B 4WI5A 2WD0A 3NH7L 1M4KA 2QR0A 4L37B 2NX5D 3QWOA 4ZFZB 1R24A 3LYRA 3K2KA 5LAPA 3S5YA 5IB3A 2H8PB 4WEEA 4AQ1C 1J0JA 5J7CC 4FXKB 2YGVA 1F02I 5EIVA 4N8CH 2Y36L 1ZANL 3MRPB 3QARA 3MRCB 3UJTL 5CEXB 2HKHH 5IVZB 4FP8H 1QHOA 4A6YH 2GY5A 1KIQB 1GRWA 4NHUA 3SY0B 2Z35B 3QP3A 1P4LA 1A7NL 1LP9A 2N0MA 3U82B 2X70B 5F1IA 2WWNA 2UVFA 1ANUA 1FP5A 1RZ8A 2X1QA 4IMLB 4QRBA 5K59F 3GBDA 3E6HB 5C0DB 2MQ3A 4OFVA 5DC2A 3GLDA 3UZVB 2ZCZA 1A4KB 1CL7I 2Q76B 1OARL 2JI3A 5BVJB 2D7PA 4F3FB 2XI9A 3L5IA 1YLBB 4XVSH 3HZVA 4YR6B 3T77B 3OAYH 3O2DL 4K71C 3C5ZB 4M7ZC 3UOAB 3ZHNA 4DGWC 2GT9B 5GJTL 2PTUA 5GSVA 3S3PA 3BSZA 2IBZX 3U9UB 4CILA 1DLHB 3CFCL 3H2WA 4G5ZL 3GZKA 4XBPB 3FFCD 4TUKL 3T6XA 1QKZL 1INEH 2BNRA 1AZVA 2E7DA 4Q14A 4NC0B 1EERB 4APQD 4IK7A 2H3NB 4G6KL 4FFYA 2XTJB 2B15A 1OP3H 3RAJH 3IRPX 2D0FA 2FAUA 4D2NA 2OULB 3EOAA 2EUVA 1ZIBA 2C1PA 3HE6B 4JM2C 4UIKL 4CW1B 1U95B 2EXSA 3TBVA 1ZXQA 1A1MB 4L1TA 4P5SA 3ZK0A 3OHXC 2PN5A 5DA0B 3O9WC 4HWBL 2BNRB 5DF0A 2R0LL 4O2FB 3IETB 4MJ6A 1TZIB 3GMLA 1JK9A 2X9YA 4F7TB 3EF7A 1REIA 5ISZB 3ZMNA 5KYYB 4JFEA 3QDGE 3RYMA 4R84A 4GFTB 3IJ8A 4ZMLA 1IKFL 2ED9A 4MXWL 5T5FH 4BUQA 3DIFB 1JCVA 1XXFC 4U31A 4MXWH 1RUMH 1SN5A 3KVPA 3ZGHA 2HCZX 2YJLA 3OKMA 4HJGA 1Y07A 2EACA 3X13A 4L9LA 1WBYB 1WHPA 5F0LB 2BY2A 3DV4A 1SN0A 3P2DA 1TVHB 1EEQA 1WZKA 3E3QE 5HJGA 3S96B 1INDL 2YC1B 1W2KT 1E8ZA 3GSOA 3MACL 4P49A 1MAMH 1VEMA 4M1CD 3U0TA 2XTJD 1KEGL 2W9EH 4POZD 3DX9A 4JPSA 2JTDA 4M3KB 3X13B 3MJ6A 3V79C 1R5VA 3PHOA 4K23L 5CO1A 3QDMB 4M8UA 3T04D 5KSBE 2CO7B 3TL5A 4U1GC 1UVQA 3L17A 3QWNA 3PIQA 4BA8A 1TETL 1GGBL 4H0HB 3ZGIA 2VL5B 3AMLA 3C6EA 3ZIMA 1WZLA 2IVFC 1M3JA 4NKIH 4P9HC 1XGTA 1HI6B 1RJLB 1Z6JT 4HF5H 1ZDQA 4LT7A 5HYJE 1P9MC 1DDTA 3FU6A 3TASA 2DQGH 5HD8D 2VZVA 4OLUL 2K3TA 2VLKB 4HGMA 3AU1B 3IN0A 4KXCA 3DV6B 4Z7OB 3ERXA 3WNIA 1FV1B 3ZE1E 4FLSA 3SPJA 5DYOA 5E08L 3UYPA 2FGWH 4KMTH 1AGBB 4IRZH 3RVXC 5EF2A 3KW8A 5E6UB 3I6GA 4RBPH 2VLLB 1FNFA 2Z65C 4ZAKB 5BNXD 1NAKL 2V2XA 4ISVB 5I1CL 3I9PA 1FV1A 2JCCF 4Y8AA 2BCKB 3MLTB 5CZXD 4EXKA 3JWDC 1AMYA 1F1GA 4IKJA 3BQUD 1QZ1A 2W0PA 3VGBA 3I9AA 1IGJB 3V10A 2LU5A 3D39D 1LO3H 1QG3A 3RIAK 1JK8A 2AEQL 2PW2B 2YEZB 1HEJC 4E9TA 1J1XH 3UAJA 3WGVB 4X99B 2HH0H 4EKJA 3WNPA 1WAEA 2HN7B 2O5XL 4BZ2L 1JMXA 2XN1A 3S34H 4IRSC 4J7RA 4WHDA 1M2VB 5IQ9A 4AY0A 3MACH 1GW0A 3BZEA 1EEZA 2ZOLB 3V4PL 2ZG3A 4ABWA 3IDUA 4X7SL 1F42A 1XB6A 2BXYA 5TF1H 4XN1A 4JM2A 3FQUA 1YAZA 4NWUL 3DX8B 4FGMA 2CLRA 2OP4L 3RX9A 2JLLA 5DFVC 4N68A 1JYVA 3DBSA 4Z0BL 3BDXA 4GAFB 2R27A 2P8MA 1DYZA 3QNXA 4WW1B 4BKSC 5K9OB 3S4SG 4F7MB 5TDOA 2EXYC 2FT8A 4L1HA 4AK2A 4BH8B 1AR1D 5EORL 2K1MA 5CCJA 4U3HA 5KZCB 2HXAA 2ESVE 4H20H 4Y4HB 1DVUA 3FKUS 1B4JL 1XCTB 1IGIH 4ZT1A 1IQDB 1QI3A 3AROA 3NRPA 4N2AA 2P5EB 3IMRA 4OKVA 5FGCE 3HRPA 4FULA 3H0TB 2AV1A 4OF8A 5IROC 1LVEA 3ZLQC 2VLME 4UDUB 1X4XA 2FIRT 2A9ML 1CVSC 1UZ6F 4UM9D 3TVMB 1IE4A 5LGKA 4NGHL 3RL2B 5DRZB 4F7PB 4FMFA 3Q5TA 3CTTA 4QOKD 1JGLL 3N1GC 4S1DC 4QRFA 4G9FB 4XMWA 3WTSA 5FHBL 3MKGA 3H3PH 3CHQA 1LO0H 3QJFA 4AYBA 4HJJL 2YSSB 3U1QA 4U3SA 3D12B 4TRPL 1TNNA 2EC9T 4N0RA 4S0SD 5I6OA 3FQ2A 3QRLA 5GRXG 2DD8H 1CDHA 1ZD6A 2HLFD 1JV2A 1QWUA 1TQBC 4GAJH 2XVGA 3C6LD 5FO7B 4LLVA 1SYSA 3RVWC 3GC3A 1FG9C 4L8BA 1PG7X 1YEFL 2DS4A 4PG2C 5JIHA 4BWUA 5KVFH 1AKPA 3TN0C 5KVFL 1AQHA 3QUMH 2BSBA 3QEQA 2DYPD 4PFEA 5HDBB 5E6IA 4P06A 3WD5L 4EI5A 4LVHC 3IAQA 3LKQA 1NTDA 5IVXF 3MUGA 3HPJB 2EH7H 1NFKA 2QVFB 2VZTA 4W6XB 3MRKA 4J1UA 2TRHA 4ONGL 4U1SB 2GITA 3NSDA 3UAJC 3ZZSA 2X6VA 5FF6B 8PAZA 4U1LB 5HDQL 5LNDA 5HTSA 2X4OB 1OAQL 3TBTA 4WWKC 4KH2A 4UU9A 2UVEA 1FGVL 1QTSA 1JERA 1EDHA 3E9UA 5JW4N 4E0RB 3T0EB 3DK2A 2VZ1A 5EUKA 1KPVA 1SVZA 1WTLA 4PPTA 3U4KA 2ZCHH 3U0PA 1HCFX 3KS0J 4LSTL 4AIZB 5ACZA 4KTDH 4K7PL 3U1SH 5D9SA 5ISZE 4ZPTA 3SBQA 2BRQA 3DX7A 4QRPE 1BHGA 3BUYB 1UOLA 2UX7A 4S10A 1EV2E 3SKJH 1JPGA 4IM8A 4N0FB 3H3PL 4UDTB 1IM9D 4KKCC 4L3CA 5L2KA 4KJWC 3TBSA 3WKNA 5HYQB 4FXGC 1T4KB 1N6UA 1OT4A 1T21A 1UADC 4JFFA 2BK8A 5L8LB 4GAJL 1OCWH 1YYLH 3PP4L 1S7SA 1YSOA 4EE2A 2ZX7A 1TENA 4D3CL 2Y3NA 1GMIA 2H47C 4Q2ZB 3K6SA 1KENL 3QA3B 4XP4L 2VDLL 4J8RA 1SY6H 3GO1H 2XFGB 3QPXL 2A0LC 2XPGB 2DAVA 2YN3A 1S7SB 5A6MA 1BPLB 4ZK8A 5I75C 1MCHA 1S7XA 4A55A 1Z32X 5C0AE 3RWGA 3UAJD 1SDDB 4N2CA 4N0YH 1LO5B 1HZHH 2RAMA 2BY1A 3DOSA 1A9EA 2CCLA 2W80C 1EAPB 4J3UA 1MJ8L 2GBAA 4TQ8A 5JQ6L 1JFQL 2Y5QA 3OJMB 3O9WA 2PCYA 4KHTL 2A1WL 4M8RA 3LH2L 3L5XL 3OAZK 3GSWB 4LSDA 3Q2NA 1NCCL 1JXJA 3EOBA 5T1DL 5I17A 3ET9F 4XVSL 2J20A 2XETA 1UZGA 3RPKA 3RVTC 3RFZA 3H4HA 1J8HB 2ENSA 5SWZB 1T04B 4TULL 4L8SA 4TNVK 2F61A 1I8AA 2DRUA 3NQIA 4Y16A 5D4HA 1WZAA 3QI9D 2VDNH 1UWXH 3FHAA 5KSVB 4NWTL 3QXWA 1NPUA 3OPZH 4NQXB 4CU7A 1CLYH 4C56D 1ZT1A 5DO2D 5E6SB 2W91A 3RAJL 5ID0B 4RH4A 2AJ3A 3D06A 2VUOA 3G3LA 4PJEB 4HUUB 3SHSA 4ZW7A 4L4VD 4LDOB 5TGBA 2VDRL 3SSGA 4MDIB 1SJEA 5KBNC 4W81A 1WFIA 4PJ9B 3KDMA 4LPYA 4Y19A 5CGYC 2IPTH 3SE3A 1P84K 5L6YH 4PJBF 3TJHD 1U6AL 5F9OH 3GHEH 1CXLA 4WWKA 2QSCH 4NHCH 1JCKA 3RVTD 4EAEA 4HKXB 2PTVA 2GSMB 5H35B 3R1GH 1KT2A 2AHIA 5DEJA 3ZSTA 2FX9L 1EFQA 2EEBA 1T1ZB 3DJ9A 1QO3B 2O5XH 2R2CA 4WO4B 2C3WA 4F37F 2V9UA 4PJGB 2UUDH 4G1MB 2XVLA 1NEUA 3N1QC 1NSNH 3B2VL 5DHVH 4F9PA 1RKRA 1YNTB 3E0GA 3JQOB 5MEPB 3VG9C 3JV5A 5EOCH 1MFAL 3WY4A 4WU7A 3K91A 4QNPE 2XV0A 1ZEAH 2Y5EA 1AGEA 2G5RA 3QEHB 4R96A 4FD0A 2A1WH 2DLFL 4P5KB 2P8MB 2N01B 4OFQA 4PJ8B 2P5WA 5C3IA 2ADGA 1Y18B 1ZY9A 2NTFB 4A7GF 1NOLA 5LWYH 4JO2H 4JKKA 4MZ2A 4Y1AD 1IEHA 3UJIL 1R3LA 2ZUUA 2XT1B 3NPZB 1UXWA 1OWRM 3VH8G 5GS0D 2RCSH 2BIOA 2QPDB 2Y2YA 4LRIC 4P48A 3QUYC 3K8MA 3QIBB 4GLRI 3D2UA 4QRQB 4P2CG 1FC2D 3ZDYF 1S9YA 1RQ5A 1T2JA 3KH3A 4J3OH 4NWTH 4QXUH 1G7IB 3FSOA 1XGQB 4UV4H 4NC1E 2CLRB 4UV4L 3VFOA 4FHBD 4GPVA 4OCYL 5FO8B 3B2MA 1SOSA 4H5SB 3Q6GH 3PXJA 3P3TA 3U9UA 1VRSA 3JUZA 3HC2A 4AL8H 1CBVL 4YQXH 4NQUA 2X44D 2V33A 4R4NC 1AHWA 1FDLH 4AYGA 2NZIA 4OZIE 1MY5A 1YYMH 1GHFL 4K8RD 3CZFA 2QSQA 4A7VA 4XXWC 3S8GB 4M5SA 3SDCD 3VX0A 5F1NA 4HOWA 3HZYB 5K9JH 1YPZB 3HHRB 1J0HA 4YSAA 2A6KA 4D8PB 1XD1A 4X6CE 5FUZL 5I1GL 5J6HA 1RHHA 2RMNA 3IDNA 2KHAA 3VFRB 4MJ6B 1DL7L 1TZIA 4Y8DC 5F21B 3PWUB 4HUKB 4MDJB 4WU5A 3BHBA 3R1GL 3ATFA 3Q8FA 2CLZA 1IEBA 1KYUA 1YPZE 1IC5H 3S6CA 3WN5C 5IVOA 3D09A 1MCRA 3CHRA 1A7NH 4ZFZA 3SYOA 2EDYA 2Q3ZA 3IDJA 3RBGA 4L8BB 4QJ3B 5D6CA 1S8DB 5B1KA 4OLYL 2V5MA 1D5BB 2VIRB 1CDIA 5E03A 1WBYA 3UIZA 2RIKA 3VD7A 1CLCA 1QLRB 5D1XE 1G94A 5D7JC 5LCVA 2QLVB 1KJ2B 3JZYA 3LKRA 4HC1H 4P46C 3LMJH 1U2YA 4L3EE 2GPZA 4XPGL 4M6ML 1FLRL 3CDZB 2W9DH 2XQBH 3MYZA 1KNOA 2OP4H 3VJ6A 3L8QA 5HHME 3SODB 2V9TA 1F4YH 5CBEB 2X12A 3RWCB 4ZQKB 2ZXQA 3PHOB 3GD1C 1X5ZA 1TNMA 1E4JA 4RGOH 3HMWH 5FA4B 4C57C 1TQCC 1UVQB 2O6CA 1B3JA 1WBZB 3KYNB 3NIGE 4NI6A 4RGOL 5CJ5A 3FC8A 4XTRD 1YJDL 4W9IC 1GGCH 1KELH 1H6FA 1Q90A 5HSFA 2ZTBA 2J6EA 2KLRA 4AK1A 4D0BB 1AXSA 2ZX5A 5KAQF 1J8SA 3QWOB 2ZOKB 3UPAA 1C16A 4D3CH 3MREA 4NO0A 4PU2A 4QHMA 4Q52A 4ZDHA 2C8NA 1U8NB 2XICA 4QLRA 2GITB 4KUCF 1KG0B 3GYRA 5D7KD 5C0CD 4D9QD 2ZXAA 2ATKB 3GGWB 5C1MB 4OV5B 1GH7A 3Q01A 4K73A 4WZ9A 4PSPA 43CAA 1KXVA 1VJSA 3SCMD 2ZSVB 4B41A 4MMXB 3VXMB 3ARGB 4PJFA 4X0NA 1NC2B 4FP8L 4XE0A 1YEEH 1RVFH 3L3IB 1WO2A 4FI8A 1EPFA 5JPNA 2F2HA 3GEFA 1WLHA 5E2VH 2FEEI 4MAUH 1NCBH 5KSAD 3EFDH 3SE3C 4NQDA 5I5JA 1GMEA 4F8NA 5ITFB 4BFIA 4IRJA 4WQOA 4BSJA 1Q94B 4LXFA 5CJXA 1H6UA 3DRQB 1P1ZB 1NZRA 3PP4H 3P0VL 1JZHA 1DHKA 4YO0B 5E2JA 4S1SH 5E4IA 2IH3A 5L8JB 2X38A 5C97A 2HTKC 4WWNA 4G8EB 3LIZL 5FOBB 4LCUA 3LQAC 1CD1B 1NMAL 2UYLA 1A6ZA 3BDBA 4OCXL 2BSRA 2IC2A 3OMNB 2J1KA 2QQLH 4LL9A 3B8SA 4CVZB 1FNEA 1SJHA 2QQNL 2VAAB 3PQYD 3U48A 4FG4A 1RFDL 3O45A 5KVGE 2I5YL 2UXTA 4C59B 4TLSA 5AVZB 3LKPA 3UTSE 1J05B 4G9FE 4F7CA 2ZX8A 3KBEA 2E7CA 1NC4B 4AYFB 3OXRA 2P49B 5EBWB 1PDKA 1F4WL 4Z7WA 4IRSB 1WWCA 4AYEC 3DIFA 2A73B 3S3SA 1CGXA 2UZYA 4HA1A 2B14A 4M48H 5L6YL 4AYSA 2C9PA 2K7QA 1LILA 5JUEH 1MCDA 1CF8H 3DJSA 1E90A 3MFGB 4HJTA 5AZ2L 2YS4A 1UA6H 4HV8A 4U1IA 1IEAA 4PB9H 4PWEA 1OB0A 4U0RC 5FWRA 3TBBA 4UAOB 3DOSB 1R3KA 2PTTA 2V3EA 3A4AA 1EZLA 1XAKA 2ADFH 2YPLB 1WWBX 3MUHL 2DWYA 2Y06H 4WWPA 3K71B 2A7BA 3MLYH 3HBZA 4Y9BA 3MRQA 2FUTA 1DVFD 3OKEB 2X2IA 3RJQB 5IEKB 4X4XB 3VFUB 3NDZE 3L7FB 1YQVH 4ZMNA 1VENA 2QHRH 3N9GL 1K6QL 3BI9X 1P4IL 3KMDA 2ICWJ 2OSXA 4CSTA 2FJFB 4WWKB 1SXNA 3QDGB 3TBYB 4KUZH 2WZPD 5FX3A 2ADIB 1AY1H 1PMYA 4U05A 4XXDA 4N8VB 3PAVA 2R4RL 5IZ7A 3LVTA 2O6FA 3WELA 4A37A 1C12A 4ZMXA 5T3ZD 2Q20A 3ARWA 4PJ7E 4EIZC 3Q2WA 3B9EA 1EFXB 4XN7A 2VXTL 3OAUH 5BS0A 2EXYD 4KQ4H 4XX5A 1HNYA 3QT2A 3AXIA 2WHVA 4L8SC 3S5ZA 5I8CB 2BHZA 5AB1A 5J6SA 5C3LD 4AEHL 1T5XB 2V2XB 2V5TA 5E8PA 1RIVL 4C4KT 4D7BA 1OP9A 3FJTA 2X4TB 5DK2B 5I8KL 3L3JA 1DQQB 4XNQB 5SX5H 2YIHA 2AEOA 4YXHH 3NIDF 1RI8A 2ZKXA 4FXKA 5JOFB 1AIFA 5JQ6H 3SD2A 4N90D 4JR9L 3WDIA 4Z76A 2DLFH 1IX2A 1G6RA 2P80A 2SEBA 5GHWL 1DEDA 1PS3A 4AYMC 1U91A 2HLAB 3CU1A 3NFPA 4WEBL 4WNJA 3L9RA 3HC4L 5FDWB 2NUPB 5C07D 5J12C 1MI5D 1WAAF 4ZS7L 1E40A 1I1CA 1JGLH 3G04A 3TA3C 4C56B 4YHML 3QEHA 1UWYA 3P9WB 4XNXH 4NNYB 1EFXD 1NM4A 1Z66A 4QXUL 5D2NC 5GPRA 1KN4L 1M1XA 2XXFA 1RJZB 1I7ZA 5DJ6B 2F9BT 3QWQB 3O2DA 2YXWA 4U3CA 4HWEL 2AABL 1UM4L 2GK0A 1E5BA 3OJDB 3EJUA 4RMRA 3RILA 4KVNL 2B9AA 2LFEA 3AXLA 4K23H 1S5HB 5AOLA 1I9RL 5C6TL 3BUIA 1K8DB 2Q9OA 4B95C 4F2FA 1AZCA 1FVEB 1HOCB 1SUJA 3KCWA 4MCMA 2R9HC 5HP5A 1FO0B 1UH2A 1GPOH 1EH9A 2ZKMX 4FNPA 5LN4A 5SWQB 1I4FA 3QWRA 2OMYB 4FTVE 4N8UA 2MMXA 2X4NB 1BFSA 1QR1B 4P05A 3O3BB 5JO5B 4K4KA 4LCCC 1YJDH 5KYYA 3I85A 4HIEB 3HUJB 5JDSB 1BZOA 5I0XA 3L4VA 2PWGA 2CHNA 4KKLC 3TEZA 3WFEH 4H0IA 1N68A 2X4NA 3IGAB 3DUSA 3HG3A 1WCBA 5JW5B 5EEUA 2RH0A 2Q2LA 5GS0H 4NJAH 6PCYA 5C86A 3LZNA 4P5TC 4JN1L 1I7TB 1T20A 4GKZA 5IMMA 2ZPKL 3CDGB 2KL6A 3MGOA 2MTAA 1XWVA 2AAAA 2JIXD 3DX6A 3UTOA 4LBEA 2BVPA 3S3BB 1FSKB 2EC9U 4U7SA 3PF2A 1UKQA 1EEYA 2VRAA 2Q2EB 3QFJD 4XWOD 3BAIA 4K2UL 4L3FA 3Q0HA 5J9PB 1PQZB 4P59L 5I1EH 5I66A 5A3IC 1QA9B 2WXKA 2O5ZH 1I1FA 4JFXB 2AABH 2Y23A 4KTGA 4QHMB 1XF3A 4LPXA 4QR7A 3ULSB 2HX9A 5KSVA 1TJIL 2EQDA 3BPCB 4PY8J 5EFIB 2IOIA 4E41B 3ULVF 3F7YA 1MRDH 1RZFH 1GHFH 1DQDL 1CICA 3IXTA 4Z5RA 3O8XA 3UTZB 3KLSA 3L6FB 4S0HA 2CKNA 4IIZA 3C8DA 5ERWA 1O75A 4UV7L 3RKPA 2D9CA 5AYUH 4UV7H 1XH3B 4A38A 2B2XH 3K6OA 1IKNC 1O5DT 1SY6L 1EO8L 1NWPA 3TC9A 3RTQA 4EO5A 2B16A 4N8CL 1GC1H 1MCOH 1QX1A 1Q0YL 2DQJL 4B50A 1PKQB 2CO6B 1MREH 5DQJA 5K9KA 3O6LL 1E4KC 2YEVB 3TA3A 1ZWIB 3DRQA 5I1HH 1JK8B 5B3SB 4NZRH 4TOYH 1QI4A 1V3MA 1KCUL 1OAYH 5EU7C 5A6LA 4P57B 4B7LA 1E30A 2DDQL 4MGXA 1UKSA 4MVBC 3IFLL 2ETWA 3ZRSA 4CC4C 1I1YA 2O26U 1LEKB 4X4MA 4HFUL 4WI8A 4HXBH 5DI8B 1ADWA 1NCAL 1QVOB 1JZ2A 4PJ5D 3Q2CA 4IKIA 4KK6D 3FT3A 1ZT7A 5HYJB 1IAII 1I8KA 2B1HL 2IANB 3D3VA 3O45B 3OX8B 1ROWA 3KBFA 3N42B 5E2UH 4ZNCD 2NX5A 4FTVB 2EVHA 1QSFD 1ZSDA 4NRXA 2GTWB 5FR3A 4ILDA 4IOFC 5CCHE 2MQGA 5DT1L 5IBTL 3SGKC 4F57H 2JKXA 4ZJ9A 3WTXA 1QP1A 2V3FA 4F80A 3DX4A 5F0JB 4D0CA 4QRRA 1FZKA 4RMWA 1FZJA 2EADA 2BY3A 4JFOA 4Y1AA 5D2NB 2HFFA 4TLKA 4P2OB 3U46A 5D5ME 4OGAC 4KO5A 1QHQA 1YA5A 4LF3A 4H5SA 2BP8B 2CDFB 4MA3A 4LPTA 4ZNEA 2DBLL 4JO4H 2XPGA 5DRXA 3CHPA 2NY2B 4LSVL 1MNNA 2VL4A 1E2ZA 2ZWSA 4I3RL 5H37H 2N3JA 4OD1H 4PRNA 5LDSA 3PAUA 2JH2A 3DVNA 4KKPA 3QDJD 3CZEA 5C0BE 1MIEH 3BKJH 2WVVA 1KBVA 5AAPA 2A6KB 4L5FE 1BBJB 1LO2H 2UY7B 3D5OF 4XOEA 5E8DH 5GGTA 2XN9E 4HH9A 1R24B 2VQUA 5IB3B 1KYOJ 4FFWD 3TGXA 2HKFL 3QIBC 3PV6A 2F1AA 1MJ7L 4MKMA 4QEGA 1K6QH 5FUOH 5DWPA 3S37L 2FYYB 2OMBA 3W0WE 4PRIA 3BP5B 3US1A 1E27A 2NNRA 3QFJA 2IMMA 4U1JA 3JYCA 4PJGA 1GYVA 4HPYH 3FUEA 3LV3B 4LE8A 4HUXA 2BXZA 1JZDC 2DYRB 3X12B 3NP4A 3HG1B 3TWCH 4PJXF 1LGVA 4JLRB 5KW9L 2DW5A 1AGCA 2G9HB 4H2AA 4XMKL 1MI5B 3TBWA 4Z7OF 4DN4L 1Y18A 5J13B 1E5UI 2DWDA 1SHXA 3QSKB 4JBSA 3VW3H 3E6FB 3IFOB 1ETZA 4XWGL 4EEEA 1JWSA 3DSNB 4P2QA 1HN1A 1U0QA 5DDHB 5IR1B 2AFNA 3EYOB 4TF4A 5JHLA 3WHE0 1SOXA 4W9GC 3UYRH 3A21A 4C54A 2XV3A 2FECL 4L48A 3L9RB 4PI0A 1UURA 4WUUB 1T66C 1GOFA 2NT1A 1I3GH 4U33A 4XVTH 1SHWA 1VACA 5B7EA 2ZUXA 1JWSB 3DSNA 3BD4A 5F71A 3NPSC 4LPVA 5DJYB 4XP4H 3L3OC 1U4FA 2XUWA 5CIPB 3T65A 1DL7H 4CU6A 1AHMA 2CO3A 5T5FL 3ZE1F 3AM8A 5HYSG 4XXCA 3NIDE 2XJKA 4G7VH 4PJCE 3ZBMA 3T3PE 2P26A 4OAWB 4G7SB 4I8DA 4JQVC 3WEBA 1M05B 5HGAA 2MCPL 1C5DB 3P9LA 1W72L 3MA7A 4KI5C 1G4MA 4PBXA 5IWLC 1MRCH 4G3YL 3MJ9L 1RUPL 2ADGB 1NFAA 3O8XC 1KCKA 3FQ1A 1OB1A 2Y7QB 4HLZG 5JHDD 3EJPA 4NNXB 4P4KC 4IQHA 1S7RB 3WG7B 2XWEA 3CN0A 2OMYA 1DANT 2V2TB 3WS6C 3EAKA 3RWHB 4DUWA 1N2RB 1KJ3L 5I19H 4Z95H 2LW3A 2VIRA 3LNFA 1Q1PA 3VI4A 1L6XA 2GIXA 3CFUA 1OP4A 3TIDA 5AL8A 2H0PA 2WBJC 3SN6N 4HIXH 4LOUC 2D7NA 4XP5L 2F68X 4WJ5B 5F72S 2APBA 2FX8H 5I1JH 5DJ0B 3QS3A 4XTRC 4DFIA 4IIQB 1PZCA 1FO0L 1QFPA 2X89D 4MB5A 4JDTL 1JF5A 1G7LB 4PR5A 4ALAC 5E1HB 2XOTA 5AENA 5BZDA 2DH2A 5ALCH 4PJHA 3ALPA 4J12A 4JE4B 4PY8I 5E23A 1OOWA 3QRGH 2QDVA 1G5GA 3AB0C 3UIYA 5FECB 3T71A 4MQ7A 4G8GE 2OSLB 3HB3C 4QAMB 5EO0B 5CSBA 5JW4M 5J89A 3FCSB 4OF7A 1G7LA 5BZDB 3P54A 2WSPA 5ACLA 1R5WB 1WQVT 5AW1B 2WW8A 1DEEA 2APXA 2QJDA 3VXME 1L7IH 4RDQG 3OSKA 3FB6B 2G4GA 3KXFE 3VRIA 2B1OA 2EYSB 3F7LA 1A2YA 1KTJA 2IEPA 3HE7C 4FF9A 1IBBA 3OJ2C 1FVDA 1SEQL 4IGBA 1I3RA 1XBRA 1TJHL 2Q10A 1W9XA 1R75A 5I2IB 3BT2L 1WWAX 2MNWA 3CLEH 1F18A 3PRZA 5MEND 1A9BB 3VQMA 2FCBA 2DEWX 2K45A 1E4XH 3O4LA 4XP6H 3X1GA 3S36X 5C09B 4DERA 2QADD 4X8JA 3CZNA 4MD0A 1LYQA 1S7VA 3PHSA 4NM4L 3UADA 1KGJA 2O61A 1JSYA 1RK0B 2NZ9C 5F9DC 4DEPC 3KXFB 1OT2A 3KPLA 1OE1A 3NSJA 3UAFA 4P07A 1PKQA 3NRFA 4IRJB 4B5EA 5GGSB 4OIIL 5IVXB 2WQ8A 2VSKB 4OY9A 3WIHL 3IE9A 4PGZA 3LHPL 3BUBA 3RJOA 2MOGA 3KPPA 3KAAA 2EXWD 1FE8L 4U0RB 1FE8H 1LO4H 2FO8A 2XWRA 4EBQL 1MF2L 1SOKA 4H1LG 2FT6A 4G70B 4L3EB 4S11A 3MLUH 2NY6B 4A6YA 1GSMA 4QPEA 1U8HB 2IAAC 4ZMYA 3WXVH 5F96H 1I85C 3O6MH 5ILTL 5AVTB 2J56A 1YUHA 3CWGA 4PJCB 5J3HC 1CDGA 3GS7A 3L4WA 5BOJA 2P5PA 2QQKL 5DUBA 4LSTH 4ZTEA 3R7RA 1T89A 3AC0A 2PPFA 3OMAB 1Q0XL 4NQSB 3C2SA 4M5ZL 4EQ3A 4HW6A 4F93B 5ITFA 2WAQA 3BZ4B 1BQLL 3CLWA 4IRJD 4K7PX 3FU7A 3OGCA 4P59H 5I1EL 1DJHA 1CFTB 1KCRH 4CVWA 4X7SH 4E41D 1QEWB 1ZGLP 3ZHFA 3N85L 5KOMC 3DPBA 3QGVA 1UASA 3TN0A 4QTHA 2UYLB 2C3HA 5L8KB 3SE4C 3FUIA 3GMMA 2VITB 2ZXCA 4ZAKD 5CWSB 1CGYA 1TZ8A 3KBPA 5G2NA 3DHPA 4BHUI 2EUZA 3GSUA 3APMA 5CLXA 4OD1L 4PJEA 4G5ZH 4C8XA 1S7WB 2C4XA 2EE2A 5AVUB 2CU9A 2FBJH 4QTHB 4YL4A 4AH2B 2EUXA 3PV6B 5HGHB 3GO1L 3QQXA 2DQFA 3NZHL 4OCWH 3WNOA 2PWEA 1F1AA 1SEBB 4FQXA 3L1OH 1FFRA 3ARTA 3HMXL 3K6FA 3TO4C 4U1HA 4XN4A 4DP8X 3ILQC 3CVDA 5KSAC 1HZHL 3ILDA 4O02H 5I1HL 4DPCX 3BQUA 4HIQA 4HUXB 1OTTD 3US9A 4PS4L 4DESA 2WUBH 1ML0A 3DVFA 3MV9A 5EO1B 3T8XB 3W2DH 5HPMA 1T5XA 5E8PB 3UBXA 3PUUA 4GP5B 5I8EA 5CF3A 1EJOH 1DQQA 4JO5A 1H0DA 1I9IL 3MRQB 4XNQA 4EIUA 4GI9A 4YSOA 3SQBA 1BP3B 4HIIA 1D5BA 3NABL 1WH0A 2A0LD 4FG0A 3QDJE 3A6CL 2WQSA 4JN2A 5KVEE 2X09A 4K5MA 4BQBA 5HPMB 2ZKWA 3MV7D 4QXVA 4PUBL 3G5YB 3ULVH 3FTSA 1NFDB 3V5DB 4AIZA 2CCWA 4FKHA 2X1XR 1I8IA 2W5PA 3EFDL 3HG4A 4WHCA 4XWGH 3BRGC 5ESQA 2Y1VA 1AR1B 3N41B 1OP5K 4TS6A 2ZSWA 1MFBH 3KM1A 1D6VH 3PWVB 1WWWX 3QIBA 4WK4B 1CJYA 1AGFA 3GUTA 1QNZH 5FAAA 2F19H 1KXHA 3ESVF 1ZTXL 1D5IL 5BOZG 3SQRA 1D5IH 4PJ5A 5F3BA 1D7CA 2GSIB 1DZBA 1U2CA 2M83A 1MG2C 3MJ8A 4ZW5A 2WWKT 5GZOC 2AMGA 1DQLL 4IGBC 4N2LA 5K9QG 5BZWA 3CCHA 3ARFC 3D52A 2JQZA 1HYSD 2VDLH 3EFOB 3M17B 5C0IB 1N59B 2F5BL 1E6OH 1DDHA 1XL6A 3CG8A 4OLWH 2EDTA 4X9GA 1J8HE 5E9DD 5A2BA 3UBXI 5DO2C 1URZA 4MB4A 4JM2F 4NNXA 1NCDL 3WS3A 5T3XE 2IQAB 2LTQB 5ALCL 4G9FD 3RWJB 3KVQA 4BSWB 3HS8A 3G5VA 3FB5B 3BZFA 2WKOA 3IRCA 3OQ3B 3GHBH 4C56E 3ASWA 3I75A 3SGDH 4U49A 5I1CH 1YJDC 3LZPA 4PGCB 1PKQE 3C9NB 1CI3M 2CHDA 4PD4J 1J88A 4Q97A 3FB5A 4PRPE 4FHKA 5A2JH 3QCVH 4OLZL 3R8QA 1FZMB 2X1OA 3MNVA 1T0MB 4JDEA 4WGVB 3T9WA 1G7HB 1VLXA 3NZUA 1BVLA 3LTVA 4K3GA 2Y9RT 3L1GA 4U1NB 5LN8A 2E6PA 1T6WA 3MXWH 1IAIH 1UH4A 1YQVL 4WY7L 4BE5A 3RX8A 4IBWA 2YSTA 3TCLB 4TNFA 4E41E 4LASL 3NESA 1ZSDB 1G0YR 4ZMAT 3CHXA 1GJWA 3TIDB 5AB0A 1TLKA 1TQVA 2M26A 3W11C 1S7UA 3TN0D 3UJJH 3GSRB 3M45A 4ODWA 1A3RL 5DYOB 6PAZA 5A2KH 3RRQA 3ARXA 1II4E 4QRPB 3M07A 3OBAA 3F64A 1BX2B 1RAMA 2X4RA 5AD0A 1UOWA 4JFVA 3IN2A 5GZND 2FWUA 2YA0A 3MXVH 1FFNB 5FECA 4RZCA 2I60L 4N0YL 2I60H 3BH4A 3T0EE 4X8JB 2D7MA 5EU4A 2ZICA 1HINL 1YHPA 2E76C 3VE0A 2QVKA 3RTQB 2EICA 1CTMA 3BKMH 3QPQD 1KXTB 5J11B 4NXKA 1GS8A 3SO3B 1BFOB 2J6EL 3K72B 2FBRA 4DPAX 4KK6C 5JXEC 3BWUC 4YBQC 2NPLX 4X7FC 4L05A 1LD9A 5IFHH 3VE0B 4ZD3H 2VSCA 4MXVE 4XNZC 2Y7SA 3QIWA 5MP6H 4RESB 4AQ8C 4OGXH 3TBSB 2NTFA 3ZRCC 3SGJA 2WXFA 3IU4L 4M02A 1AXTH 3VI3B 1FIGH 3WY1A 1W16A 1XIWD 4HSQA 1K3ZA 4R83A 4Y5VA 3H9YA 1EFXA 3Q6GL 4X6DA 3EZJB 1TJIH 4XB8A 1J8KA 4WHTB 4PP1C 3X3GL 1JVLA 4H26B 2XFXA 3PGCA 3D50A 3UROR 1NGXA 2A9CA 4JO3H 3O4LD 1WBXA 3MA9L 3VWKA 4N6RB 4BK8A 3UAEA 3L3JB 2YD0A 2OR8A 4AZ8B 1A7PL 4K7FB 2A6JB 2MKLC 3GMPA 1MCPL 4X0KB 1TUPA 1VACB 1NGXB 1N7MH 1PTZA 2KZBA 5EO9A 4IU2B 2GHWB 1KIUB 1SF3A 3VFRA 5D7JA 2Y7NA 4Z77B 1CGWA 3GMOB 4LNVA 1LQSR 4HV8B 4U1IB 4ZO9A 1C7SA 4XH2B 4XNAA 4GG6F 5B38A 3FQWB 3KLKA 4KNQA 1RHFA 5ENWA 4LOVA 1PCSA 3EBGA 2Y6SD 3ARFA 3QDJB 1QLEH 9CGTA 2W9DL 2QSTA 1JF6A 3P73A 3FB7B 2GIMA 1KYFA 1ZAGA 1TCRA 4S2SA 2FWLB 4HUWB 4RRPM 4WTZA 3W9EA 4FLOA 3VMPA 2FO1A 1E8XA 4I2XE 1X9LA 3NIFB 1GKEA 5CM1A 1FZJB 1FYTD 1N2RA 4JFOB 4L5FH 3KJ4B 1OPGL 4OR1A 4FQHA 3D69B 1L5GA 1AJ7L 1N9PA 4UIMA 1KSRA 3EDKA 1BOGA 3JTSA 4EI5B 4DGUA 5BVPH 2G60H 4HIJB 3HPJA 3BP6A 3I9GL 1SM3H 3B3IB 4JO3L 3CXDH 3BOVA 4NSKA 3EXJA 4NZJA 5T1LA 3C60C 3FQXA 5JUEL 3FUKA 4GT0A 4APXB 4ZZKA 1YEDA 5CFHA 4KKAD 1O6VA 4G1MA 2FEJA 1UHVA 3QR2A 3IFPB 1JV2B 3BP6B 1MCCA 1RUML 5JW3H 4LMQI 4F8PA 1Q9WA 1N0LB 3LX9A 2QELA 3BP5A 4BXVA 2GJZB 5TF0A 4TYUA 4M1GL 5DJYA 4ODSH 3RGBA 5ADOH 2JJSA 4G2AA 2AEPL 3ARBC 1FVCA 3OKOA 2C9AA 1SMDA 1V3KA 2AMUA 1PSKL 1JTTA 4RGND 4R97C 5AG9A 2B8OT 3BQUC 4YE4L 5BRZD 2A9BA 3EJYD 1QLEL 1NCAH 1S9XB 3F00A 5HJBA 1QWHA 3SYCA 4DPRA 1U3HC 2NYKA 4L1SA 3G08B 2Y1YA 5D70H 4ZSOA 1G1KA 5F7DA 1NGPL 3QPKA 2VLJD 4KKAC 4NQVB 4X7TA 2VXTH 3RIKA 3BN9C 5FYJL 3VWKC 3T0EA 1WGOA 1NGZA 5HVWA 4H0LC 4M7LL 1IAIL 2WNXA 4M7LH 3C12A 4AIOA 4ZFGL 1R5IA 1LNUB 3PABA 3L1OL 4P23D 4NUMA 4GJTB 1RIVH 4D9RE 2XWJB 3SCMA 1BJ1J 4HBCH 2FNBA 5SWQA 3BLBA 1P0SE 2EINB 3APNA 1U33A 2VQ4A 3Q13A 3ML9A 1X5KA 2NY7H 3GSNA 5DEGB 2WUBL 2DBLH 3SGEI 1RZIA 1XEDA 4X6CF 2CD0A 3TEXA 1BQHB 2G2RB 3X3FL 5I26A 4N8VG 5C08B 4OFIA 3QQ3B 4NHCL 3GJFH 4EZMA 5MERA 4M7LT 3S36H 5IBUB 2HT4D 4HIHA 5JOPE 3QORD 1U8OA 2CR0A 1GVIA 4JJ5B 3RP1A 3DDFA 1RZKH 3GIZL 2G3ZA 3LS4H 4Y5XC 1SDAB 3NN8A 3QHFL 5I1KH 4LSSL 3QXVA 4MNHA 4UUJA 3MDJA 2HT2C 4HIHB 3R0NA 1GY2A 1T1WA 1C1EH 4OGQC 4GSRA 5D96B 3MR9B 4L9LB 4PV9B 1BMWA 2ZYSA 5FYKD 1Z2KA 4KAQL 4XN2A 3F58L 2ORBH 1DBAL 2H2PD 4OF3A 1TETH 3H56A 3M7OA 4FQQA 4HF5L 1R34A 1B4LA 3SPCA 4JQIH 4CMHC 1UZ6E 2WKOF 4GP8B 4WW2C 1Q8MA 2N7BA 5DFWH 3GB7A 4JFYB 4PV1C 2P48B 2VWEE 4O02A 2VLLA 3REVB 3OC8A 2XBZA 3CSYA 1OCZB 3HUJF 3UC0H 3IU3A 4X6BA 7PAZA 1KXTA 4C4KO 1G84A 3WNNA 3QUMA 4N9GA 5D1XB 4H20L 2WY3B 1LK2A 5EO0A 2EXWC 4JM4L 3PQYE 2ZOTA 3NCMA 3GGWA 2NSMA 3WTWA 3VXNA 3UCRA 3VUAA 2GBVA 2E27H 5KG9B 4QF1A 5DS1A 5F7LB 5DS8A 1OW0A 3PJSA 4YHNB 1U3ZA 4ZS6C 1F1DA 3SDDC 4MX7A 3FO9B 3BEWA 5MP6L 3C8KA 5CGBA 3H6JA 4OCSL 3DROB 2BWIA 1TG8A 3LKNA 4MJIE 5H37A 2KC0A 1WFNA 2NY6D 1EVTC 4K2UH 4AVHA 1LWHA 4FMKA 4OF5A 3PGCB 3T2NH 1FI8C 1OQXA 1DVFC 1W8NA 5MENE 4PJIA 1KN2L 2WJ7A 1OOAA 4OZIB 1HXYB 4LESA 3HI1A 2XZAH 1GCFA 2DQCH 3O3AB 4RAVA 3UABA 2X6BA 1UJ3C 3FH7A 3I50H 3LKOA 5BQ7B 1QFUH 3KPMB 5DZOA 1RZ7L 1HXYA 4EQ2A 4AENA 4KROC 5B3JF 4OCLC 3HI1B 4Z3GA 2VR5A 4HWBA 1BJ1H 4GUPA 4ZTPL 1K8DA 1UYWL 2OSWA 1N7ML 5IIEA 1FO0A 3IRZA 4AEHH 1KFAL 3VXUE 1FYTB 4HZ1A 4PRIE 5DRXB 2BP5M 3VWKB 4KFZC 4N6RA 3GRWA 4PWFA 4GUPB 5JHDE 4K5OA 1G9NC 5HYIA 1WV7T 2LLGA 4Q6IC 4YC2B 4IJ3B 1EUUA 1R3KB 2PTTB 1H9DA 4WWKD 5TDPB 3DYOA 5AW9B 1L9MA 2YD1A 2QADC 4IJTA 5F6HJ 4RAUB 3ALXA 4LQ1A 1CYXA 4Z7NB 2V5RA 3RIFK 4XCEB 4PGEB 5ALBH 1THCA 2VERN 4OFYD 2H6OA 3FAXA 1W8OA 5GGTH 1HWWA 3DGGB 2V6HA 3AS2A 3U6RB 1EZVX 4UT6H 1S4IA 4F58L 1QTYT 4EZLA 1OE3A 4I87A 1U8CA 1O0VA 3M1CA 1NL0L 5IQNA 1KJ2L 1WK0A 3FB7A 3RTLA 4HKZB 3LEXB 1P1VA 2X6AA 4MJ2A 1HKFA 2W81C 5DMYA 2F54A 1KY7A 2XBTA 4XN5A 4AM0Q 1S7WA 3ARYA 2MEJB 3FO0H 1J1PL 3NCFB 3QJRB 5C0BB 1UM5L 3DHUA 2KZ1B 3SKNA 4NUGH 5GRJL 4A7TA 3S8FB 3KPRD 2Y22A 3BUQA 4N2GA 1HYSC 4FFZL 3M1BB 2R0KH 3QYCA 5T8IA 2BVUA 3CFCH 2PMZA 3CHSA 4XC1H 5DDHA 5BVJA 5IR1A 3WIHH 2WSDA 3T6QC 3DWTA 2F54B 4CADA 3WDJA 4PRDA 3QEUB 3U4AA 5CBAA 1EO8H 1IARB 5C0JA 3CAFA 1QI5A 5DSCB 3ROOB 4DKAA 2FJUB 3WI9A 4BRVA 3QEGL 1D5MA 3HMXH 1X5YA 2NXYC 1QD0A 1QSEA 3A4DA 4QT5A 4AV0A 1B4JH 4DFHA 2E9BA 1SJVA 2AXGB 5JW4Q 3B2PA 5KOVC 3P4MB 4E9QA 3QEUA 1SDYA 5IROD 2ZSVA 2JCCE 1DSYA 4NUPA 1MCEA 3L4YA 3IGKA 3GLEA 3T4YB 1UA6L 3IGUA 4XX1G 3QXDA 4U1LA 3VWJB 3JSSA 5EOCJ 4EPSA 2VW4A 3ULUD 1WEJH 5DJAB 5LNEA 5CGMA 3AUWB 5I6KA 1S9WB 2Y7LA 1NCTA 2O4EA 3L45A 5L2KD 2HVKA 3QEQE 2AVFA 3NJJA 1CE1H 2JK5A 1A4KA 2Q76A 3ZDYE 1SBSH 4N5EC 4OTXL 3NEEA 3EJZC 4OZFA 4XWOC 3N9GH 5FKPB 3SKJL 3U0PB 3PDDA 1R4XA 1C1EL 4BH7B 3KYAA 1VGEH 1YEHL 3ME0A 3QA3A 4YSDA 4IHOA 1W0WA 5F88A 4AEIL 3HC3L 4TNGA 4Z7QE 1ONQB 2VDLB 5JHLL 1F6LL 4Y5VB 4OZFB 5FKPA 5D1QD 4JJ5A 4NZTH 3MCG1 2FEEL 1IZJA 2FL5A 3EJTA 1I7UB 5JXAL 1CPUA 1B0RB 1KENH 3GHEL 4HIEA 5D2NA 1MELA 4KKBC 3HW7A 5HYQA 3L3DB 2C9XA 4NP4H 3TFKC 3WN5B 3WFDL 4UM9B 3L9EA 4EZJA 1DVFA 1HIML 1EAPA 1J48A 1VDGA 3O41A 1NFIA 3GZPA 2LVEA 4UT6A 2VSDA 2P24B 3VFWB 1H3TA 3ZR6A 1HZLA 1S3RA 4KROB 3BYTA 5ISZA 4LSRH 4TTDD 2PUQT 2AGJL 1X9QA 3FOMB 4N0CD 4ZTOH 5FC9A 4ABQA 1J5IA 4OLXL 4QRPA 1Q72H 1T4WA 4WKXA 2CO7A 4V1DD 2NNAA 1INDH 1WZ1H 5IEHB 3DX2A 2CG9X 4H1LB 3A6OA 3BKML 4HC1A 4J23A 1PSKH 4ZMTA 4M48L 1Z7JA 4QRPD 3JV6A 3LH2H 3HZMA 4NZ8A 3REVA 4WEBH 1TVHA 1ADQA 2GFBB 3ZHDA 2DI7A 3T0VA 2EO9A 3NOIA 5IFHL 4TN9A 5DMKB 4KX7A 5AKRA 3EO0B 2P9RA 3VFVA 4B9PA 4HUUA 4M7JL 4PUBH 3H9SD 4MMYB 2Y2WA 3ZE2F 2WK2A 4DN4H 3QDMA 2G3NA 1E8WA 2FLMA 3CFJB 4Y5XA 1CLZL 4YGVB 3BRDA 4X9YA 3H53A 2QEJA 3GTNA 3N0AA 1LTXA 4Z7OE 4R90L 5BW7C 2EE0A 3W5MA 4PV8B 3HPLA 3L81A 3ARDC 2B39A 4X6EA 3FTGB 1AD9B 1U3YA 4KDVA 4GIPD 2K8QA 5D4JA 1D9KA 5DJCA 4MX7B 1U6AH 5F9OL 5I74B 1OL0A 2DV6A 4Z0BH 1QACA 3CXHK 2IDCA 1P6WA 1H5BC 2K70A 5E9AA 3V0WH 2R0ZL 5AW5B 5A40E 2WBKA 2V2WB 5HHNB 1XMWA 4B3EA 5KEZA 2BIPA 4TQPA 2EO7A 1L3WA 3SJVE 5EIIA 5IHUH 1N5YH 2VDPB 1Y6MR 4OJEH 4NKDB 2VR6A 4PWKA 2VXQH 1BQUA 4TTDC 5ABZA 2ZG1A 2VO8A 4P5MA 5EN2A 2HWZL 1NIAA 3QHZL 1QSFB 5DJZB 3WE6B 5KSUB 2JKWA 3SDXF 4I4WA 2EEDA 3EGDB 1Z3GL 4QRSB 1YECL 2MCMA 5HYSA 5I71B 2ICEC 2DQIL 1OAUL 3JWNG 2DQIH 1KT2B 4CC0A 4PHZA 3U7YL 1MCIA 3MMEA 1ZT7B 5TQ0H 3BSGA 1JZ7A 4I77H 4M8QB 4WLCA 3K2UH 4WTXA 1K3IA 1G7IA 3A67H 2ZPKH 3I6SA 4U4BA 1WP6A 4XCYB 2P5EA 1QLFB 4OKVB 4EI5C 5IMLA 1E5YA 4Z8FH 3SDCB 1RZ7H 4MXQC 3QQNA 2YKLL 4WI3A 5ENWB 1UH3A 2BINA 3ZTCC 1A4BA 3HZVB 3KPSD 2P5WB 4XOAA 3T77A 2UWEB 3RGVA 5H4YA 1KJVA 4HLJA 4R7NB 4Y4HD 4XP5H 1X6LA 3BFWA 3HZYA 3U4EB 2XA8H 2C9SA 1UB6B 2AK4A 1JZ5A 5AW6B 2R69H 4IBTA 1I4FB 2JFCA 2OMXB 3IMSA 3UACA 3CU7A 3G5ZA 1G0XA 4O51A 4PRNB 35C8H 4WRLA 5AAWA 5C2UB 2ICCA 3INOA 4PGJA 2FGZA 4PJAE 1OGAE 3GXTA 3GMPB 2BFVH 1O9WA 4PJBE 5FUZH 4GSDH 3L2NA 5EA0H 5HHVL 3Q9QA 3H9SE 5F7UA 4PJ7B 1O7DC 2P5WE 4TVPH 3VQ2C 2EKSA 5DEGA 2W0LA 3LRHA 4KK5C 2QQKH 3CZLA 3X1FA 4KV5F 4UZSA 2WTOA 2C3GA 2WXNA 2DQJH 2F54D 3FCSA 1MVUB 5DZAA 5BCAA 4OLVH 3NJFA 4UNVA 1BYNA 5K39A 4RAUA 4IS6B 4NCC2 1MFDL 4P4KD 5ADOL 1CE6A 3MUGB 2HRLA 5FGRA 1T7ZA 4N2NA 2BX5A 1NDGA 3RDTD 1BXXA 2NR6A 1S5IH 4MCNA 2FO4A 2FE0A 4P2OC 4BZ2A 1WDAA 1B6DA 3MV8D 4R5VA 2RA1A 4KGJA 1FH5L 4PRPB 1I85A 2NY0B 2CBPA 4HJ0D 4PRAA 1X5LA 2FBJL 2O5YL 3DTUB 5GIRA 5LKNA 5EH1A 4GMTH 3MODH 1J9RA 5IF0B 4A2DA 3BH9A 4J3OC 3RGHA 2BDNH 2OM5A 4ZRGA 5B1AB 4F2ME 3LEVL 3IK2A 2X4RB 5AD0B 2XXCB 2YD7A 1PQZA 4HFWA 2C1OB 5JLZA 3Q8EA 4DWHA 2APFA 3I6KB 5C9JA 5HI3D 4PW3A 2WXHA 1JZ6A 3PU7A 1QFWH 2Z6FA 1DQIA 3QC5X 4X9FA 3V9FA 4KJYA 1R33A 3QH3B 1KIPA 4M29A 5FA3B 3X1NA 4L1DA 3KYOB 3KYKH 3RWJA 4BSWA 1B9KA 1BXUA 3B2UD 3FQNB 1UD6A 4L9LC 1PIFA 5KBPA 4TSCL 4P23B 4ODVL 2VR8A 3ZT5A 1RZGB 1BLNB 1BZ8A 1MHCA 2CHZA 2Y06L 1QUNB 3FCTA 1JD7A 3IDGB 4JCWA 1NFDF 2G2RA 5E8DL 2J71A 3SDDD 1U8NA 3ABGA 2XZQL 4O9HH 2BMKA 4UT9A 4RAHA 3N41F 2VN7A 3LZLA 3L3OA 3QNFA 4ABVA 1SDDA 1FCCA 1HQRB 1QUNA 3FCTB 3HJEA 3WKMH 1QNZL 5IHBA 2YAOA 3LXCA 3VI3A 2XQBL 4JRLA 4L4VA 3T3ME 3O2DH 2D0HA 2A9NL 2PR9A 3EYQD 1GGBH 3Q8CA 1NGPH 4PLKD 5JXAH 2BSEA 1F3JA 4AIXA 4HUVA 3DMMB 4CN4A 3EFFA 1J05A 4IIQA 1XF5A 5FYJH 1FJ1B 4IHOB 4Z7IA 2V5SA 2QQLL 4L23A 4P4KA 5EEVA 1JGIA 3MODL 2ICEA 3JBG7 1R9FA 4BK5C 3S5LB 3HLAB 4FX5A 2EILB 2J8UA 4A2EA 3O9WB 2F6AA 1UENA 4B3VA 4AH2A 4B9IA 2JXMA 1WHOA 1BQHA 5AZEL 5K9OA 5E08H 3SDDB 5DJ8B 1KDJA 2HRPH 3OKLA 4HWZA 4X0KA 5E1IA 4JNXA 1IBGL 4BIKA 4P2RB 4NQDE 3ZZLA 3F5WA 3FZUC 3OG6B 3RVUC 3S5LA 4JCLA 5L88H 2CRZA 1PZBA 1AZUA 2QV4A 4GS7B 2BZ7A 3AAZB 3K2IA 2G2PA 1TYRA 5JPMA 1BAWA 2V9QA 3QK0A 1AS8A 4MJID 5TPWL 1K4CB 3I6GB 5LGJA 2Q3AA 3HE7D 4IRSA 4KQ3H 1H8OA 5BZZA 5JW3L 4ZS7H 1AH1A 4ISVA 5FEBA 3GMQA 5E5RB 4B6ZA 3TPUA 2ADIA 3G6DL 4XXDB 3MN8A 4LCVA 1XH2A 1HCZA 4X6EB 5C7XL 2E5EA 3VDBA 3UYOD 1K4CA 1XSKA 2ZT9C 3GRGA 1VIWA 1WFTA 4UQ9A 5T3ZH 1V3LA 3KHOA 3V6FA 4OI9A 3SZKC 1QYGH 3QIWB 2DWEB 3BX7C 3FOLA 1QBBA 4B9YA 1E9QB 4JK0D 1EJ8A 2BSTB 5LWYL 3VD9A 1VZIA 2IDSA 2IPTL 1HVXA 2F7QA 5EUOB 3RVUD 2YWZA 5I76A 2DMKA 1T1ZA 5E95B 2F8IA 4OVUA 3TWCL 4Z7WF 1AKJB 2FIKA 4MCZA 2EIBA 2EDRA 4N8VA 4KROD 4NB7A 3MAWA 3S2AA 2DIJA 2XFXB 2FX9H 2WO2B 5IB5A 1DJGA 4BZ1L 3ABKB 1VFAB 2OL3H 5JORB 2OL3L 1HSBB 2ENJA 3GSNH 1Z3GH 2WZ6A 4GKLA 3WEOA 2NY7L 4TM9A 4HAKA 4KZDL 4L4JA 5GS0L 3H3BC 4LLMB 2EIMB 4P2QB 1RPQA 3K2UL 3Q2LA 5H94B 4MKTA 1AHWB 5AZ2H 3BAKA 5EBLA 2NY3C 1NBZB 5ALBL 1MRFL 3FT2B 4BELD 4YHYB 5IGXH 3ARRA 1MH5A 1WS7A 1AIFB 2CKBH 3OG4B 1TQBB 3BO8A 3MRRB 1OSYA 3FSWA 4NBZB 1OGPA 1R3HB 1U3NA 4XNBA 3DXAA 4Z7NE 1A9VA 1CO1A 3LN5B 4G8GD 3GQFA 4OCYH 1FCGA 2RB8A 4MDJA 4WU5B 3ZKSD 1F41A 3WDHA 4G6JL 1YEIH 4KQ0A 4LVEA 3U6RA 2NY2C 3G04B 4YDNA 5FDYA 1AC0A 3RLSA 3LMJL 5L2JB 2UY6B 4A66A 1G7PA 3FAWA 4LQFH 3GZOA 4AUYA 4QJ5B 1I9RH 5C6TH 5TD4A 4TNWK 2Y7QA 3SYQA 4ZW6A 1T4KA 2Y25A 5TTRA 1RPUA 6TAAA 4S0TD 4FFZH 3VAEA 4M62H 2EYTA 1I1AA 1NPJA 4BDVA 4IGBD 3GSRA 4WI9A 1A64A 1TCMA 2GC4C 1NANH 4AG4L 1YUKB 3FTUA 4NN5B 3DJTA 3ILQD 7FABH 5DC0A 5F9JA 1I7TA 1P84J 4OLVL 2X3AA 5B39A 1BMZA 4Z7VB 2MRYA 1T1XB 1P4UA 4BDVB 2EE3A 2D03L 5CJXC 3SGJC 3VRIB 4OD3L 1J0IA 2ZF9A 4RISH 4UAHA 3L1FA 1VFUA 2VDKB 4G43A 1IT9L 2XKUA 4U3XA 5FB8B 4MCYA 3ULUC 5DHYB 3ZL4H 1I1FB 4TV3A 5HDOA 3WIFA 1OGTB 3FF8A 4YHZH 3WY3A 1P7KA 3C2AL 2O93L 2XRAH 3LD8B 3EDFA 4K8RH 3BKYH 5DC4B 5C09A 2ZSWB 1KJ2A 3LKRB 3CSGA 2CPCA 2WLLA 3AU0A 1GW6A 4NQEB 2P42B 1H19A 3DLQR 2Y72A 4Z9KB 3P1VA 4KRPD 5SWZA 1QPXA 1QBLL 5KYNA 1S9VB 5I23A 2W65B 4LASH 1JHLH 4Y4KD 3PFUA 2V7HB 4MVBD 3EOYG 1A66A 4IKLA 4LQFL 1CT8A 5C0IA 5E6YA 1OTSC 2DIBA 1ZLWK 5CBAB 5ICZB 1F11A 3QUML 5L2KB 5D1ZB 4YZWA 2AXFA 3BW9A 2EUWA 5H4ZA 5IROA 3SCMB 2YPKA 1RMFH 2CBTA 4MMZC 1UXSB 4X5QA 3UTTE 5KVDE 3TFKD 1QOKA 3UZEC 3ARZA 2MNJB 2YA2A 3JWDL 2A77L 3CFEB 2X4PA 4A6YL 5E56A 1G6RL 2JV6A 4IU3A 1EUTA 1YEGL 5GGVH 1P5UA 2ITEA 2LR4A 1V7NH 4D9RD 4HGKC 2YZ8A 3WV0A 1JFHA 3AT9A 3WOVA 1I31A 1K5NA 1K4DB 4X8CA 3SIKA 2R8SH 4G7RB 4KZCA 4N2IA 4YLQT 4E5XB 3WL9A 5FM5M 3RFZC 3EGDA 1NCCH 3G6JB 5TH2A 4QY8B 1OAXL 2DPKA 3F7VB 3BIKB 3OQRA 3BGFB 3B3BA 2DJSA 5EZIL 3AG1B 5F44A 5E2UL 5GS3A 2D7QA 3KGTA 2L4OA 3FO1A 4ZOAA 4YMPA 2GFBA 4PJDB 3E8UL 5LVEA 2UZYB 3HOGA 4ODWB 2LTQC 1UGNA 4FN0A 4O58L 4QRUA 4HUVB 5IUCA 2PXYD 1CL7L 3M8OH 4LARL 2OAAA 3EYSL 1H3UA 1YQ2A 4Y16B 1MRDL 1RZFL 3C60A 1JHTB 4TUOA 4L8CA 1CB4A 1QSZA 1OCWL 1YYLL 3GB7B 4R9HA 2ARWA 3OWEA 2ICES 1BM3L 1PLGH 1EANA 1WFOA 4R8WH 3KLLA 3H55A 4F92B 3QUYD 1E42A 3T0XA 1H15B 5EU6A 2AITA 4QO1B 4OCWL 3VB9A 1DQML 4OF6A 4ZW3A 4JKMA 2CIKA 4PTTA 5D7KE 4RGMC 3FQTB 4D9LL 1BFTA 1A7RL 1QNIA 4PJHE 5I8EB 1RV6X 2ZP8A 4LSRL 5CJOL 3HG2A 2JQAA 1A6PA 1A4AA 1G6RH 4JRXE 3HN5A 1JGEA 1GZQA 2W07B 3IFPA 1XB3A 4P3DB 4O02L 3DVNB 4KKCD 4EJ1C 1KLUB 3ZKMC 5CD5C 3MI6A 3S37H 1OAYL 1Y1DA 2PXYC 2VMEA 4HDIA 2FJHA 5CLZA 1MCQA 1AGCB 1AY1L 2FIKB 2G9HA 3BPOB 1KB9K 3A23A 3DROA 3HS0A 3LXUX 4MCZB 3T0AA 2I69A 1OZUA 4AVJA 3EDJA 2X05A 2YXMA 1ADQH 1MLCA 3B4NA 3GPSA 4NP9A 5IP4A 3DC0A 5BXFB 1LDPH 2JTYA 2JB5L 4U1JB 1LP9E 1VZGA 2FSDA 3E38A 4JG0H 1U91B 2BSTA 5A7BA 2IFFH 3MJ8B 5E94B 4ELDA 5GS2H 4XMXA 3OHMB 3WUWG 2XKNB 1L4IA 3DDGA 4HS8L 2OJEB 1C9SA 1XGZA 1N4XL 2XN9A 4POZC 1G7QB 2ZIDA 3DBXB 5D6DA 2WQRA 4YLBA 5F1KC 2ZXEB 2Q7AA 4XBMA 3D39B 3PWVA 2W0FB 5GRWA 3SKUD 2OMXA 4JG9A 4PCKA 2C1OA 4K3DH 3QO0B 5JLZB 1DBKH 4I9XA 4UNTA 4HALA 4R4BA 1KOAA 4P5RA 3GXIA 7FABL 3D2TA 5E1AB 5FK9A 3WO4C 1Z5YD 4EKXA 1IC5L 3QIBD 3DETD 5BZWB 2D31A 1M6OA 5DWUH 2YD6A 3SDYH 4G3YH 4JHAH 3A24A 1FVEA 4GXVH 4XO3A 1WD9A 4UWQB 4F7PA 1L9PA 3NN8B 3VB8A 5DC9B 3KPQB 1QLFA 3TF7C 1CLOH 4K3HA 3O0RL 2PF6A 3L5XH 3HAEA 2UWEE 3S96A 3RY4A 2Q8BL 2Q8BH 3EYFA 3CUPB 4BXSV 4FQXD 4JGNA 4R7VA 3CN4A 2K9UA 4WJKB 4JQIL 3F01A 3ORJA 3KR3H 1RLWA 3VX1A 1MFCH 3KPTA 2Y69B 4FFTA 3VJ6B 1T1YB 4KX8A 3UC0L 1NDMB 3WCYA 4YDZA 4X80H 1F6AB 4G43B 3QAZB 1RJLA 5DJ2B 1CD1A 5EIIG 3L4CA 5BMFL 2VDQB 2P5ED 1AMXA 1QPKA 4P23C 4PEEA 5EULV 4AZUA 4ERSL 2AJSH 4YHOH 3W9DB 3NUKA 3MRGB 4WEUD 5GIRB 3FMGL 1SVBA 5DLML 3F62A 4D8OA 2N4IA 3PL6D 4Z7NF 4J4PD 4PVLA 4BZ1A 1NC4A 3U0WH 3B7TA 5C09D 1GJIA 1LWJA 1Z9LA 2G5BA 4PQXA 1XF3B 3KGSA 3QFDA 5CCGE 1NCOA 1I1AC 2A77H 4MJ5A 3N1MC 2GSGB 1L9RA 1QZNA 4HKJA 3UTQB 3FN3A 3GXNA 4N0UA 3KW7A 3LZOA 3ZQXA 2X4SB 2P4AB 1EGJA 2ATKA 4K5NA 4XC3H 1UT1A 3DHJA 3CLEL 3E7JA 5DMKA 3L9YA 4AWJC 3IJHB 1F11B 5AB9A 5ACZB 2ZOUA 5AUMB 3ETTA 1IGYA 1EMTH 5GSRB 4XPFL 4NRZA 5AVWB 3UBFA 5A2FA 2P8LA 3A67L 4JRYD 4RRPG 3BWUF 5JPNB 2WLKA 5AOKA 1KLFA 3SQOL 1CR9H 2H3NA 3KPPB 4MJHA 4HQQH 4NJ9H 3UTTD 1LK3H 1AQKL 1EIBA 4QJ4B 2GI0A 1TQUA 4NM8L 3KHQA 3FCBA 1VF5C 2X6CA 1T21B 3MRFA 1AFVL 1N19A 3KPMA 2XHNA 4YO0A 1QBAA 3KXFA 3BSZH 4KK8C 4WKZB 5IB1A 3TNNB 1XTLA 3WNKA 1J0ZA 4KO6A 4G9DB 4MA8L 3FFOA 1DVYA 2X9WA 4G5AA 4F7MA 1WITA 1I82A 1QHPA 1H8SA 4A7UA 2PP7A 2VM4A 3NYKA 5BQDA 1KIUA 2PABA 4ZYKA 2ID5A 8CGTA 1GJUA 4GQRA 2IH1A 3BZ4A 4MRCA 1RUQH 4LOFA 4L3EA 1GIGL 1QTPA 1V55B 2EIZA 4C83B 1NUFA 2VXQA 4JW3A 2G3MA 2HKAA 4ODUA 3TH2T 3NJGA 2YC1A 2YGOA 1H9VA 4DPBX 1IO4C 1WRFA 4GRLA 3BGMA 5A16A 5I75B 1DQJA 4XGZA 3WKPA 3O2WH 4JZJC 5FYLE 2B1AL 1HNFA 4LHUD 5F7MC 4YPGA 2VE6A 5ESAA 5EO9B 1IL1B 3W38A 1P5UC 1FZOA 4ETQB 3LNDA 4R7NA 1T03H 1KB5L 3MBEA 3PWNB 1T2QL 2EO1A 4XNYL 3FTWA 5ADPH 2A9NH 4GSQA 5CJQL 5I1LA 4UOJA 2JMRA 2VE6B 4DW2L 3PY9A 1CFQB 4OJCA 3AM8C 4JFUA 3O3EA 4LLDA 1HH9A 3V4VA 4G7YH 3JWNE 3Q1SH 2EP6A 3UZQB 2YOCA 1JGUH 1EWHA 3HMWL 1A0QL 2OR9H 4HCFA 2Q6WA 5GXBB 2WXOA 1NCIA 3LV3A 4DZ8B 4RGNE 3EJZD 2VDNB 3W0WD 3AWEA 3FUJA 4AOFA 1H8LA 2W1NA 4QF1B 2XWTB 4I1PA 4FXTA 1F2XK 2PCPA 2QV2A 4WW2A 4XVOA 4IRZA 2VDRB 3X3FH 2LAAA 4LGRB 1A8JH 1OSPH 2XXMB 4YFLF 3DRTA 4UAOC 4M4RA 3C6LA 1I9IH 4PJAF 3VM5A 3E6FA 3IFOA 1F4AA 3R7QA 4F5CA 1A4CA 1KLUA 2ZOWA 3KXFD 5G5DA 3UP6A 3VRJA 5I9QB 4E0RA 4ONHA 1XT5A 2V7NB 1VEOA 5L4IA 1R1CA 3FQXB 4HD9A 1BXVA 1G7QA 3DBXA 5J6GA 5I1KL 1ZLVK 4CRPA 3HC0B 1XQ4A 2XV6B 4WY7H 4G8IA 4ENED 1G7JA 4KRPC 4CU8A 2K3HA 4KOCA 4PH8A 2J1ZA 3OR6A 4R2GD 5IKCB 1VEPA 2E6JA 3IYLW 4GNKB 5I66B 3HR5B 1N59A 4BK4A 4ZOEA 4MNQA 4PJBB 1E2WA 2GTZB 3BVDB 5FO8A 4HPOH 5I1IL 1BZQK 1NBYB 4JY6B 2GABA 1NMAH 3RPBA 3VYNA 4QRAA 1MFCL 3E9TA 3UTZA 3N3EA 2BC4B 4H1LH 1M7DB 1N8ZB 3P3UA 4UOW0 4KNUA 4WI0B 1ZVNA 4JVPA 2AKRA 3DI2B 3UO8B 4JY6A 1CXFA 3HAEB 5C0CA 1OGAA 4OFYA 4NIYE 5D55A 3B9KC 4PGDA 1TTFA 3LAFA 4NQQA 3NSFA 3JUYA 2Z4QA 2DLHA 2V8MA 4JR9H 1DP0A 4IBUA 1U92B 4OB5L 2BIHA 4M93B 1L9TA 5CCKH 2WTRA 5EHFA 2V4LA 1ZHLA 1KYOK 2VTFA 3GJFK 3Q06A 1YN7B 2Y1AA 3JV4B 4FNUA 2QVMA 4DGIH 2YR3A 3B5GA 3WXWH 3KPRB 4HKZA 3LEXA 1D9KC 1U8PA 2KDYA 2WNWA 1BZ7A 3FUHA 3GHPA 2Q87A 5BS0E 4DKFH 4JQXA 4AYDC 1JUFA 1NA8A 3BISA 5IJVB 1IC1A 1BCIA 4DP7X 3VFMB 3FHQA 4HJGB 4PLJC 3ECBB 1FO0H 4MMYA 1I9JH 3IJSA 4I48A 4KUZL 4JKLA 5CZVL 2ICWB 2VLKA 4UINH 3P9MA 2IPKA 3OHXA 3TZVB 1KJMB 2WUCL 2OX5A 5JMRA 3QFDB 4JRYB 1ZVSA 3QDHA 1OTSD 1IKNA 3FH8A 3T4AA 2VAJA 3A4EA 4OCMC 2B77A 3U4BH 2IDTA 4OZ4A 4KKBD 1LE5A 1S7UB 3P9MB 3VFNA 4PYGA 3TJPA 3FQRA 1L9QA 5AKVA 2V8LA 4IYKA 3BWAA 5ERWB 2C3VB 3QHZH 4RETB 3BT2H 1KIPB 4Y19E 5LGJB 2CJTA 3DV6A 4B96A 2VLRB 1XF2B 1UXSA 1NAKH 3FB6A 4Q9RH 3G5WA 1ZTXE 1BZ9B 1QSFA 5C92A 4NN6C 1PZAA 4JREB 5CINH 1UWGL 5I15H 2HT3D 5T3XD 1D6EA 2OTUA 3R18A 4LLWA 4N0UB 1ZLDA 3ISYA 3P4OB 1G9NL 4M7KL 1MOEA 3BUYA 4NN7C 4ZD3L 2IDUA 1P6AB 3GSVA 4DGIL 4PVNA 4YVUA 4UDTA 1ZS8B 4I3GA 2LE9A 7TAAA 4WTQA 1ZRUA 3WL9B 3D4GA 4MA1B 2WXRA 2NNCA 2VC2H 4I0PA 3D2UB 5DMGC 1ZV9A 5KBLA 2IH1B 3DMMA 4TLUA 1I53A 5TE7H 4ZSOE 2EC8A 1JJUA 3FU7B 3OGCB 5ANHA 2ERJC 2FT7A 1T7WA 2ZKYA 4PREA 4U6HA 5EZOH 4GINA 4PJDA 3H7LA 4NFCA 2XKNA 2P45B 2J55A 4Y4HA 2W9LA 1U21A 1A1OB 1PZ5A 3F2LA 2IXQA 3EG9B 3C5XA 4UOW1 4UM8A 4BKTC 3EXLA 1NEZA 1A0QH 2IJ0C 3DSFH 5HDBF 3VU2A 5F1NB 5EBWA 1XGPB 2IAMD 1UTDA 2G9KA 3C87A 1OLLA 1FNHA 1RY7B 1HL5A 1MCFA 1Y7VA 3H2PA 5H8DA 4XP9L 3G5XB 2EKSB 4V1DE 3QZPA 4K7FA 4OSUL 3II2A 5E2VL 1JWMB 1MH5B 2CO1A 5IIEB 4HUWA 1OHQA 2WLYA 4FXGB 3GSQB 3KPNA 3KBHE 4DSYA 3ZKMD 4S1RL 5CD5D 2YOAA 5FCSH 1LEIA 3MFFB 1GXEA 5JXED 2FWSA 2CDEB 3NCWA 3LIZA 3C60D 2WKGA 3VGEA 4LHQB 2OMVA 2JIXA 5B39G 3I3BA 4JFFE 1QW8A 1G7MA 4R7XA 3QULA 4YXLH 3GMNA 2UXGA 3ABZA 3Q2VA 2AJ3B 3GXPA 1P7QB 3V5HA 1XSJA 2UY6A 4J3WA 5D1QE 4ZOCA 2YK1H 5ABAA 1FAIH 3STLA 1BM7A 3SKMA 3QI9A 3V6ZA 2PCPB 4GRLC 4TMPA 4WV1B 5T5NG 5HDWA 1OPGH 2NY1B 2OMZA 3OF6D 3VD2A 1JV5B 2CDGB 3NK4A 3D4CA 1JPTH 3KYNA 5KSBF 1Z3RA 3PWPA 3B7SA 4IBLT 2R0LH 1E4KA 32C2A 1ORSB 1WJ3A 1I8IB 4F9LA 2WXIA 4G6FB 1D5XA 3PHQB 4TL5A 4PIRF 4PLKC 3MZGB 5FF6A 1HT6A 3MRGA 3U9WA 4JQXC 1NLDH 5DJZA 3WE6A 2ZOKA 3LEYH 4K3DL 2RD0A 4ZXBB 1EXGA 3MLPA 2LAGB 4MAYB 2Y36H 2WIMA 4I5BA 1AOZA 1J9QA 4ODVH 3QEGH 5IWLA 4LHUB 3PHQA 1W91A 3M46A 1Z9NA 4WSGA 5IW6A 2DTMH 2P80D 3UBXB 1MWAB 5B8CC 4CSZA 1Y1UA 3U36B 4BKLB 1JNHA 4ODSL 4U6YA 2BY0A 5C6WH 2A74C 2XWZA 3JWNH 1KCUH 3J27A 1OAZL 1FG2B 1OALA 4ZODA 1XL4A 3ARUA 4EZKA 5CEXA 2J8UF 4YE4H 3G5YA 4PI2A 3GSXB 3PNRB 5A2IH 1I75A 5CJQH 4LLYA 4JZOA 5FM4A 1UCBH 3MROB 3EGSB 5L0QB 4ZNEE 3ESUF 3RI5K 3KPQA 1UB5B 1KC5H 2VDOL 4M7JH 3VMOA 4RX4A 3IDIB 3V4UL 4Y4HC 2FEDC 1CE1L 3E80A 4LNRA 4YHIB 4ZFGH 3ZKND 2Z4QB 4DQAA 4W1TA 1AJ7H 5FO9B 3IFNL 1DR9A 3CPUA 3AWGA 5CZRA 3DX7B 3EYSH 1KCVL 3ARBD 2K9FB 4TUJA 5F7BA 4YXKH 2ICEB 1CTNA 1ZV5A 3T1FA 2J8UE 4ERSH 4BCYA 3ESNA 4WGWB 4H88L 1X7QA 2BW4A 3FN9A 3JTTA 1FFOB 4PJEE 4RMUA 4CW1A 1U95A 4KXAA 2Q3XA 4CGUB 2WLZA 5K9QI 3OAWA 2ERJB 3LEYL 4TUJB 3HKFA 2AQSA 1NAMA 5SV4A 1V8HA 4UB0L 3GSNB 3MBED 2CKBL 4CSSA 5A2CA 3OZ9L 2EDLA 1IEAB 4LSSH 5FB8A 4W4NA 4Z3JA 1I1AD 4PJGF 4DTGL 1D5ZB 1HHIB 5SX5K 3QG6B 1OXYA 1NAMB 2QKIA 2WTPA 4RWHA 4UANA 3PDOB 4Q9RL 3DKHA 1DQJB 1KGYE 1EMTL 4MJ5B 2VLRD 1RURH 2BIQA 1AI1L 4B7IA 5DO8A 1E3XA 4X4YB 1QSED 3D9AH 2BH0A 4EDXA 1IBHA 4KAQH 3O2VH 4CKQA 2FJFA 3CHOA 5IJVA 4J3SA 2WGNB 2WBJB 4YFLI 5T1KA 1SJXA 5I6LA 4HQQL 4JGUA 4OT1L 2AQPA 3T08A 1IFHL 5F7YC 4OT1H 4OLUH 5TGBB 5T3XH 2BVOA 4BCZA 2WLIA 4UQ2A 4ODXA 4ESKA 3O6FC 1NINA 4DGVH 4JRYA 2YD3A 4HS8H 4QYOB 4YFDB 2WZAA 4ELME 1LO4L 1CGTA 3ES6B 1NGYB 4MTMA 3HFML 4NDMA 3ZO9A 1B0IA 5H35A 2DLGA 3FMGH 3FTVA 1N5AA 2MFNA 1YY8B 1NGQH 1YYCA 3BLPX 5DJXA 2CO2A 3L5WA 2BFGA 5JORA 3FPYA 1T5KA 3KWTA 1LK2B 1N26A 1IGMH 3UTTA 2YARA 3OKKA 4MD4B 5F3HB 5EDXA 5HYSB 4LPWA 2QADB 4H26A 5DVMA 2PCXA 2ZOLA 4Y5YC 5AW2B 5KUKA 5EV7A 1E4WH 4PBWD 1CFBA 1EZVY 4PRBA 3I74A 3B6SA 3IU4H 5AWNH 3PL6A 3MJ9H 3BT0A 5C6PB 4PD4K 1HKLH 4QRTB 3VXSA 4OF0A 4KNSA 1LO0L 2W59A 4V2CB 3LPOA 3O0RH 5B8CB 4NWUH 5L4FA 1MCLA 3LN5A 2DQCL 4MQSB 1FNGB 2A83B 5IK3A 4N1CA 3MRIA 4QWWC 3V0EA 4R26H 4QCIA 4PB0L 4J4PC 4A68A 2BNQD 3OJDA 2E7LA 4KKZA 1RK7A 1ZDSA 1B6UA 2J5LB 3WNJA 4AMXA 3NCCB 3NCXA 3CC1A 3AXLB 4M62L 3HE6D 4PM1A 2YPVL 4ZS6D 4K94H 1GL4B 2MOQA 4WNQB 3IAGC 1N64L 4NX0A 4MFHA 2BP8A 2CDFA 4R0LC 3ZQWA 2RR3A 5DVNA 1MVFA 4IRSD 2ROXA 5J6HB 2HB0A 5DU7A 4DVBB 2KPWA 3KYMA 4M5YL 1YEGH 5GGVL 4FNQA 4AW4A 4HS6A 5FHAL 35C8L 1EQWA 1SM3L 4HZLB 2CGYA 5E2TL 3RNKB 2ADYA 5BO0D 3HZ3A 3P4NB 1UWFA 4AQEB 4IU2A 4ONFH 3T8VA 5LAXA 3QIWD 1DLFH 2DIAA 2WXQA 3TPUB 1GIGH 4MSWA 3HS9A 1C08B 1U9KA 3MO1B 4RDQF 3KPOA 4A2GA 1Z5LB 4OKDA 3MOAL 1E27B 3B9VA 3VD0A 3IDNB 2R2EA 5SWSD 3X11A 1SBSL 3WIFB 2PLTA 3PV7A 3PWUA 4XC3L 1IAOB 2X53A 5IBTH 3TTYA 1U30A 1WFJA 3RUGA 1G7HA 5F7WC 3L48A 5IHZA 4Y4FB 3VXUA 4TRPH 2X4QB 3ISRA 4PLJD 3GF8A 2IALB 3NSYA 4HC1L 1P7QA 4NUJA 4YHYC 4B9GA 2DD8L 1QA9A 2B4CH 2NY2D 5HHXL 4YBHA 2B4CL 3X11B 3SPGA 3BH9B 2GJ6D 4FKKA 1ZIAA 3VXUD 1S8DA 4GS7C 4JHUA 4ORGA 3SEPA 2G3XA 2H2SD 2GY7B 3HNTL 2IGFH 4OCXH 1UYWH 4X6FA 3SGDI 1HJCA 4N25A 3L6FA 3WAJA 4M43H 32C2B 4X6DE 2ZYIA 4UTBH 4J3OF 2YD8A 1G87A 4WW2B 1TTAA 2R1YA 3ZDWA 2JCWA 3LEVH 3SYAA 3G7TA 1BVOA 1ZJBA 3EFOA 3KLDA 4WJG3 3IMWA 3MROA 1K72A 3APDA 2VDMB 3V9CA 5ILTH 4I5BB 4FMVA 4ZPTB 5F8QC 2K0RA 2VDPL 5CP7A