1RLAA

Three-dimensional structure of rat liver arginase, the binuclear manganese metalloenzyme of the urea cycle
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGINASE
publication title Structure of a unique binuclear manganese cluster in arginase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1rlaA00
3SL1A 3THHA 4IE3A 5CEVA 1WOIA 1P8QA 4RHQA 4GSZA 1HQ5A 1PQ3A 4MYKA 2EIVA 4IE2A 4G3HA 1P8PA 1D3VA 1WOHA 2RLAA 2PHAA 4HXQA 4GWDA 4IU4A 1P8OA 1WVBA 3LP4A 4IU1A 4GWCA 4RHMA 1HQFA 1ZPGA 4Q41A 1WOGA 2PHOA 1R1OA 1TBHA 4FCKA 3NIOA 4GSMA 3E6VA 3NIPA 1P8MA 4IXUA 4Q3PA 4MYLA 4RLAA 4Q3VA 3CEVA 1HQHA 3MFVA 3MJLA 4HWWA 2CEVA 1P8RA 4Q3TA 1T4PA 4IE1A 2AEBA 4Q3RC 3THEA 3SKKA 1P8SA 2PLLA 2A0MA 1P8NA 3MFWA 1T5GA 4RHLA 3TH7A 4RHIA 1RLAA 4ITYA 3GN0A 4IU5A 1T4SA 1T5FA 3MMRA 4Q3SA 5RLAA 4Q3RA 3F80A 3NIQA 1TA1A 4RHJA 3E6KA 4Q3UA 3M1RA 4MYFA 3RLAA 1HQGA 4FCIA 3E9BA 5HJAA 3SJTA 3GMZA 3TF3A 4Q40A 3THJA 4RHKA 1TBLA 3DJ8A 4MXRA 2EF5A 4HZEA 4MYNA 4CEVA 3PZLA 5HJ9A 1HQXA 3LHLA 1XFKA 4DZ4A 1ZPEA 1CEVA 4GSVA 1WVAA 3KV2A 4Q42A 2ZAVA 1TBJA 2EF4A 3E8QA 4IU0A 4Q3QA 1GQ7A 3LP7A 1T4RA 4I06A 3SL0A 3E8ZA 1GQ6A 4IXVA 1T4TA
chains in the Genus database with same CATH superfamily
5BWZA 3SL1A 3THHA 4IE3A 5CEVA 3EZPA 1WOIA 1P8QA 4RHQA 4GSZA 2VQQA 3F0RA 1HQ5A 1PQ3A 5G13A 5EEMA 4MYKA 2EIVA 4IE2A 5JI5A 4G3HA 1P8PA 1D3VA 5G1BA 1WOHA 4BZ7A 2RLAA 5THSA 2PHAA 3C0YA 5G0YA 4HXQA 4GWDA 4IU4A 3MZ4A 3EWFA 3Q9CA 4ZURA 1P8OA 1WVBA 3LP4A 4IU1A 4GWCA 4RHMA 1HQFA 1T64A 1ZPGA 5G11A 5G12A 4Q41A 2V5WA 5THTA 4ZUOA 1WOGA 2PHOA 1R1OA 1TBHA 4FCKA 5EFJD 3NIOA 4GSMA 5DC8A 3E6VA 3NIPA 5EENA 1P8MA 4IXUA 5DC7A 4QA4A 5IX0A 5G10A 3MENA 4Q3PA 4MYLA 4QA1A 4RLAA 4Q3VA 3CEVA 4QA6A 1HQHA 4LY1A 5EF8A 3MFVA 3MJLA 4HWWA 4QA2A 2CEVA 1P8RA 5D1DA 2VQWG 1T4PA 4Q3TA 4ZUPA 4IE1A 4ZUMA 2VCGA 2AEBA 4Q3RC 3THEA 4BZ9A 3MZ3A 3SKKA 5EEKA 1ZZ0A 5EEIA 5EFGA 5THVA 1P8SA 1W22A 2PLLA 1ZZ1A 5EFBD 3SFHA 2A0MA 1P8NA 2VQOA 1T5GA 3MFWA 4RHLA 4RHIA 1RLAA 3TH7A 4ITYA 3GN0A 4IU5A 4CQFA 1T4SA 1T5FA 3MMRA 5G0XA 5LI3A 4Q3SA 3EZTA 3MZ7A 4QA5A 5D1BA 5RLAA 5D1CA 4A69A 4Q3RA 3F80A 3NIQA 1TA1A 1VKGA 4RHJA 4BZ8A 3MZ6A 3E6KA 5EFNA 4Q3UA 5EFHA 5G1AA 1T67A 3M1RA 4RN2A 4ZUQA 4QA7A 5FCWA 4MYFA 3ZNRA 3RLAA 4BKXB 1HQGA 4FCIA 3EW8A 3F06A 5THUA 3ZNSA 1ZZ3A 3E9BA 4ZUNA 2VQVA 5G0GA 3SJTA 5HJAA 3GMZA 3RQDA 4Q40A 3THJA 3TF3A 4QA3A 4RHKA 4BZ6A 1TBLA 3DJ8A 3F07A 4MXRA 5G17A 2EF5A 4HZEA 4MYNA 5DC5A 5EF7A 1C3PA 3Q9BA 4CEVA 1T69A 5G0JA 3PZLA 5HJ9A 1HQXA 3LHLA 4CBYA 5ICNB 1XFKA 4DZ4A 3MAXA 5EFKB 4CBTA 1ZPEA 2VQMA 3Q9FA 3Q9EA 1C3SA 1CEVA 5G1CA 5FUEA 4GSVA 4BZ5A 5G0HA 1WVAA 3KV2A 5DC6A 5EEFA 4Q42A 2ZAVA 5G3WA 1TBJA 4RN0A 2EF4A 3C10A 5A2SA 3E8QA 4IU0A 4Q3QA 4QA0A 1GQ7A 3LP7A 5G0IA 1T4RA 3SFFA 2V5XA 4I06A 3SL0A 4RN1A 3E8ZA 5IWGA 3C0ZA 1GQ6A 2VQJA 4LXZA 4IXVA 1C3RA 1T4TA 2GH6A
chains in the Genus database with same CATH topology
3SL1A 3THHA 4IE3A 5CEVA 1WOIA 1P8QA 4RHQA 4GSZA 1HQ5A 1PQ3A 4MYKA 2EIVA 4IE2A 4G3HA 1P8PA 1D3VA 1WOHA 2RLAA 2PHAA 4HXQA 4GWDA 4IU4A 1P8OA 1WVBA 3LP4A 4IU1A 4GWCA 4RHMA 1HQFA 1ZPGA 4Q41A 1WOGA 2PHOA 1R1OA 1TBHA 4FCKA 3NIOA 4GSMA 3E6VA 3NIPA 1P8MA 4IXUA 4Q3PA 4MYLA 4RLAA 4Q3VA 3CEVA 1HQHA 3MFVA 3MJLA 4HWWA 2CEVA 1P8RA 4Q3TA 1T4PA 4IE1A 2AEBA 4Q3RC 3THEA 3SKKA 1P8SA 2PLLA 2A0MA 1P8NA 3MFWA 1T5GA 4RHLA 3TH7A 4RHIA 1RLAA 4ITYA 3GN0A 4IU5A 1T4SA 1T5FA 3MMRA 4Q3SA 5RLAA 4Q3RA 3F80A 3NIQA 1TA1A 4RHJA 3E6KA 4Q3UA 3M1RA 4MYFA 3RLAA 1HQGA 4FCIA 3E9BA 5HJAA 3SJTA 3GMZA 3TF3A 4Q40A 3THJA 4RHKA 1TBLA 3DJ8A 4MXRA 2EF5A 4HZEA 4MYNA 4CEVA 3PZLA 5HJ9A 1HQXA 3LHLA 1XFKA 4DZ4A 1ZPEA 1CEVA 4GSVA 1WVAA 3KV2A 4Q42A 2ZAVA 1TBJA 2EF4A 3E8QA 4IU0A 4Q3QA 1GQ7A 3LP7A 1T4RA 4I06A 3SL0A 3E8ZA 1GQ6A 4IXVA 1T4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SL1 A;  3THH A;  4IE3 A;  5CEV A;  1WOI A;  1P8Q A;  4RHQ A;  4GSZ A;  1HQ5 A;  1PQ3 A;  4MYK A;  2EIV A;  4IE2 A;  4G3H A;  1P8P A;  1D3V A;  1WOH A;  2RLA A;  2PHA A;  4HXQ A;  4GWD A;  4IU4 A;  1P8O A;  1WVB A;  3LP4 A;  4IU1 A;  4GWC A;  4RHM A;  1HQF A;  1ZPG A;  4Q41 A;  1WOG A;  2PHO A;  1R1O A;  1TBH A;  4FCK A;  3NIO A;  4GSM A;  3E6V A;  3NIP A;  1P8M A;  4IXU A;  4Q3P A;  4MYL A;  4RLA A;  4Q3V A;  3CEV A;  1HQH A;  3MFV A;  3MJL A;  4HWW A;  2CEV A;  1P8R A;  4Q3T A;  1T4P A;  4IE1 A;  2AEB A;  4Q3R C;  3THE A;  3SKK A;  1P8S A;  2PLL A;  2A0M A;  1P8N A;  3MFW A;  1T5G A;  4RHL A;  3TH7 A;  4RHI A;  1RLA A;  4ITY A;  3GN0 A;  4IU5 A;  1T4S A;  1T5F A;  3MMR A;  4Q3S A;  5RLA A;  4Q3R A;  3F80 A;  3NIQ A;  1TA1 A;  4RHJ A;  3E6K A;  4Q3U A;  3M1R A;  4MYF A;  3RLA A;  1HQG A;  4FCI A;  3E9B A;  5HJA A;  3SJT A;  3GMZ A;  3TF3 A;  4Q40 A;  3THJ A;  4RHK A;  1TBL A;  3DJ8 A;  4MXR A;  2EF5 A;  4HZE A;  4MYN A;  4CEV A;  3PZL A;  5HJ9 A;  1HQX A;  3LHL A;  1XFK A;  4DZ4 A;  1ZPE A;  1CEV A;  4GSV A;  1WVA A;  3KV2 A;  4Q42 A;  2ZAV A;  1TBJ A;  2EF4 A;  3E8Q A;  4IU0 A;  4Q3Q A;  1GQ7 A;  3LP7 A;  1T4R A;  4I06 A;  3SL0 A;  3E8Z A;  1GQ6 A;  4IXV A;  1T4T A; 
#chains in the Genus database with same CATH topology
 5BWZ A;  3SL1 A;  3THH A;  4IE3 A;  5CEV A;  3EZP A;  1WOI A;  1P8Q A;  4RHQ A;  4GSZ A;  2VQQ A;  3F0R A;  1HQ5 A;  1PQ3 A;  5G13 A;  5EEM A;  4MYK A;  2EIV A;  4IE2 A;  5JI5 A;  4G3H A;  1P8P A;  1D3V A;  5G1B A;  1WOH A;  4BZ7 A;  2RLA A;  5THS A;  2PHA A;  3C0Y A;  5G0Y A;  4HXQ A;  4GWD A;  4IU4 A;  3MZ4 A;  3EWF A;  3Q9C A;  4ZUR A;  1P8O A;  1WVB A;  3LP4 A;  4IU1 A;  4GWC A;  4RHM A;  1HQF A;  1T64 A;  1ZPG A;  5G11 A;  5G12 A;  4Q41 A;  2V5W A;  5THT A;  4ZUO A;  1WOG A;  2PHO A;  1R1O A;  1TBH A;  4FCK A;  5EFJ D;  3NIO A;  4GSM A;  5DC8 A;  3E6V A;  3NIP A;  5EEN A;  1P8M A;  4IXU A;  5DC7 A;  4QA4 A;  5IX0 A;  5G10 A;  3MEN A;  4Q3P A;  4MYL A;  4QA1 A;  4RLA A;  4Q3V A;  3CEV A;  4QA6 A;  1HQH A;  4LY1 A;  5EF8 A;  3MFV A;  3MJL A;  4HWW A;  4QA2 A;  2CEV A;  1P8R A;  5D1D A;  2VQW G;  1T4P A;  4Q3T A;  4ZUP A;  4IE1 A;  4ZUM A;  2VCG A;  2AEB A;  4Q3R C;  3THE A;  4BZ9 A;  3MZ3 A;  3SKK A;  5EEK A;  1ZZ0 A;  5EEI A;  5EFG A;  5THV A;  1P8S A;  1W22 A;  2PLL A;  1ZZ1 A;  5EFB D;  3SFH A;  2A0M A;  1P8N A;  2VQO A;  1T5G A;  3MFW A;  4RHL A;  4RHI A;  1RLA A;  3TH7 A;  4ITY A;  3GN0 A;  4IU5 A;  4CQF A;  1T4S A;  1T5F A;  3MMR A;  5G0X A;  5LI3 A;  4Q3S A;  3EZT A;  3MZ7 A;  4QA5 A;  5D1B A;  5RLA A;  5D1C A;  4A69 A;  4Q3R A;  3F80 A;  3NIQ A;  1TA1 A;  1VKG A;  4RHJ A;  4BZ8 A;  3MZ6 A;  3E6K A;  5EFN A;  4Q3U A;  5EFH A;  5G1A A;  1T67 A;  3M1R A;  4RN2 A;  4ZUQ A;  4QA7 A;  5FCW A;  4MYF A;  3ZNR A;  3RLA A;  4BKX B;  1HQG A;  4FCI A;  3EW8 A;  3F06 A;  5THU A;  3ZNS A;  1ZZ3 A;  3E9B A;  4ZUN A;  2VQV A;  5G0G A;  3SJT A;  5HJA A;  3GMZ A;  3RQD A;  4Q40 A;  3THJ A;  3TF3 A;  4QA3 A;  4RHK A;  4BZ6 A;  1TBL A;  3DJ8 A;  3F07 A;  4MXR A;  5G17 A;  2EF5 A;  4HZE A;  4MYN A;  5DC5 A;  5EF7 A;  1C3P A;  3Q9B A;  4CEV A;  1T69 A;  5G0J A;  3PZL A;  5HJ9 A;  1HQX A;  3LHL A;  4CBY A;  5ICN B;  1XFK A;  4DZ4 A;  3MAX A;  5EFK B;  4CBT A;  1ZPE A;  2VQM A;  3Q9F A;  3Q9E A;  1C3S A;  1CEV A;  5G1C A;  5FUE A;  4GSV A;  4BZ5 A;  5G0H A;  1WVA A;  3KV2 A;  5DC6 A;  5EEF A;  4Q42 A;  2ZAV A;  5G3W A;  1TBJ A;  4RN0 A;  2EF4 A;  3C10 A;  5A2S A;  3E8Q A;  4IU0 A;  4Q3Q A;  4QA0 A;  1GQ7 A;  3LP7 A;  5G0I A;  1T4R A;  3SFF A;  2V5X A;  4I06 A;  3SL0 A;  4RN1 A;  3E8Z A;  5IWG A;  3C0Z A;  1GQ6 A;  2VQJ A;  4LXZ A;  4IXV A;  1C3R A;  1T4T A;  2GH6 A; 
#chains in the Genus database with same CATH homology
 3SL1 A;  3THH A;  4IE3 A;  5CEV A;  1WOI A;  1P8Q A;  4RHQ A;  4GSZ A;  1HQ5 A;  1PQ3 A;  4MYK A;  2EIV A;  4IE2 A;  4G3H A;  1P8P A;  1D3V A;  1WOH A;  2RLA A;  2PHA A;  4HXQ A;  4GWD A;  4IU4 A;  1P8O A;  1WVB A;  3LP4 A;  4IU1 A;  4GWC A;  4RHM A;  1HQF A;  1ZPG A;  4Q41 A;  1WOG A;  2PHO A;  1R1O A;  1TBH A;  4FCK A;  3NIO A;  4GSM A;  3E6V A;  3NIP A;  1P8M A;  4IXU A;  4Q3P A;  4MYL A;  4RLA A;  4Q3V A;  3CEV A;  1HQH A;  3MFV A;  3MJL A;  4HWW A;  2CEV A;  1P8R A;  4Q3T A;  1T4P A;  4IE1 A;  2AEB A;  4Q3R C;  3THE A;  3SKK A;  1P8S A;  2PLL A;  2A0M A;  1P8N A;  3MFW A;  1T5G A;  4RHL A;  3TH7 A;  4RHI A;  1RLA A;  4ITY A;  3GN0 A;  4IU5 A;  1T4S A;  1T5F A;  3MMR A;  4Q3S A;  5RLA A;  4Q3R A;  3F80 A;  3NIQ A;  1TA1 A;  4RHJ A;  3E6K A;  4Q3U A;  3M1R A;  4MYF A;  3RLA A;  1HQG A;  4FCI A;  3E9B A;  5HJA A;  3SJT A;  3GMZ A;  3TF3 A;  4Q40 A;  3THJ A;  4RHK A;  1TBL A;  3DJ8 A;  4MXR A;  2EF5 A;  4HZE A;  4MYN A;  4CEV A;  3PZL A;  5HJ9 A;  1HQX A;  3LHL A;  1XFK A;  4DZ4 A;  1ZPE A;  1CEV A;  4GSV A;  1WVA A;  3KV2 A;  4Q42 A;  2ZAV A;  1TBJ A;  2EF4 A;  3E8Q A;  4IU0 A;  4Q3Q A;  1GQ7 A;  3LP7 A;  1T4R A;  4I06 A;  3SL0 A;  3E8Z A;  1GQ6 A;  4IXV A;  1T4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...