1RLBE

Retinol binding protein complexed with transthyretin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
174
structure length
174
Chain Sequence
b'ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPQVQKIVRQRQEELCLARQYRLIPHNGYC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSTHYRETIN
publication title Structure of a complex of two plasma proteins: transthyretin and retinol-binding protein.
pubmed rcsb
molecule tags Complex (protein/protein)
total genus 41
structure length 174
sequence length 174
chains with identical sequence F
ec nomenclature
pdb deposition date 1995-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1rlbE00
1ZNLA 1BBPA 1G74A 3KFFA 3S26A 4OMWA 2KT4B 1FTPA 4QGVA 1KT5A 1CJ5A 4XMCA 4YKMA 3PH6A 3VG7A 3L4RA 1BEBA 4A1HA 4AYHA 2ASNX 2HMBA 4I3DA 5HCEC 2K23A 2G79A 3O2YA 5BVQA 3VG2A 4ORWA 5FENA 2O62A 3P6GA 4HPCA 2F73A 4MVIA 4GH7A 4M6SA 3K3LA 2AKQA 3P6FA 1FDQA 1BSQA 4IMOA 4YBUA 1PMPA 4TJZA 5LJBA 3CR6A 2MO5A 5HCCC 1SXXA 4NNSA 2WEWA 1MX7A 4IB9A 3APVA 3KFHA 1QQSA 4A1YA 2OFRX 1U18A 2W2BA 4ODDA 1ZNHA 4ORUA 1IIUA 4IB6A 2RD7C 3B2KA 3BS2A 4YBPA 4TQ2A 2EU7X 1FEMA 1SA8A 5F7GA 3UEUA 1S7DA 4HPBA 3FLLA 1G85A 3U9PC 3TGBA 1LIFA 3AKNA 4YFPA 1GX9A 4ARHA 2RCTA 2WQAE 3P6CA 4YKOA 2RQ0A 3WBGA 2L68A 3WJCA 5LJGA 1E06A 4QYNA 3C77X 2AL0X 1I06A 2HNXA 5LJDA 3B2HA 1R0UA 2A13A 1SY2A 4NNTA 4QYPA 3F9DA 1LKEA 4YGGA 1VYFA 4XMEA 3KFGA 5EEDA 4Y0SA 1QY2A 5KICA 3C76X 2HZQA 3KQ0A 3Q6LA 1DC9A 3NADA 1KGLA 2R73A 3FA8A 1LIBA 3PP6A 1EXSA 4ZHDA 1GX8A 1LPJA 1OEEA 2CBSA 3IFBA 1Z24A 1HN2A 1O1VA 1SXYA 2CBRA 4ZFXA 3U03A 2CM9A 3RZYA 3WVMA 1EPBA 3MBTA 3DTQA 1KOIA 1IKEA 1KT7A 4ORXA 1U0XA 3D97A 5CE4A 4EDEA 1YWAA 3T1DA 3UEVA 1ZNKA 5B29A 2FR3A 4O9SA 1PBOA 3STKA 4UU2A 5LKFA 2RCQA 3CMPA 3FA7A 1RLBE 1ZNDA 1BM5A 2NP1A 5HTDA 1CRBA 4NLIA 4BVMA 1JZUA 5HBSA 1AQBA 1KQXA 1L6MA 2AH7X 1SY0A 5D8JA 5HAEA 1DZKA 1A57A 1ACDA 3TGAA 2QO6A 1HMTA 4AW8A 1AVGI 2FS6A 3HWFA 2R56A 4ZCBA 3TF6A 1I4UA 1KT4A 2IFBA 4XMDA 1KQWA 4IB8A 1SY3A 4QGWA 1GXAA 1GT5A 1HMRA 3PPTA 4CK4A 4NYRA 3JSQA 4ZR2A 2WR6A 1H91A 2AMMX 4IMNA 1HBQA 3FR5A 1ICMA 1OPBA 2HLVA 2N93A 4EFGA 1KZXA 1QFTA 2Q39A 1KXOA 1X8QA 4AZNA 1I05A 4YDAA 5HA0A 3NX2A 3O22A 3BLGA 4KIIA 1JJJA 1OBPA 4I9RA 3FA6A 1X8OA 4RUUA 2LKKA 4GETA 1LFOA 3D96A 1GGLA 4ZJ0A 1DV9A 2AT0X 4ZH9A 1ALBA 1QY0A 5F6ZA 5HWZA 3TZSA 3FMZA 3WXQA 4GKCA 4PSQA 3UEXA 3MVFA 4AZQA 1S44A 3PECA 2LFOA 1TW4A 3NQ9A 5LJEA 5LKEA 3ZUIA 3STNA 2OFMX 3EMMA 4Y0RA 1LNMA 3BU1A 3PEDA 2GC9A 3P6EA 5KIDA 1ERXA 1T0VA 3BRNA 2A3FX 1S2PA 4OS0A 1SY1A 2W2FA 5BVSA 5LJCA 1PM1X 4TKJA 2NNEA 1FENA 1HQPA 5EPQA 3F8AA 2CM4A 3EYCA 2L67A 4ORSA 4K19A 1ERBA 2QO4A 1CBQA 5EEEA 1BJ7A 2FWVA 4HPDA 5EDCA 2FS7A 1LICA 2WWPA 2AT3X 3B2IA 2JU3A 1MX8A 1TOUA 2POAA 3VG5A 1QY1A 4NLJA 4ZHGA 1TXLA 5H9LA 1B8EA 3HWGA 1X8PA 4N7DA 5DPQA 1P6PA 3I0AA 1N0SA 1X8NA 2AT5X 2RA6A 4TLJA 3PH5A 3BU9A 3SAOA 1E5PA 5B27A 4YCHA 1OBUA 1BRQA 4MVLA 5HZ6A 2NNDA 2OVAA 1SXWA 4ALBA 1D2UA 3C78X 4EEJA 4AZPA 1BRPA 1EIIA 3APWA 1T8VA 1OBQA 3D95A 2ALLX 2L5PA 4LZUA 5D47A 5C0NA 1JV4A 1A18A 4M7MA 1LIEA 5F58A 1LIDA 3RSWA 1HBPA 1UREA 3P6HA 1JJXA 1DZPA 1GM6A 2X45A 1YIVA 3EM0A 1IFCA 2CZUA 2ACOA 3ZUOA 2MM3A 4QZUA 2X46A 4ZHCA 4EXZA 4GRJA 5BVTA 2QOSC 2OZQA 3CBSA 4TKHA 4D6AA 3CWKA 1DFVA 2L9CA 5HZQA 5F1EA 1FE3A 1UZ2X 2NNQA 3WJEA 1KT3A 2BLGA 4ORRA 2FT9A 4R0BA 4OS3A 4A8ZA 1YUPA 1AB0A 3FW5A 4TKBA 4WFVA 4ES7A 4LKTA 3FA9A 1O8VA 4GNYA 3GAQA 3CBCA 4ZH6A 3BSZE 2A0AA 1E02A 1BSOA 1JYDA 4Y0QA 5DG4A 1IKJA 1RBPA 4IBAA 4UU3A 3WJBA 2WEXA 1LF7A 2W2AA 2P8GA 5IO6A 1MUPA 2LB6A 3DSZA 4GE1A 1B56A 3O19A 5FAZA 2LBVA 1KZWA 1IFBA 3QKGA 4HPAA 2MJIA 4OS8A 5HCDC 1VYGA 2YG2A 4GNWA 1YWDA 1ZRYA 5HTEA 2XKLA 3NP1A 3NPOA 1I04A 5L8IA 1BWYA 1JYJA 1D3SA 1CBSA 1JBHA 1CBIA 1E00A 4TNNA 3HK1A 4YCEA 1PEEA 2QO5A 1GT4A 1EALA 1YWBA 4ALOA 2GJ5A 5FFHA 5F6BA 1QG5A 3JS1A 4I9SA 1OPAA 2Q2PA 5EZ2A 1X8UA 5AQ6A 1GT1A 4YFRA 2ACPX 3AKMA 4QAEA 4WFUA 5HZ9A 1OEJA 1QWDA 1X71A 1NP4A 4XMFA 1QABE 4ZGUA 1X89A 1BSYA 4D6BA 4IAWA 4N7CA 2WUTA 4QGXA 1TOWA 1MDCA 2HYSA 3TGCA 3STMX 1U17A 1QFVA 2G78A 5HA1A 5L8OA 4OMXA 2JU8A 1NGLA 1ZNGA 2A2UA 5H9KA 2Q9SA 3FEPA 2G7BA 3UEWA 4DQ3A 3U0DA 1IW2A 2E4JA 2FR2A 1YWCA 4BQUA 1KT6A 5HZ8A 3FEKA 1G7NA 2WQ9A 2JU7A 1BLRA 2FTBA 1NP1A 1CBRA 3FR4A 2CZTA 3I17A 3FW4A 3KFIA 5D45A 2HZRA 5JR8A 4AZMA 3BX7A 4LZVA 2A2GA 1EQDA 3FIQA 5IO5A 1DZJA 4AZOA 5K06A 5LJKA 2K62A 4Y0PA 5H8TA 5KHPA 2KTDA 3B2JA 2DM5A 1O1UA 3VG6A 2Q4NA 4YDBA 2ANSA 2FRSA 3CQRA 1EPAA 2Q2MA 4YH0A 4IAXA 4HFOA 3ZQ3A 4A60A 4YGHA 1DF3A 3P6DA 5IO7A 1HMSA 3ELXA 1B4MA 2AT8X 4NYQA 3EBWA 1EUOA 3HWDA 4ZHHA 5H9NA 1T68X 1G5WA 4WBKA 5L8NA 1TVQA 5D4AA 3NQ3A 5D48A 2JOZA 2OVEA 1A2DA 1MVGA 3B2LA 1EW3A 5EDBA 1ML7A 3G7XA 4YGZA 2QM9A 3ELZA 1EIOA 3BDRA 4IB7A 4RUNA 1VPRA 2AT6X 2GTFX 1FELA 3FELA 4BOEA 3EBKA 1YP6A 3APUA 3NX1A 1GKAB 1DZMA 1ZNEA 1B0OA 3BY0A 3HWEA 3OJYC 4XMHA 2OVDA 1ADLA 2LBAA 1SXUA 4XMGA 1XKIA 1A3YA 1ICNA 4ORYA 2PY1A 3WJFA 2XSTA 3NR3A 2FLJA 3KZAA 1GKAA 2R74A 2WSJA 3WJGA 4AZRA 2JN3A 3VG3A 3CQNA 5H9AA 3WJDA 3VG4A 4MVKA 3FENA 5LJHA 4YMYA 1AELA 1OEKA 4I3CA 1YP7A 1XCAA 4I3BA 4YFQA 5HZ5A 1GT3A 4QZTA 3IA8A 3APXA 4NP1A 4DQ4A 3FR2A 4ZHFA 4LKPA 3BX8A
chains in the Genus database with same CATH superfamily
1ZNLA 1BBPA 1G74A 3KFFA 5AJBA 1MK5A 3S26A 5JD2A 2RTPB 4OMWA 4O4XA 2HKDA 2KT4B 1FTPA 4QGVA 1KT5A 1CJ5A 2IZHB 4XMCA 4YKMA 2IZFB 3PH6A 3VG7A 3E3CA 3VGWA 3L4RA 3RE6A 1BEBA 1JMXA 4A1HA 3EW1A 4AYHA 1RSUB 2ASNX 2HMBA 4I3DA 5HCEC 2K23A 1W4TA 2G79A 3O2YA 5BVQA 4ORWA 3VG2A 2O62A 3P6GA 4HPCA 2F73A 4MVIA 4GZVA 3D9WA 4GH7A 3WYQA 4ZGFA 4M6SA 3K3LA 2AKQA 3T6LA 3P6FA 1FDQA 1UYNX 4JGLA 1BSQA 3HTYA 4IMOA 4YBUA 1PMPA 4TJZA 5LJBA 3CR6A 1HXLA 1SWSA 2MHDA 5B10O 2MO5A 2X56A 5HCCC 1SXXA 4OKAA 5B5GA 4NNSA 1EI5A 2BHVA 3RDUA 2MWHA 1SWPA 2WEWA 1MX7A 5F2BA 4IB9A 1SWUA 3APVA 3FDCA 4GGRA 3RE5A 2OFBA 3KFHA 3LV4A 1QQSA 4A1YA 2OFRX 1STRB 1U18A 2RTIB 2W2BA 4ODDA 1VWJB 1ZNHA 1NC9A 3AEHA 1IIUA 4IB6A 2RD7C 2IZBA 3B2KA 3BS2A 4GDAA 4ORUA 4YBPA 2X8TA 1FJ1E 1N9YA 4TQ2A 2EU7X 1FEMA 2OFAA 2RTQB 1SA8A 1SWAA 5F7GA 4KC7A 3FYFA 4L1NA 4Y5DA 1S7DA 3UEUA 2C4IA 2RTOB 1UYOX 4HPBA 1KL3A 2X4MA 4O4SA 3FLLA 1G85A 3U9PC 3TGBA 1LIFA 3AKNA 1VWCB 4YFPA 1GX9A 4ARHA 2RCTA 1SMPI 2WQAE 2Y3FA 1N7YA 3P6CA 2RQ0A 4YKOA 5FQ7E 2L68A 3WBGA 2OL6O 4COTA 3WJCA 4FBOA 4JO6A 5LJGA 4GJSA 4L3RA 2OF9A 1E06A 1SRIA 4QYNA 3C77X 2AL0X 1I06A 2HNXA 2IZJA 5LJDA 3GE2A 4DNEA 1W6FA 3RDXA 1SLGB 1R0UA 2A13A 1SY2A 3B2HA 4NNTA 4QYPA 3F9DA 1LKEA 4YGGA 1VYFA 4XMEA 5B11O 3KFGA 1VWFB 4Y0SA 1QY2A 5EEDA 5KICA 3C76X 2F01A 2HZQA 3KQ0A 3Q6LA 1DC9A 2AF5A 3NADA 1KGLA 2R73A 3FA8A 3NBXX 1LIBA 1VWAB 1SLFB 1EXSA 2IZCB 3PP6A 4ZHDA 4YVBA 1GX8A 1LPJA 1OEEA 2CBSA 2Y32A 1LCZA 3VE2A 3WYPA 2OF8A 1Z24A 1HN2A 1O1VA 1SXYA 2A5BA 2CBRA 3IFBA 4Z2VA 4ZFXA 3U03A 3LTWA 4CPHA 2CM9A 2LA7A 3RZYA 4CV7A 3VHMA 3WVMA 1Y9LA 2FGSA 1OSPO 1EPBA 4U3QA 5FENA 3MBTA 3DTQA 1KOIA 1IKEA 2OY8A 1KT7A 4ORXA 3VHIA 1U0XA 3D97A 2IZGB 5CE4A 3HOLA 4EDEA 1YWAA 2F09A 1JMZA 3T1DA 1ZNKA 3UEVA 5B29A 2FR3A 4O9SA 2FKJA 2OVSA 1PBOA 3STKA 3RDMA 4UU2A 5K68A 5LKFA 2RCQA 3CMPA 5IRUA 3FA7A 1RLBE 1ZNDA 1BM5A 3AUMO 2NP1A 1SWTA 5HTDA 4I95A 2FHLA 1CRBA 2GTLO 4O4UA 4NLIA 4BVMA 3PDFA 1JZUA 5HBSA 1AQBA 1KQXA 2FKGA 1L6MA 2RTCB 2AH7X 1SY0A 5D8JA 4EKVA 5HAEA 1DZKA 1MM9A 1A57A 4DCBA 1ACDA 3RWXA 3RY2A 3TGAA 2QO6A 1HMTA 4KCAA 1HXZA 4PJ2A 4AW8A 1VWHB 4CDFA 1AVGI 2FS6A 2OL8O 2R56A 3HWFA 2Z4IA 4ML7B 3T6FA 4ZCBA 3TF6A 1JJUA 1I4UA 1SWDA 3SOTA 1KT4A 2IFBA 4XMDA 3WZQA 1KQWA 4IB8A 1SY3A 4KT5A 4QGWA 4IRWA 3T2XA 1GXAA 1GT5A 1SWBA 1HMRA 3PPTA 5IXGA 4CK4A 4NYRA 3JSQA 4ZR2A 2WR6A 1H91A 1RXJA 2AMMX 2KW1A 1HBQA 3FR5A 4IMNA 1ICMA 1OPBA 2JGSA 2HLVA 2N93A 4EFGA 1KZXA 1QFTA 2IZAA 2Q39A 1KXOA 4O49A 1X8QA 4AZNA 1I05A 4YDAA 5HA0A 3NX2A 3O22A 3BLGA 4KIIA 4GGZA 3SLJA 5FQ8E 2A5CA 1OBPA 4BX5B 4I9RA 1JJJA 3VU1A 5K67A 3FA6A 1X8OA 4RUUA 4GUZA 3VHHA 3SLTA 2LKKA 4GETA 4NV8A 1K3BA 2M4LA 1LFOA 3CKFA 1GGLA 3D96A 4JNJA 2BC3A 4ZJ0A 2AT0X 4ZH9A 1DV9A 1ALBA 1QY0A 4U46A 5F6ZA 4BBOA 1SLEB 5HWZA 3TZSA 4O3ZA 3FMZA 1PBYA 3WXQA 1Y0GA 2ZAGA 2X8SA 3PK2A 4GKCA 2C1SA 4LQZA 3MVFA 4PSQA 4QRLA 3UEXA 4AZQA 4FBRA 1S44A 2JW1A 1AVEA 2LFOA 1TW4A 2GTLN 1KFFA 1WBIA 3NQ9A 3PECA 4OELA 5LJEA 5LKEA 3ZUIA 2X8FA 3STNA 2OFMX 1LCVA 2RTGB 3EMMA 4Y0RA 1LNMA 2BT9A 1RXKA 3BU1A 5AEOA 4Z27A 2RTRB 3PEDA 2GC9A 3P6EA 4FGIB 3V8UA 1VWMB 5KIDA 1ERXA 1T0VA 1VWNB 2RTFB 2A3FX 1S2PA 3BRNA 3T2WA 4OS0A 1SY1A 3P24A 2W2FA 1N4JA 5BVSA 5LJCA 1PM1X 4TKJA 2NNEA 1FENA 1HQPA 5EPQA 3ZW0B 2RTLA 3F8AA 2CM4A 3EYCA 2L67A 4ORSA 1SWKA 4K19A 1ERBA 2QO4A 1CBQA 5EEEA 1BJ7A 2FWVA 4HPDA 2YMSA 4I6SA 2FS7A 5EDCA 5CHKA 1LICA 2WWPA 2AT3X 2RN4A 2JU3A 3B2IA 1MX8A 1TOUA 2POAA 3VG5A 1QY1A 4NLJA 4ZHGA 1TXLA 5H9LA 3ZW0A 1B8EA 2RTKA 5IRAA 3HWGA 2IZEB 2X32A 1X8PA 4N7DA 5DPQA 2DJGA 1VYOA 1P6PA 4Z2PA 3I0AA 1N0SA 1X8NA 2AT5X 2RA6A 4TLJA 3PH5A 1VWPB 3BU9A 4JHQA 3SAOA 1E5PA 2IZLB 4GK9A 4U8UN 4YCHA 1VWEB 5B27A 1NDJA 1OBUA 1BRQA 4MVLA 2UZ2A 5HZ6A 2NNDA 2OVAA 1Y52X 1SXWA 1NBXA 4ALBA 1D2UA 1VWOB 2OY1O 3C78X 4EEJA 2GH7A 1RAVA 4AZPA 1BRPA 1EIIA 3APWA 1T8VA 1OBQA 3D95A 3MM0A 1DF8A 2ALLX 2IZKA 2L5PA 4LZUA 1JV4A 5D47A 3RKGA 1LDQA 5C0NA 1A18A 4BX5A 4M7MA 1LIEA 5F58A 3WOVA 1LIDA 4GGTA 1HBPA 3RSWA 1UREA 1JIWI 3P6HA 5FQ6E 1JJXA 1DZPA 1GM6A 2X45A 3SZHA 1SRGA 4QNIA 1YIVA 3EM0A 1IFCA 2CZUA 2Z4HA 2OYBO 2ACOA 3OBLA 3OD9A 3ZUOA 4O3YA 2MM3A 3X00A 4QZUA 2X46A 4ZHCA 1Y53X 1VWQB 2Y3EA 4GRJA 4EXZA 5BVTA 3S5XA 2QOSC 1SREA 2OZQA 3CBSA 4KH8A 4TKHA 4D6AA 3CWKA 3RY1A 3UAQA 1DFVA 3RBYA 2X55A 2L9CA 4GDZA 5HZQA 5F1EA 1FE3A 1UZ2X 2NNQA 3WJEA 1KT3A 2UYWA 4Z6JA 2C1QA 1VWIB 2BLGA 1NQMA 4ORRA 2FT9A 2PI3O 2IZDB 4OS3A 1WUBA 4KC8A 2MF6A 4R0BA 3WZNA 1YUPA 4A8ZA 1AB0A 3FW5A 4TKBA 4WFVA 4ES7A 3MG5A 4LKTA 3FA9A 3ZW1B 5IRWA 1O8VA 4GNYA 3GAQA 3CBCA 4ZH6A 3BSZE 4XMHA 2A0AA 1E02A 2GTLM 1BSOA 1JYDA 2RTEB 2VFBA 3JQOA 1IKJA 1RBPA 4IBAA 4UU3A 4Y0QA 5DG4A 3WJBA 3H3IA 4MEEA 2WEXA 1LF7A 2W2AA 4BX7B 1LELA 2P8GA 1SWFA 4EQAC 4MISA 5IO6A 1MUPA 2LB6A 3Q34A 3DSZA 2ZAIA 4GE1A 3WZPA 1B56A 3O19A 5FAZA 2LBVA 3WZOA 3ZW1A 1KZWA 3SZIA 3RDQA 1IFBA 3QKGA 4HPAA 4BGFA 1AVDA 1W5RA 2A8GA 2AVIA 2MJIA 4BJ8A 4OS8A 5HCDC 1VYGA 3HOEA 3LHNA 2YG2A 3ZI8A 3EC5A 4GNWA 1YWDA 1ZRYA 5CSEA 5HTEA 2XKLA 4BX7A 5BYPA 3NP1A 3NPOA 1I04A 1N9MA 4ID2A 5L8IA 4U8UO 1BWYA 1JYJA 4OEMA 1D3SA 1I78A 1CBSA 1JBHA 1CBIA 1E00A 4GU8A 3HK1A 4TNNA 2RTBB 4YCEA 1RXHA 1PEEA 2QO5A 2JMBA 4MIRA 1GT4A 1EALA 1YWBA 1KL4A 2GJ5A 5FFHA 4ALOA 1SWGA 5F6BA 1QG5A 3JS1A 3PQUA 1I9HA 4I9SA 2G5LA 1OPAA 4NW4A 1SWJA 2Q2PA 3SZJA 5EZ2A 1X8UA 5AQ6A 1GT1A 4YFRA 2ACPX 3AKMA 4QAEA 4WFUA 5HZ9A 1OEJA 1QWDA 4U8UM 2RTAA 3CKGA 1X71A 2QMIA 4Z28A 2CAMA 1NP4A 4XMFA 1QABE 4ZGUA 1X89A 4FQBB 1BSYA 1SWRA 4IAWA 4N7CA 3PQSA 5AJCA 4D6BA 2WUTA 1GX3A 3HPEA 4QGXA 1TOWA 1MDCA 2HYSA 2OY7A 1PTSA 3TGCA 3STMX 1SWHA 1U17A 1QFVA 2G78A 5CYBA 1VWKB 2RTMA 5HA1A 4IABA 5L8OA 4OMXA 2JU8A 1NGLA 1ZNGA 2A2UA 5H9KA 2Q9SA 3FEPA 2G7BA 3UEWA 4DQ3A 3U0DA 1IW2A 2E4JA 2FR2A 1YWCA 4BQUA 1KT6A 4BX6B 2RTHB 3KVNA 3N91A 5HZ8A 4CPHB 4CDCA 3FEKA 4GJVA 3RDSA 1G7NA 1SLDB 1SRJA 2WQ9A 1IJ8A 2JU7A 3F6ZB 1BLRA 2RTNB 2FTBA 1NP1A 1CBRA 3FR4A 3NQKA 1KL5A 2CZTA 3I17A 3FW4A 4LKPA 3VE1A 4CPIA 3KFIA 5D45A 2HZRA 1VWGB 3SLOA 4AZMA 3BX7A 5JR8A 4LZVA 2A2GA 1EQDA 3FIQA 5IO5A 1DZJA 4AZOA 4BX6A 5B3MO 5K06A 2K62A 1E2TA 4Y0PA 5LJKA 5H8TA 2ZSCA 4O4OA 4Y59A 5KHPA 2KTDA 3B2JA 2DM5A 1O1UA 3VG6A 2Q4NA 1SWCA 2QCBA 1LCWA 2FHNX 4YDBA 1STSB 2BS6A 4BCSA 2ANSA 1MEPA 2FRSA 4U9CA 3CQRA 1EPAA 2Q2MA 4YH0A 4IAXA 3VPJE 4HFOA 1RSTB 2OY5O 4CPEA 3S5VA 3ZQ3A 2BSZA 4YGHA 4A60A 5L3YA 1MOYA 3FIDA 1Y55X 1DF3A 3P6DA 1K24A 1SWLA 1HMSA 1SWQA 3ELXA 2AT8X 3ZZVA 5IO7A 4NYQA 2VDFA 1B4MA 2DJFA 1EUOA 3EBWA 3HWDA 3S60A 4WHIA 5H9NA 4ZHHA 2IZIA 2OL7A 4I60A 1T68X 1SWNA 3QQ2A 4WBKA 1G5WA 4GD9A 1TVQA 5L8NA 5D4AA 3NQ3A 5D48A 2JOZA 2OVEA 3EW2A 1A2DA 3ZWEA 1MVGA 2VFCA 3B2LA 1EW3A 5EDBA 1ML7A 3G7XA 4YGZA 2QM9A 1Y9TA 1VWBB 2I5VO 2KD2A 3ELZA 1EIOA 3BDRA 4IB7A 4RUNA 4FBVA 1VPRA 2AT6X 2GTFX 2WPUA 1FELA 2X34A 3FELA 1SWEA 4ON1A 4BOEA 3D4RA 4CPFA 3EBKA 1LDOA 4NV7A 1YP6A 2I5ZO 3APUA 1GKAB 1DZMA 1SWOA 1B0OA 1ZNEA 3BY0A 3HWEA 3NX1A 3OJYC 1ADLA 2LBAA 2OVDA 1SXUA 1N43A 4XMGA 1XKIA 1A3YA 1ICNA 5B2AO 4ORYA 4QQ1A 2BS5A 2PY1A 1NQNA 3WJFA 3RDOA 2KTSA 4B55A 1HQQA 3P02A 4CSBA 2RTDB 2XSTA 1SRHA 2QOMA 2RTJA 1JQPA 3NR3A 3ZW2A 2FLJA 3KZAA 1GKAA 1STPA 1HY2A 2R74A 1SRFA 2WSJA 4INNA 1VWRB 3WJGA 2JN3A 3VG3A 4AZRA 3CQNA 4CDDA 4MVEA 4Z2OA 5H9AA 3WJDA 3VG4A 4MVKA 3FENA 2G8CO 3MX7A 4YMYA 4C5PA 4O3XB 5LJHA 1AELA 1OEKA 4I3CA 1YP7A 1XCAA 1VWDB 4I3BA 4O3WA 4YFQA 5B5FA 5HZ5A 3OE3A 1GT3A 4QZTA 3IA8A 3APXA 4NP1A 4DQ4A 3FR2A 4CDEA 4ZHFA 4HWMA 1LUQA 1VWLB 3BX8A
chains in the Genus database with same CATH topology
1ZNLA 1BBPA 1G74A 3KFFA 5AJBA 3S26A 4OMWA 4O4XA 2KT4B 1FTPA 4QGVA 1KT5A 1CJ5A 4XMCA 4YKMA 3PH6A 3VG7A 3E3CA 3L4RA 1BEBA 4A1HA 4AYHA 2ASNX 2HMBA 4I3DA 5HCEC 2K23A 2G79A 3O2YA 5BVQA 3VG2A 4ORWA 5FENA 2O62A 3P6GA 4HPCA 2F73A 4MVIA 4GZVA 4GH7A 4ZGFA 4M6SA 3K3LA 2AKQA 3P6FA 1FDQA 4JGLA 1BSQA 3HTYA 4IMOA 4YBUA 1PMPA 4TJZA 5LJBA 3CR6A 2MHDA 2MO5A 5HCCC 1SXXA 4NNSA 1EI5A 2BHVA 2WEWA 1MX7A 4IB9A 3APVA 3KFHA 3LV4A 1QQSA 4A1YA 2OFRX 1U18A 2W2BA 4ODDA 1ZNHA 4ORUA 1IIUA 4IB6A 2RD7C 3B2KA 3BS2A 4YBPA 2X8TA 4TQ2A 2EU7X 1FEMA 1SA8A 5F7GA 4KC7A 3FYFA 4L1NA 3UEUA 1S7DA 4HPBA 4O4SA 3FLLA 1G85A 3U9PC 3TGBA 1LIFA 3AKNA 4YFPA 1GX9A 4ARHA 2RCTA 1SMPI 2WQAE 3P6CA 4YKOA 2RQ0A 5FQ7E 3WBGA 2L68A 4COTA 3WJCA 4FBOA 5LJGA 4L3RA 1E06A 4QYNA 3C77X 2AL0X 1I06A 2HNXA 5LJDA 3GE2A 3B2HA 1R0UA 2A13A 1SY2A 4NNTA 4QYPA 3F9DA 1LKEA 4YGGA 1VYFA 4XMEA 3KFGA 5EEDA 4Y0SA 1QY2A 5KICA 3C76X 2HZQA 3KQ0A 3Q6LA 1DC9A 3NADA 1KGLA 2R73A 3FA8A 3NBXX 1LIBA 3PP6A 1EXSA 4ZHDA 1GX8A 1LPJA 1OEEA 2CBSA 3VE2A 3IFBA 1Z24A 1HN2A 1O1VA 1SXYA 2CBRA 4ZFXA 3U03A 2CM9A 2LA7A 3RZYA 4CV7A 3WVMA 1Y9LA 1EPBA 4U3QA 3MBTA 3DTQA 1KOIA 1IKEA 1KT7A 4ORXA 1U0XA 3D97A 5CE4A 3HOLA 4EDEA 1YWAA 2F09A 3T1DA 3UEVA 1ZNKA 5B29A 2FR3A 4O9SA 2OVSA 1PBOA 3STKA 4UU2A 5LKFA 2RCQA 3CMPA 3FA7A 1RLBE 1ZNDA 1BM5A 2NP1A 5HTDA 4I95A 4O4UA 1CRBA 2GTLO 4NLIA 4BVMA 1JZUA 5HBSA 1AQBA 1KQXA 1L6MA 2AH7X 1SY0A 5D8JA 5HAEA 1DZKA 1A57A 1ACDA 3RWXA 3TGAA 2QO6A 1HMTA 4KCAA 4PJ2A 4AW8A 1AVGI 2FS6A 3HWFA 2R56A 4ML7B 2Z4IA 4ZCBA 3TF6A 1I4UA 3SOTA 1KT4A 2IFBA 4XMDA 1KQWA 4IB8A 1SY3A 4KT5A 4QGWA 1GXAA 1GT5A 1HMRA 3PPTA 4CK4A 4NYRA 3JSQA 4ZR2A 2WR6A 1H91A 2AMMX 2KW1A 4IMNA 1HBQA 3FR5A 1ICMA 1OPBA 2HLVA 2N93A 4EFGA 1KZXA 1QFTA 2Q39A 1KXOA 4O49A 1X8QA 4AZNA 1I05A 4YDAA 5HA0A 3NX2A 3O22A 3BLGA 4KIIA 5FQ8E 1JJJA 1OBPA 4I9RA 3VU1A 3FA6A 1X8OA 4RUUA 2LKKA 4GETA 2M4LA 1LFOA 3D96A 1GGLA 4ZJ0A 1DV9A 2AT0X 4ZH9A 1ALBA 1QY0A 5F6ZA 5HWZA 3TZSA 4O3ZA 3FMZA 3WXQA 2ZAGA 4LQZA 2X8SA 4GKCA 4PSQA 3UEXA 4QRLA 3MVFA 4FBRA 4AZQA 1S44A 2JW1A 3PECA 2LFOA 1TW4A 2GTLN 3NQ9A 5LJEA 5LKEA 3ZUIA 2X8FA 3STNA 2OFMX 3EMMA 4Y0RA 1LNMA 2BT9A 3BU1A 5AEOA 3PEDA 2GC9A 3P6EA 4FGIB 3V8UA 5KIDA 1ERXA 1T0VA 3BRNA 2A3FX 1S2PA 4OS0A 1SY1A 3P24A 2W2FA 5BVSA 5LJCA 1PM1X 4TKJA 2NNEA 1FENA 1HQPA 5EPQA 3ZW0B 3F8AA 2CM4A 3EYCA 2L67A 4ORSA 4K19A 1ERBA 2QO4A 1CBQA 5EEEA 1BJ7A 2FWVA 4HPDA 2YMSA 4I6SA 2FS7A 5EDCA 1LICA 2WWPA 2AT3X 2RN4A 2JU3A 3B2IA 1MX8A 1TOUA 2POAA 3VG5A 1QY1A 4NLJA 4ZHGA 1TXLA 5H9LA 3ZW0A 1B8EA 3HWGA 1X8PA 4N7DA 5DPQA 1P6PA 3I0AA 1N0SA 1X8NA 2AT5X 2RA6A 4TLJA 3PH5A 3BU9A 3SAOA 1E5PA 4GK9A 4U8UN 5B27A 4YCHA 1OBUA 1BRQA 4MVLA 5HZ6A 2NNDA 2OVAA 1SXWA 4ALBA 1D2UA 3C78X 4EEJA 4AZPA 1BRPA 1EIIA 3APWA 1T8VA 1OBQA 3D95A 2ALLX 2L5PA 4LZUA 5D47A 5C0NA 1JV4A 3RKGA 1A18A 4M7MA 1LIEA 5F58A 3WOVA 1LIDA 3RSWA 1HBPA 1UREA 1JIWI 3P6HA 5FQ6E 1JJXA 1DZPA 1GM6A 2X45A 4QNIA 1YIVA 3EM0A 1IFCA 2CZUA 2Z4HA 2ACOA 3OBLA 3OD9A 3ZUOA 4O3YA 2MM3A 4QZUA 2X46A 4ZHCA 4EXZA 4GRJA 5BVTA 3S5XA 2QOSC 2OZQA 3CBSA 4KH8A 4TKHA 4D6AA 3CWKA 3UAQA 1DFVA 3RBYA 2L9CA 4GDZA 5HZQA 5F1EA 1FE3A 1UZ2X 2NNQA 3WJEA 1KT3A 2BLGA 4ORRA 2FT9A 4R0BA 4OS3A 4A8ZA 4KC8A 1YUPA 1AB0A 3FW5A 4TKBA 4WFVA 4ES7A 4LKTA 3FA9A 3ZW1B 1O8VA 4GNYA 3GAQA 3CBCA 4ZH6A 3BSZE 2A0AA 1E02A 2GTLM 1BSOA 1JYDA 3JQOA 4Y0QA 5DG4A 1IKJA 1RBPA 4IBAA 4UU3A 3WJBA 3H3IA 2WEXA 1LF7A 2W2AA 2P8GA 4EQAC 4MISA 5IO6A 1MUPA 2LB6A 3DSZA 2ZAIA 4GE1A 1B56A 3O19A 5FAZA 2LBVA 3ZW1A 1KZWA 1IFBA 3QKGA 4HPAA 2MJIA 4OS8A 5HCDC 1VYGA 3HOEA 3LHNA 2YG2A 3ZI8A 4GNWA 1YWDA 1ZRYA 5HTEA 2XKLA 5BYPA 3NP1A 3NPOA 1I04A 4ID2A 5L8IA 1BWYA 4U8UO 1JYJA 1D3SA 1CBSA 1JBHA 1CBIA 1E00A 4GU8A 3HK1A 4TNNA 4YCEA 1PEEA 2QO5A 2JMBA 4MIRA 1GT4A 1EALA 1YWBA 4ALOA 2GJ5A 5FFHA 5F6BA 1QG5A 3JS1A 3PQUA 4I9SA 4NW4A 1OPAA 2Q2PA 5EZ2A 1X8UA 5AQ6A 1GT1A 4YFRA 2ACPX 3AKMA 4QAEA 4WFUA 5HZ9A 1OEJA 1QWDA 4U8UM 1X71A 2QMIA 1NP4A 4XMFA 1QABE 4ZGUA 1X89A 4FQBB 1BSYA 4D6BA 4IAWA 4N7CA 3PQSA 5AJCA 2WUTA 4QGXA 1TOWA 1MDCA 2HYSA 3TGCA 3STMX 1U17A 1QFVA 2G78A 5CYBA 5HA1A 4IABA 5L8OA 4OMXA 2JU8A 1NGLA 1ZNGA 2A2UA 5H9KA 2Q9SA 3FEPA 2G7BA 3UEWA 4DQ3A 3U0DA 1IW2A 2E4JA 2FR2A 1YWCA 4BQUA 1KT6A 3N91A 5HZ8A 3FEKA 1G7NA 2WQ9A 3F6ZB 2JU7A 1BLRA 2FTBA 1NP1A 1CBRA 3FR4A 3NQKA 2CZTA 3I17A 3FW4A 4LKPA 3VE1A 3KFIA 5D45A 2HZRA 5JR8A 4AZMA 3BX7A 4LZVA 2A2GA 1EQDA 3FIQA 5IO5A 1DZJA 4AZOA 5K06A 5LJKA 2K62A 4Y0PA 5H8TA 4O4OA 5KHPA 2KTDA 3B2JA 2DM5A 1O1UA 3VG6A 2Q4NA 4YDBA 2BS6A 2ANSA 2FRSA 4U9CA 3CQRA 1EPAA 2Q2MA 4YH0A 4IAXA 3VPJE 4HFOA 3S5VA 3ZQ3A 4A60A 4YGHA 1DF3A 3P6DA 5IO7A 1HMSA 3ELXA 1B4MA 2AT8X 3ZZVA 4NYQA 3EBWA 1EUOA 3HWDA 3S60A 4ZHHA 4WHIA 5H9NA 1T68X 1G5WA 4WBKA 5L8NA 1TVQA 5D4AA 3NQ3A 5D48A 2JOZA 2OVEA 3ZWEA 1A2DA 1MVGA 3B2LA 1EW3A 5EDBA 1ML7A 3G7XA 4YGZA 2QM9A 1Y9TA 2KD2A 3ELZA 1EIOA 3BDRA 4IB7A 4RUNA 4FBVA 1VPRA 2AT6X 2GTFX 1FELA 3FELA 4ON1A 4BOEA 3D4RA 3EBKA 1YP6A 3APUA 3NX1A 1GKAB 1DZMA 1ZNEA 1B0OA 3BY0A 3HWEA 3OJYC 4XMHA 2OVDA 1ADLA 2LBAA 1SXUA 4XMGA 1XKIA 1A3YA 1ICNA 4ORYA 4QQ1A 2BS5A 2PY1A 3WJFA 4CSBA 2KTSA 3P02A 2XSTA 3NR3A 3ZW2A 2FLJA 3KZAA 1GKAA 2R74A 2WSJA 4INNA 3WJGA 4AZRA 2JN3A 3VG3A 3CQNA 4MVEA 5H9AA 3WJDA 3VG4A 4MVKA 3FENA 3MX7A 4YMYA 5LJHA 1AELA 4O3XB 1OEKA 4I3CA 1YP7A 1XCAA 4I3BA 4O3WA 4YFQA 5HZ5A 3OE3A 1GT3A 4QZTA 3IA8A 3APXA 4NP1A 4DQ4A 3FR2A 4ZHFA 4HWMA 2MWHA 3BX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZNL A;  1BBP A;  1G74 A;  3KFF A;  3S26 A;  4OMW A;  2KT4 B;  1FTP A;  4QGV A;  1KT5 A;  1CJ5 A;  4XMC A;  4YKM A;  3PH6 A;  3VG7 A;  3L4R A;  1BEB A;  4A1H A;  4AYH A;  2ASN X;  2HMB A;  4I3D A;  5HCE C;  2K23 A;  2G79 A;  3O2Y A;  5BVQ A;  3VG2 A;  4ORW A;  5FEN A;  2O62 A;  3P6G A;  4HPC A;  2F73 A;  4MVI A;  4GH7 A;  4M6S A;  3K3L A;  2AKQ A;  3P6F A;  1FDQ A;  1BSQ A;  4IMO A;  4YBU A;  1PMP A;  4TJZ A;  5LJB A;  3CR6 A;  2MO5 A;  5HCC C;  1SXX A;  4NNS A;  2WEW A;  1MX7 A;  4IB9 A;  3APV A;  3KFH A;  1QQS A;  4A1Y A;  2OFR X;  1U18 A;  2W2B A;  4ODD A;  1ZNH A;  4ORU A;  1IIU A;  4IB6 A;  2RD7 C;  3B2K A;  3BS2 A;  4YBP A;  4TQ2 A;  2EU7 X;  1FEM A;  1SA8 A;  5F7G A;  3UEU A;  1S7D A;  4HPB A;  3FLL A;  1G85 A;  3U9P C;  3TGB A;  1LIF A;  3AKN A;  4YFP A;  1GX9 A;  4ARH A;  2RCT A;  2WQA E;  3P6C A;  4YKO A;  2RQ0 A;  3WBG A;  2L68 A;  3WJC A;  5LJG A;  1E06 A;  4QYN A;  3C77 X;  2AL0 X;  1I06 A;  2HNX A;  5LJD A;  3B2H A;  1R0U A;  2A13 A;  1SY2 A;  4NNT A;  4QYP A;  3F9D A;  1LKE A;  4YGG A;  1VYF A;  4XME A;  3KFG A;  5EED A;  4Y0S A;  1QY2 A;  5KIC A;  3C76 X;  2HZQ A;  3KQ0 A;  3Q6L A;  1DC9 A;  3NAD A;  1KGL A;  2R73 A;  3FA8 A;  1LIB A;  3PP6 A;  1EXS A;  4ZHD A;  1GX8 A;  1LPJ A;  1OEE A;  2CBS A;  3IFB A;  1Z24 A;  1HN2 A;  1O1V A;  1SXY A;  2CBR A;  4ZFX A;  3U03 A;  2CM9 A;  3RZY A;  3WVM A;  1EPB A;  3MBT A;  3DTQ A;  1KOI A;  1IKE A;  1KT7 A;  4ORX A;  1U0X A;  3D97 A;  5CE4 A;  4EDE A;  1YWA A;  3T1D A;  3UEV A;  1ZNK A;  5B29 A;  2FR3 A;  4O9S A;  1PBO A;  3STK A;  4UU2 A;  5LKF A;  2RCQ A;  3CMP A;  3FA7 A;  1RLB E;  1ZND A;  1BM5 A;  2NP1 A;  5HTD A;  1CRB A;  4NLI A;  4BVM A;  1JZU A;  5HBS A;  1AQB A;  1KQX A;  1L6M A;  2AH7 X;  1SY0 A;  5D8J A;  5HAE A;  1DZK A;  1A57 A;  1ACD A;  3TGA A;  2QO6 A;  1HMT A;  4AW8 A;  1AVG I;  2FS6 A;  3HWF A;  2R56 A;  4ZCB A;  3TF6 A;  1I4U A;  1KT4 A;  2IFB A;  4XMD A;  1KQW A;  4IB8 A;  1SY3 A;  4QGW A;  1GXA A;  1GT5 A;  1HMR A;  3PPT A;  4CK4 A;  4NYR A;  3JSQ A;  4ZR2 A;  2WR6 A;  1H91 A;  2AMM X;  4IMN A;  1HBQ A;  3FR5 A;  1ICM A;  1OPB A;  2HLV A;  2N93 A;  4EFG A;  1KZX A;  1QFT A;  2Q39 A;  1KXO A;  1X8Q A;  4AZN A;  1I05 A;  4YDA A;  5HA0 A;  3NX2 A;  3O22 A;  3BLG A;  4KII A;  1JJJ A;  1OBP A;  4I9R A;  3FA6 A;  1X8O A;  4RUU A;  2LKK A;  4GET A;  1LFO A;  3D96 A;  1GGL A;  4ZJ0 A;  1DV9 A;  2AT0 X;  4ZH9 A;  1ALB A;  1QY0 A;  5F6Z A;  5HWZ A;  3TZS A;  3FMZ A;  3WXQ A;  4GKC A;  4PSQ A;  3UEX A;  3MVF A;  4AZQ A;  1S44 A;  3PEC A;  2LFO A;  1TW4 A;  3NQ9 A;  5LJE A;  5LKE A;  3ZUI A;  3STN A;  2OFM X;  3EMM A;  4Y0R A;  1LNM A;  3BU1 A;  3PED A;  2GC9 A;  3P6E A;  5KID A;  1ERX A;  1T0V A;  3BRN A;  2A3F X;  1S2P A;  4OS0 A;  1SY1 A;  2W2F A;  5BVS A;  5LJC A;  1PM1 X;  4TKJ A;  2NNE A;  1FEN A;  1HQP A;  5EPQ A;  3F8A A;  2CM4 A;  3EYC A;  2L67 A;  4ORS A;  4K19 A;  1ERB A;  2QO4 A;  1CBQ A;  5EEE A;  1BJ7 A;  2FWV A;  4HPD A;  5EDC A;  2FS7 A;  1LIC A;  2WWP A;  2AT3 X;  3B2I A;  2JU3 A;  1MX8 A;  1TOU A;  2POA A;  3VG5 A;  1QY1 A;  4NLJ A;  4ZHG A;  1TXL A;  5H9L A;  1B8E A;  3HWG A;  1X8P A;  4N7D A;  5DPQ A;  1P6P A;  3I0A A;  1N0S A;  1X8N A;  2AT5 X;  2RA6 A;  4TLJ A;  3PH5 A;  3BU9 A;  3SAO A;  1E5P A;  5B27 A;  4YCH A;  1OBU A;  1BRQ A;  4MVL A;  5HZ6 A;  2NND A;  2OVA A;  1SXW A;  4ALB A;  1D2U A;  3C78 X;  4EEJ A;  4AZP A;  1BRP A;  1EII A;  3APW A;  1T8V A;  1OBQ A;  3D95 A;  2ALL X;  2L5P A;  4LZU A;  5D47 A;  5C0N A;  1JV4 A;  1A18 A;  4M7M A;  1LIE A;  5F58 A;  1LID A;  3RSW A;  1HBP A;  1URE A;  3P6H A;  1JJX A;  1DZP A;  1GM6 A;  2X45 A;  1YIV A;  3EM0 A;  1IFC A;  2CZU A;  2ACO A;  3ZUO A;  2MM3 A;  4QZU A;  2X46 A;  4ZHC A;  4EXZ A;  4GRJ A;  5BVT A;  2QOS C;  2OZQ A;  3CBS A;  4TKH A;  4D6A A;  3CWK A;  1DFV A;  2L9C A;  5HZQ A;  5F1E A;  1FE3 A;  1UZ2 X;  2NNQ A;  3WJE A;  1KT3 A;  2BLG A;  4ORR A;  2FT9 A;  4R0B A;  4OS3 A;  4A8Z A;  1YUP A;  1AB0 A;  3FW5 A;  4TKB A;  4WFV A;  4ES7 A;  4LKT A;  3FA9 A;  1O8V A;  4GNY A;  3GAQ A;  3CBC A;  4ZH6 A;  3BSZ E;  2A0A A;  1E02 A;  1BSO A;  1JYD A;  4Y0Q A;  5DG4 A;  1IKJ A;  1RBP A;  4IBA A;  4UU3 A;  3WJB A;  2WEX A;  1LF7 A;  2W2A A;  2P8G A;  5IO6 A;  1MUP A;  2LB6 A;  3DSZ A;  4GE1 A;  1B56 A;  3O19 A;  5FAZ A;  2LBV A;  1KZW A;  1IFB A;  3QKG A;  4HPA A;  2MJI A;  4OS8 A;  5HCD C;  1VYG A;  2YG2 A;  4GNW A;  1YWD A;  1ZRY A;  5HTE A;  2XKL A;  3NP1 A;  3NPO A;  1I04 A;  5L8I A;  1BWY A;  1JYJ A;  1D3S A;  1CBS A;  1JBH A;  1CBI A;  1E00 A;  4TNN A;  3HK1 A;  4YCE A;  1PEE A;  2QO5 A;  1GT4 A;  1EAL A;  1YWB A;  4ALO A;  2GJ5 A;  5FFH A;  5F6B A;  1QG5 A;  3JS1 A;  4I9S A;  1OPA A;  2Q2P A;  5EZ2 A;  1X8U A;  5AQ6 A;  1GT1 A;  4YFR A;  2ACP X;  3AKM A;  4QAE A;  4WFU A;  5HZ9 A;  1OEJ A;  1QWD A;  1X71 A;  1NP4 A;  4XMF A;  1QAB E;  4ZGU A;  1X89 A;  1BSY A;  4D6B A;  4IAW A;  4N7C A;  2WUT A;  4QGX A;  1TOW A;  1MDC A;  2HYS A;  3TGC A;  3STM X;  1U17 A;  1QFV A;  2G78 A;  5HA1 A;  5L8O A;  4OMX A;  2JU8 A;  1NGL A;  1ZNG A;  2A2U A;  5H9K A;  2Q9S A;  3FEP A;  2G7B A;  3UEW A;  4DQ3 A;  3U0D A;  1IW2 A;  2E4J A;  2FR2 A;  1YWC A;  4BQU A;  1KT6 A;  5HZ8 A;  3FEK A;  1G7N A;  2WQ9 A;  2JU7 A;  1BLR A;  2FTB A;  1NP1 A;  1CBR A;  3FR4 A;  2CZT A;  3I17 A;  3FW4 A;  3KFI A;  5D45 A;  2HZR A;  5JR8 A;  4AZM A;  3BX7 A;  4LZV A;  2A2G A;  1EQD A;  3FIQ A;  5IO5 A;  1DZJ A;  4AZO A;  5K06 A;  5LJK A;  2K62 A;  4Y0P A;  5H8T A;  5KHP A;  2KTD A;  3B2J A;  2DM5 A;  1O1U A;  3VG6 A;  2Q4N A;  4YDB A;  2ANS A;  2FRS A;  3CQR A;  1EPA A;  2Q2M A;  4YH0 A;  4IAX A;  4HFO A;  3ZQ3 A;  4A60 A;  4YGH A;  1DF3 A;  3P6D A;  5IO7 A;  1HMS A;  3ELX A;  1B4M A;  2AT8 X;  4NYQ A;  3EBW A;  1EUO A;  3HWD A;  4ZHH A;  5H9N A;  1T68 X;  1G5W A;  4WBK A;  5L8N A;  1TVQ A;  5D4A A;  3NQ3 A;  5D48 A;  2JOZ A;  2OVE A;  1A2D A;  1MVG A;  3B2L A;  1EW3 A;  5EDB A;  1ML7 A;  3G7X A;  4YGZ A;  2QM9 A;  3ELZ A;  1EIO A;  3BDR A;  4IB7 A;  4RUN A;  1VPR A;  2AT6 X;  2GTF X;  1FEL A;  3FEL A;  4BOE A;  3EBK A;  1YP6 A;  3APU A;  3NX1 A;  1GKA B;  1DZM A;  1ZNE A;  1B0O A;  3BY0 A;  3HWE A;  3OJY C;  4XMH A;  2OVD A;  1ADL A;  2LBA A;  1SXU A;  4XMG A;  1XKI A;  1A3Y A;  1ICN A;  4ORY A;  2PY1 A;  3WJF A;  2XST A;  3NR3 A;  2FLJ A;  3KZA A;  1GKA A;  2R74 A;  2WSJ A;  3WJG A;  4AZR A;  2JN3 A;  3VG3 A;  3CQN A;  5H9A A;  3WJD A;  3VG4 A;  4MVK A;  3FEN A;  5LJH A;  4YMY A;  1AEL A;  1OEK A;  4I3C A;  1YP7 A;  1XCA A;  4I3B A;  4YFQ A;  5HZ5 A;  1GT3 A;  4QZT A;  3IA8 A;  3APX A;  4NP1 A;  4DQ4 A;  3FR2 A;  4ZHF A;  4LKP A;  3BX8 A; 
#chains in the Genus database with same CATH topology
 1ZNL A;  1BBP A;  1G74 A;  3KFF A;  5AJB A;  1MK5 A;  3S26 A;  5JD2 A;  2RTP B;  4OMW A;  4O4X A;  2HKD A;  2KT4 B;  1FTP A;  4QGV A;  1KT5 A;  1CJ5 A;  2IZH B;  4XMC A;  4YKM A;  2IZF B;  3PH6 A;  3VG7 A;  3E3C A;  3VGW A;  3L4R A;  3RE6 A;  1BEB A;  1JMX A;  4A1H A;  3EW1 A;  4AYH A;  1RSU B;  2ASN X;  2HMB A;  4I3D A;  5HCE C;  2K23 A;  1W4T A;  2G79 A;  3O2Y A;  5BVQ A;  4ORW A;  3VG2 A;  2O62 A;  3P6G A;  4HPC A;  2F73 A;  4MVI A;  4GZV A;  3D9W A;  4GH7 A;  3WYQ A;  4ZGF A;  4M6S A;  3K3L A;  2AKQ A;  3T6L A;  3P6F A;  1FDQ A;  1UYN X;  4JGL A;  1BSQ A;  3HTY A;  4IMO A;  4YBU A;  1PMP A;  4TJZ A;  5LJB A;  3CR6 A;  1HXL A;  1SWS A;  2MHD A;  5B10 O;  2MO5 A;  2X56 A;  5HCC C;  1SXX A;  4OKA A;  5B5G A;  4NNS A;  1EI5 A;  2BHV A;  3RDU A;  2MWH A;  1SWP A;  2WEW A;  1MX7 A;  5F2B A;  4IB9 A;  1SWU A;  3APV A;  3FDC A;  4GGR A;  3RE5 A;  2OFB A;  3KFH A;  3LV4 A;  1QQS A;  4A1Y A;  2OFR X;  1STR B;  1U18 A;  2RTI B;  2W2B A;  4ODD A;  1VWJ B;  1ZNH A;  1NC9 A;  3AEH A;  1IIU A;  4IB6 A;  2RD7 C;  2IZB A;  3B2K A;  3BS2 A;  4GDA A;  4ORU A;  4YBP A;  2X8T A;  1FJ1 E;  1N9Y A;  4TQ2 A;  2EU7 X;  1FEM A;  2OFA A;  2RTQ B;  1SA8 A;  1SWA A;  5F7G A;  4KC7 A;  3FYF A;  4L1N A;  4Y5D A;  1S7D A;  3UEU A;  2C4I A;  2RTO B;  1UYO X;  4HPB A;  1KL3 A;  2X4M A;  4O4S A;  3FLL A;  1G85 A;  3U9P C;  3TGB A;  1LIF A;  3AKN A;  1VWC B;  4YFP A;  1GX9 A;  4ARH A;  2RCT A;  1SMP I;  2WQA E;  2Y3F A;  1N7Y A;  3P6C A;  2RQ0 A;  4YKO A;  5FQ7 E;  2L68 A;  3WBG A;  2OL6 O;  4COT A;  3WJC A;  4FBO A;  4JO6 A;  5LJG A;  4GJS A;  4L3R A;  2OF9 A;  1E06 A;  1SRI A;  4QYN A;  3C77 X;  2AL0 X;  1I06 A;  2HNX A;  2IZJ A;  5LJD A;  3GE2 A;  4DNE A;  1W6F A;  3RDX A;  1SLG B;  1R0U A;  2A13 A;  1SY2 A;  3B2H A;  4NNT A;  4QYP A;  3F9D A;  1LKE A;  4YGG A;  1VYF A;  4XME A;  5B11 O;  3KFG A;  1VWF B;  4Y0S A;  1QY2 A;  5EED A;  5KIC A;  3C76 X;  2F01 A;  2HZQ A;  3KQ0 A;  3Q6L A;  1DC9 A;  2AF5 A;  3NAD A;  1KGL A;  2R73 A;  3FA8 A;  3NBX X;  1LIB A;  1VWA B;  1SLF B;  1EXS A;  2IZC B;  3PP6 A;  4ZHD A;  4YVB A;  1GX8 A;  1LPJ A;  1OEE A;  2CBS A;  2Y32 A;  1LCZ A;  3VE2 A;  3WYP A;  2OF8 A;  1Z24 A;  1HN2 A;  1O1V A;  1SXY A;  2A5B A;  2CBR A;  3IFB A;  4Z2V A;  4ZFX A;  3U03 A;  3LTW A;  4CPH A;  2CM9 A;  2LA7 A;  3RZY A;  4CV7 A;  3VHM A;  3WVM A;  1Y9L A;  2FGS A;  1OSP O;  1EPB A;  4U3Q A;  5FEN A;  3MBT A;  3DTQ A;  1KOI A;  1IKE A;  2OY8 A;  1KT7 A;  4ORX A;  3VHI A;  1U0X A;  3D97 A;  2IZG B;  5CE4 A;  3HOL A;  4EDE A;  1YWA A;  2F09 A;  1JMZ A;  3T1D A;  1ZNK A;  3UEV A;  5B29 A;  2FR3 A;  4O9S A;  2FKJ A;  2OVS A;  1PBO A;  3STK A;  3RDM A;  4UU2 A;  5K68 A;  5LKF A;  2RCQ A;  3CMP A;  5IRU A;  3FA7 A;  1RLB E;  1ZND A;  1BM5 A;  3AUM O;  2NP1 A;  1SWT A;  5HTD A;  4I95 A;  2FHL A;  1CRB A;  2GTL O;  4O4U A;  4NLI A;  4BVM A;  3PDF A;  1JZU A;  5HBS A;  1AQB A;  1KQX A;  2FKG A;  1L6M A;  2RTC B;  2AH7 X;  1SY0 A;  5D8J A;  4EKV A;  5HAE A;  1DZK A;  1MM9 A;  1A57 A;  4DCB A;  1ACD A;  3RWX A;  3RY2 A;  3TGA A;  2QO6 A;  1HMT A;  4KCA A;  1HXZ A;  4PJ2 A;  4AW8 A;  1VWH B;  4CDF A;  1AVG I;  2FS6 A;  2OL8 O;  2R56 A;  3HWF A;  2Z4I A;  4ML7 B;  3T6F A;  4ZCB A;  3TF6 A;  1JJU A;  1I4U A;  1SWD A;  3SOT A;  1KT4 A;  2IFB A;  4XMD A;  3WZQ A;  1KQW A;  4IB8 A;  1SY3 A;  4KT5 A;  4QGW A;  4IRW A;  3T2X A;  1GXA A;  1GT5 A;  1SWB A;  1HMR A;  3PPT A;  5IXG A;  4CK4 A;  4NYR A;  3JSQ A;  4ZR2 A;  2WR6 A;  1H91 A;  1RXJ A;  2AMM X;  2KW1 A;  1HBQ A;  3FR5 A;  4IMN A;  1ICM A;  1OPB A;  2JGS A;  2HLV A;  2N93 A;  4EFG A;  1KZX A;  1QFT A;  2IZA A;  2Q39 A;  1KXO A;  4O49 A;  1X8Q A;  4AZN A;  1I05 A;  4YDA A;  5HA0 A;  3NX2 A;  3O22 A;  3BLG A;  4KII A;  4GGZ A;  3SLJ A;  5FQ8 E;  2A5C A;  1OBP A;  4BX5 B;  4I9R A;  1JJJ A;  3VU1 A;  5K67 A;  3FA6 A;  1X8O A;  4RUU A;  4GUZ A;  3VHH A;  3SLT A;  2LKK A;  4GET A;  4NV8 A;  1K3B A;  2M4L A;  1LFO A;  3CKF A;  1GGL A;  3D96 A;  4JNJ A;  2BC3 A;  4ZJ0 A;  2AT0 X;  4ZH9 A;  1DV9 A;  1ALB A;  1QY0 A;  4U46 A;  5F6Z A;  4BBO A;  1SLE B;  5HWZ A;  3TZS A;  4O3Z A;  3FMZ A;  1PBY A;  3WXQ A;  1Y0G A;  2ZAG A;  2X8S A;  3PK2 A;  4GKC A;  2C1S A;  4LQZ A;  3MVF A;  4PSQ A;  4QRL A;  3UEX A;  4AZQ A;  4FBR A;  1S44 A;  2JW1 A;  1AVE A;  2LFO A;  1TW4 A;  2GTL N;  1KFF A;  1WBI A;  3NQ9 A;  3PEC A;  4OEL A;  5LJE A;  5LKE A;  3ZUI A;  2X8F A;  3STN A;  2OFM X;  1LCV A;  2RTG B;  3EMM A;  4Y0R A;  1LNM A;  2BT9 A;  1RXK A;  3BU1 A;  5AEO A;  4Z27 A;  2RTR B;  3PED A;  2GC9 A;  3P6E A;  4FGI B;  3V8U A;  1VWM B;  5KID A;  1ERX A;  1T0V A;  1VWN B;  2RTF B;  2A3F X;  1S2P A;  3BRN A;  3T2W A;  4OS0 A;  1SY1 A;  3P24 A;  2W2F A;  1N4J A;  5BVS A;  5LJC A;  1PM1 X;  4TKJ A;  2NNE A;  1FEN A;  1HQP A;  5EPQ A;  3ZW0 B;  2RTL A;  3F8A A;  2CM4 A;  3EYC A;  2L67 A;  4ORS A;  1SWK A;  4K19 A;  1ERB A;  2QO4 A;  1CBQ A;  5EEE A;  1BJ7 A;  2FWV A;  4HPD A;  2YMS A;  4I6S A;  2FS7 A;  5EDC A;  5CHK A;  1LIC A;  2WWP A;  2AT3 X;  2RN4 A;  2JU3 A;  3B2I A;  1MX8 A;  1TOU A;  2POA A;  3VG5 A;  1QY1 A;  4NLJ A;  4ZHG A;  1TXL A;  5H9L A;  3ZW0 A;  1B8E A;  2RTK A;  5IRA A;  3HWG A;  2IZE B;  2X32 A;  1X8P A;  4N7D A;  5DPQ A;  2DJG A;  1VYO A;  1P6P A;  4Z2P A;  3I0A A;  1N0S A;  1X8N A;  2AT5 X;  2RA6 A;  4TLJ A;  3PH5 A;  1VWP B;  3BU9 A;  4JHQ A;  3SAO A;  1E5P A;  2IZL B;  4GK9 A;  4U8U N;  4YCH A;  1VWE B;  5B27 A;  1NDJ A;  1OBU A;  1BRQ A;  4MVL A;  2UZ2 A;  5HZ6 A;  2NND A;  2OVA A;  1Y52 X;  1SXW A;  1NBX A;  4ALB A;  1D2U A;  1VWO B;  2OY1 O;  3C78 X;  4EEJ A;  2GH7 A;  1RAV A;  4AZP A;  1BRP A;  1EII A;  3APW A;  1T8V A;  1OBQ A;  3D95 A;  3MM0 A;  1DF8 A;  2ALL X;  2IZK A;  2L5P A;  4LZU A;  1JV4 A;  5D47 A;  3RKG A;  1LDQ A;  5C0N A;  1A18 A;  4BX5 A;  4M7M A;  1LIE A;  5F58 A;  3WOV A;  1LID A;  4GGT A;  1HBP A;  3RSW A;  1URE A;  1JIW I;  3P6H A;  5FQ6 E;  1JJX A;  1DZP A;  1GM6 A;  2X45 A;  3SZH A;  1SRG A;  4QNI A;  1YIV A;  3EM0 A;  1IFC A;  2CZU A;  2Z4H A;  2OYB O;  2ACO A;  3OBL A;  3OD9 A;  3ZUO A;  4O3Y A;  2MM3 A;  3X00 A;  4QZU A;  2X46 A;  4ZHC A;  1Y53 X;  1VWQ B;  2Y3E A;  4GRJ A;  4EXZ A;  5BVT A;  3S5X A;  2QOS C;  1SRE A;  2OZQ A;  3CBS A;  4KH8 A;  4TKH A;  4D6A A;  3CWK A;  3RY1 A;  3UAQ A;  1DFV A;  3RBY A;  2X55 A;  2L9C A;  4GDZ A;  5HZQ A;  5F1E A;  1FE3 A;  1UZ2 X;  2NNQ A;  3WJE A;  1KT3 A;  2UYW A;  4Z6J A;  2C1Q A;  1VWI B;  2BLG A;  1NQM A;  4ORR A;  2FT9 A;  2PI3 O;  2IZD B;  4OS3 A;  1WUB A;  4KC8 A;  2MF6 A;  4R0B A;  3WZN A;  1YUP A;  4A8Z A;  1AB0 A;  3FW5 A;  4TKB A;  4WFV A;  4ES7 A;  3MG5 A;  4LKT A;  3FA9 A;  3ZW1 B;  5IRW A;  1O8V A;  4GNY A;  3GAQ A;  3CBC A;  4ZH6 A;  3BSZ E;  4XMH A;  2A0A A;  1E02 A;  2GTL M;  1BSO A;  1JYD A;  2RTE B;  2VFB A;  3JQO A;  1IKJ A;  1RBP A;  4IBA A;  4UU3 A;  4Y0Q A;  5DG4 A;  3WJB A;  3H3I A;  4MEE A;  2WEX A;  1LF7 A;  2W2A A;  4BX7 B;  1LEL A;  2P8G A;  1SWF A;  4EQA C;  4MIS A;  5IO6 A;  1MUP A;  2LB6 A;  3Q34 A;  3DSZ A;  2ZAI A;  4GE1 A;  3WZP A;  1B56 A;  3O19 A;  5FAZ A;  2LBV A;  3WZO A;  3ZW1 A;  1KZW A;  3SZI A;  3RDQ A;  1IFB A;  3QKG A;  4HPA A;  4BGF A;  1AVD A;  1W5R A;  2A8G A;  2AVI A;  2MJI A;  4BJ8 A;  4OS8 A;  5HCD C;  1VYG A;  3HOE A;  3LHN A;  2YG2 A;  3ZI8 A;  3EC5 A;  4GNW A;  1YWD A;  1ZRY A;  5CSE A;  5HTE A;  2XKL A;  4BX7 A;  5BYP A;  3NP1 A;  3NPO A;  1I04 A;  1N9M A;  4ID2 A;  5L8I A;  4U8U O;  1BWY A;  1JYJ A;  4OEM A;  1D3S A;  1I78 A;  1CBS A;  1JBH A;  1CBI A;  1E00 A;  4GU8 A;  3HK1 A;  4TNN A;  2RTB B;  4YCE A;  1RXH A;  1PEE A;  2QO5 A;  2JMB A;  4MIR A;  1GT4 A;  1EAL A;  1YWB A;  1KL4 A;  2GJ5 A;  5FFH A;  4ALO A;  1SWG A;  5F6B A;  1QG5 A;  3JS1 A;  3PQU A;  1I9H A;  4I9S A;  2G5L A;  1OPA A;  4NW4 A;  1SWJ A;  2Q2P A;  3SZJ A;  5EZ2 A;  1X8U A;  5AQ6 A;  1GT1 A;  4YFR A;  2ACP X;  3AKM A;  4QAE A;  4WFU A;  5HZ9 A;  1OEJ A;  1QWD A;  4U8U M;  2RTA A;  3CKG A;  1X71 A;  2QMI A;  4Z28 A;  2CAM A;  1NP4 A;  4XMF A;  1QAB E;  4ZGU A;  1X89 A;  4FQB B;  1BSY A;  1SWR A;  4IAW A;  4N7C A;  3PQS A;  5AJC A;  4D6B A;  2WUT A;  1GX3 A;  3HPE A;  4QGX A;  1TOW A;  1MDC A;  2HYS A;  2OY7 A;  1PTS A;  3TGC A;  3STM X;  1SWH A;  1U17 A;  1QFV A;  2G78 A;  5CYB A;  1VWK B;  2RTM A;  5HA1 A;  4IAB A;  5L8O A;  4OMX A;  2JU8 A;  1NGL A;  1ZNG A;  2A2U A;  5H9K A;  2Q9S A;  3FEP A;  2G7B A;  3UEW A;  4DQ3 A;  3U0D A;  1IW2 A;  2E4J A;  2FR2 A;  1YWC A;  4BQU A;  1KT6 A;  4BX6 B;  2RTH B;  3KVN A;  3N91 A;  5HZ8 A;  4CPH B;  4CDC A;  3FEK A;  4GJV A;  3RDS A;  1G7N A;  1SLD B;  1SRJ A;  2WQ9 A;  1IJ8 A;  2JU7 A;  3F6Z B;  1BLR A;  2RTN B;  2FTB A;  1NP1 A;  1CBR A;  3FR4 A;  3NQK A;  1KL5 A;  2CZT A;  3I17 A;  3FW4 A;  4LKP A;  3VE1 A;  4CPI A;  3KFI A;  5D45 A;  2HZR A;  1VWG B;  3SLO A;  4AZM A;  3BX7 A;  5JR8 A;  4LZV A;  2A2G A;  1EQD A;  3FIQ A;  5IO5 A;  1DZJ A;  4AZO A;  4BX6 A;  5B3M O;  5K06 A;  2K62 A;  1E2T A;  4Y0P A;  5LJK A;  5H8T A;  2ZSC A;  4O4O A;  4Y59 A;  5KHP A;  2KTD A;  3B2J A;  2DM5 A;  1O1U A;  3VG6 A;  2Q4N A;  1SWC A;  2QCB A;  1LCW A;  2FHN X;  4YDB A;  1STS B;  2BS6 A;  4BCS A;  2ANS A;  1MEP A;  2FRS A;  4U9C A;  3CQR A;  1EPA A;  2Q2M A;  4YH0 A;  4IAX A;  3VPJ E;  4HFO A;  1RST B;  2OY5 O;  4CPE A;  3S5V A;  3ZQ3 A;  2BSZ A;  4YGH A;  4A60 A;  5L3Y A;  1MOY A;  3FID A;  1Y55 X;  1DF3 A;  3P6D A;  1K24 A;  1SWL A;  1HMS A;  1SWQ A;  3ELX A;  2AT8 X;  3ZZV A;  5IO7 A;  4NYQ A;  2VDF A;  1B4M A;  2DJF A;  1EUO A;  3EBW A;  3HWD A;  3S60 A;  4WHI A;  5H9N A;  4ZHH A;  2IZI A;  2OL7 A;  4I60 A;  1T68 X;  1SWN A;  3QQ2 A;  4WBK A;  1G5W A;  4GD9 A;  1TVQ A;  5L8N A;  5D4A A;  3NQ3 A;  5D48 A;  2JOZ A;  2OVE A;  3EW2 A;  1A2D A;  3ZWE A;  1MVG A;  2VFC A;  3B2L A;  1EW3 A;  5EDB A;  1ML7 A;  3G7X A;  4YGZ A;  2QM9 A;  1Y9T A;  1VWB B;  2I5V O;  2KD2 A;  3ELZ A;  1EIO A;  3BDR A;  4IB7 A;  4RUN A;  4FBV A;  1VPR A;  2AT6 X;  2GTF X;  2WPU A;  1FEL A;  2X34 A;  3FEL A;  1SWE A;  4ON1 A;  4BOE A;  3D4R A;  4CPF A;  3EBK A;  1LDO A;  4NV7 A;  1YP6 A;  2I5Z O;  3APU A;  1GKA B;  1DZM A;  1SWO A;  1B0O A;  1ZNE A;  3BY0 A;  3HWE A;  3NX1 A;  3OJY C;  1ADL A;  2LBA A;  2OVD A;  1SXU A;  1N43 A;  4XMG A;  1XKI A;  1A3Y A;  1ICN A;  5B2A O;  4ORY A;  4QQ1 A;  2BS5 A;  2PY1 A;  1NQN A;  3WJF A;  3RDO A;  2KTS A;  4B55 A;  1HQQ A;  3P02 A;  4CSB A;  2RTD B;  2XST A;  1SRH A;  2QOM A;  2RTJ A;  1JQP A;  3NR3 A;  3ZW2 A;  2FLJ A;  3KZA A;  1GKA A;  1STP A;  1HY2 A;  2R74 A;  1SRF A;  2WSJ A;  4INN A;  1VWR B;  3WJG A;  2JN3 A;  3VG3 A;  4AZR A;  3CQN A;  4CDD A;  4MVE A;  4Z2O A;  5H9A A;  3WJD A;  3VG4 A;  4MVK A;  3FEN A;  2G8C O;  3MX7 A;  4YMY A;  4C5P A;  4O3X B;  5LJH A;  1AEL A;  1OEK A;  4I3C A;  1YP7 A;  1XCA A;  1VWD B;  4I3B A;  4O3W A;  4YFQ A;  5B5F A;  5HZ5 A;  3OE3 A;  1GT3 A;  4QZT A;  3IA8 A;  3APX A;  4NP1 A;  4DQ4 A;  3FR2 A;  4CDE A;  4ZHF A;  4HWM A;  1LUQ A;  1VWL B;  3BX8 A; 
#chains in the Genus database with same CATH homology
 1ZNL A;  1BBP A;  1G74 A;  3KFF A;  5AJB A;  3S26 A;  4OMW A;  4O4X A;  2KT4 B;  1FTP A;  4QGV A;  1KT5 A;  1CJ5 A;  4XMC A;  4YKM A;  3PH6 A;  3VG7 A;  3E3C A;  3L4R A;  1BEB A;  4A1H A;  4AYH A;  2ASN X;  2HMB A;  4I3D A;  5HCE C;  2K23 A;  2G79 A;  3O2Y A;  5BVQ A;  3VG2 A;  4ORW A;  5FEN A;  2O62 A;  3P6G A;  4HPC A;  2F73 A;  4MVI A;  4GZV A;  4GH7 A;  4ZGF A;  4M6S A;  3K3L A;  2AKQ A;  3P6F A;  1FDQ A;  4JGL A;  1BSQ A;  3HTY A;  4IMO A;  4YBU A;  1PMP A;  4TJZ A;  5LJB A;  3CR6 A;  2MHD A;  2MO5 A;  5HCC C;  1SXX A;  4NNS A;  1EI5 A;  2BHV A;  2WEW A;  1MX7 A;  4IB9 A;  3APV A;  3KFH A;  3LV4 A;  1QQS A;  4A1Y A;  2OFR X;  1U18 A;  2W2B A;  4ODD A;  1ZNH A;  4ORU A;  1IIU A;  4IB6 A;  2RD7 C;  3B2K A;  3BS2 A;  4YBP A;  2X8T A;  4TQ2 A;  2EU7 X;  1FEM A;  1SA8 A;  5F7G A;  4KC7 A;  3FYF A;  4L1N A;  3UEU A;  1S7D A;  4HPB A;  4O4S A;  3FLL A;  1G85 A;  3U9P C;  3TGB A;  1LIF A;  3AKN A;  4YFP A;  1GX9 A;  4ARH A;  2RCT A;  1SMP I;  2WQA E;  3P6C A;  4YKO A;  2RQ0 A;  5FQ7 E;  3WBG A;  2L68 A;  4COT A;  3WJC A;  4FBO A;  5LJG A;  4L3R A;  1E06 A;  4QYN A;  3C77 X;  2AL0 X;  1I06 A;  2HNX A;  5LJD A;  3GE2 A;  3B2H A;  1R0U A;  2A13 A;  1SY2 A;  4NNT A;  4QYP A;  3F9D A;  1LKE A;  4YGG A;  1VYF A;  4XME A;  3KFG A;  5EED A;  4Y0S A;  1QY2 A;  5KIC A;  3C76 X;  2HZQ A;  3KQ0 A;  3Q6L A;  1DC9 A;  3NAD A;  1KGL A;  2R73 A;  3FA8 A;  3NBX X;  1LIB A;  3PP6 A;  1EXS A;  4ZHD A;  1GX8 A;  1LPJ A;  1OEE A;  2CBS A;  3VE2 A;  3IFB A;  1Z24 A;  1HN2 A;  1O1V A;  1SXY A;  2CBR A;  4ZFX A;  3U03 A;  2CM9 A;  2LA7 A;  3RZY A;  4CV7 A;  3WVM A;  1Y9L A;  1EPB A;  4U3Q A;  3MBT A;  3DTQ A;  1KOI A;  1IKE A;  1KT7 A;  4ORX A;  1U0X A;  3D97 A;  5CE4 A;  3HOL A;  4EDE A;  1YWA A;  2F09 A;  3T1D A;  3UEV A;  1ZNK A;  5B29 A;  2FR3 A;  4O9S A;  2OVS A;  1PBO A;  3STK A;  4UU2 A;  5LKF A;  2RCQ A;  3CMP A;  3FA7 A;  1RLB E;  1ZND A;  1BM5 A;  2NP1 A;  5HTD A;  4I95 A;  4O4U A;  1CRB A;  2GTL O;  4NLI A;  4BVM A;  1JZU A;  5HBS A;  1AQB A;  1KQX A;  1L6M A;  2AH7 X;  1SY0 A;  5D8J A;  5HAE A;  1DZK A;  1A57 A;  1ACD A;  3RWX A;  3TGA A;  2QO6 A;  1HMT A;  4KCA A;  4PJ2 A;  4AW8 A;  1AVG I;  2FS6 A;  3HWF A;  2R56 A;  4ML7 B;  2Z4I A;  4ZCB A;  3TF6 A;  1I4U A;  3SOT A;  1KT4 A;  2IFB A;  4XMD A;  1KQW A;  4IB8 A;  1SY3 A;  4KT5 A;  4QGW A;  1GXA A;  1GT5 A;  1HMR A;  3PPT A;  4CK4 A;  4NYR A;  3JSQ A;  4ZR2 A;  2WR6 A;  1H91 A;  2AMM X;  2KW1 A;  4IMN A;  1HBQ A;  3FR5 A;  1ICM A;  1OPB A;  2HLV A;  2N93 A;  4EFG A;  1KZX A;  1QFT A;  2Q39 A;  1KXO A;  4O49 A;  1X8Q A;  4AZN A;  1I05 A;  4YDA A;  5HA0 A;  3NX2 A;  3O22 A;  3BLG A;  4KII A;  5FQ8 E;  1JJJ A;  1OBP A;  4I9R A;  3VU1 A;  3FA6 A;  1X8O A;  4RUU A;  2LKK A;  4GET A;  2M4L A;  1LFO A;  3D96 A;  1GGL A;  4ZJ0 A;  1DV9 A;  2AT0 X;  4ZH9 A;  1ALB A;  1QY0 A;  5F6Z A;  5HWZ A;  3TZS A;  4O3Z A;  3FMZ A;  3WXQ A;  2ZAG A;  4LQZ A;  2X8S A;  4GKC A;  4PSQ A;  3UEX A;  4QRL A;  3MVF A;  4FBR A;  4AZQ A;  1S44 A;  2JW1 A;  3PEC A;  2LFO A;  1TW4 A;  2GTL N;  3NQ9 A;  5LJE A;  5LKE A;  3ZUI A;  2X8F A;  3STN A;  2OFM X;  3EMM A;  4Y0R A;  1LNM A;  2BT9 A;  3BU1 A;  5AEO A;  3PED A;  2GC9 A;  3P6E A;  4FGI B;  3V8U A;  5KID A;  1ERX A;  1T0V A;  3BRN A;  2A3F X;  1S2P A;  4OS0 A;  1SY1 A;  3P24 A;  2W2F A;  5BVS A;  5LJC A;  1PM1 X;  4TKJ A;  2NNE A;  1FEN A;  1HQP A;  5EPQ A;  3ZW0 B;  3F8A A;  2CM4 A;  3EYC A;  2L67 A;  4ORS A;  4K19 A;  1ERB A;  2QO4 A;  1CBQ A;  5EEE A;  1BJ7 A;  2FWV A;  4HPD A;  2YMS A;  4I6S A;  2FS7 A;  5EDC A;  1LIC A;  2WWP A;  2AT3 X;  2RN4 A;  2JU3 A;  3B2I A;  1MX8 A;  1TOU A;  2POA A;  3VG5 A;  1QY1 A;  4NLJ A;  4ZHG A;  1TXL A;  5H9L A;  3ZW0 A;  1B8E A;  3HWG A;  1X8P A;  4N7D A;  5DPQ A;  1P6P A;  3I0A A;  1N0S A;  1X8N A;  2AT5 X;  2RA6 A;  4TLJ A;  3PH5 A;  3BU9 A;  3SAO A;  1E5P A;  4GK9 A;  4U8U N;  5B27 A;  4YCH A;  1OBU A;  1BRQ A;  4MVL A;  5HZ6 A;  2NND A;  2OVA A;  1SXW A;  4ALB A;  1D2U A;  3C78 X;  4EEJ A;  4AZP A;  1BRP A;  1EII A;  3APW A;  1T8V A;  1OBQ A;  3D95 A;  2ALL X;  2L5P A;  4LZU A;  5D47 A;  5C0N A;  1JV4 A;  3RKG A;  1A18 A;  4M7M A;  1LIE A;  5F58 A;  3WOV A;  1LID A;  3RSW A;  1HBP A;  1URE A;  1JIW I;  3P6H A;  5FQ6 E;  1JJX A;  1DZP A;  1GM6 A;  2X45 A;  4QNI A;  1YIV A;  3EM0 A;  1IFC A;  2CZU A;  2Z4H A;  2ACO A;  3OBL A;  3OD9 A;  3ZUO A;  4O3Y A;  2MM3 A;  4QZU A;  2X46 A;  4ZHC A;  4EXZ A;  4GRJ A;  5BVT A;  3S5X A;  2QOS C;  2OZQ A;  3CBS A;  4KH8 A;  4TKH A;  4D6A A;  3CWK A;  3UAQ A;  1DFV A;  3RBY A;  2L9C A;  4GDZ A;  5HZQ A;  5F1E A;  1FE3 A;  1UZ2 X;  2NNQ A;  3WJE A;  1KT3 A;  2BLG A;  4ORR A;  2FT9 A;  4R0B A;  4OS3 A;  4A8Z A;  4KC8 A;  1YUP A;  1AB0 A;  3FW5 A;  4TKB A;  4WFV A;  4ES7 A;  4LKT A;  3FA9 A;  3ZW1 B;  1O8V A;  4GNY A;  3GAQ A;  3CBC A;  4ZH6 A;  3BSZ E;  2A0A A;  1E02 A;  2GTL M;  1BSO A;  1JYD A;  3JQO A;  4Y0Q A;  5DG4 A;  1IKJ A;  1RBP A;  4IBA A;  4UU3 A;  3WJB A;  3H3I A;  2WEX A;  1LF7 A;  2W2A A;  2P8G A;  4EQA C;  4MIS A;  5IO6 A;  1MUP A;  2LB6 A;  3DSZ A;  2ZAI A;  4GE1 A;  1B56 A;  3O19 A;  5FAZ A;  2LBV A;  3ZW1 A;  1KZW A;  1IFB A;  3QKG A;  4HPA A;  2MJI A;  4OS8 A;  5HCD C;  1VYG A;  3HOE A;  3LHN A;  2YG2 A;  3ZI8 A;  4GNW A;  1YWD A;  1ZRY A;  5HTE A;  2XKL A;  5BYP A;  3NP1 A;  3NPO A;  1I04 A;  4ID2 A;  5L8I A;  1BWY A;  4U8U O;  1JYJ A;  1D3S A;  1CBS A;  1JBH A;  1CBI A;  1E00 A;  4GU8 A;  3HK1 A;  4TNN A;  4YCE A;  1PEE A;  2QO5 A;  2JMB A;  4MIR A;  1GT4 A;  1EAL A;  1YWB A;  4ALO A;  2GJ5 A;  5FFH A;  5F6B A;  1QG5 A;  3JS1 A;  3PQU A;  4I9S A;  4NW4 A;  1OPA A;  2Q2P A;  5EZ2 A;  1X8U A;  5AQ6 A;  1GT1 A;  4YFR A;  2ACP X;  3AKM A;  4QAE A;  4WFU A;  5HZ9 A;  1OEJ A;  1QWD A;  4U8U M;  1X71 A;  2QMI A;  1NP4 A;  4XMF A;  1QAB E;  4ZGU A;  1X89 A;  4FQB B;  1BSY A;  4D6B A;  4IAW A;  4N7C A;  3PQS A;  5AJC A;  2WUT A;  4QGX A;  1TOW A;  1MDC A;  2HYS A;  3TGC A;  3STM X;  1U17 A;  1QFV A;  2G78 A;  5CYB A;  5HA1 A;  4IAB A;  5L8O A;  4OMX A;  2JU8 A;  1NGL A;  1ZNG A;  2A2U A;  5H9K A;  2Q9S A;  3FEP A;  2G7B A;  3UEW A;  4DQ3 A;  3U0D A;  1IW2 A;  2E4J A;  2FR2 A;  1YWC A;  4BQU A;  1KT6 A;  3N91 A;  5HZ8 A;  3FEK A;  1G7N A;  2WQ9 A;  3F6Z B;  2JU7 A;  1BLR A;  2FTB A;  1NP1 A;  1CBR A;  3FR4 A;  3NQK A;  2CZT A;  3I17 A;  3FW4 A;  4LKP A;  3VE1 A;  3KFI A;  5D45 A;  2HZR A;  5JR8 A;  4AZM A;  3BX7 A;  4LZV A;  2A2G A;  1EQD A;  3FIQ A;  5IO5 A;  1DZJ A;  4AZO A;  5K06 A;  5LJK A;  2K62 A;  4Y0P A;  5H8T A;  4O4O A;  5KHP A;  2KTD A;  3B2J A;  2DM5 A;  1O1U A;  3VG6 A;  2Q4N A;  4YDB A;  2BS6 A;  2ANS A;  2FRS A;  4U9C A;  3CQR A;  1EPA A;  2Q2M A;  4YH0 A;  4IAX A;  3VPJ E;  4HFO A;  3S5V A;  3ZQ3 A;  4A60 A;  4YGH A;  1DF3 A;  3P6D A;  5IO7 A;  1HMS A;  3ELX A;  1B4M A;  2AT8 X;  3ZZV A;  4NYQ A;  3EBW A;  1EUO A;  3HWD A;  3S60 A;  4ZHH A;  4WHI A;  5H9N A;  1T68 X;  1G5W A;  4WBK A;  5L8N A;  1TVQ A;  5D4A A;  3NQ3 A;  5D48 A;  2JOZ A;  2OVE A;  3ZWE A;  1A2D A;  1MVG A;  3B2L A;  1EW3 A;  5EDB A;  1ML7 A;  3G7X A;  4YGZ A;  2QM9 A;  1Y9T A;  2KD2 A;  3ELZ A;  1EIO A;  3BDR A;  4IB7 A;  4RUN A;  4FBV A;  1VPR A;  2AT6 X;  2GTF X;  1FEL A;  3FEL A;  4ON1 A;  4BOE A;  3D4R A;  3EBK A;  1YP6 A;  3APU A;  3NX1 A;  1GKA B;  1DZM A;  1ZNE A;  1B0O A;  3BY0 A;  3HWE A;  3OJY C;  4XMH A;  2OVD A;  1ADL A;  2LBA A;  1SXU A;  4XMG A;  1XKI A;  1A3Y A;  1ICN A;  4ORY A;  4QQ1 A;  2BS5 A;  2PY1 A;  3WJF A;  4CSB A;  2KTS A;  3P02 A;  2XST A;  3NR3 A;  3ZW2 A;  2FLJ A;  3KZA A;  1GKA A;  2R74 A;  2WSJ A;  4INN A;  3WJG A;  4AZR A;  2JN3 A;  3VG3 A;  3CQN A;  4MVE A;  5H9A A;  3WJD A;  3VG4 A;  4MVK A;  3FEN A;  3MX7 A;  4YMY A;  5LJH A;  1AEL A;  4O3X B;  1OEK A;  4I3C A;  1YP7 A;  1XCA A;  4I3B A;  4O3W A;  4YFQ A;  5HZ5 A;  3OE3 A;  1GT3 A;  4QZT A;  3IA8 A;  3APX A;  4NP1 A;  4DQ4 A;  3FR2 A;  4ZHF A;  4HWM A;  2MWH A;  3BX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...