1RL1A

Solution structure of human sgt1 cs domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
SKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human Sgt1 Binds HSP90 through the CHORD-Sgt1 Domain and Not the Tetratricopeptide Repeat Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein degradation
molecule keywords Suppressor of G2 allele of SKP1 homolog
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1rl1A00
4JUTA 4ZJ9A 3VQMA 2Y22A 2XCMC 2K8QA 2MNWA 2CR0A 3N3EA 2Y1ZA 4JUSA 4YL9A 3L1EA 2KMWA 3Q9PA 3GT6A 1X5MA 4PBDA 5DS2A 4ELDA 4YE0A 1GMEA 3QORC 4FEIA 4M5SA 4YLCA 3AACA 2KLRA 1WH0A 1WFIA 3VQLA 2WJ7A 2N3JA 3L1FA 4I88A 3L1GA 2RH0A 2WJ5A 4M5TA 4PCKA 1WGVA 1RL1A 3J07A 2JKIS 3QORB 4MJHA 4RZKA 2Y1YA 3GUFA 3EUDA 3QORD 3AABA 3W1ZA 3IGFA 4YLBA 1SHSA 3GLAA 1EJFA 2N0KA 4YDZA 3Q9QA 5DS1A 5LUMA 2BOLA 2CG9X 2O30A 3QORA
chains in the Genus database with same CATH superfamily
2L7EA 1R24A 1MRDH 4HKXB 4JKNA 4QO1B 3JBG7 4C8XA 1NCWH 3BUBA 3DJTA 4QXGL 5CP3A 5DO2C 4FTVE 5E4OA 4KOBA 5B7EA 3VGAB 3IRZA 1EEQA 1KY7A 2ROXA 4BA0A 3MREB 5CEZL 1AQKL 2ZWZA 3LN5A 1TJIL 3INUL 2YLKA 1DJXA 1IO4C 5D2LE 3OLDA 1PTZA 2RGSA 1UWEH 4YFLF 4MB4A 3CN1A 1NMAH 3I3DA 5ECJE 1B4JL 3PP3K 4QT5B 3KBEA 3US9A 1NLBH 3PHQB 4YHML 3MQIA 5EA0L 1DBKH 2LVCA 1CFVL 1DVUA 3B9VA 3RVWC 4YDLB 5PAZA 4RGNB 4Z7NE 1P53A 2J8HA 1HEZA 2IANE 1CTOA 3PABA 3QJHA 5EOQH 4TOYH 1KELH 1RUPL 5KVFE 1KFAH 2R0WL 5HDBB 1V3JA 2WTRB 3PHOB 4TQPA 3W0WD 2FECL 2X4QA 2ARWA 4X6CA 5HYJD 1QASA 1QR1B 1E42A 1UGKA 1ZSDB 4Q74A 4FOMA 5I0YA 3FYIB 3GMQA 1UD2A 3X13B 4BE5A 4OD1H 1LEGB 4C83B 4QRTA 3UX9B 3K5SA 1A14H 2WXHA 1PQZB 3H3BC 1FVCA 3RVVD 1J88A 4GBXC 4JJ5B 1W91A 4KY1L 4URTB 3R19A 1G1CA 4YL9A 1PSKL 1QO3A 4IRJC 4IRSD 1YEHL 5KVEE 2ICWB 2AJVL 4NN5B 2OMBA 1XEUA 1C8QA 3ULVH 2YSSB 1DFBL 1DN2A 2WJ7A 1ORSA 1WIOA 1OP5H 4EVNA 3C9NA 4IJ3C 2CKBL 4TVUA 3J07A 3VA2C 3S7GA 3D08A 4G9DA 3OG6B 1FPTL 4I9WD 1XAUA 4OCSH 5EN2A 3TM6A 3C8DA 5INCB 2ED9A 4KK6C 2YQGA 3ZIMA 2E0PA 2I9LA 3BWZA 4N2GA 1XF2A 1FVDB 1NEZB 4GI9A 3RGVB 1U8OA 3MX0A 2ESVA 4FFWC 4Q6IC 2ZT9C 4BSWA 4KNQA 5DUPL 1KBVA 3HUJA 4Z1PA 1UEMA 3S3SA 2Z8SA 3JWOH 3M6DA 4ZS6C 1R3KA 3LKQA 2J55A 1Z9SA 2F53A 4X6EA 1XF4A 1JV2B 2UWEA 4JG0L 3KZ8A 4UNIA 1M3IA 1ND0B 1ASOA 2MPVA 4KO5A 3IWVA 4JY6B 4NT6B 4FRWA 2WO4A 3ZKMD 4F92B 1U2CA 2O5ZL 3GKWH 3PQYE 4O4YL 4APXA 1OTUC 3LYRA 1GGYA 3GSNL 2H1PL 4PJAA 3NSYA 2QGEA 4WSKA 4BV1A 4AE0A 2PMZA 4R84A 4P2YA 3ZE0E 4PTUA 5TE7H 4HBCL 2J88L 1E50A 4RGNC 3Q8BA 2EYRB 2YSTA 4W4OA 3TNNA 4A2MA 4JM2C 3AY2A 1IB5A 3BZEB 1KXVC 3W0WA 4DHLA 2ITCB 5CZKA 1LP9F 4J28A 4KUZL 4OJEH 4XOBA 1RZGB 1JJUA 4KY2A 7FABH 2I26N 3L3HA 3H9HA 1WBZB 2OMWB 3RKDD 1JGLL 2X2YA 3UP1A 3VGGA 1S9XA 5I1GL 2VO8A 1D2OA 3BP6A 1WQVT 3QR0A 3F7YB 3EYFA 3GBNH 1RUML 2IH1B 5EDSA 4NRYB 4GINA 2V3FA 4RMVA 3RPIB 1UYWH 3EJJX 4EZMA 5CCKH 1JPST 4NRZA 4KFZC 2OW6A 3OR6A 1ES0A 1JHKL 4AEEA 4NZJA 1L6ZA 1Q94A 4UOW1 1FZKB 2WYIA 2YPLB 3TVMA 3G5WA 1KTDA 1UC6A 2P3YA 2WKGA 4A2FA 1AP2B 3LKNB 3VWJB 3GJEA 3FTGB 2NY2B 4QHKJ 3GMMB 5HHNB 3S96A 5E8PB 4ZMOA 3RUGE 3RPKA 2J21A 4FGMA 1ZLEA 3RJQB 4ZUSB 3MLUL 1UFGA 1WYJA 1W80A 5AUMB 5DT1L 1CDCA 1PEWA 2A38A 4WTZG 5EZOH 4F20A 5D7JB 2IXQB 5MI0B 3U48A 1SOKA 3FO0L 2NY4D 5GSVB 2JKIS 4PJ9D 3L9BA 1OGAE 1K5NB 4NZTL 1NIEA 3G6AA 4ZFZA 1DCEA 4I48B 3GQFA 2A6KB 5I16B 2BVQB 2ZCKL 3N43F 4HKBB 4KGLA 3KPRA 1K8DB 3MXWL 1CFQB 2QEJA 4Y2DB 4E5XB 3N04A 3FT3B 1U8NA 3KH3A 2J7LA 3AXLB 1DJIA 4QHPA 4OAWA 5JA9A 2ZAGA 4ZD3H 4XWGH 3GK8L 4CVZA 3V6BR 4M7JH 2J3SA 3MJWA 3QHZL 5AL0A 3IMTA 4NUMA 4QDGA 2X4RA 1RULL 4N0FB 4AYID 4F5CA 2BWDA 1LDPH 4PRBB 1CBVH 1GTFA 3IT8D 4XT1C 3NZHH 4JQVA 4U1JB 5EZLA 4CNIB 1MI5E 4JPSA 3H3KA 1Y6NR 2VDPH 3CX5J 2HMID 4A1RA 1LP9A 1B4LA 3OJDB 1ZHBA 4H1LH 1KG0A 4M7ZC 2PW2A 2QZ5A 3L2LA 4G72B 3C5SB 4YPGB 4I77H 3ETBJ 3VB9A 5AW3B 3QORC 2RQEA 5IB3B 2AK1L 4DJMA 4L4TA 4NP9A 5C6TH 3BMWA 3RVVC 2WXJA 4JFFB 3ESOA 5IW6B 2Y7MA 3RDJA 2ZUYA 1HAWA 3H3PL 4FYQA 4Y1AE 2IPKA 1JGLH 5DQDL 3D39E 4ZMYA 4V1DA 1MF2H 1DBKL 1T7VA 4QJ5B 1MHHA 3PQYB 2JKJA 4WU5B 4A63A 4I3RH 1SYSA 2ATKB 3GZQA 2WAQA 3DIVA 1MJ8H 3GBML 2GT9A 2Z0BA 4GAFB 3DOHA 2I69A 4PJ7E 4XP1H 5DZJA 4Z95H 4ACTA 2ESVD 1AQKH 2IWKA 3OR7A 1MFCL 4XPBL 5C0BB 1O7VA 2QDVA 2EILB 5FO9A 1UKQA 4KNUA 5DD0H 3DETD 2XI9A 4JKWA 5DA0B 4JZOB 3NJFA 4DN3H 4CVXB 1BEYH 4JZJA 4IIQC 3UBFA 2OJ1A 3ARBD 2ENYA 2OMVB 2VTFA 4NQCA 1CGSH 3EF4A 4TSCL 3PDOB 3MRMA 2Q1EA 4TVPL 1GSMA 1N3NA 4J2XA 4IHOB 4LOUD 3FF8A 1ETZA 1MDAA 4MMZA 2VMCA 1VERA 5CIPA 5DVLA 1JZ6A 1NKGA 1KN4H 3BHBB 4HLZG 4YN3A 3IN0A 3QNFA 2Q3ZA 2ZUVA 3NA4A 4OFYA 3WXVL 3ZE2E 3C09C 3L81A 3LPWA 4PCSA 2D4DA 2HFEA 3IU3B 3VI3A 4P9MH 4L8DB 5EWIH 1HZHH 4WW2B 1TXKA 4ZPTB 1FPTH 2DLGA 4OCSL 4JREC 5LBSH 3ROOB 3Q2CA 3MLRL 4PFEA 5CZXD 3P4OB 2NW2B 4YWGL 1XB3A 5GGTL 1UWYA 5AVYB 5JHAA 3RRQA 4PJ8A 2WMPB 3ZTDC 5EO1B 4P0DA 4JR9H 3GM0A 2DYPA 2NY3D 3SE3C 2EH7H 3H4HA 4H20L 4FADA 3VXPA 5BZDA 5TE4L 2KI6A 2HSIA 1TTAA 1RL1A 3VE0B 4LZKA 4PG9A 4QRPB 5LGJB 3QFDA 1NAMB 4U0RB 5T1MB 4H25A 4E9RA 2H26A 4PGEB 1ZA3B 5AWNL 4GXVL 2VN4A 5LNEA 1N8ZB 3N55A 1B4RA 4BKLB 5KWYC 5A6IA 3IPBA 5HD8C 4PBDA 3SOBL 3ZTJG 4HJ1A 1ZHKB 3JWDL 3GK8H 3SE4A 5KBDA 3H7BB 4H44C 5KS9E 3T2LA 3JV4B 2AJYL 4F7TA 4P5SA 5LB1A 3NJVA 4J4PC 1UKTA 2VN7A 4Z77A 1EO5A 3NP4A 2GCYA 4I13B 3QDGB 4A55A 4MCZA 2WKLA 2YEQA 3NCYS 4ERSH 2WQUA 1H3XA 5TDOA 1ZT1A 1XF3B 4H8QA 1FL5A 4UIMB 4KITB 4KUCF 4WFFD 1MIEH 1T0OA 5KYXB 1F11B 3EDFA 3T1FA 1GZQA 4WJKB 2O6FA 2WXMA 3NFSL 1A6AB 2WP3O 3NAAL 5ICUA 2J56A 5FKPA 1H6FA 1CD1A 4OF5A 4Q6IA 3OV6A 4MNQD 1KNOA 5BOZG 2NR6C 4BUHA 3QXAA 5IR1B 3D85B 1P7QA 3U0TB 2AQ1A 2IADA 5B3NA 3DUUA 5J12C 5B4MC 1A4BA 1ESOA 4M1CD 1RSFA 4IBWA 1L9SA 1Y0LA 4N20A 3K2UL 3CZKA 2X2UA 4YHPB 1DEEB 2CKNA 3U83A 1ZWIA 3FTSA 2AK4A 4Y5VA 5D2LA 2DTSA 3KCPA 3NIFE 2N01B 4K3DL 4NCC2 5DMIL 1ZLUH 4DFIA 4LLUB 3UGXA 4R83A 3WIIH 5CF3A 2CHDA 2ZOTA 4LEXH 4FXGC 1B3JA 3MGOA 5F7DA 3BFOA 2O5XL 5C0CD 2AJ3B 1YRKA 3FTXA 2DRUA 2QQQA 4KRNA 1UG9A 5DGRA 3CN3A 4CL7A 2F19H 3OXSA 4HIHB 2Y1YA 1YMMD 3NFPA 4MXVF 1FGNL 3BAIA 2MQ0A 5AZEL 3RJOA 8FABB 4RISH 2NR6A 1X7TA 3H1ZA 1B0IA 1Q9KB 3VRLE 5IQNA 1CFBA 1YEKH 2AV7B 1A5FH 2Q7YA 3TIDB 2VQ4A 4WW2F 3ZL4L 4XMKL 4JPWL 1IM3A 1LLAA 1RZJC 3E6FB 4JY5L 1AI1H 4OCRL 3R1GH 3X1GA 1P4IL 1YPZE 3U46A 4EN3B 3JQOB 1T1ZA 3QHTC 4HAKA 4H88L 4RAVA 4EI5D 4TL4A 2QVMA 2DQ6A 3ZLQC 1XGPA 4R90L 3EDEA 3D52A 1E4KA 4NKMB 2WINB 5IROA 3NCYP 5HYJA 3SKJL 4G7VL 1E2ZA 4AVIA 3N1FC 1G9NH 5DJZA 5D7IE 4YHZH 1GIGL 2NY2D 2IG2L 4PQXA 4MBOA 2JCCA 4WWKB 5FGRA 1MLBB 5K33A 3W82A 3QULB 3AWEA 3WJMB 5KSAB 4FEIA 4BJLA 2VRKA 3GBEA 2Z8RA 3HJEA 4S0HA 5EIIA 5KVGL 4RZKA 5E9DE 4P3DA 3U6XS 4K2UH 1J10A 4BQBA 4DH2A 3RA7L 1BVNT 1UA6H 2XN9E 3L7FA 4POZC 5IVZB 4GSUA 1CICD 3WMSA 1F56A 4RGMC 4C56A 1QLEB 1H8SA 2JTDA 3D18A 4PP2A 3ATFA 4UDUA 3QEQE 1CWVA 1QWHA 2AZUA 5FB8A 5IMOB 4XO4A 5FECA 1LE5B 3CU1A 3WEBA 3MXVL 5J0BA 5KVEL 2EYTA 3QZWA 3CSFA 5D2NE 4GW5A 3G6DL 1JWSA 4XMZA 5C0CA 4XVJH 3CSYA 4EDWL 4RESB 3L3IA 3POCA 4HKJB 1U3ZA 3QUHA 1ADQL 4ZMXA 5FGSA 3IN2A 2OXHB 1HDMA 2VWEE 2WGXA 3VJ6B 4YHYB 2OCCB 3MBWB 5D5ME 3ME0B 3VXMB 2EKSA 2XIBA 1O0VA 2Q86B 4W68A 3SGDH 2DZEA 3T0DA 2FX8H 4M7ZB 3SJVB 1KPVA 1CIDA 2IBGA 3GXIA 5J1TC 1K6QH 5EBMB 5KAQG 2E4FA 2ARJB 3PWPB 4UT6A 3UEQA 5HHVH 1I8KA 4LF3B 5FGCB 5E2UL 1BQHA 2XWZA 4YFLI 1U8CB 3IJEB 2A99A 5LNDA 2W0PA 3BVTA 3WSQL 2CLVA 1J0JA 1IM3D 1EZLA 4MJIB 4PRHE 3FT4A 4TUUA 5A16B 2W0FA 1S7SA 3SQOL 5HD8D 2Z1KA 4XP6L 1JGVH 3QJFA 4DETA 2ZXQA 3O9WA 1VENA 4M61B 4AZUA 3HPJA 5FYKD 1NCDH 4QNPE 1IC1A 3RX5A 4PB9L 5C70A 1T0MB 2P47B 2VLKD 4Y5XB 3E9TA 3C6LB 1MCNA 1QRND 2KZBA 4IIQB 5CR1A 4GP4B 4QYAA 4WSGA 2CRYA 3ZDXF 2FWOB 4G9FE 2B1AH 2CR6A 2D03H 2WWOA 1YZZA 3FPXA 2WQRA 4Y2LA 2BFVL 4TQIA 1P7QD 2AQTA 3DTXB 1T5WA 4PYHA 2V9RA 4LPVA 5DC2A 4JO5A 3ZTNL 1F6FB 4XP5H 2XDHA 1AS8A 1WA0X 4CILA 1D5ZB 2IGLA 4FQXC 1IEAB 4KXCA 5K93A 3R7QA 2MMXA 3FBQA 1I1YB 4MA1C 2F1BA 3SD5A 1PMYA 5ALCL 3QUML 4JFHD 2CU9A 4RMWA 1U95B 4OLUL 3TH3T 5I8EA 3SYQA 3MV11 3ULSA 1J0KA 3D0VA 3AT9A 1BZEA 3CDZB 2GG1A 4FQXA 1KCSL 4F91B 1GTNA 1OQOA 1Y7VA 2NY6B 3WKNA 1LJMA 4JFSA 3CHOA 4NHUB 5IEHB 5IKCA 3MJ8A 3CHXA 5KYUA 5IFJA 3VGDA 3TBSA 1OAXL 5DDHA 2BIQA 2CAKA 4MHHG 2OL3A 3ESNA 5BS0B 2VYRE 1NMCB 3HG1A 5KBLA 4TV3A 1E40A 3HKZA 3SDCC 1XR9A 5IV2A 4U1IA 1ZLVH 1W8OA 4LLWB 2F53D 4AH2B 1J05A 4RX4D 2VXVH 5K39A 1NIBA 3VG0L 3MV7A 2ZCHH 5EZIL 1EAOA 4AMKL 2OLDA 3L08A 5IJVA 2QLVB 4QAMB 3W38A 4EI6B 1M7XA 2X2HA 3V5DA 3D6GA 3NAAH 1JRHI 4GKNA 4RDBA 1CU4H 1OLZA 4N86A 4Z3GA 3LKPB 2L04A 4PJDF 2KYIA 3HZKA 4BGLA 1TYEB 4GUPB 3BWSA 1NIFA 1JGEA 1MFUA 2V9TA 4HD9A 4F2ME 1AKJB 4CW1B 4MDIA 2VDKH 2X3AA 3QJTB 1PKQE 2P24B 5G4NA 2XRAL 2HT3C 3NCBB 3APNA 5AVWB 2H9GB 5DR5L 3LN9A 3APCA 3MRPB 3RIKA 5E8DH 4AL8C 2CLRB 1PFCA 4WWKD 4UU9B 3P02A 4HLZH 5FGCE 2GUOA 3UFIA 4GUCA 2WPGA 4G80A 1MVUB 1CXLA 4LEOB 1PZUB 4PSRA 5I30H 4XI5C 4S1SL 1R3LA 5HDLA 3SDXB 4EOWH 1OTSD 1J5OL 1JV5B 4PM1A 1SJXA 2X4SA 2V8MA 2FB4L 5H37G 1TLMA 4Y9FA 1ZTXL 2PO6B 3KLAB 5E95B 1OK8A 4MLSA 4HQQL 1XGZA 2D0GA 3KJ4C 1RZQA 2VM9A 5ANMA 4DP1X 1TCMA 4MQTB 5A3ID 1A6UL 4J3XA 4APQD 2CGZA 3LHPH 5AAPA 3GRGA 2VQ1B 3C8KB 3HNSL 4GFXA 4RISL 4P2RA 1TPXC 5J9PB 5L6YH 1VKXB 1Z66A 2LABA 4FQQA 1R33A 1JF1B 1F8TH 2YUZA 4PBWD 3ZE1E 1IC5H 3OJ2C 2XFGB 3VXMD 3IDNA 1IGIL 1I1AD 4MVBD 1X6LA 4XNMB 3QG7H 4U6HA 3RURA 4FXGB 4RMSA 3VXNB 5MHSE 4KMTL 4TXVB 5C0RH 1QQDB 2IH9A 5D2NA 4LU5L 4WWPA 1PZAA 1CFSB 3QUZA 4YSEA 2J5LC 4V11A 1A6TB 3NSJA 4PJ9A 4UOW0 4YE4L 2BFGA 1MZZA 2HJFB 5D8JL 1F42A 2B4CH 4UTCA 2PWDA 3WEAA 4GJTB 3RDTA 2CUAA 3H0TA 3PGDB 1YMMB 3MKGA 3SPGA 2Y7LA 3AB0B 3UGUA 1YA5A 4DUWA 5EEZA 3JTTA 4O02A 4KI5F 1QFWM 2HFGH 5J06A 5BV7B 1KDIA 3QRGH 4DGWC 3U4BL 5KSAC 1IVTA 1NFAA 1P7HL 4KRPB 2GITA 4AITA 2DWDA 2ZZUT 2UY7A 4KQ4L 5E7BA 3RY5A 1DVFC 3T3PF 3Q43A 1QW9A 5DVNA 3APMA 4QXWA 3EZJB 3NACH 4OI8A 3BXNA 2JJTC 2OTUA 2YEZB 1RZFL 2YPKB 4N1CA 3QCTL 2BSRB 3EO9H 3LEVH 5BO1H 5J56B 2B1HL 3G6JB 3RTQC 1E28B 5T3ZD 4RLDA 5FM8A 3GSUA 2QSVA 2A6IA 5TE6L 3LRKA 3KL5A 3QFGA 5BQDA 5SWZD 1KFGA 2AEIT 3TPUB 1EEYB 3ARRA 4E41E 3VXSD 1OGTA 1NM9A 4AYMC 4LSVL 4DOHE 1MJUL 3BPLB 4XBEH 2Q6WB 2UUDH 4Q4EA 3X3GL 2BC4A 1O9WA 2YWYA 3ARDD 4KVNL 3AACA 5D1XD 2W9DH 5DUMH 3WFCL 3ZGIA 3RWCB 1TFHA 3JT2A 4EEEA 3DXAA 3L5XH 1KIPA 4K0OA 1T0PB 3NDZE 4P2RD 4GIOA 4DAGL 4EZKA 2X38A 5IMKB 4P2AA 1IKNC 2V7HB 3F3HA 5F1SA 5DRXA 2X2JA 4GP8B 4HWZB 4QRRA 4U1SA 1R3HB 2EDJA 2FEEL 2VDKB 3DX0A 4YHYC 2H0JA 4X0NA 1O9VA 2G60H 3MU3A 1SLXA 3HBQA 1Y1UA 4DGUA 4K5NA 3TFKC 1NFDA 3B83A 4NQCD 2EICA 2FO4B 1REIA 3B8YA 4OKVB 1JN6A 1Y18B 3D25B 4BH8A 3ECBA 5BMFL 3JTSB 2NSQA 4KX9A 5E6UB 4PWFA 1HC1A 1ZY9A 5M94B 4QR7A 4HA1A 4P5TB 1U58B 3RNKA 4DKFL 1XGUA 1BFVH 2FSDA 2C7FA 3S8FB 4J23A 1HEJC 43CAB 2XPGA 3T3MF 3VFTB 1DVZA 3TO2B 3RI5F 3TN0A 3DYPA 3QIWD 3BSZH 2BHZA 3FQTA 5E8OB 5TGBA 5ITFA 2YXVA 4R5TA 5AVRB 1HSBB 4TKWA 4GW4B 3O3AA 3B9AA 2MQGA 1UOLA 1HXYB 3MBEC 1TU2B 1RV6X 4HC1A 1MWAL 2EEFA 3AGVA 2QFRA 4A2HA 2VGLM 4NFCA 5HHXL 5ESVB 4WUUA 1X5AA 5I1AB 2TRHA 4Y9BA 5D7HA 5DJ0B 1IL1B 5J6GA 5AVVB 3VXSA 1H3TA 1W9XA 3F6JA 4R6UA 1IQWH 2BNRD 2WVVA 1GGIH 3ARFC 3EGSA 4MD5B 3CXDL 1FYTB 3QUYC 3EYOA 5AW7B 1QX1A 1AGFA 1URZA 4I3RL 3HC3L 3LXUX 4PCYA 3HE6B 4X98B 5E6IC 3AG3B 2VLJB 3TFBA 1AGFB 3JUYA 1MLCA 4BELD 4HS6A 1RZPA 4KTYA 4OLZL 4JPIA 3UJTH 5A1AA 1I9IH 5C2UB 1ZJAA 4JG1H 4Y8AA 1UOWA 1E9PA 3B7YA 4J3UA 4IRSC 2QQLH 2FLRT 2C1OB 4HHGA 4AVKA 3QCUL 5FYKU 1BLNB 1U93B 5EU5A 4KFMA 1ZTMA 4KAQH 4NQDB 1P5UA 3RWHA 4Z8FH 3RY6C 1DBMH 1S7QB 1I1AC 4MVBC 4DN4H 1WZ1L 4JM4H 4NN6B 1S8DA 4JZJC 1G0XA 5ITFB 5TGBB 4WI5A 1NFKA 1DL7L 3IKCB 2CJTA 3PGCA 4V1DE 5TE6H 2HFFB 2V37A 3ISYA 4HH9A 4K8RC 4CVUA 4XMLL 5JO5A 5I1IL 4FQCH 1SUJA 3X2QB 2PWHA 2P9RA 5ENWA 3O2WH 3KYMA 3CUPB 4TSCH 3SYPA 43CAA 3ZZ1A 2R0LL 4OT1H 3CFJA 3V5HB 1S6NA 1XX9C 4KI5D 1SOQA 3ARGC 3IFOB 2WAHA 3GSOA 4P99A 4BYHA 4OD3H 1JGDA 3K1KC 3I84A 2HLAA 2UZYB 4J8RB 5EO9B 4UUJA 1AI1L 3S9DB 1EMTH 1A6ZB 3UZVB 3QCVH 4NQCE 4XNBA 3D3VD 3DI3B 1SXBA 1JRHH 4MCMA 2WQWA 1SMDA 2N0KA 2K3TA 4ZUWA 2CLZA 2IAMC 1EK3A 4J27A 1HESA 4MAZA 5C08B 3CPLB 3BKCL 4PRPD 1F1AA 1RURH 4NKOB 3BIKA 4ZMPA 3SKMB 5AL8A 4NHCH 2PN5A 5BRZA 2EEDA 2FSEA 2JB5L 3DSFH 3O41B 2AFNA 3ALXA 3R0MA 1FRGH 2YC1A 4FFVD 1GKOA 1E67A 4XN1A 1H3WM 3GGWA 1G5AA 1TMCB 4ZO6A 3CZFA 3GRWH 3LPFA 3MNWB 5EBLB 1E4WL 4JL1A 2C3VA 4BFOA 2WQSA 1U8QA 3FQ2A 1M71B 1QFUL 2XQYA 4M03A 4G7RB 2VLRE 1KWGA 4GKSB 4X6DA 3SBPA 4JZNA 5HYJE 2BVPB 2Y7OA 3OHXB 5IJKA 1JPTH 1YHPA 2ENSA 1UACL 4YO0B 5EMYA 2I5YH 3BQUA 2Q3AA 1SF5A 3ARFD 5ETUA 2I9TA 2DQTH 1UFUA 1TVBA 3AG2B 2UZIH 2QZQA 3KDMA 4QI3A 2Q9OA 2X4UB 3B5TA 1ZA6B 3U4EA 4APQB 1AJ7L 3HPLB 4UB0H 4AIEA 2WZ6A 4L37B 1KV7A 1TEFA 3G6JA 2VDLL 4QLRA 2YPKA 2Y72A 3CFCL 4CC1A 3MXWH 2B4CC 1T4KB 3T2NL 1G7MB 5HDQH 4BEIA 3SDYH 3WAKA 4AK1A 5ALBH 2J5LB 4YZFE 4JQXC 1EWHA 3Q8EA 9PCYA 1T03L 3KPSE 3WKML 2X10A 1PNDA 4YOKA 3FO0H 2CHXA 5EOCH 4A6YH 1HINL 3RLSA 3HC0A 4N25A 3O2VH 5LLIC 4IEFB 1K4CA 3WIFB 1NGWA 3ENEA 5DT1H 3H0TB 3PGDA 4TVPH 3QJSB 2QPSA 3ARPA 3ARSA 5K59F 3NZ8B 2X9YA 1F4YH 1R47A 2BS9A 4HAFA 1A6TA 1M42A 4PJ9B 3DX7B 1C9SA 1QRKA 1SEQL 2QQNH 2YD8A 5FW6A 5TQ2L 5BS0E 1XIWB 3FHQA 3L9RA 4LK4A 4PRIA 1PCSA 4EBQL 2VW7A 3T4AB 3H42L 1N2RA 1JZ3A 4WNJA 2A5UA 3GB7B 1J12A 2RHEA 3FSVA 3PL6A 4ONHB 3RUGA 2E7HA 3QS3A 2P45B 3MBED 4FTVB 4OIAA 3X12A 1UZ6E 1AO7D 3TCLB 4J3WA 3TNMA 1LD9A 3P4NB 2W81C 4FQQB 4X5LA 3MRKB 4KKCD 5DRNA 3MA9H 2Y4SA 3K4ZA 5J9PA 1IC7H 2IQAB 3FC8A 4HIEA 1PG7X 1KTLA 5LBSL 2D7QA 3BDYL 4KGJA 2G5BB 2DL9A 2YMOA 5E5MA 3JYBA 4B3VA 1WS8A 2BJMH 1P2CA 3HR5A 2B9AA 1V3MA 3V5KA 1B9KA 3RWEA 2O72A 4WHTB 4HIXH 5C0JA 2H4EA 2O61B 2GBUA 4G6KL 1VSCA 1KEGL 4GG8B 4X6BB 4XCYA 4ZX5A 1P7BA 4JO3H 2UXVA 4X6CE 2VMDA 1BBJB 3Q6FA 2QPDB 5C71A 4GQPH 3CFBA 1KIUA 4LCIL 4U6TA 4TTGA 5ISZA 5FGBA 1OT4A 3M1CA 4CA4A 2H1PH 2J8UF 1D6VH 3E1ZA 4OCLC 1RZIB 3RAJL 2Z1PA 4ODSL 4ANKA 4E9QA 3BN3B 5AVZB 2XU9A 1F6LL 1K9TA 4OF7A 4HUWA 3FN0H 3FJTA 2AEQH 5FFOA 4R9HA 4XPHL 2BOBB 5JPNB 1JAEA 5AVSB 2H9GA 1FNSL 3LIZA 1IC0A 4R7DB 2IAMA 2BNQA 3W9EB 1WAPA 2GBTA 4IDJH 2OP4L 1XB8A 4MQ7B 3DJZA 3DSNB 3MRRA 5ADOL 2GFBB 2XPZA 3OKKA 4NWUH 4J4PD 4DKEH 5HHPB 4L1BA 1OSPL 2DQUH 5J13C 2IC2A 2W0KA 1T20B 2XA8H 3BIAX 1OP5K 4A2GA 4BFIB 3ELQA 2IGFL 2ZQKA 1IV8A 3V5DB 4F57H 3FCUB 1WWCA 1GW0A 3MNZA 4X4YB 5IJVB 2X7LA 5F9AC 3BPOC 3OKEA 5E00A 3TZVA 1E2VA 3VSTA 2VXUH 3QUXA 3ZE1B 1WWAX 4U3CA 3LMJL 4MJIE 1KGYE 1UCBH 1L9OA 1TOXA 1JFQH 1RZKH 3TBYB 4FA8A 1MY7A 1YNTA 4XXWC 4D9QD 1TSRA 4H5SA 5DDHB 2HMIC 1W2KT 4N2FA 2HJLA 3MJ8B 3MRIB 2HJKB 5HHXH 3FBKA 1EXUB 4D0DB 1IAKA 4OU3A 1I9RH 3G7TA 4YMPA 1OGSA 4OCYL 4ZUUA 4XZUA 4M00A 5IMMA 5HDOA 4AYFA 5DHYA 2M1KA 3J7HA 3R7RA 3FH7A 5JPNC 5ICZB 1IAOA 2H32H 3G6DH 4GRMA 2CUIA 1QOKA 3BDYH 1LK3H 3ARFA 1DUZB 3VGEA 5GS0D 4PJEA 4FJZA 1JUFB 4D9RD 4Z7QB 5E00B 1A65A 5KSBF 4U6VL 3MNZB 5F7LB 4L23A 4X4YA 1QRNE 4QXVA 1URIA 2D3JA 1OL0A 4K2UL 5J13B 1DQDL 4X9HA 5GGVH 1R34A 1BJ1J 1DBBL 4H26B 3BO8A 2W38A 4GYBA 4P2OD 2BIIA 4AIOA 3Q0HA 3H42H 4QWWC 3BD4A 3U7YL 2I7SA 3HHMA 2DD8H 3V0JA 4I2XE 4TUKL 5ACZA 5E51A 4D0CA 3GIVA 2X1WL 1RU9H 4S0SD 2C9XA 5DUBA 5TJWK 2R39A 2GJ6A 3F00A 5HGAB 2IAMB 3UEZA 3NGBC 1U2HA 3AG4B 5BRZE 3FT4B 5A16A 2F1EA 4MD0B 5FC9A 3OX8A 4PJXE 2R1YA 1MG2C 1LNUA 3VD0A 5DHXB 5BVPH 3EBGA 2ICEB 1AQDB 2WXIA 3HS9A 5ICXA 1E4WH 3BPOB 5A2KH 1BBJA 3Q6FB 4R2GD 3ZOAA 3S8WA 5LGKA 4EI5B 4ZFFB 2AXJA 2ZSWA 2E5EA 5DYOA 1P69B 2E76C 1RJLA 2EKSB 3VXMA 1RHFA 3D07A 3BSGA 3X1EA 3SDDA 3GSNB 1IZJA 2OTWB 4IJ3B 4OZHA 1JI2A 2OXHA 4WIQA 3DX8A 2OR8A 1CICC 4PVBA 1CLCA 4RDQF 3TA3C 3UTTE 5KSBA 3QFJD 1A64A 2IQAA 3QG6B 2UY6B 3FSWA 5SWSB 1OW0A 3QK0A 2P8MB 3QZWB 5AW6B 2AK1H 3TNMB 1AVAA 2FWUA 3ULUL 3RQ3A 3ILDA 3WTXA 2AQQA 4DFHA 1LVEA 3D18B 1XH0A 1KV3A 4C56B 5CD5D 1ZT7A 3GB7A 5IVOA 3S3JA 2PXYC 3TONA 3ZQXA 1JBJA 1HQ4A 1URLA 4L9LC 2G0KA 3SDXE 4HH8A 4KZDL 1BM3H 3EZ8A 5B1JA 1CT8B 3MHZA 1CI5A 1UGNA 4Z7WF 4JRYA 5E99H 2BOLA 4ZMNA 3ESVF 2BIHA 1RULH 5DLMH 4MNQB 4YVUA 1YLBB 3NZ8A 4H8WH 3ZDXE 4YQXL 1IEBA 3GI8L 1HZLA 1FO0L 4JB9H 4ONGL 3O6MH 4WWKA 5D2LF 3BCFA 4IEFA 1MHCA 4M5SA 4NYLA 3VMPA 4W81A 4DKFH 2ODIA 3O3BA 4KK9C 2P80A 3JWOL 1X9RA 1MCPH 4WFGD 4FQ2H 3S2AA 3N44B 5GGRY 4OQTH 4LLVB 2CGRH 4KWUA 5I71C 1JYVA 4RAVB 4PGBA 4X7TB 4R8WH 3CFKA 1H5BA 3OAZH 1OP3H 2CPCA 2HVKA 5CLYA 4OFKA 3FQNB 4AQ1A 2EEAA 4W9ZA 2JQAA 5JIKA 2YD9A 5DFVD 1UCTA 5G4OA 2MOVA 3QS2A 5F9JA 1ANUA 2QV4A 3NTCH 4WCYL 1U6AH 2F7RA 3OXSB 1TJGL 4WK2B 1DQJB 1E5AA 4JZNB 1MFEH 5CO1A 3DBXA 2DH3A 1WZ1H 4JM4L 1MCRA 3IRPX 1ZTXH 2Y2TA 3B34A 2YUXA 3K6OA 4EN3D 4GMTL 4TLUA 2WZ5A 1Q72L 1JPGA 4MZRA 5T5NF 4KH2A 2HUHA 3HC4H 1XCQA 3KHQA 4PGZA 1DBAL 2AK4B 3HZMB 4JG1L 5IUSA 3HMXA 3GI9H 3B2PA 1A02N 2YC1B 1CG9A 1FA4A 1WO2A 3GYRA 5BRZB 1WDAA 3PL6C 5E5LA 1QWNA 4HFWA 1OWWA 3V4LA 2EAEA 2P8PA 5IHZB 5C08A 5IR1A 3KXFD 3NJMA 3VMOA 3QSKB 4LCUA 1U8MB 1D9KB 4KO7A 4XXDA 4B97A 4OJDH 2XA3A 3KPQA 2X12A 2HLAB 1SEQH 5DWPA 2IAAC 3GSOB 2B20A 4Z7WA 1LYQA 4W9HC 3FCTB 1D6EB 1ET7A 1T1XA 2BZDA 2G60L 1IKFL 4FXKA 4LVOC 4XMWA 4MB3A 5HHMD 1QBLL 5K5YA 2AP2A 1ZXKA 3QDGA 4P07A 3TF4A 3CUPA 4ZUTB 3PUCA 2AQSA 5B38A 4LSPH 4F7TB 5JO5B 3ZO0A 2R27A 2J25A 1BREA 1DL7H 1D5XA 1LEKA 1ADQA 5BQ7B 3PGCB 3VQ1C 2FUQA 3U4AA 3JV0A 5I8OH 1O7SA 1KJVA 2ZAIA 3MOBL 4OLXL 1WCBA 3IJYB 4PY7A 2ZUSA 1TQBC 5HHOB 3T08A 3B2VH 3EFOA 4NQDA 2DIJA 2NY4C 4QCIB 4QRFA 4ORGB 3WHE0 3ERXA 3MR9A 3PAYA 1TZGH 2YUVA 4CMMB 1YO4A 3RZCC 3QFDB 1G1OA 1QSEB 4YAQA 1E9PB 4LBEB 4DQOL 4F24A 5ESAA 2VUYA 2XX1A 2IDCA 4HMCA 4B9YA 2NXZC 2DYPB 3U6XA 3KPRE 4RCAA 2NQCA 2DQGL 4E36A 3DX4A 2D3NA 1VZGA 3CG8A 4LB8A 2C9UA 1FZOA 4QRBA 3IMBA 2CR0A 3ZTNH 1A6UH 2B1OA 1DFBH 1YEGL 3MLWH 4HKZB 2D03L 3EGSB 4MD5A 4BZ2H 3EFDL 3ARDB 3NIFF 3VDBA 3KPSD 4OI9A 4MMXC 4QYOB 2EDLA 5DI8A 2DEXX 2PWGA 3FU6A 4OGAC 3MMEA 3OQRA 2BNQE 2IOIA 5I2IB 4OF0A 3U9UB 5ESVA 1G6RA 2XWCA 3A3YB 3WFCH 3LQZA 1NKRA 4QCIA 4UT7L 1L9RA 3US0A 3EFOB 2G0LA 3COOA 1TU2A 1BF5A 1EZSA 2VZ3A 3OD3A 1KBKA 1R5VA 5CSGA 3SPVA 3IJ9A 1VEPA 3FQTB 1TZHB 3KWUA 4MTMA 5DJ8B 4TRPL 3VD4A 1A9EA 4LSUH 3HA0A 1OSYA 4UWQB 4ZZKA 2NYYC 2X5PA 3VFTA 2F5BH 2JVUA 2X1QA 3MRMB 5IVNA 3US1A 3E8UH 3ETBF 1R5VB 1T03H 2WBJA 4XP9L 4A7VA 3PL6D 3UZEA 1EAQA 4WY7H 5KBPA 1VFBB 1G9NL 2YPLE 1GOGA 2BINA 5JZ7D 2EUWA 3NJJA 4QRPE 4NB7A 1OCOB 2FJFB 2D2OA 1QEXA 2ICCA 3LZFH 3U9UA 5EEXA 3RL2B 2JNZA 3JTSA 5FUCE 5FO9B 3QDMD 5C6WH 5LWYH 3L7EB 2PPCA 1DEDA 4CGUB 5C0BA 3CZLA 5I1HL 1RSYA 2VLLB 3D25A 2W59A 5L9DH 5FCSH 1EH9A 3RVWD 3QIBC 4XXDB 2NXZB 4XHJD 1AKJD 3EFDH 3VXUA 4FCAA 2CJUL 5IHZA 5HJGA 3OB0H 1YEGH 3VXTA 2VERA 3LNHA 3T4AC 4RAUA 5BVJA 2ADYA 4HFWB 5JQIB 4A67A 4Y16D 4J3VA 4U1SB 2NY4B 4NM8L 2X6VA 4ZMZA 2WQVA 4HCRA 1QAWA 1EDQA 4YAQB 5IMKA 3QDAA 4JO2L 4L4TB 5CCGE 1WIUA 5IB3A 5GS2H 5IHUL 1BMWA 1F3RB 2Y1AA 3FK3A 3MRLB 4KQ0A 4GBXD 1I53A 5J1SC 4IBYA 5GISH 4ORGA 1KG0B 3RWCA 1HHGA 4WV1B 4PJFA 4HD5A 4ZYKB 4KXZH 3VFGH 4NC1C 4NQVA 4PY7B 4CGTA 2FLBT 2C9AA 3VRJA 3VXOA 4F8NA 5E6IB 4XPFL 3KGSA 5L0QC 2F7OA 2FHFA 1F8TL 1QACA 1D5XB 4E9LA 1DJHA 2X87A 3GXTA 3QJQB 3WO3B 3PCYA 2NY1C 1A7PH 4HZ1A 3BT2H 5DRWB 3V52H 4MBRA 1MAKA 1JZJA 1TVHB 4TULL 4BKTC 3ZT5A 2EDMA 3BT0A 2ADIB 2P5PA 3FOLB 4W70A 5AAMA 2V5SA 4XPGL 2Y2YA 5AD0A 1VFAA 4E5XA 1SXNA 2OTUB 2WV3A 3ET9F 3B1TA 3HBPA 4R97C 4B9FA 2IGTA 1A9VA 2VLKE 3ARTA 2G3XA 4LLYA 4Y9EA 4I0PD 1D9KA 3KWVA 1BD2A 1AR1B 3LZFL 1VIWA 3E3QC 5FFLA 2P8PB 2NCMA 5I0VA 1PKQA 1S3RA 1NCBL 2NT0A 1TDQA 4ESKA 2FO8A 4E68A 2ZUQC 3VYOA 2JH2A 2XZAL 3OGCB 5D4QA 1M4KA 1OTUD 3FFCD 3WTTA 3ECUA 2LAGB 4XWOD 2BWQA 1PY0A 1UWXH 4HJJL 3RGHA 4FNTA 1OTSC 3BPCB 3GJEB 3IDUA 3O0RL 1GHFH 2HT4C 4WTXA 3VWJA 1R0AH 3ZZSA 1T66D 1Q9OB 4H0GA 5BO0D 4ZOCA 1FZMA 1FZKA 2YJLA 1DQJA 4ZSOB 3LPGA 1ES0B 5LUMA 2SEBA 1DVXA 1JF1A 2F08A 2GABA 5CEXA 5I17A 1RIHH 4L1HA 4NRYA 1JPSH 3IVKB 3NABH 5GS0C 1VKXA 1BXVA 2BO0A 1YNLH 4QKXB 4WUKL 3U9PL 4MFHA 3TA3A 1SHMA 4ZO9A 4YDKH 3DX8B 1JP5A 4EN2A 4TSBH 3G3LA 1ED3A 3GSNA 4PS4H 5ISZD 2E3VA 3K6DA 2NX5D 1JNHA 4Y7MA 4F7MB 1DJSA 4Y4HC 5KANG 2QHRL 4CN6A 1HKFA 1RJLB 5CGYD 3BZEA 4ODVH 4JDZA 3KLAA 3TT1H 2HG5B 5K1JA 3IXAB 4IRZL 2OSXA 1DQKA 5I1HH 2EYRA 3NMEA 5DUML 3CAFA 3CMGA 4CN4A 2YEVB 1BOYA 1BZOA 2O30A 1PX3A 5GS0L 2OW7A 4ZXBD 5MP6H 1TZOA 1T5KA 1IBHA 1MPAL 5F7NC 1MVUA 3WLWC 5LG1A 2R0WH 4NYLB 4GQZA 3WAJA 2C9QA 2R4SL 5F7UA 3S34L 1T1WB 1GYCA 5FF6A 5D4JA 4PBXA 1M7DB 3NOIA 3CTTA 3ASNB 2X05A 4OM1L 4OFVA 4GAJH 5FUCC 2ZKHL 4FG4A 1ADWA 1SGKA 3EYQD 5DUBB 3UJIL 4OV5A 2QQKH 1EBAA 4FFZH 2XN9D 4MDIB 5E08H 1JV2A 1CT8A 1JE6A 3GIVB 1DQML 3MUHL 2O93L 2YZ8A 1JGEB 2WIIA 3V4PA 2R0KH 2E7BA 2WUBL 2ZKYA 3T4YB 1XR8B 3N3EA 2XIIA 4Z7NF 3EUUA 3VG9C 3HZKB 4H26A 3QUMB 3W56A 3X3FL 4LVOB 1CXHA 2P5EE 3L4YA 2IBZX 5C0AB 4Q6KA 4WKZA 2CBOA 1BJ8A 4NUJA 3X14B 2I9LB 2VXQA 1WG3A 2DLIA 1HYSC 1NWOA 4B50A 1NAKH 1BX2A 3E6HA 4JHBA 3SGJA 5EULV 3VSQA 4F7EA 5EF1A 4O2EA 1XR9B 3U1PA 4OZHB 1ITCA 4N0UE 4N90E 4DTGL 1IAOB 2B4CL 3ILEA 3GO1H 1JTOA 1IC7L 4AEIH 4J1UB 4JANB 2YSSA 2ORBH 2J72A 1FC1A 3RHWF 5KBMA 3TBSB 3W57A 2Z31A 3PXLA 4NHUA 5IEHA 5GZOD 2BMKB 4YXHH 4LVNB 1IKNA 1EXUA 2NQDA 4D0DA 1PQZA 3CDZA 5HVHB 2BMKA 3LS4L 3KYNA 1MOEA 1LNUB 5HYEA 1ZJBA 1XD0A 3GMQB 2NSXA 3ARVA 5DURB 1ZSDA 1KWKA 3FMGL 1ZV5A 4POZD 3OX8B 5IY5B 4R7NA 2CO4A 1OAKL 4MD0A 2WXPA 4EPSA 1CDHA 5H35B 4F7EB 1T5WB 1KLFB 1BX2B 3WENA 3QUXB 3QA3A 4MJ6B 3CVCA 5J57B 1OSEA 4IK7A 2AXGB 1A3RL 3QDJB 5KVEH 2DJ4A 2FWOA 3EW3B 5ACZB 4ZOBA 4WKZB 4A7QA 5L9DL 2VH5L 1YECH 3BEWA 2A2QT 1UXSA 4FMVA 2J4WH 3Q48A 4D3CH 1Z9OA 2VDPB 4HC1L 2VAJA 1UXSB 4BK4A 3UC0H 1PD6A 3LN5B 3SDYL 1DUYA 5CGMA 3QDJA 1UXMA 5FUOH 4S1RH 3B7SA 1HIMH 2GFBA 3O9WB 2A9NH 5CZRA 1RUQH 4MQ7A 3P3RA 1CFNB 5H35A 2A74C 1XQ4A 4JFTA 4R7DA 2XQBL 4BUGA 3LXBA 3FTWA 2M2DA 5KTEH 2AJYH 3DX2A 3AREC 3BGMA 3MCLH 5ICZA 1M7DA 4R7NB 5DHYB 1T1WA 4YQXH 5J89A 1I4FA 5HSFA 4U49A 2WYHA 3C5ZD 1NCOA 1C5BL 4ZTOL 5CEZE 4MA8H 2RH0A 1S9WB 1CD0A 3HNVH 2WC7A 5IBTL 5AKTA 1CLOL 3B4NA 4FQ1H 4B9IA 5IP4A 4JO1L 4FHJA 4HUUB 4FZ8L 4YBQC 3V4VH 2K78A 4XNUH 3SJVA 3IXAA 2MFNA 3QUZC 3Q13A 5DU7A 2VR6A 3B2UC 4PJHE 1MFEL 4J6RH 4M5YH 2VR3A 4FAAB 1E3XA 4ZMVA 3ME0A 5C08D 4F7MA 4PJBE 4UM8B 1A22B 3R06B 2PPAA 2YA2A 3MBWA 4WCYH 3TBYA 3UTOA 4Z7NB 3Q5YA 3GNMH 2BZCA 1CGTA 3B8SA 4GRLC 4A39A 3QH3B 2PUQT 2JELH 2X7LB 1SDYA 3IVKA 3MRKA 3V4UL 4NQED 5HI4C 2H3NB 1XFPA 4M1GH 2JCCF 1T7XA 4ZSOA 3NT0A 4ZTPL 4BFIA 3RUGB 1OY3B 3N85L 5D7LA 2XKUA 3I9AA 4PV8A 4RVBA 5HYQB 2YMXL 2Z0UA 1OE2A 3BISA 2GB2A 4PRIB 4P3DB 1FSKB 3OKKB 3DSNA 4GMSL 4K5PA 5IVXF 4XC3L 1ML0A 3LX9A 2BOBA 4KO6A 4HUWB 3FN0L 5FF6B 2A9NL 2NT1A 5LGHL 5F7AA 4YK4B 4P46B 3P3SA 1V5JA 1BEYL 1A7RL 1KIUB 1XHHA 3GIZH 3O4LD 4YGAB 4LFHG 5F7YC 1BD2B 2HRHA 5FYKL 2OFQA 2PO6C 1QFOA 3ZKXC 2HG5A 3N1QC 2YN3A 4IBTA 5AKVA 5JIHA 4BK8A 1R19A 4XNAA 4QKTA 5DUPH 4WHTA 3PWLA 4JPWH 4JY5H 3V5KB 1JNHB 3IE4A 1IM3B 5AD0B 1ED3B 4R4FL 5ECGA 1MCDA 2J8UE 3DX6A 4ZS6D 2WW8A 3FOLA 1MZYA 3TH4T 5CM1A 4MAYD 2L3BA 2GHWB 3MLRH 5GGTH 4TUOA 4F58H 2QKIC 2ZF9A 3P11H 5I1GH 1S2EA 2I9TB 3SCMD 4HX1A 4AQEA 2KDGA 1KB5L 5E2VL 5I17B 3TCLA 4D9LL 4Y4KD 4DQOH 3ZMNA 3OHXA 2R8SL 4FTVA 4HIHA 2BVPA 2VDNL 3FUHA 4PJIF 1IIKA 1ZCRA 2FJHA 4QNPF 4ONHA 4O51B 1VCAA 2OZNA 4DP5X 2F0CA 5E6IA 2QHLA 5I1JH 3GMNB 3AS1A 5F7DB 4YHKH 2P7TB 1HHGB 4BK5C 3PIQA 3BPCA 4LLUA 2XKNA 4KKRA 3MRLA 4TQHA 3M8OL 4UZGA 5C0FA 3CX2A 2WZPA 2DTMH 4WZ9A 4YLBA 4LHUG 1ZWIB 2WBJD 2BS8A 3HS8A 1RH8A 1DEEA 1XAKA 5D72H 4Z7UF 3ATAA 4P4KB 4AQ1C 4F9PC 5F72S 5BVJB 4EXKA 1P84K 2ZONA 1AD9A 3O11A 2UVFA 1V7NH 5AZUA 1K4DA 4XRCA 2VR8A 3D85A 1HCZA 2CLZB 3QDGD 5T8IA 3SY6A 1G9MH 2YGQA 1BXXA 4FG6C 3GSXA 4ZXBC 4LLYB 1NMAL 1A6ZA 2R83A 1J0HA 1KIQB 4UT6H 4UUJB 4C58B 4LKCA 1SN0A 1XH1A 3PY9A 1GYUA 1Q1JH 2VR7A 5F0JB 3U7WL 1BVLB 1ZT1B 2NNAB 3V6ZB 1LL1A 1KLUA 3OZLA 4A7UA 2ADIA 1U3HC 4FZEL 2JI2A 3CLEL 5ETUB 2EIJB 2XXGA 3NIDE 1FO0H 4ONGH 4YO0A 4AQZA 5C92A 2E7DA 2VLJD 4HJ0D 4ODSH 4DUVA 2W80C 2WSDA 4QOKE 4NZRL 3WGVB 3C08L 4PJFB 3WS3A 2PYEE 1J87A 1KF9B 2PNDA 5JHLL 1AGDB 2FEJA 2DJSA 3MNWA 4JX0A 3V7MA 2VOTA 3CZFB 1MCWM 1P4IH 4FKEA 3MMEB 4PI2A 2JQMA 3WUZA 2BP3A 4PG9B 1B9ZA 5DI8B 4XHQA 3OGOE 4O2CB 3DGGB 4XI5D 3IEAA 1N5YH 3L1OH 3N9GH 1AAJA 4HXAH 2PLTA 4JY4B 2ZP8A 5C7XH 1H19A 1UCBL 4KTGA 3VXTB 3HE6A 1RZ7L 1I7RB 1IAIH 2NW2A 2Y5TB 3ZR6A 2YQ3A 2VDOH 5BOPA 4Z7OF 1QWUA 3VXUB 4XMUA 4ZPTA 3SCMC 3GWJA 1GS8A 3QUXC 2F54A 1L0YA 3U2JA 2VLLA 2HG0A 2VUOA 4H8PA 5EO9A 2HFEB 2Y06L 4CMMA 3NJNA 5I1AA 3N40F 4NKQB 1Z3RA 4KV5F 1IC4H 1ZMYA 4FQLH 4WUUD 2FQGA 5HHOA 4OFQA 2RQ8A 3V5HA 3QWNA 2AS5M 4IU2A 4RSVA 3QQDA 1QFHA 1X5HA 4O4YH 3KYMB 1EGJA 1D5MB 4I89A 4LRNL 1LEKB 3I9PA 4G7YH 4A68A 2AI0H 3QI9A 1A9EB 2L8AA 1GJUA 4ZUTA 3IKCA 3V0WL 1YNKL 3WMQA 1QHOA 4LMQE 3ARZA 1E4XL 3QQDB 4IU2B 3N40P 2EXYC 1GPOL 1RU9L 2ERJB 1XGUB 4OV6F 1D6EA 4KKQA 6FABL 2FT8A 4JZOA 3ML9A 1OAQH 3LQZB 1BLNA 3UTZB 2WB7A 3CZEA 5C3TA 4G83A 2C1OA 4ZT1A 5CGTA 3ECBB 4X50A 4QYOA 3CK0H 1E4KC 4OZIF 4G6KH 1KEGH 1LO3H 1U8MA 4HKZA 4BK5A 3DTUB 4HUMB 1MLCB 4BZ1A 2IDTA 2ATAA 2VLJA 2JI3A 4XN4A 1ZVSB 1FZOB 4JY4A 3LQAC 3EYOB 4PJ8D 1R3HA 3UMTA 3GT6A 4L4TD 1FBIL 1SM3L 1RQ5A 1ZS2A 2OJZH 3DKHA 4O2CA 3ZDZE 2R9HC 4H2AA 5GJSH 3UADA 3S36L 1FNFA 2CQVA 2WSPA 1WH0A 3QIWC 1YEIL 5AG9A 4Q7DA 2OYMA 3WEMA 1OAUH 1VFUA 5JIIA 3B5GA 4OLWL 3FSOA 3OJDA 4P4RB 5EIVA 5T3XE 4YSQA 1UM5H 5C0DB 1ZD6A 4TNEA 3OAZK 3O3AB 5B7MA 3WV0A 3TEZA 4QGTA 2BP0A 3QZPA 3CXFA 1QSZA 1M2OA 3A67H 2X4RB 5DJAB 1MCOH 5F9JB 1AANA 1EEYA 4AG4L 4LHJB 4ZFGH 1LMIA 4JMXA 2XPGB 4NHCL 4AIXA 3GSUB 3PJNA 1MCLA 5IJCC 3RNKB 1F3DH 1KLUB 1HXMA 1NGPL 1T1XB 3FQUA 3T0XA 4F57L 2KBGA 4Z7WB 4Y2DA 2JJTA 3KPQB 4LKCB 3DYOA 4PGBB 2A9CA 5D96B 4OCWH 5IQLA 5FXCH 2Z93A 4OKVA 4D9QE 2KLTA 3NJKA 2X88A 3EF7A 4GQ9L 4ILDA 1NGPH 5FW8A 5DO8A 1AD9B 3SO3B 5ILTH 4FMFA 4FLQA 1KDJA 1XSIA 5C7XL 2IXQA 1XGTA 4LVHB 3DIDA 1MRDL 4QRRB 3K1DA 3SBWA 3CFUA 2EZ0C 1IEBB 3C6EA 3TEXA 4N1HB 4AQ8A 2COQA 4QTFA 3HZMA 3JZYA 4B27A 2X1PA 3E38A 3S96B 5IGXH 2WN2A 1KIPB 1UJ3A 1CL7I 2RJMA 3GEWB 1JPGB 3OM3B 3LKNA 1OO2A 3LRLA 5D2NC 2VITB 2FE0A 4E9YA 1Q8MA 4Z0XA 5LG6A 2BOCA 5DS2A 1MNNA 4O51A 4IOFD 2BC4B 3DBXB 1AXTH 1Q94B 2FJHB 2APVA 3EDJA 1UJ3C 1UWFA 1HE8A 4NRZB 5D5MB 5DD3L 2H5UA 3RPIA 2XSKA 2YO3A 2ZXGA 3TPUA 4HX1B 3QIBD 4NIKB 5IBUB 2UY6A 2MQCA 2VJ8A 2DQGH 2NR6D 4TUOB 1D5RA 2VQ1A 4YDJA 5JHDE 3H9HB 4AQ1B 2WLKA 1QNIA 1BGXL 3OAUH 1H0DA 2XWXA 4QUOA 1SQ2N 2IVFC 1KCWA 4EN3C 3PWLB 4R5VA 2YEZA 3V55A 2ITCA 5DYOB 4X7TA 3HAEH 4Y4KB 4XCFH 2D7NA 3N91A 3D4GA 1AE6L 4LLVA 4GLRH 1YQVL 4EI5A 2K45A 1NOLA 3HFMH 1D2PA 2DWDB 2XY1A 3GBLA 3KR3H 4F33A 4I1PA 1XV8A 4PTUB 4ZMAT 3P2BA 2ICEA 3QPXH 4FQHA 1RAMA 1QSED 4G80B 2PTTB 4NKIL 3LEYH 3UG3A 1J1PL 4YHLH 4ZW6A 3LEXB 2MKWA 4EKXA 2K7PA 3GXMA 1EHAA 1IJNA 1KCKA 4LHQB 4WWKC 4PLNC 1KB9J 2CLRA 2TSBA 3ILQC 3MV9B 5EU7E 4MNQA 5HGAA 5KVFH 4PVLA 3ATBA 5I9QC 4JRYB 5AVXB 3VA6A 3K4DA 4M3HA 1BFVL 1RMFH 2JV6A 3LKQB 4KROB 4LU5H 1HQ4B 1LWRA 3L13A 3S97C 3HI5L 1N26A 4JO3L 3RY6A 5D7LB 2DW5A 2XVLA 2ZUQB 5A2CA 1E6OH 5I5RA 3C5JA 5F1NA 3JSSA 5T3XH 2H3NA 35C8L 1MFVA 5IVXE 3TPKA 5DFWH 5SWSA 3PRZA 4QJ3B 2YD5A 3QH3A 5DZAA 5EN2B 1DUZA 3ARFB 4U1IB 2ZWYA 2Z31C 2B5IC 3QVAA 4G9DB 4PY8I 4TSBL 4AYBA 3QEUA 5GGVY 3NZSA 1HHHB 5DD3H 3SDDB 4GRMB 3HMWL 1ORSB 2P4AB 5ACMA 2LW3A 4AYFB 3GMOA 5F88A 3L8QA 4CJ0A 3IMVA 4PJ7F 2X3BA 4F2MB 3RTLA 2BIOA 4WO4C 3CIQA 5IREA 5DF0A 4HUUA 2J73A 2EDOA 4Q97A 1JV5A 4P2CG 3ZYZA 2V5TA 1TQUA 1IAKB 2KLSA 5K59E 3LXAA 3V4PL 4P3CH 2D9QB 3EO1A 1S9WA 1A8ZA 4YXLL 1CZ8H 2R1YB 1CTMA 4JUSA 3TF7C 4OR1A 3FL7A 2NZ9D 5ISZE 1GAFL 2HVJB 3TCXA 2QVIA 5T33H 3H9SB 4WNSA 4QRRE 3QUXD 1QSFD 4O9HH 2GJ6B 2OZ4L 1CFNA 1H3GA 1YPZA 3PABB 3SDXF 2P24A 4PJIE 3DTXA 1Z1WA 3TZVB 4CW1A 4N2CA 1PLCA 2WTOA 1J11A 4FI6A 5GGRB 1DUYB 1G87A 5GGQL 4QT5A 4JJOA 3F5WB 5GJTL 3ARWA 4FL4B 4NQEB 1E7VA 1E8XA 3DETC 4J3OD 3F5WA 3BEWB 5E4AA 3VD3A 4OF6A 1T0MA 4EI0A 5ANME 5GGRA 4UOQA 3ZT7A 2Y23A 2CR3A 1H8NA 3DARA 3MRRB 5CINL 5D1XE 5KEZA 5DSCA 1KLFA 1I1CA 1NJ9A 1YPZB 4Y8DC 1LWJA 4XAKE 3NIGE 3W9EA 3FFCE 1NANI 1TYRA 2Z8WC 3H9SA 5JPNA 4LCWE 2HVJA 1KEMH 3DWTA 2R56H 5BS0A 2V17L 2CLVB 4XZUB 5IMMB 3NCMA 4RFOL 1T22B 4YDNA 1RK0A 1OTTD 3KLDA 4P9HL 3OJMB 2XXMB 4XPFH 4LF3A 4DP4X 4FQXB 2QSTA 4K8RL 5LHDA 4H5SB 4F2MA 4M7KH 4ODWA 5KANI 4KKBD 1IGFH 3CHPA 2YR3A 2WOYA 2EDBA 1P2CB 3HR5B 3L9YA 1HHHA 1QNZL 2BM3A 3BIBX 4OGXH 5EG6C 1N7ML 2G5BA 3QIBA 4HKJA 2Y24A 4ENZA 5FAAA 5EU6E 1BP3B 3K81A 3UERA 4KJWD 4PBVC 3MTXA 3AU1B 4S1RL 2EYTB 1LD9B 3P4NA 3R8BB 1BMGA 3CVDA 1S9KC 2HUEA 3C5JB 2VB5A 3UYPA 4M5YL 2DLHA 3PL6B 1T20A 1KTKE 5K69A 3D7PA 3FUMA 4D7PA 4OZHF 5HHPA 3S4SG 3T4YA 1ITBB 1E8YA 2WIIB 3BVXA 1WAEA 1S78C 4M61A 4KKAD 1DYZA 1F02I 1ODUA 1H6TA 2XBZA 2ICWJ 4X8XA 4HBQA 4OV5B 4X6DE 3ZQWA 3FAXA 3QULA 3MV9A 2W0FB 3N1GC 4OLYH 5KSAA 1JXGA 2FHCA 3DO4A 1MLBA 1ZLSH 1C5CL 2ITFA 2UZXA 2D73A 4DERA 5I5MA 2A1WH 2OZ4H 3WIFA 4BWWA 3LEXA 5HYFA 3WNJA 3D39D 1ET8A 2PTTA 1DQVA 5ISZB 1U9KA 3HC0B 4FQHB 1X4XA 1S7VA 2J5WA 3ZJAA 5E1HB 1JK8A 3CJJA 1EHKB 2B0SL 3EKCA 4BHUI 5DMGD 4GXVH 4G59C 1OE1A 1GOHA 4Y4KA 4JDZB 1G7MA 5C0JB 1T1ZB 1T4KA 1CU4L 5DS8B 5EC1B 3RWEB 3U46B 2R2CA 4JCMA 1OEZW 5E6ID 1RUAL 4NQEE 4AGPA 1E9OB 2AV7A 4GIPD 2Q7YB 3RL1B 4APQA 3SCMB 4HPYL 4NERA 4JR9L 1FYTD 1TVBB 3L3IB 1NAKL 1IZKA 5IOKA 2E8ZA 4J12A 1OZUA 1KTBA 2JCCE 3FW6A 2ZX7A 4GW5B 4N8VG 3ZT6A 8FABA 2CA3A 4HK3J 4OGAD 3UO1H 5CEXB 2W91A 4HZAA 1LE5A 2SEBB 3CFTA 4K5MA 3S2CA 4UDUB 4LSRL 4GIAA 3VFWA 3AC0A 2O6PA 1FZMB 1I85A 4NNPH 4W9JC 2QKSA 2RMNA 4NP4H 1N2RB 1BQKA 1DBJL 3L7FB 4V2CB 3T4AA 4Z0XB 4A7GF 1XIWA 2NNRA 3L9RB 2AJUL 4HVBA 1UJ3B 2OBGA 1KCLA 5EBLA 5I30L 5AKRA 3FQYA 5AAWA 2C4XA 1NPJA 1BM7A 3DGCR 3QFJE 4L8SC 4WJG3 4JN1L 1XO8A 3MUZ1 2JCCB 4YHPA 3RDTD 4Y4HD 5KVFL 1NGWB 3MCLL 2FSEB 1DVSA 1K4CB 3JVGC 1XGTB 9CGTA 5IHHA 5L7XL 3VX0A 4OVVA 1S3KH 3SKMA 5LN4A 1QSFA 2EDKA 2VNCA 1JERA 2Z7ZA 1PKQB 3ETTA 1J9CT 3NVQA 3U0TA 1MPAH 4NSKB 2AVGA 2EUVA 3QZLA 1N6UA 3LZRA 2D7OA 3E0GA 4U2ZA 3T04D 4KJWC 1J1XL 4CSSA 2MCMA 5F7FA 3LOWA 4UYQA 5C3IA 4BBWA 4J8RA 3I3EA 3KR3L 1P1VA 4HC1H 4XPTH 1JGDB 1YYLH 4LSTL 3LNEA 4EN3A 2FO1A 1N9PA 2ERJC 3IFOA 5LCVL 4NQTA 1XF3A 2FT7A 2QGDA 2YD1A 5TDOB 1EJOH 3HPLA 1Q9KA 1ZA6A 2R29A 3ZQ9A 3AW5A 4DW2H 2GCYB 1HVXA 1JVOA 1KCVL 1TVHA 3GJFH 4KKLC 1CDYA 4L3ED 4LVEA 5DRWA 2FNBA 4N90D 4AK2A 4LPWA 2YAOA 1GRWA 4X6DB 1IAIM 5F96L 4GKSA 5AVQB 5DVPA 1S8DB 4RETB 1U30A 3VRJB 3VXOB 4NPYB 5C0DA 3MGOB 4NQVB 1U8QB 1A6VL 2C3VB 4P4RA 3HC4L 5FUZH 2IDFA 4AGOA 3RI5K 1NSNH 2JKXA 1Q0EA 2J43A 5F3BB 4N6QA 5JIPA 3BUIA 3E9UA 1NAMA 3A6BH 4QRPA 1OARH 3VE0A 4PJ6A 1OD9A 3KXFE 1HS6A 1L7TL 3VWKA 1YSOA 1WTLA 5EO1A 4HS6B 1YY9D 3PREA 1JYXA 1ZVSA 1TR7A 4RAUB 4WVRA 3BIKB 2YD7A 3GNML 2H2SC 5AOMA 5SX4I 3PQYD 2KMWA 4O5LL 2X40A 5JW4N 1VAHA 3DUHA 4ZUWB 4XWGL 4A6YA 3VI3B 5J6GB 3EOAA 3UZVA 1Z0MA 5FWQA 3P3TA 1LHZA 1SJVA 4WUUB 4WI3A 3UTZA 2FJFA 4KZEH 1QP1A 1CDGA 3HNVL 2MOQA 1VFBA 1O5DT 3HNTH 3BQVA 2WBJB 1JZHA 3BHBA 2G4EA 4PWJA 2ILLA 2BSEA 3PLYA 1J9SA 4OQ1A 1WF5A 2XPYA 5A6MA 3O9WC 3ZYOA 4MMZB 3QI9B 3JV4A 2DS4A 3CZSA 4O9HL 5CKAA 3TJEH 3H7BA 4BE6A 1TZHA 3HG0A 3MACH 4NO3B 5BNXD 3ZKNC 4JO8A 3ZHFA 4BKLA 1S7QA 4AI7A 1N8ZA 1NCBH 1U58A 2NX5B 4HUXA 3GLDA 4FQIH 5MP6L 4PIBA 1G6RB 3PYCA 4N2DA 2H26B 3WFDL 5I2IA 1KN2L 4BHUA 4PVMA 3EFFA 4IRSA 3B7UX 3ARDA 5KYNA 5J7CC 3ZZQA 5DD5L 4H20H 4PJ8B 1NBVH 3WHXB 2ENPA 3ISWA 4K23L 4KMLB 4XNZC 5I5IA 3P4OA 1FYTA 1XWVA 1QSEE 1QZNA 4HWZA 2Q20A 3CLFL 4UQIM 3DGGA 5ESAB 4LBEA 4LOUC 3IU3A 1IL1A 2F58L 4XR8C 1WE5A 1QSEA 1ZPLA 1NDTA 1GVIA 5AZ2L 4HP5A 3RG1C 1AGDA 5I8KL 3MR9B 1CLOH 2VDML 2PW2B 1ZRUA 4KHTL 3RA7H 1JIBA 1JTTA 4M8QA 5FUZL 1GKEA 3UBGA 1E5BA 1UZ6F 1TETL 5LQBH 3FU5A 4EIZC 1KJVB 1HSBA 2FDBP 3FDWA 3MOBH 1TO5A 1MJUH 4NZ8A 2JJUA 4W4OC 1CIUA 3F7KA 2DQIH 4GAYB 1A25A 4JHZA 4GSDL 4LSUL 4DPAX 2ZXDA 5D7JC 3UAFA 1C5CH 2V2XB 4OIBA 4CVZB 5I0DA 1GIGH 5CD5C 3SE8H 2OMVA 5GHWL 1MFAL 2NNAA 2ITEA 3ASWA 3FCTA 3P69A 4NKIH 2L7QA 3VFPB 2BSRA 3C12A 2X09A 4FNLL 4M48L 1IBGH 4OD3L 1CF1A 1CL7L 4GH7B 1N19A 3OXRB 5I16A 1JN6B 5H8DA 2OAAA 3S3DB 4PJCA 2FO4A 4LCUB 3HG5A 4ZFZB 3C6LC 4IK6A 4I0CC 1T80A 2ATKA 1MFAH 3CVHL 4Q89A 2K1MA 3O11B 2AITA 3ARED 4V1DB 1EDYA 3E8UL 3UTSD 4P4KA 1LWHA 3P4MA 1YMMA 2DKSA 4K7PX 5DRXB 1CG9B 2Q10A 3FMGH 1NEPA 3SE6A 4GNKB 1QTYT 4OGXL 3FH8A 2ATPB 3VD9A 1X5MA 1OCZB 1ZGLM 1T4WA 1XCQB 5C0FB 4XVSH 2XKNB 3DXAB 1KBWA 4XO9A 4L48A 4FN0A 1X44A 1PD0A 1LP9B 3EHBC 4WK0B 2Y07L 1QQDA 3BLPX 3GMNA 4KK5C 5HJBA 4UOJA 1KTDB 3Q2NA 1L5GA 2VDLB 4FCHA 3UXFA 4FXGA 2YPLA 2X89A 3TVMB 4I0PA 3RU8H 1XL6A 3MNMA 2Q6WA 2PR4H 3VI4E 3I6LE 5AOJA 1ZVNA 3R4RA 3QHFL 4AQEB 3VGFA 2Q87A 3UG5A 3F7YA 3PP4L 4P2RB 3BP6B 1ZEAL 3ZE0F 4U6XB 4U7MA 4BQ6A 5HVFB 5KS9A 4OAWB 2ZYSA 1KFAL 3NG5A 3DX6B 2JLPA 3AXLA 3FQNA 1M57B 5I1KL 5B4MD 3BN9C 3CFKB 1CFQA 2X53A 3W0WB 5T5NG 4P8QA 1GW6A 4FA6A 2VRQA 2XTSA 4NAMA 4W9EC 4MYWB 3RGVC 1RFDH 2UY7B 3EIFA 4ZZFA 1B2WL 1TQWA 3G6AB 2YOAA 2YJQA 4NS0A 3S35X 3O3BB 3HC2A 1MHCB 3JTTB 4O02B 4B9CA 1BLIA 5PCYA 4I1NB 1FNGA 2Y3NA 3MRPA 5IB5B 5H4YA 4EZLA 5MEND 3VAEA 3JWDH 4PJ9C 3GMMA 5HHNA 3M86A 2CH8A 4M1DL 2EDFA 3OMZA 4LL9A 1CFSA 3QUZB 1QBLH 3ZDXB 1N68A 4ADJA 1OP9A 5DS1A 4DN3L 5HYQA 2DIAA 2AAVA 3B2UD 3C87A 4KI5E 4NBZB 3N42F 5LCVA 3VXNA 4NP4L 3LKPA 3IDNB 1JXDA 2R59A 3A21A 1J7VR 4GKNB 2APTA 2WBXA 2FUTA 5KVDL 4YHKL 2CO3A 2DQFA 4EI6A 1FVDA 1NEZA 1U6AL 4XPGH 2P8MA 3RGVA 2ROYA 4FYRA 1ZVYA 1PBYA 5CKGA 3VFRA 3QG6A 1TT6A 2V9UA 4JDTL 3ELAT 3MROA 1DSWA 5KSBB 4GB9A 4AH2A 1AGBA 1BGXH 2I60L 4EVNB 4DVRL 3R06A 3HG1B 4JLRA 4I85A 2XETA 1IGFL 5EUOE 1HN1A 1GL4B 4OBRA 1JL8A 3ZE1F 2PO6A 4ZFFA 1WFOA 4CC4A 4XWOC 1Z5HA 5IFJB 4OI7A 5C07D 1E5CA 5A2AA 2FBRA 2X9ZA 2C3XA 3WXVH 1R3LB 1FVCB 4PJGE 3KHOA 4LEOA 1GS7A 3CC5A 1OAQL 2NXYD 4K3DH 5I8EB 3VQLA 1LEGA 2ESVE 3Q1SL 2ZWLT 1B90A 2GUOB 1U95A 3EH2A 3F8UB 2KKQA 2OR9H 4F7KA 4WK4B 4AM0Q 2VQUA 1YNKH 3BGMB 2WO3B 2WTRA 3PHOA 5E70A 6PAZA 1EHNA 5KW9H 2WNGA 3A5VA 3OKLA 3G08A 4F2FA 1CDIA 2UWEB 4OZHE 4ODBD 4X6EB 5HHME 5EO0B 4D0CB 5CN3A 1MNUH 1R3KB 1EJ8A 2VC2B 5BV7C 3MDJA 4IIQA 2QSQA 4EE2A 1GYWA 3MLYL 3B2XA 1AS7A 1IM9D 4WEBH 2XACC 2ESVB 4NQXA 3EADA 4OCWL 4JRXE 1CUOA 3H7LA 5F7HA 3HPJB 2AXGA 1FJ1B 3MV7B 3T0AA 3QA3B 4MJ6A 1JUFA 5CLWA 1J05B 2AC0A 3O3EA 4JG5A 4E42B 5IV2B 4WHYH 3K46A 5DFAA 3C9NB 2XUWA 4L3FA 4QO1A 1FH5H 1N4XL 4HKXA 4YVNA 4I3SH 4P4KD 3ZUCA 4MJIA 4G5ZL 1EO8L 3A67L 2ICWA 1VB9A 1AQHA 1MFBL 2AJVH 3MOAH 1IEHA 5KYUB 2VSKB 4KDTA 3VFGL 2EQDA 3KYNB 1RKRA 5F7WC 1TQTA 1F3DJ 2HJKA 3VW3H 3D0VB 4XMPH 4NOFA 1A7OL 2WTPA 3WMPA 2HJLB 1H8LA 2Z31B 4Y4FD 3ZMRA 4WV1C 5CR8A 4JANA 1OANA 4UNVA 4J1UA 3L5JA 4G43A 4PJ8C 1TJGH 3MLWL 4M9PA 3ZYJA 3OTTA 1CF8H 4K23H 1NGYA 4GFTB 2R9HD 4O2EB 3J2PA 3E6HB 3QHZH 4N2HA 1VEOA 4RMBA 1SOXA 3ZHNA 4N2AA 2GHZA 3AROA 3CSYB 3OKEB 4R5XA 3ZE2F 5CFHA 5AW8B 4NUJB 3X14A 2OXGB 5C6PB 4XB8A 5C0AA 2YD3A 5FB8B 1NMCC 1GZHA 4OIFA 3QUMA 2FRGP 3WD5L 2E7LA 1NLDL 2DJUA 3VYPA 4YSUA 1QI5A 5IVZA 3TV8A 3Q1EA 1GGBH 1XR8A 4AOFA 3V4PB 3THMH 1Z5YD 2K6YA 4XN8A 3K7UA 4ES9A 1OPGL 2PW1B 3OC8A 5D96C 4M6MH 3RIAK 1R1CA 1G9ML 4I2XA 2DQEL 5E2WL 1WICA 2BNQB 2MSPA 4BXSV 4WAFA 3H9SD 1XVSA 4Z3IA 1X6NA 2Z64C 3HE7D 4BKSC 4M43L 2YAQA 2FD6L 2VDKL 3DI2B 3N41F 3DURB 3S98A 4C4UA 4K3JH 2YAEA 5GS1C 4KI5C 4HIQA 5EUOF 1UQSB 2LOEA 1P9MC 2FZ3B 1F86A 3CFBB 1BQHB 1QYGH 3G5YA 3ALPA 3VWKD 4ES8A 1I8KB 1BFTA 1BM3L 1KUMA 2BIMA 5JIQA 3ISRA 1A3ZA 1KYUA 1T89C 3HTLX 2DBLL 4ZOEA 5EBMA 4H88H 3MBEB 4Z8FL 1DZ0A 4GG8A 4OJFL 4X6BA 4XCYB 3BH4A 5I1EH 4G8AC 1GZHC 4PLJD 3ABLB 4XCFL 2HKAA 5LBGA 5TFSH 5DURD 1A4KA 5HP5A 3QEGL 4RX4A 2PKDA 1UYWL 3VJ6A 3SGDI 1HDMB 5E5MB 2MEJB 3TIDA 1FRGL 1S46A 4ZO8A 4AE1A 2DLTA 3TA3B 4HWBL 2VZ1A 4XB7A 4FLSA 1XSOA 1KTLB 3D2TA 4P46D 3EJUA 1BVNP 5DRNB 2EEXA 2Z3FA 1IU1A 2WWKT 1NANH 3T8MA 2AAAA 2EDQA 3FFDB 3X12B 2N59A 5DZLA 5IMOA 1I3GL 3NFPB 1PZBA 5IB4A 1E4XI 3BUTA 3NSXA 2YBRA 1I8MA 4FLOA 3K6NA 4I87A 1SJMA 2VZVA 1P0SE 1Q9OA 1EMTL 2A9AA 2BSED 2P5WA 5M7QA 4ALAC 4JM2A 1U8PA 5C07B 1W72H 2EECA 5HI5D 4YX2L 4LEBA 4NWUL 3V8CA 1RIVH 4XXCA 5EEUA 3O9WD 5IGXL 1T1YA 4BFKA 4LHUB 4JFQA 4P59L 4GUOA 1XDTT 1UA3A 4Y1AD 1QVOA 3WDJA 3P3YA 4D9RE 5F6HJ 1HKLL 3OGCA 2IPUG 1NCCL 3T5WA 5HGHB 5JHBA 1KELL 5DJZB 4KHXL 2NZ1A 2BNRE 5K9KA 3HI6H 3QPXL 3KBHE 4RRPM 2WINA 5D70H 5HYJB 3ULUF 3JZ7A 3QXAB 2EDEA 1MFDH 4UV4H 2VLRB 4LEEA 4DGIL 2KUTA 2E6PA 1E7UA 4PB0L 3K6SB 2W8CA 4X9IA 1UWEL 2CGRL 5E0FA 4P23B 3VXRA 5IQ9B 5KYXA 5FIEA 4EUPG 3KGUA 3PU7A 3VG9B 1B0GA 1VFAB 1HX0A 2ODHA 4Y7OC 2XV6B 4M1GL 1ORQB 4DEUA 4PJDE 3MLVL 2EUZA 4OY9A 3L6FA 1MAMH 3BQUB 2Y9RT 3CZGA 1ACZA 2BRRH 1HL9A 4MXWL 4WKXA 1ZPUA 5F3FA 4EQ3A 1F13A 1JPTL 3BAYA 4MJID 3PP4H 1OM9A 2ID5A 1SY6H 2EXTA 2HN7A 2AJ3A 2ICWI 3QORB 3TESA 2QPFA 4YHNA 4ZYKA 3F7RA 4ENED 5LNGA 4KY1H 1ZA3A 3MCKA 5FK9B 1G9MC 2CD0A 5I1CL 1I8IA 1IGMH 3WNMA 4TYUA 4FP8H 2JF1A 3GGWB 1BJ1H 5D2LB 4ABVA 3JWOC 1EVUA 2FQFA 2NY1D 1QBAA 5LGJA 3S36H 3JWNC 2YAHA 4MSWA 1F90L 3MUJA 2DMCA 4W6WB 3KE0A 3PWUA 3HRPA 3O41A 2AF2A 2XX0A 3KLKA 3V0FA 2DPKA 1J86A 2WXNA 3CD4A 5FV2A 3VFMB 3WNIA 4NKOA 1E5UI 5AQ0A 4BZ1H 1TENA 3QJRB 3ROLA 1WAAA 3CPLA 4ZSOE 1P7QB 4UAOC 4DK6A 3WTUA 2MTAA 4FTDA 1D9KC 1IILE 2K7QA 2XN9B 3S37L 4LPTA 5I6PA 1JZDC 2XT1B 4APQC 3AADB 1QEWA 1MXGA 1Z9LA 3NP3A 3NYKA 3L9EA 1I8UA 3NCCB 2W95A 1HWHB 3L7EA 1F11A 3KNBB 1N6VA 3RL2A 2MNWA 1AH1A 5I1EL 1EHXA 4JRXD 2P46B 4LDEB 3QDME 5F7EH 5CJ5A 2VH5H 3WIAA 5JXAL 1J5HA 2JQZA 2HLFC 5I75B 4X8GA 3EXLA 4MMYB 4CADB 2OP4H 4FNLH 2G2RA 4Z77B 4WEEA 2WJ5A 5DJ6A 2C3HA 5ENWB 3S5YA 2I5YL 5DEJA 5GHWH 3ZRCC 3ULVC 3FQ4A 5KW9L 3SQBA 1NCCH 1MW3A 2HFFA 3K2IA 4HH9B 5DJ8A 3VFVB 3WJJA 3MRHB 4P23C 5DJXA 3SPVB 5EDXA 3SGEI 4X9GA 2X89D 3C09B 3DX9A 4BQCA 4J3OC 5LGYA 1P5UB 1E2WA 3RWHB 3VFOA 1MHPH 2YD0A 1U93A 5EU5B 2K6ZA 1I3UA 4IDLA 1PW3A 3WCYA 3FQ1A 1RP9A 1VGKB 4PGEA 3BGFC 4H25B 4TQ8A 5ALBL 4PMEA 3BWAB 1I75A 3GRWL 1NC2A 4NUGL 2LFEA 4OFIA 4OQTA 2IWGA 3CH8A 4UQ3B 1X4ZA 1XBRA 1KJ3L 3WIHA 3O4LE 2OCFD 4XNQB 2P5WE 4JPIB 5D6DA 4UIKH 3NSFA 1KTJA 4FMKA 3T3PE 1A1NA 4TNVF 2O26U 1SYSB 3B1UA 4W9CC 4WU5A 4NCC1 1MHHB 3PQYA 3UTTB 1S4IA 2MPAH 4KJPD 3HC3H 4UBDD 1G7PA 3LKSB 1OOWA 4K73A 4KQ3H 2IDUA 4QRSA 2WVVB 4KKLD 1UACH 4JFFA 5HYIA 5IW6A 3UGEA 1IE4A 3VXSB 3CSBA 1KJ3H 3FO2A 5DJ0A 2NMSA 3EO9L 3DV4A 3VCLA 2CNYA 4GW1A 1W16A 3U4KA 3WEXB 1GJIA 5C0CB 2P43B 3ZKSD 4YSTA 3IJYA 1ID2A 1PZ3A 2JKRM 5J1AB 4RFOH 1WCBB 2YS4A 3BJLA 4Q9CA 4U1JA 1CXKA 3MRGA 2VDQL 4H2CA 3W2DH 4PRBA 5BQ7A 3A6CH 2HX7A 3KCWA 3T77A 5E4EB 3F2LA 1ETZB 1NCIA 4JRLA 4N0FA 3HR6A 3TO2A 3TV3L 3UG4A 5B38B 3EH3B 2FQEA 1N3NB 1CK0H 3MJ9A 2XWJB 5C09E 2WXKA 4OFPA 1YAZA 2D3VA 3IBEA 4PY8J 3HHSA 4XC3H 4BFNA 2UZPA 1RZJL 1IAII 4FXKB 4XO8A 4P5TA 4TUKH 4CVXA 4ZG1A 2YD4A 4FI7A 4GRWB 5EU7C 4G1EB 4NFDA 4N5EC 5E9DD 3UPAA 3QDMA 4HHWA 2ZCKH 2Z7UA 4BH8B 3OR7B 3THML 3TC9A 1G6RH 2BVQA 2A6KA 3ZTCC 4K9EH 5GRYA 2GT9B 3ZKXB 1XTMA 1NFDB 2D4FA 1Z5LA 1YUKB 5D1XA 3SDAC 3A47A 3M17B 2YGOA 3OHMB 3FN3A 3ZY7A 4JFDE 1MCJA 5DZ9A 3L4CA 4BGDA 4WGWB 4O5LH 4IMLB 2V7HA 5DD1L 1F5WA 4OCNC 5C9JA 5B39A 2DM4A 2H1LM 2VDQB 2FJSA 4U4BA 1ACYL 1T83C 1VZIA 4CUCA 3VO0A 2V3DA 4XNDA 4OUUB 2BSBA 4RGNE 3RWGA 5D1ZD 2CG9X 1BBDH 1FDLL 3D3VE 4NZRH 1IFHH 3WY4A 3QUZD 3I6KA 3EBHA 1CGWA 2ZKXA 4JQVC 3ECWA 4HSQA 4DGYL 2E6QA 2J71A 3KPNA 4K7PH 4N9OB 5GRXG 2VW6A 5I19H 3OR6B 3MRFA 1H3PL 5L8KB 1OP4A 1ETA1 4YSOA 5E8NB 3ZVVA 3VI4F 4NN5C 5GGTA 4CU8A 3BSHA 1I1RA 3F04A 4M5TA 2Z34A 1V8HA 4DCQA 4DTGH 1EZUA 4X4KA 5EWIL 4U31A 1CN4A 1DFXA 4U1NA 3AUWB 1RZGA 4OZIB 3FB7B 5LO7A 2HVKB 1T89A 4L4VE 4PHZA 1H5BB 3U25A 3BXNB 3RX9A 4RBPK 5DGQA 3KPRB 1UVQB 1P9MA 3Q9PA 4F9LC 3DXAE 2I7OA 5E4EC 5A2BA 1WUZA 4GUQA 4I48A 3FT2B 1AZVA 1D9KD 2GITB 3M45A 4J3OH 1K5NA 2FJGB 5TF1L 1R3IL 1MCEA 2OS7A 3JWDC 3GS0A 4KXZI 5GSVA 2B9BA 2YQBA 4QXGH 1FFRA 4KBPA 2VDNB 4HETA 1NUGA 1BVZA 3RDTB 3RIAF 4APXB 1QPPA 1QSVA 4LPUA 2PCFB 3Q05A 5CJ8A 2G5RA 4NC2B 2HJFA 3FS9A 4JGUA 5E8PA 2DTML 1JNNH 2PR4L 2R2EA 2F5AH 1CYGA 1KCBA 2F53B 4HEPA 1KGCE 4U1KA 5F0LB 2VZOA 4IBZA 4NZFA 1ERNA 3D06A 4FC3E 3UYRL 2YPLD 4K5LA 3VTMA 1Q0XL 1ZT7B 1EHLH 3FTYA 4XNMA 3HN3A 1T2QH 4PJGA 4IOSA 1HJBC 3AQDA 4WFEE 1IGIH 2VMJA 5DQJB 4UILL 3DK0A 3MX0B 3HS0A 2VXSL 4DVBB 3B3BA 4EI5C 1XF2B 4KXAA 4GRLD 2HWZH 3BRGC 1X9LA 1SUHA 1TUPA 3QARA 2ISDA 1S9XB 4LGPB 2RB8A 1FG2A 1RD6A 3DO3A 4YNYB 1E4JA 2OTWA 4X9FA 1BHGA 2CA4A 3GPEA 2NY2C 3B9EA 5ANMB 5I6KA 1LQBC 3G6JF 3WE6B 1XD1A 3NABL 5A7BA 2AXFA 3VD1A 2ZSWB 1UB6B 2DIEA 3VSUA 1ECYA 4XX5A 1PG7L 2X4SB 1QO3B 1UH2A 4KKAC 4E9VA 1M7IA 1V27A 4JO1H 2I25N 2FX7H 3QORD 1AQDA 5ICXB 4KTEH 3MLXH 3L4WA 5CJXA 3FXIC 4X4MA 3KGTA 1RJYB 1BW8A 4WHCA 4XN9A 1MCBA 2V6HA 2TRYA 4C47A 4L0YA 1DR9A 2H45A 3ARUA 2F8IA 1ZLVK 4DOHB 1I8LA 1O6SB 3AM8A 3F6LA 4DZBB 1MELA 2F5BL 3S8GB 5F6IC 4Y19D 2CK2A 5B3SB 3TTYA 4A66A 2A3TA 2EVGA 3PGFH 1KB5A 1B6DA 3F83A 3NDYE 3Q5OA 4K94C 2FR4A 2LE9A 4ODTH 2F8VA 3LN4A 3TX4A 2GPZA 4OIIL 5T1JA 4GUPA 3U7WH 1OAZL 2E7CA 1MJ7H 1F4XL 1PL3A 4XNYH 5F89A 3BO8B 2A9ML 4IRZA 5JORA 5JPMB 4KZDH 5DZVA 4BSWB 1TZ8A 3MV7D 2C9PA 4X4ZA 1DJYA 2A77L 1BVOA 3ULVD 5D1QC 3B9DA 3WNOA 5K39B 1I3VA 4PJEB 2AJSL 4LLWA 2L0DA 5HJ3A 1J8HE 2BNUA 2Q2LA 1W6LA 2AMGA 4UTAH 3WO4B 5MERA 1R24B 4YHOL 4OCXH 5D5MF 1H6UA 2OL3B 4K3EL 4LAQL 2I32A