1RLFA

Structure determination of the ras-binding domain of the ral-specific guanine nucleotide exchange factor rlf, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
GSSDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEFELVQLLPGDRELTIPHSANVFYAMDGASHDFLLRQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RLF
publication title Structure determination of the Ras-binding domain of the Ral-specific guanine nucleotide exchange factor Rlf.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction protein
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1rlfA00
3L0WB 4AJYB 2NBVB 3H7PB 4KIKA 4BBNF 1WE7A 4ANUA 4ZDVA 3MTNB 1XQQA 2JZZA 2NPTB 3LDZE 2K6QA 2KN5A 4CO7A 3BY4B 2RR9A 1V9JA 1V6EA 1BT0A 1WJ4A 2L0FA 2C5LC 2KK8A 2PE6B 3PREA 2K39A 2REXA 1Y8RC 5CTRC 1V86A 2K6DB 3N3KB 2G4DB 3ZIMA 2GBMA 2JY6A 2JUOA 2JZ3B 2L0TA 2MWSB 3CMMB 3DBRI 2BYVE 5G55A 4ZRJA 2M0XA 2ZVOA 2ZCCA 3JSVA 3QCAA 2FIFA 3VFKA 3P2BA 4JLCA 4ZYNA 4WWPA 3TMPB 5FR6A 2EKEC 2C60A 2KJ6A 2V4LA 3ZVVA 4BFRA 3V6EB 4IWOA 1WGHA 1WH3A 5HKHA 2M4NA 4B9KA 1YQBA 2ZPYA 2G45B 3QARA 2D3GA 4M8MA 4PS3A 3RUIB 3WAPA 3HK0A 2ZCBA 1SIFA 2Z59B 3CSTA 3TIXA 3DVGY 2HD5B 2KNBA 1YX6B 3SU8X 2HE7A 2MBBB 5JHBA 2LGDA 3L16A 4HXDA 2EMTA 2QHOA 4YL8A 4KIKB 4W9DA 4BVUC 2Y5BB 2FCSA 3MHSD 4PS7A 5BO4B 3VAWA 4AP4C 1Q0WB 2D07B 1IPGA 2PE9A 4JGHB 4ZRKA 1TTNA 2L00B 4HJKA 4P7IA 2KX0A 4I6LB 3DBSA 3NY5A 4II2B 4WWNA 4DXAB 3WA0A 3HHMA 5LXHA 2WX0A 3VUXA 4GIVA 5J18A 2UYZB 2I1JA 5KHQA 2L8JA 4NPNA 5J17A 2DAFA 2NBUA 2FCNA 3NZSA 2BGFA 2MW5A 3K9OB 5CHFA 3RCZA 4URKA 3PS6A 4GSWA 4HWIB 2DYOA 4EUTA 3A33B 1WZ0A 4MGZE 3DCGA 2PPHA 3JVZX 4NJ6A 2KDEB 1XD3B 3ZDMC 2DX5B 2FCMA 2N1WA 3L17A 2VRRB 2LUEA 2DHZA 1UH6A 1E7VA 1EO6A 2WYQA 1YIWA 3CSFA 2CKHB 2LWPA 2KLCA 2N9XA 1M94A 3OJ4B 4A3OA 1L7YA 2AYOB 3U7DA 2NBWB 2MLBA 1MG8A 2J0KA 5JH5C 1E5WA 3QC8B 3WIMA 3VUYA 3AI5A 2MQJA 4KDIC 4GN1A 3KH0A 2D10A 2KQSA 3ZNGC 4GDLB 4K7SA 1RLFA 3L10B 3OAWA 4DK5A 2MCNB 3ZRFA 1RFAA 2MBOA 2N7EA 2OOBB 1YX5B 1G6JA 2JVCA 5L95C 3X23A 2RD0A 3RT3B 3PRZA 2K8CA 4MH0E 2YVCA 4ZRIA 2KVRA 1K8RB 1QZEA 1UGMA 2V3SA 1P1AA 2CHWA 1E8ZA 2MBQA 3L08A 3O65B 3A9KA 2J0MA 4EKUA 3AU4A 1LXDA 2KWVB 1Q5WB 4HPMB 3VH4B 2GMIC 2K1FA 1V49A 3U30A 2YLMA 1JRUA 4N9F4 3ZW3A 2G4SA 3UQAA 3A4SC 4TQ0A 4HCNB 1A5RA 5CX3A 3ZO5B 3NS8A 3PT2B 1D3ZA 2HTHA 4HPLB 2GBKA 3PV1A 4GMVA 2KDFB 4W9EA 3HM3A 4FULA 3ZNZB 1KOTA 2RGFA 4BOSC 2FNJB 1WGYA 2K25A 3KUDB 1WJUA 4KZ0A 2FAZA 5C23A 4XZ4A 5DPTA 2ZNVB 1KM7A 1E7UA 5G2NA 4WAAA 2JWZA 4W9JA 4FHKA 2KWCA 3M62B 3PRMB 5D2MB 4EZJA 3IVFA 3TL5A 2IY1B 4W9HA 1EF1A 4LDTB 3NOBA 1L2NA 4WJOA 3UF8A 3JW0X 1WJNA 5CHWA 2CHXA 3T8MA 4GB9A 1WFYA 3DVGX 2JXXA 4AUQC 1J8CA 1UBQA 4XX5A 3ECIA 4BKSA 2DENB 1V81A 3R3MA 4MELA 2JRHA 3V62A 4E3CA 5E6NA 2KJRA 3LJ3A 2DYBA 2XK5A 4FJVB 2RSUA 2ZZPB 4KDLB 1EF5A 4ICVA 3A9KB 2Z0EB 3Q3FA 3RD2A 1LFDA 2L7RA 1F9JA 3HM6X 4BKSD 1ISNA 4RM8A 2UWQA 2NVUI 1P0RA 3OJ3A 3VQIA 1P3QU 2KDBA 4I6NB 4HDOA 1NI2A 1OEYA 3SDLC 2KOXA 2BWFA 5AZFA 2FUHB 2DZKA 1TGZB 4K7WA 2C7NB 1ZKHA 2IO0B 5DPWA 4TKNA 4OVVA 4DHJD 3H1UA 4JIOU 4NQLB 3VHTC 1WM3A 5E6PA 1V2YA 3GZNI 3B08A 2LRUA 1UD7A 2C9WB 2OJRA 3UGBB 2PEAA 2DAJA 4GDLA 3QK0A 3NHEB 3KUCB 3W1SA 2BYEA 1T0YA 4MGYE 3PTFC 1UZXB 1UELA 1SE9A 3RZFA 3JYUA 2KTFA 3K9PB 4X57B 5TR5A 1GJZA 2LASA 4GU2A 4MSQB 4F8CB 2AL6A 3I3TB 4AWJA 3HIZA 4GXBA 4MSMB 3S2AA 2XK5B 4A20A 3ZNID 4RMAA 1WR1A 3R7QA 4BKGA 4W9CA 2AL3A 1R4MI 1C3TA 4XC2A 5L83A 1WF9A 3UIOB 3WALA 1E8XA 3PZDA 4JL9A 2DZIA 2KHWB 1FXTB 1RAXA 1OQYA 4I6PA 4LJPB 3QHTA 3DBHI 2LXCA 1P9DU 3PPAA 2KFKA 3EECA 1NDDA 3PLUA 4GOCA 2IO3B 4GGQA 4M0WB 3TCAA 5JHAA 2KJHB 4DDGD 3H7SA 4MGKE 1WX7A 3KYDD 1WYWB 1V5TA 1WZ3A 3V6CB 2AWTA 2KANA 4IM2A 2KXJA 2AEHA 2NR2A 2WDTB 1KLVA 2MRPA 2KQ7A 4AJWA 3VDZA 4TUUA 4G0NB 4FJZA 1TZ1A 1S1QB 2K8BA 2KMCA 5D6JB 3VTVA 4MDKE 4FHJA 3TJPA 4MEMA 2R2OA 3PHWB 4NAWA 4EOYA 4DDID 4BKTA 1WIAA 2JPHA 3PHXB 2XBBC 2XEWA 3RZWC 5LLIA 3A9JA 2LXAA 2LGXA 3IG3A 1H8CA 4IWQA 4B6WA 2R2QA 3GOEA 1I35A 4K81A 3ZNHB 1OGWA 3B0AA 4J6IA 2LD9A 1WGGA 4ANXA 1VD2A 1YD8U 3V60A 4IM3A 3W1YA 3APCA 2KFKB 4II3B 3ZUNA 4LJOB 1WY8A 3DOWA 2ZPNA 2KFJA 2PJHA 3M95A 4WQOB 4DBGA 1WJ6A 1GNUA 2MP2A 1WRDB 4KSKC 3R7RA 2JRIB 4BOZB 3DVNU 4WJQA 5EDSA 4IC7B 4NJ7A 5IAAC 5C1ZA 3W1SC 5D7GA 1PQSA 2ZJDA 2IBIB 3WAOA 4W9LA 2GBRA 2N9PC 5J2RA 4MJSA 1Z2MA 1UBIA 2FCQA 2A5UA 2NCNA 1OTRB 4WWOA 4NAWB 1E90A 3IHPC 2W9NA 4W9GA 5CHVC 1WE6A 4EZKA 3AXCA 2GBJA 3N32A 3A9JB 2BKFA 1HE8A 2JF5A 2M1MA 3Q3JA 2M8SA 3V61A 4MM3A 4GDKA 4CHKA 2Z0DB 4KV2A 2KZRA 3VTUA 4ANVA 2DZJA 2GOWA 3VTWA 1NBFC 3H6NA 2BF8B 1WMHA 5GMVA 1U4AA 2O2VA 3VUWA 3PSEB 2IYDB 4EZLA 3L13A 2L3ZA 3PGEA 1WM2A 2ZNVC 1Z5SB 1WXVA 2D11A 4EFOA 3QAQA 2V1YA 2D2QA 3RULA 2J0JA 2MP2B 4TQ1A 1LQBA 3N30A 3SHQA 4NNJB 2DZMA 2ZEQA 5DPRA 2LJ5A 2J7QB 2MX2A 1AARA 4IW0A 3UQBA 2LVOA 1H4RA 3AULA 3APFA 1ZW7A 2GBNA 3ML9A 2C7MB 3ZKJC 4HDQA 4W9KA 1J19A 4B95A 2KX3A 1WX9A 1WGRA 4IM0A 1P98A 2O6VA 3PRPB 3R66C 4RM9A 2LVQA 1WX8A 3M63B 5AZHA 4HVBA 4W9IA 3ZTDA 4FADA 3UIPB 2FIDA 3ZLZA 3EC8A 4MJSB 3QA8A 1TBEA 2G3QB 3U8ZA 3ZTCA 3ENEA 2JT4B 2IO2B 4PYUA 2O6VD 5IA7A 2KC2A 3DVNV 2N7DA 1WXAA 2B3AA 1KJTA 2N1VA 3SD5A 2BKRB 1CMXB 4TV3A 3ZDTA 3T9LA 5LXIB 1WGDA 4GDKB 5KHOA 2CS4A 4AOFA 4ANWA 4WJPA 1X1MA 4FA6A 2KC1A 2MBHA 2A4ZA 3B1LX 1WXMA 4E71A 2RPQA 3ML8A 1J0GA 1GC6A 1XT9B 1WMHB 2CHZA 3KVFB 1ZGUB 2LVPA 2O2VB 1IP9A 3QJZA 4DHJB 5D94A 3QQ8B 5DCNA 2LI5A 1EUVB 4NY0A 3VH3B 4A3PA 4EEWA 3H9DA 4OVUA 3WAMA 1E8YA 3L54A 1SGHA 3X0WA 1V5OA 2DYMA 5JZEB 3QX1A 3JSVB 3DQVA 3OLMD 4FLHA 2I1KA 1Q1OA 2MBEA 3PVLA 3VVWB 1WR6E 2KTRA 3CF6E 1RRBA 3NZUA 4IWPA 2O6VB 3UINB 1I42A 1WXSA 3A4RA 3ONSA 4WJNA 4HK2A 2WX1A 3ZRCA 3A1QA 4PYZA 2ZVNA 4CYEA 4KSLC 1R4NI 1S3SG 3IBEA 3QIJA 1GUAB 2LGYA 3KW5B 3KYCD 2L76A 3AU5A 2MSED 3DBLI 3MJWA 4JQWC 1LM8B 1V80A 4M8NA 2M17A 4ASWC 4G3XB 1GC7A 4DWFA 3H7PA 3C0RB 4KVGB 4FBJB 4IUMB 2NPTA 2KO3A 1E8WA 1IYFA 2C7HA 2IZVB 4G11A 1OEYJ 2BPSA 2NS5A 4HCPB 1YJ1A 2L05A 2MA9B 2LZ6A 3D32A 3IFWB 2ASQA 4KZCA 4W9FA 2K8HA 2KLGA 5AEKB 4DHZE 2KDIA 3DPDA 2KD0A 3KUZA 3RYTA 1C1YB 3PLVA 4NQKE 2LRWA 4LDTD 2CR5A 2BWES 2WWZA 2BYFA 4FN2A 2EMSA 2N9EB 2KWUB 2HJ8A 2KMAA 1WI0A 1VCBA 2IY0B 4G50A 3TBLD 4LCDE 2KTRB 4E74A 3EFUA 3QWZB 4ICUA 5DPSA 4K1RB 3APDA 4MGIE 2N4FA 4F1SA 3BINA 2CU1A 3DDCB 3ALBA 3A1QB 5AZGA 5E6OA 1GG3A 2IO1B 3M3JA 4HLEA 4BBNC 4IG7B 4DHZB 4FJYA 3EHVA 3WANA 4PS8A 3VXWA 2KKCA 4K7UA 4F7ZA
chains in the Genus database with same CATH superfamily
4AJYB 1T0RC 1VZ6A 3BY4B 3GB1A 3BVGA 1R4NB 2PE6B 5CTRC 2K6DB 2AQ1B 2JY6A 2MWSB 3CMMB 3DBRI 1UWMA 2ZCCA 4GLSC 2FIFA 4MT5A 1AWDA 4WIPA 3TMPB 2C60A 2KJ6A 4RF0A 4A8XC 5HKHA 1PGXA 4YSXB 4PS3A 1JWAD 1SIFA 2DNFA 1ZDVA 2HD5B 4OVZA 5JHBA 1FEHA 4HXDA 4KIKB 4BVUC 3FILA 3EGRA 2BBCA 5BO4B 4AP4C 4ZRQA 2JXTA 2PE9A 1K51A 3BYYB 2L00B 2WXLA 4I6LB 4WWNA 1L0YB 1L6VA 3HHMA 5LXHA 4GIVA 2UYZB 2L8JA 4LNIA 2DAFA 5G5HA 2NBUA 3W5VB 1D5XC 3PS6A 1D5ZC 3LB8C 3A33B 1WZ0A 4MGZE 2PPHA 1C77A 2KDEB 1XD3B 1YN5A 3ZDMC 2FCMA 2N1WA 1E6EB 3WCQA 4C4VA 1YIWA 4A3OA 2KLCA 1M94A 2MLBA 4N59A 5JH5C 4KKIA 3QC8B 1HQRD 2CJNA 3RPFC 1TJEA 2MQJA 4GN1A 4K7SA 1RFAA 2MBOA 3P1MA 2OOBB 5L95C 1SBBB 3MC0B 2M19A 4MH0E 2KVRA 2V3SA 3W5UB 1LXDA 3GZNB 3VH4B 3NVZA 1DOYA 1V49A 5BMHA 4OZAA 3ZW3A 3A4SC 3NS8A 2JWUA 4HPLB 3PV1A 4W9EA 2KDFB 1L4DB 1MJDA 4FULA 2RGFA 2FNJB 4K3BA 2WXIA 2WU2B 4ACFA 4P1BC 3NVYA 3T3OA 4EZJA 5D2MB 4S0RA 4W9HA 5IN7A 3NOBA 1I4PA 2G1EA 2L32A 3AN1A 3V62A 2KJRA 3LJ3A 2XK5A 3MJ5A 3RD2A 3A9KB 1CJEA 2EELA 2QILA 1LFDA 2W3RA 5EE3A 2L7RA 1FCLA 1V1OA 2G9HD 3BYTB 1TGZB 2C7NB 4N6EB 4TKNA 3Q14C 4NQLB 3VHTC 3GZNI 2LRUA 1UD7A 5HI1A 3QK0A 3NHEB 1T0YA 1UZXB 2WS3B 2KTFA 2D3BA 4YT0B 1GJZA 1QOBA 2AL6A 4AWJA 4WQMA 4GXBA 4Q2JA 3E56A 3S2AA 1WR1A 2UU7A 5BYSA 1F77A 1IBXB 2J53A 4A6QA 2INDC 3PZDA 1QT9A 1FFVA 3PPAA 2KFKA 3N1YC 1SXTA 2Y5CA 1NDDA 4GOCA 2KJHB 1TS5A 2PVGC 3H7SA 1WZ3A 1ZOYB 3N1ZC 4IM2A 2AQ3B 2NR2A 1KLVA 2MRPA 4C7YA 4FJZA 3BZDB 3VTVA 3SR6A 4NAWA 3FC4A 2ON8A 4KGTA 2WXPA 4ZHPA 3I5JC 1H8CA 4B6WA 1I35A 4K81A 1OGWA 3B0AA 4DXFA 2WXFA 3W1YA 3APCA 4II3B 2E3TA 1WY8A 2KT7A 1WJ6A 1TS4A 2JRIB 2YEPB 5EDSA 4NJ7A 3TEWA 2N9PC 1F1HA 4FXCA 1CZPA 1Z2MA 1UBIA 2NCNA 4ITKA 3RNCC 3IHPC 4W9GA 3RMKC 1UGJA 3AXCA 5IKCM 3A9JB 2BKFA 2M8SA 2K22A 2KZRA 3VTUA 1SE2A 3R2IA 3VTWA 3Q3MC 5GMVA 3DWMA 1RYJA 1C4CA 3P4PB 3UI3A 2EKIA 1WM2A 4EFOA 2D2QA 4TQ1A 2MP2B 3N30A 4NNJB 5DPRA 2MX2A 1AARA 4IW0A 1ROEA 3ML9A 2C7MB 4HDQA 4C7ZA 2KX3A 1WGRA 1AN8A 4W9IA 2FIDA 3EC8A 1PYWD 1JCKB 4REZA 5IA7A 3L4PA 2B3AA 3SD5A 3ZJVA 1CMXB 4XDCA 2RDGA 2V3NA 4MM3B 4GDKB 5KHOA 4WJPA 2IGDA 3V05A 4E71A 1IGCA 3U52E 1WMHB 2O2VB 5D94A 2LI5A 1EUVB 1DGJA 3H8HA 4A3PA 3RNBC 3H9DA 3WAMA 1E8YA 2BQQA 1KH0A 3DQVA 4FLHA 1I4HA 3OLMD 2MBEA 1L0XB 5I4DA 2O6VB 2WXMA 1AW7A 2WX1A 3ZRCA 1YN4A 4L1BA 4B0MA 5HFYA 3IBEA 3KW5B 3KYCD 2VZKD 3AU5A 3MJWA 1LM8B 1V80A 2HDEA 5C3JB 3C0RB 4FBJB 3P63A 1E0ZA 3W9CB 2KO3A 4TSSA 5BMIA 1IYFA 4G11A 1OEYJ 2FBWB 2L05A 3D32A 2ASQA 2JQRB 3B2GA 4KZCA 4P16A 4W9FA 1F0ZA 1F2RI 2I2YA 1E7PB 1V8CA 2GRIA 2KD0A 2KDIA 3EFCA 5FR3A 1PUTA 4FN2A 2N9EB 1WI0A 3LXFA 2D3CA 4LCDE 4ICUA 5DPSA 4YSZB 2FE8A 2MEKA 3A1QB 4LTUA 2IO1B 1EU4A 3M3JA 4BBNC 4DHZB 4FJYA 3WANA 1BMLC 3N20C 4PS8A 2LUMA 4K7UA 3RNFC 4KIKA 4BBNF 1WE7A 1XQQA 1JALA 4IDIA 3O13A 1QOGA 1FNVA 4NJCA 1WYGA 4P6VF 1N63A 1V9JA 2L0FA 3PREA 2REXA 1QLBB 3N3KB 1FXIA 3ZIMA 1IGDA 2GBMA 2L0TA 2JUOA 5G55A 5IOIA 1N60A 3P2BA 2R61A 4WWPA 5FR6A 3LYYA 4BFRA 1ZP0B 2KQ4X 4IWOA 4B9KA 2D3GA 4M8MA 3HK0A 2ZCBA 2J52A 2Z59B 3TIXA 2KNBA 1YNTE 2HE7A 3ABVB 3SU8X 3TUOA 3AV8A 3AE5B 4W9DA 1JQ4A 1SF0A 1BXTA 1IPGA 2JX5A 1JWBD 3DBSA 3AEFB 2PVOD 1T0QC 2I1JA 4NPNA 4XWTA 2BGFA 2MW5A 3P4SB 3RCZA 4LNFA 4URKA 4HWIB 2DYOA 4JWUC 3DCGA 1ZXIA 2VRRB 2LUEA 2WYQA 3CSFA 2CKHB 4KX6B 3DBRB 2MJ3A 3P42A 2NBWB 2LGIA 2LHEA 4ZOHC 1C4PA 1EU3A 4KDIC 2KQSA 4GDLB 1RLFA 1MPEA 1K52A 4HPPA 3ZRFA 1YX5B 4JX1C 2JVCA 2RD0A 4C80A 2YVCA 4ZRIA 3RFZB 1K8RB 1QZEA 1TZOA 1RM6C 2V0GA 1FRRA 3A9KA 3O65B 3E9SA 2DLBA 1GB4A 4H2AA 1JRUA 4N9F4 4TQ0A 4HCNB 4O1NA 2BB6A 3Q8CA 2GBKA 3ZNZB 1KOTA 4BOSC 2K25A 3B2FA 2ZNVB 1E7UA 3CWIA 3DHHC 4W9JA 3PRMB 3RNAC 4TMAB 3IVFA 1EF1A 3AE3B 4LDTB 4WJOA 3DBHB 3T8MA 4GB9A 1J8CA 1UBQA 3ECIA 4BKSA 3R3MA 4MELA 3IT4B 4E3CA 3AEBB 4FJVB 2RSUA 2ZZPB 1EF5A 3Q3FA 1IBXA 2GB1A 2NVUI 4PT5A 3VQIA 2KDBA 2JZPA 1NI2A 1OEYA 4M00A 2BWFA 3N1XC 2FUHB 2DZKA 4OW0A 2BTEA 2KAJA 4K7WA 1ZKHA 4US9A 5H92C 3P4RB 1V2YA 4IOIE 2OJRA 3Q6BA 4XGAB 2PEAA 4MGYE 3BK2A 2FUG1 3Q8FA 1SB3C 1N62A 5TR5A 2M56B 4MSQB 3HIZA 3ZNID 4RMAA 2X8XX 4HKQA 4W9CA 5E6JA 2V4IB 2W82A 4BZAA 3UIOB 3WALA 1E8XA 4JL9A 1FXTB 2KHWB 4I6PA 1C9FA 3DBHI 1MVKA 3EECA 3PLUA 1CK1A 3J9CA 2IO3B 5JHAA 4DQOC 3R2TA 1WX7A 3V6CB 2AWTA 3VDZA 2K8BA 3DHGC 5D6JB 3AEGB 1QQRA 4LK0M 4A90A 3Q69A 3TJPA 1FO4A 2XBBC 2XEWA 5HG2A 3A9JA 2LXAA 2LGXA 5BMGA 3AECB 4IWQA 3AM9A 3GOEA 1L4ZB 2KWDA 1UNSA 2QMTA 1Y56A 4XE0A 3AH7A 1FM0D 2LEKA 4IM3A 3T3NA 5T8IA 4UDUC 3M95A 2MP2A 2INPE 3TEZA 3DVNU 1M4VA 4IC7B 2B76B 1ZPSA 1PQSA 2ZJDA 4W9LA 2WXJA 3W2DA 3VRBB 3SEBA 1DYQA 1E9MA 4BAXA 1OTRB 3KWVA 2ZW1A 4LNNA 1PGBA 2JYEA 4YTPB 1WGKA 1TY2A 3Q3JA 4MM3A 2OHFA 4GDKA 2Z0DB 2KMMA 1D5MC 2DZJA 1NBFC 2BF8B 1WMHA 1U4AA 2O2VA 5H8YE 3ZXVA 2IYDB 1XCTL 3PGEA 3B9JA 1Z5SB 1WXVA 3QAQA 2V1YA 3RULA 1N6ZA 3SHQA 2DZMA 2ZEQA 5MPOA 1BUIC 2YEPF 3UQBA 1YMHE 3AULA 1ZW7A 4W9KA 3HVZA 2BS2B 5AUIA 2IGGA 2O6VA 1JRPA 1FMAD 4HVBA 4FADA 3ZTDA 3UIPB 4MJSB 1FCCC 1TBEA 3ZTCA 2JT4B 5EE1A 3DVNV 4QAYA 2N7DA 1WXAA 4XDDA 3RI7C 5LXIB 3NJTA 4AOFA 1NENB 1DOIA 2ONQA 5D3DA 3Q8BA 1GC6A 1XT9B 1IP9A 2KACA 4XWWA 1ACCA 1V5OA 2I1KA 3VVWB 1NYQA 1WR6E 3ZYYX 1F2RC 3KLSX 4WJNA 1KTKA 4HK2A 3A1QA 4PYZA 2PLPA 4CYEA 1P7FA 1GUAB 2L76A 2PKOA 1QOAA 1GC7A 1HTQA 1JROA 1D4BA 4S17A 1TT5B 2BPSA 1FXAA 2K8HA 2KLGA 3ZXRA 2QCZA 2MJEA 1GAQB 1C1YB 4NQKE 4LDTD 2CR5A 2BWES 2EMSA 2HJ8A 2IY0B 4E74A 3QWZB 3EA6A 1YN3A 4F1SA 3ZGZA 5D3IB 3DDCB 5G5GA 2WP9B 1HZ6A 1TS2A 4IG7B 3N9YC 1FIQA 4HRSA 3EHVA 2HTME 2KKCA 2WQYB 4A9AA 4ANUA 2JZZA 2VH2A 3LDZE 2K6QA 4CO7A 3PO0A 1WJ4A 2KK8A 1BT0A 4LNKA 5EE9A 2C5LC 2BS3B 1Y8RC 2W3SA 2G4DB 3AE7B 4A55A 1HXYD 2JZ3B 3RNGC 2ZVOA 2CJOA 3JSVA 1FFUA 3KQ4A 3VFKA 1SE4A 2EKEC 2V9HA 4YWGG 4HROA 3ZJUA 1YQBA 2ZPYA 2G45B 1KLGD 1ZUD2 3CSTA 1ESFA 3L16A 2EMTA 1JWMD 2FCSA 3MHSD 3AMZA 1Q0WB 2D07B 4ZRKA 1TTNA 3NY5A 4II2B 3TEYA 3WA0A 3HRDD 2NTSA 2WX0A 3VUXA 2XNAC 3AEEB 2FCNA 2KVZA 3HUIA 3K9OB 5CHFA 4GSWA 1PGAA 5FK9C 3PZ7A 1T0SC 2WLBA 3RN9C 1Q10A 2L52A 2ACZB 1C78A 2LMCA 3ZJTA 2DHZA 1UH6A 1E7VA 1EO6A 4RCOA 2MJDA 2AYOB 3U7DA 1MG8A 2J0KA 1E5WA 1OFFA 3ZNGC 2D10A 4HKZE 3L10B 1HA5A 3OAWA 2MCNB 2WXGA 4DK5A 2N7EA 2NMQA 3RT3B 3PRZA 4K3CA 2K8CA 1LO5D 3Q3NC 1P1AA 3L08A 2KWVB 1Q5WB 2GMIC 4RNAA 1J7AA 3AE9B 2YLMA 1MFWA 1CQVA 3UQAA 1A5RA 1D3ZA 3PT2B 1I4QA 4B0EA 3U2SC 2HTHA 1NI3A 3HM3A 1PFDA 3VR8B 3KUDB 5C23A 2FAZA 4XZ4A 5DPTA 3NZ3A 5G2NA 4WAAA 2WDRB 3BIID 4FHKA 1R4MB 3M62B 3TL5A 2IY1B 1ET9A 1A70A 1R7SA 1WJNA 1ZDXA 5IO9A 1WFYA 1TKGA 2SEBD 1SEBD 1ZE3D 4XX5A 2D3AA 2JRHA 2OJWA 5E6NA 4KDLB 2DYBA 1F9JA 4BKSD 1ISNA 4RM8A 1P3QU 4JWSC 1GPXA 2IO0B 5DPWA 4OVVA 3H1UA 4JIOU 1WM3A 5E6PA 3W1SA 3KUCB 3PTFC 1UELA 3JYUA 3DWGC 3MP9A 2WHIA 3I3TB 4A20A 4YXDB 4N58A 4BKGA 4M01A 2AL3A 1R4MI 2LFIA 1WF9A 2DZIA 1RAXA 4LJPB 3NVVA 1NVID 3RNEC 1T5XD 4ZHOA 4GGQA 4M0WB 3TCAA 1XEEA 2QEJC 2OEDA 4DDGD 4MGKE 2TSSA 3KYDD 2AQ2B 1V5TA 2KANA 2KXJA 2HJ1A 2WDTB 2IGHA 2KQ7A 2RPVA 2KMCA 2WXHA 4FHJA 4MEMA 1V1PB 3I63C 4BKTA 4DDID 3PHXB 3MHZA 1F52A 2WNMA 3DHIC 3ZNHB 1HTOA 2LD9A 1WGGA 1FNUA 1UUPA 1VD2A 3V60A 2QIEB 4RGOS 3ZUNA 3NUHB 3DOWA 4LJOB 1C79A 2JYTA 2ZPNA 2PJHA 4WQOB 4DBGA 2WXRA 1I4XA 1XLQA 3R7RA 1RFKA 2BW2A 4WJQA 4KKJA 3NVWA 4RGTA 3W1SC 2IBIB 5HHDG 4MJSA 2A5UA 1XLOA 2W9NA 1WE6A 1YQ3B 4EZKA 2WDQB 3N32A 1NEKB 2JF5A 2M1MA 3V61A 4CHKA 2IPKD 4ANVA 4WAFA 4EZLA 3L13A 3DBLB 2I38A 3SFDB 1TS3A 2LJ5A 2J7QB 3BVMA 3Q2AC 3APFA 3ZKJC 1J19A 2RMMA 1WX9A 4M02A 4IM0A 2K0PA 1P98A 3PRPB 3U4EG 2LVQA 1VDVA 3M63B 4RF1A 4XYCA 4WWMA 1I4RA 2CU3A 2G3QB 4C56C 2N9LA 2O6VD 2KC2A 1XLPA 2N1VA 1KJTA 2BKRB 3ZDTA 1VJKA 4LNOA 3T9LA 1JWSD 2CS4A 4FA6A 1X1MA 3B1LX 1WXMA 2RPQA 2Y3AA 1J0GA 2MHJA 2LVPA 1D6EC 4DHJB 3QQ8B 2J42A 2DBYA 4NY0A 4RGNA 4JPSA 5JZEB 3QX1A 2MH7A 3IT6B 2LJIA 1Q1OA 3Q8EA 1JMLA 1RRBA 4IWPA 3UINB 2BT6A 1I42A 3ONSA 1T3QA 4KSLC 1R4NI 1TY0A 3QIJA 1P7EA 1FPYA 2MSED 3DBLI 2N9KA 3I9V1 4JQWC 2M17A 4ASWC 1VZ7A 4DWFA 1IUEA 1L5PA 2C7HA 4HCPB 2NS5A 4HEA1 1WRIA 2H88B 2L1AA 5AEKB 2J4XA 4DHZE 1FRDA 3NRZA 2GI9A 4WH4A 3RYTA 2JU6X 1LGRA 2LRWA 2X38A 3TSSA 2WWZA 2KWUB 2KMAA 3TBLD 2KTRB 3IAM1 2VZKB 3AE2B 4K1RB 3APDA 2GLSA 3IXSA 2ICIA 2N4FA 2Y5PA 3BINA 4YSYB 1I7HA 3GE3C 3ZQ4A 1OQRA 2SAKA 5AUKA 4ARIA 4HLEA 2PIAA 3C8YA 5C2TB 3VXWA 4F7ZA 1C4AA 1HZ5A 2NBVB 3H7PB 3L0WB 4ZDVA 3MTNB 4C00A 2NPTB 3FKYA 2KN5A 1ENFA 3MC8A 4RFBA 2RR9A 1V6EA 4CQNA 1E10A 2K39A 2LGSA 1V86A 2WXKA 1YOVB 2BYVE 4ZRJA 2M0XA 3QCAA 2QC8A 2H89B 4JLCA 4ZYNA 2V4LA 3ZVVA 3V6EB 1XO3A 3MC9A 1WGHA 4EE2A 1WH3A 2M4NA 2WXOA 3QARA 3RUIB 2N7JA 1MG4A 1K53A 3WAPA 1GOZA 2K3UA 2N0SB 3VR9B 3DVGY 1YX6B 2MBBB 1MHHE 2LGDA 2QHOA 4YL8A 1SSNA 2IDYA 2Y5BB 4PS7A 1VR9A 2BB5A 3VAWA 3Q3OC 3OWEB 4JGHB 3IAS1 2W54A 4HJKA 4P7IA 2KX0A 4DXAB 5J18A 5KHQA 2M0AA 1N61A 5J17A 1ZXHA 3HVDA 5TSSA 1C76A 3U7ZA 1DOXA 3AE8B 3NZSA 4L2YA 1OQQA 1RWSA 4EUTA 1K50A 1GB1A 3JVZX 4NJ6A 2DX5B 3L17A 4D2KA 3VRAB 4OZCA 4DXGA 2LWPA 2N9XA 3OJ4B 3BK1A 1L7YA 1L6UA 1B1ZA 1NYRA 3WIMA 3VUYA 4NZLB 2WGSA 3FILB 3AI5A 3FAHA 1EWCA 3KH0A 2INNE 3R8BA 1G6JA 3X23A 4RH6A 1KFYB 2PW9A 4P1CC 1JWUD 1UGMA 2CHWA 1E8ZA 2MBQA 4EKUA 2J0MA 2BS4B 3AU4A 4HPMB 2K1FA 3U30A 2G4SA 5CX3A 3ZO5B 2WXNA 2QJLA 4C4VB 4GMVA 3OG5A 1TYGB 1KLUD 4USAA 1WGYA 3TEXA 1WJUA 4KZ0A 1KM7A 2JWZA 2WDVB 1YJIA 2KWCA 1EWYC 1L2NA 3SFEB 2RDHA 3UF8A 3JW0X 1MHXA 1SJED 5CHWA 2CHXA 3DVGX 2JXXA 4AUQC 1N5WA 3PZ8A 2DENB 1V81A 1VRAB 1VLBA 4ICVA 2Z0EB 3BVZA 3HM6X 1HEZE 2UWQA 1P0RA 3OJ3A 2KYWA 4I6NB 4ZYSA 4HDOA 5LNK1 3SDLC 2KOXA 5AZFA 1T6BX 4M0WA 1ET6A 1QKZA 2BVCA 4WURA 2WXQA 4DHJD 2WU5B 2QDFA 3B08A 2C9WB 3UGBB 2DAJA 4GDLA 2BYEA 4OHJA 1STEA 4RGMA 1SE9A 3RZFA 3K9PB 3AEDB 4X57B 3NG0A 1V1PA 2LASA 4GU2A 4F8CB 1KRHA 3ETRA 4MSMB 2XK5B 2IJ0A 2INCC 3P4QB 1TKEA 3R7QA 1C3TA 4XC2A 4L23A 5L83A 1OQYA 2ZW0A 1SJHD 4YTNB 3QHTA 2LXCA 1P9DU 1WSPA 4NAMA 1WYWB 4ZRPA 2AEHA 1I4GA 1WWTA 4AJWA 2PTLA 4TUUA 1FNWA 4G0NB 1TZ1A 1S1QB 4HJGE 1J7BA 2L83A 4JE3B 4MDKE 2R2OA 3PHWB 4EOYA 1WIAA 2JPHA 4OZBA 1QF6A 3RZWC 5LLIA 4AS1A 3AB5A 3IG3A 5FKAC 2R2QA 1YJJA 4J6IA 3GE8C 4ANXA 1YD8U 1JW9D 2KFKB 3AEAB 2KFJA 1J7CA 1UWXA 3AE1B 1GNUA 1WRDB 3KWLA 4KSKC 4MH8A 3V3XA 4BOZB 2Z8LA 1UF0A 5IAAC 5C1ZA 5D7GA 3EUB2 3GP7A 3WAOA 2GBRA 1N5XA 5EE0A 4MACA 5J2RA 2FCQA 4WWOA 3GS2A 4NAWB 1E90A 5CHVC 2GBJA 1HE8A 2K5PA 4KV2A 1YQ4B 2E6XA 1VZ8A 2GOWA 3H6NA 3VUWA 4PK1A 3PSEB 4US8A 2L3ZA 1V97A 2ZNVC 2D11A 2J0JA 1LQBA 2Q5WD 3CIRB 1TIFA 2LVOA 1H4RA 2GBNA 4B95A 1PDXA 2NTTA 1XLNA 3I57A 2KN4A 3R66C 4RM9A 1WX8A 5AZHA 3NS1A 1KF6B 3ZLZA 1QOFA 3BWUD 3QA8A 3U8ZA 3ENEA 2IO2B 4PYUA 2V3PA 2BYTA 4TV3A 1WGDA 2JSVX 4J3OD 4ANWA 2KC1A 2XN9C 2MBHA 2A4ZA 4YTMB 3ML8A 2CHZA 3KVFB 1ZGUB 3QJZA 2VH1A 5DCNA 1QILA 1XCQL 3VH3B 4EEWA 5JXVA 4OVUA 1AYFA 3L54A 1SGHA 2K9XA 3X0WA 2DYMA 2DWQA 3JSVB 3Q8AA 3URYA 3C19A 3PVLA 2KTRA 4IKGA 1SE3A 2QSDA 1B9RA 3CF6E 3NZUA 2D5GA 5GXGB 4KGSA 5BYQA 1WXSA 3A4RA 2ZVNA 1S3SG 1TKYA 1WXQA 1XF5L 2LGYA 2KDMA 4M8NA 3MFGA 1SIJA 4G3XB 4ARCA 3H7PA 4KVGB 4IUMB 3AE6B 2RDBC 1XXGA 2NPTA 1E8WA 1FD6A 2IZVB 1YJ1A 2LHDA 2LZ6A 2MA9B 3IFWB 4AQ7A 5BYRA 4LLGM 3DPDA 3KUZA 3PLVA 2PMVA 2BYFA 1L0VB 2AX5A 1VCBA 5IP4D 4G50A 3EFUA 4MGIE 2CU1A 3ALBA 5AZGA 5E6OA 1GG3A 3AE4B 4KGRA 4R3DA 1MI0A 2W55A 1EM7A
chains in the Genus database with same CATH topology
3L0WB 4AJYB 2NBVB 3H7PB 4KIKA 4BBNF 1WE7A 4ANUA 4ZDVA 3MTNB 1XQQA 2JZZA 2NPTB 3LDZE 2K6QA 2KN5A 4CO7A 3BY4B 2RR9A 1V9JA 1V6EA 1BT0A 1WJ4A 2L0FA 2C5LC 2KK8A 2PE6B 3PREA 2K39A 2REXA 1Y8RC 5CTRC 1V86A 2K6DB 3N3KB 2G4DB 3ZIMA 2GBMA 2JY6A 2JUOA 2JZ3B 2L0TA 2MWSB 3CMMB 3DBRI 2BYVE 5G55A 4ZRJA 2M0XA 2ZVOA 2ZCCA 3JSVA 3QCAA 2FIFA 3VFKA 3P2BA 4JLCA 4ZYNA 4WWPA 3TMPB 5FR6A 2EKEC 2C60A 2KJ6A 2V4LA 3ZVVA 4BFRA 3V6EB 4IWOA 1WGHA 1WH3A 5HKHA 2M4NA 4B9KA 1YQBA 2ZPYA 2G45B 3QARA 2D3GA 4M8MA 4PS3A 3RUIB 3WAPA 3HK0A 2ZCBA 1SIFA 2Z59B 3CSTA 3TIXA 3DVGY 2HD5B 2KNBA 1YX6B 3SU8X 2HE7A 2MBBB 5JHBA 2LGDA 3L16A 4HXDA 2EMTA 2QHOA 4YL8A 4KIKB 4W9DA 4BVUC 2Y5BB 2FCSA 3MHSD 4PS7A 5BO4B 3VAWA 4AP4C 1Q0WB 2D07B 1IPGA 2PE9A 4JGHB 4ZRKA 1TTNA 2L00B 4HJKA 4P7IA 2KX0A 4I6LB 3DBSA 3NY5A 4II2B 4WWNA 4DXAB 3WA0A 3HHMA 5LXHA 2WX0A 3VUXA 4GIVA 5J18A 2UYZB 2I1JA 5KHQA 2L8JA 4NPNA 5J17A 2DAFA 2NBUA 2FCNA 3NZSA 2BGFA 2MW5A 3K9OB 5CHFA 3RCZA 4URKA 3PS6A 4GSWA 4HWIB 2DYOA 4EUTA 3A33B 1WZ0A 4MGZE 3DCGA 2PPHA 3JVZX 4NJ6A 2KDEB 1XD3B 3ZDMC 2DX5B 2FCMA 2N1WA 3L17A 2VRRB 2LUEA 2DHZA 1UH6A 1E7VA 1EO6A 2WYQA 1YIWA 3CSFA 2CKHB 2LWPA 2KLCA 2N9XA 1M94A 3OJ4B 4A3OA 1L7YA 2AYOB 3U7DA 2NBWB 2MLBA 1MG8A 2J0KA 5JH5C 1E5WA 3QC8B 3WIMA 3VUYA 3AI5A 2MQJA 4KDIC 4GN1A 3KH0A 2D10A 2KQSA 3ZNGC 4GDLB 4K7SA 1RLFA 3L10B 3OAWA 4DK5A 2MCNB 3ZRFA 1RFAA 2MBOA 2N7EA 2OOBB 1YX5B 1G6JA 2JVCA 5L95C 3X23A 2RD0A 3RT3B 3PRZA 2K8CA 4MH0E 2YVCA 4ZRIA 2KVRA 1K8RB 1QZEA 1UGMA 2V3SA 1P1AA 2CHWA 1E8ZA 2MBQA 3L08A 3O65B 3A9KA 2J0MA 4EKUA 3AU4A 1LXDA 2KWVB 1Q5WB 4HPMB 3VH4B 2GMIC 2K1FA 1V49A 3U30A 2YLMA 1JRUA 4N9F4 3ZW3A 2G4SA 3UQAA 3A4SC 4TQ0A 4HCNB 1A5RA 5CX3A 3ZO5B 3NS8A 3PT2B 1D3ZA 2HTHA 4HPLB 2GBKA 3PV1A 4GMVA 2KDFB 4W9EA 3HM3A 4FULA 3ZNZB 1KOTA 2RGFA 4BOSC 2FNJB 1WGYA 2K25A 3KUDB 1WJUA 4KZ0A 2FAZA 5C23A 4XZ4A 5DPTA 2ZNVB 1KM7A 1E7UA 5G2NA 4WAAA 2JWZA 4W9JA 4FHKA 2KWCA 3M62B 3PRMB 5D2MB 4EZJA 3IVFA 3TL5A 2IY1B 4W9HA 1EF1A 4LDTB 3NOBA 1L2NA 4WJOA 3UF8A 3JW0X 1WJNA 5CHWA 2CHXA 3T8MA 4GB9A 1WFYA 3DVGX 2JXXA 4AUQC 1J8CA 1UBQA 4XX5A 3ECIA 4BKSA 2DENB 1V81A 3R3MA 4MELA 2JRHA 3V62A 4E3CA 5E6NA 2KJRA 3LJ3A 2DYBA 2XK5A 4FJVB 2RSUA 2ZZPB 4KDLB 1EF5A 4ICVA 3A9KB 2Z0EB 3Q3FA 3RD2A 1LFDA 2L7RA 1F9JA 3HM6X 4BKSD 1ISNA 4RM8A 2UWQA 2NVUI 1P0RA 3OJ3A 3VQIA 1P3QU 2KDBA 4I6NB 4HDOA 1NI2A 1OEYA 3SDLC 2KOXA 2BWFA 5AZFA 2FUHB 2DZKA 1TGZB 4K7WA 2C7NB 1ZKHA 2IO0B 5DPWA 4TKNA 4OVVA 4DHJD 3H1UA 4JIOU 4NQLB 3VHTC 1WM3A 5E6PA 1V2YA 3GZNI 3B08A 2LRUA 1UD7A 2C9WB 2OJRA 3UGBB 2PEAA 2DAJA 4GDLA 3QK0A 3NHEB 3KUCB 3W1SA 2BYEA 1T0YA 4MGYE 3PTFC 1UZXB 1UELA 1SE9A 3RZFA 3JYUA 2KTFA 3K9PB 4X57B 5TR5A 1GJZA 2LASA 4GU2A 4MSQB 4F8CB 2AL6A 3I3TB 4AWJA 3HIZA 4GXBA 4MSMB 3S2AA 2XK5B 4A20A 3ZNID 4RMAA 1WR1A 3R7QA 4BKGA 4W9CA 2AL3A 1R4MI 1C3TA 4XC2A 5L83A 1WF9A 3UIOB 3WALA 1E8XA 3PZDA 4JL9A 2DZIA 2KHWB 1FXTB 1RAXA 1OQYA 4I6PA 4LJPB 3QHTA 3DBHI 2LXCA 1P9DU 3PPAA 2KFKA 3EECA 1NDDA 3PLUA 4GOCA 2IO3B 4GGQA 4M0WB 3TCAA 5JHAA 2KJHB 4DDGD 3H7SA 4MGKE 1WX7A 3KYDD 1WYWB 1V5TA 1WZ3A 3V6CB 2AWTA 2KANA 4IM2A 2KXJA 2AEHA 2NR2A 2WDTB 1KLVA 2MRPA 2KQ7A 4AJWA 3VDZA 4TUUA 4G0NB 4FJZA 1TZ1A 1S1QB 2K8BA 2KMCA 5D6JB 3VTVA 4MDKE 4FHJA 3TJPA 4MEMA 2R2OA 3PHWB 4NAWA 4EOYA 4DDID 4BKTA 1WIAA 2JPHA 3PHXB 2XBBC 2XEWA 3RZWC 5LLIA 3A9JA 2LXAA 2LGXA 3IG3A 1H8CA 4IWQA 4B6WA 2R2QA 3GOEA 1I35A 4K81A 3ZNHB 1OGWA 3B0AA 4J6IA 2LD9A 1WGGA 4ANXA 1VD2A 1YD8U 3V60A 4IM3A 3W1YA 3APCA 2KFKB 4II3B 3ZUNA 4LJOB 1WY8A 3DOWA 2ZPNA 2KFJA 2PJHA 3M95A 4WQOB 4DBGA 1WJ6A 1GNUA 2MP2A 1WRDB 4KSKC 3R7RA 2JRIB 4BOZB 3DVNU 4WJQA 5EDSA 4IC7B 4NJ7A 5IAAC 5C1ZA 3W1SC 5D7GA 1PQSA 2ZJDA 2IBIB 3WAOA 4W9LA 2GBRA 2N9PC 5J2RA 4MJSA 1Z2MA 1UBIA 2FCQA 2A5UA 2NCNA 1OTRB 4WWOA 4NAWB 1E90A 3IHPC 2W9NA 4W9GA 5CHVC 1WE6A 4EZKA 3AXCA 2GBJA 3N32A 3A9JB 2BKFA 1HE8A 2JF5A 2M1MA 3Q3JA 2M8SA 3V61A 4MM3A 4GDKA 4CHKA 2Z0DB 4KV2A 2KZRA 3VTUA 4ANVA 2DZJA 2GOWA 3VTWA 1NBFC 3H6NA 2BF8B 1WMHA 5GMVA 1U4AA 2O2VA 3VUWA 3PSEB 2IYDB 4EZLA 3L13A 2L3ZA 3PGEA 1WM2A 2ZNVC 1Z5SB 1WXVA 2D11A 4EFOA 3QAQA 2V1YA 2D2QA 3RULA 2J0JA 2MP2B 4TQ1A 1LQBA 3N30A 3SHQA 4NNJB 2DZMA 2ZEQA 5DPRA 2LJ5A 2J7QB 2MX2A 1AARA 4IW0A 3UQBA 2LVOA 1H4RA 3AULA 3APFA 1ZW7A 2GBNA 3ML9A 2C7MB 3ZKJC 4HDQA 4W9KA 1J19A 4B95A 2KX3A 1WX9A 1WGRA 4IM0A 1P98A 2O6VA 3PRPB 3R66C 4RM9A 2LVQA 1WX8A 3M63B 5AZHA 4HVBA 4W9IA 3ZTDA 4FADA 3UIPB 2FIDA 3ZLZA 3EC8A 4MJSB 3QA8A 1TBEA 2G3QB 3U8ZA 3ZTCA 3ENEA 2JT4B 2IO2B 4PYUA 2O6VD 5IA7A 2KC2A 3DVNV 2N7DA 1WXAA 2B3AA 1KJTA 2N1VA 3SD5A 2BKRB 1CMXB 4TV3A 3ZDTA 3T9LA 5LXIB 1WGDA 4GDKB 5KHOA 2CS4A 4AOFA 4ANWA 4WJPA 1X1MA 4FA6A 2KC1A 2MBHA 2A4ZA 3B1LX 1WXMA 4E71A 2RPQA 3ML8A 1J0GA 1GC6A 1XT9B 1WMHB 2CHZA 3KVFB 1ZGUB 2LVPA 2O2VB 1IP9A 3QJZA 4DHJB 5D94A 3QQ8B 5DCNA 2LI5A 1EUVB 4NY0A 3VH3B 4A3PA 4EEWA 3H9DA 4OVUA 3WAMA 1E8YA 3L54A 1SGHA 3X0WA 1V5OA 2DYMA 5JZEB 3QX1A 3JSVB 3DQVA 3OLMD 4FLHA 2I1KA 1Q1OA 2MBEA 3PVLA 3VVWB 1WR6E 2KTRA 3CF6E 1RRBA 3NZUA 4IWPA 2O6VB 3UINB 1I42A 1WXSA 3A4RA 3ONSA 4WJNA 4HK2A 2WX1A 3ZRCA 3A1QA 4PYZA 2ZVNA 4CYEA 4KSLC 1R4NI 1S3SG 3IBEA 3QIJA 1GUAB 2LGYA 3KW5B 3KYCD 2L76A 3AU5A 2MSED 3DBLI 3MJWA 4JQWC 1LM8B 1V80A 4M8NA 2M17A 4ASWC 4G3XB 1GC7A 4DWFA 3H7PA 3C0RB 4KVGB 4FBJB 4IUMB 2NPTA 2KO3A 1E8WA 1IYFA 2C7HA 2IZVB 4G11A 1OEYJ 2BPSA 2NS5A 4HCPB 1YJ1A 2L05A 2MA9B 2LZ6A 3D32A 3IFWB 2ASQA 4KZCA 4W9FA 2K8HA 2KLGA 5AEKB 4DHZE 2KDIA 3DPDA 2KD0A 3KUZA 3RYTA 1C1YB 3PLVA 4NQKE 2LRWA 4LDTD 2CR5A 2BWES 2WWZA 2BYFA 4FN2A 2EMSA 2N9EB 2KWUB 2HJ8A 2KMAA 1WI0A 1VCBA 2IY0B 4G50A 3TBLD 4LCDE 2KTRB 4E74A 3EFUA 3QWZB 4ICUA 5DPSA 4K1RB 3APDA 4MGIE 2N4FA 4F1SA 3BINA 2CU1A 3DDCB 3ALBA 3A1QB 5AZGA 5E6OA 1GG3A 2IO1B 3M3JA 4HLEA 4BBNC 4IG7B 4DHZB 4FJYA 3EHVA 3WANA 4PS8A 3VXWA 2KKCA 4K7UA 4F7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0W B;  4AJY B;  2NBV B;  3H7P B;  4KIK A;  4BBN F;  1WE7 A;  4ANU A;  4ZDV A;  3MTN B;  1XQQ A;  2JZZ A;  2NPT B;  3LDZ E;  2K6Q A;  2KN5 A;  4CO7 A;  3BY4 B;  2RR9 A;  1V9J A;  1V6E A;  1BT0 A;  1WJ4 A;  2L0F A;  2C5L C;  2KK8 A;  2PE6 B;  3PRE A;  2K39 A;  2REX A;  1Y8R C;  5CTR C;  1V86 A;  2K6D B;  3N3K B;  2G4D B;  3ZIM A;  2GBM A;  2JY6 A;  2JUO A;  2JZ3 B;  2L0T A;  2MWS B;  3CMM B;  3DBR I;  2BYV E;  5G55 A;  4ZRJ A;  2M0X A;  2ZVO A;  2ZCC A;  3JSV A;  3QCA A;  2FIF A;  3VFK A;  3P2B A;  4JLC A;  4ZYN A;  4WWP A;  3TMP B;  5FR6 A;  2EKE C;  2C60 A;  2KJ6 A;  2V4L A;  3ZVV A;  4BFR A;  3V6E B;  4IWO A;  1WGH A;  1WH3 A;  5HKH A;  2M4N A;  4B9K A;  1YQB A;  2ZPY A;  2G45 B;  3QAR A;  2D3G A;  4M8M A;  4PS3 A;  3RUI B;  3WAP A;  3HK0 A;  2ZCB A;  1SIF A;  2Z59 B;  3CST A;  3TIX A;  3DVG Y;  2HD5 B;  2KNB A;  1YX6 B;  3SU8 X;  2HE7 A;  2MBB B;  5JHB A;  2LGD A;  3L16 A;  4HXD A;  2EMT A;  2QHO A;  4YL8 A;  4KIK B;  4W9D A;  4BVU C;  2Y5B B;  2FCS A;  3MHS D;  4PS7 A;  5BO4 B;  3VAW A;  4AP4 C;  1Q0W B;  2D07 B;  1IPG A;  2PE9 A;  4JGH B;  4ZRK A;  1TTN A;  2L00 B;  4HJK A;  4P7I A;  2KX0 A;  4I6L B;  3DBS A;  3NY5 A;  4II2 B;  4WWN A;  4DXA B;  3WA0 A;  3HHM A;  5LXH A;  2WX0 A;  3VUX A;  4GIV A;  5J18 A;  2UYZ B;  2I1J A;  5KHQ A;  2L8J A;  4NPN A;  5J17 A;  2DAF A;  2NBU A;  2FCN A;  3NZS A;  2BGF A;  2MW5 A;  3K9O B;  5CHF A;  3RCZ A;  4URK A;  3PS6 A;  4GSW A;  4HWI B;  2DYO A;  4EUT A;  3A33 B;  1WZ0 A;  4MGZ E;  3DCG A;  2PPH A;  3JVZ X;  4NJ6 A;  2KDE B;  1XD3 B;  3ZDM C;  2DX5 B;  2FCM A;  2N1W A;  3L17 A;  2VRR B;  2LUE A;  2DHZ A;  1UH6 A;  1E7V A;  1EO6 A;  2WYQ A;  1YIW A;  3CSF A;  2CKH B;  2LWP A;  2KLC A;  2N9X A;  1M94 A;  3OJ4 B;  4A3O A;  1L7Y A;  2AYO B;  3U7D A;  2NBW B;  2MLB A;  1MG8 A;  2J0K A;  5JH5 C;  1E5W A;  3QC8 B;  3WIM A;  3VUY A;  3AI5 A;  2MQJ A;  4KDI C;  4GN1 A;  3KH0 A;  2D10 A;  2KQS A;  3ZNG C;  4GDL B;  4K7S A;  1RLF A;  3L10 B;  3OAW A;  4DK5 A;  2MCN B;  3ZRF A;  1RFA A;  2MBO A;  2N7E A;  2OOB B;  1YX5 B;  1G6J A;  2JVC A;  5L95 C;  3X23 A;  2RD0 A;  3RT3 B;  3PRZ A;  2K8C A;  4MH0 E;  2YVC A;  4ZRI A;  2KVR A;  1K8R B;  1QZE A;  1UGM A;  2V3S A;  1P1A A;  2CHW A;  1E8Z A;  2MBQ A;  3L08 A;  3O65 B;  3A9K A;  2J0M A;  4EKU A;  3AU4 A;  1LXD A;  2KWV B;  1Q5W B;  4HPM B;  3VH4 B;  2GMI C;  2K1F A;  1V49 A;  3U30 A;  2YLM A;  1JRU A;  4N9F 4;  3ZW3 A;  2G4S A;  3UQA A;  3A4S C;  4TQ0 A;  4HCN B;  1A5R A;  5CX3 A;  3ZO5 B;  3NS8 A;  3PT2 B;  1D3Z A;  2HTH A;  4HPL B;  2GBK A;  3PV1 A;  4GMV A;  2KDF B;  4W9E A;  3HM3 A;  4FUL A;  3ZNZ B;  1KOT A;  2RGF A;  4BOS C;  2FNJ B;  1WGY A;  2K25 A;  3KUD B;  1WJU A;  4KZ0 A;  2FAZ A;  5C23 A;  4XZ4 A;  5DPT A;  2ZNV B;  1KM7 A;  1E7U A;  5G2N A;  4WAA A;  2JWZ A;  4W9J A;  4FHK A;  2KWC A;  3M62 B;  3PRM B;  5D2M B;  4EZJ A;  3IVF A;  3TL5 A;  2IY1 B;  4W9H A;  1EF1 A;  4LDT B;  3NOB A;  1L2N A;  4WJO A;  3UF8 A;  3JW0 X;  1WJN A;  5CHW A;  2CHX A;  3T8M A;  4GB9 A;  1WFY A;  3DVG X;  2JXX A;  4AUQ C;  1J8C A;  1UBQ A;  4XX5 A;  3ECI A;  4BKS A;  2DEN B;  1V81 A;  3R3M A;  4MEL A;  2JRH A;  3V62 A;  4E3C A;  5E6N A;  2KJR A;  3LJ3 A;  2DYB A;  2XK5 A;  4FJV B;  2RSU A;  2ZZP B;  4KDL B;  1EF5 A;  4ICV A;  3A9K B;  2Z0E B;  3Q3F A;  3RD2 A;  1LFD A;  2L7R A;  1F9J A;  3HM6 X;  4BKS D;  1ISN A;  4RM8 A;  2UWQ A;  2NVU I;  1P0R A;  3OJ3 A;  3VQI A;  1P3Q U;  2KDB A;  4I6N B;  4HDO A;  1NI2 A;  1OEY A;  3SDL C;  2KOX A;  2BWF A;  5AZF A;  2FUH B;  2DZK A;  1TGZ B;  4K7W A;  2C7N B;  1ZKH A;  2IO0 B;  5DPW A;  4TKN A;  4OVV A;  4DHJ D;  3H1U A;  4JIO U;  4NQL B;  3VHT C;  1WM3 A;  5E6P A;  1V2Y A;  3GZN I;  3B08 A;  2LRU A;  1UD7 A;  2C9W B;  2OJR A;  3UGB B;  2PEA A;  2DAJ A;  4GDL A;  3QK0 A;  3NHE B;  3KUC B;  3W1S A;  2BYE A;  1T0Y A;  4MGY E;  3PTF C;  1UZX B;  1UEL A;  1SE9 A;  3RZF A;  3JYU A;  2KTF A;  3K9P B;  4X57 B;  5TR5 A;  1GJZ A;  2LAS A;  4GU2 A;  4MSQ B;  4F8C B;  2AL6 A;  3I3T B;  4AWJ A;  3HIZ A;  4GXB A;  4MSM B;  3S2A A;  2XK5 B;  4A20 A;  3ZNI D;  4RMA A;  1WR1 A;  3R7Q A;  4BKG A;  4W9C A;  2AL3 A;  1R4M I;  1C3T A;  4XC2 A;  5L83 A;  1WF9 A;  3UIO B;  3WAL A;  1E8X A;  3PZD A;  4JL9 A;  2DZI A;  2KHW B;  1FXT B;  1RAX A;  1OQY A;  4I6P A;  4LJP B;  3QHT A;  3DBH I;  2LXC A;  1P9D U;  3PPA A;  2KFK A;  3EEC A;  1NDD A;  3PLU A;  4GOC A;  2IO3 B;  4GGQ A;  4M0W B;  3TCA A;  5JHA A;  2KJH B;  4DDG D;  3H7S A;  4MGK E;  1WX7 A;  3KYD D;  1WYW B;  1V5T A;  1WZ3 A;  3V6C B;  2AWT A;  2KAN A;  4IM2 A;  2KXJ A;  2AEH A;  2NR2 A;  2WDT B;  1KLV A;  2MRP A;  2KQ7 A;  4AJW A;  3VDZ A;  4TUU A;  4G0N B;  4FJZ A;  1TZ1 A;  1S1Q B;  2K8B A;  2KMC A;  5D6J B;  3VTV A;  4MDK E;  4FHJ A;  3TJP A;  4MEM A;  2R2O A;  3PHW B;  4NAW A;  4EOY A;  4DDI D;  4BKT A;  1WIA A;  2JPH A;  3PHX B;  2XBB C;  2XEW A;  3RZW C;  5LLI A;  3A9J A;  2LXA A;  2LGX A;  3IG3 A;  1H8C A;  4IWQ A;  4B6W A;  2R2Q A;  3GOE A;  1I35 A;  4K81 A;  3ZNH B;  1OGW A;  3B0A A;  4J6I A;  2LD9 A;  1WGG A;  4ANX A;  1VD2 A;  1YD8 U;  3V60 A;  4IM3 A;  3W1Y A;  3APC A;  2KFK B;  4II3 B;  3ZUN A;  4LJO B;  1WY8 A;  3DOW A;  2ZPN A;  2KFJ A;  2PJH A;  3M95 A;  4WQO B;  4DBG A;  1WJ6 A;  1GNU A;  2MP2 A;  1WRD B;  4KSK C;  3R7R A;  2JRI B;  4BOZ B;  3DVN U;  4WJQ A;  5EDS A;  4IC7 B;  4NJ7 A;  5IAA C;  5C1Z A;  3W1S C;  5D7G A;  1PQS A;  2ZJD A;  2IBI B;  3WAO A;  4W9L A;  2GBR A;  2N9P C;  5J2R A;  4MJS A;  1Z2M A;  1UBI A;  2FCQ A;  2A5U A;  2NCN A;  1OTR B;  4WWO A;  4NAW B;  1E90 A;  3IHP C;  2W9N A;  4W9G A;  5CHV C;  1WE6 A;  4EZK A;  3AXC A;  2GBJ A;  3N32 A;  3A9J B;  2BKF A;  1HE8 A;  2JF5 A;  2M1M A;  3Q3J A;  2M8S A;  3V61 A;  4MM3 A;  4GDK A;  4CHK A;  2Z0D B;  4KV2 A;  2KZR A;  3VTU A;  4ANV A;  2DZJ A;  2GOW A;  3VTW A;  1NBF C;  3H6N A;  2BF8 B;  1WMH A;  5GMV A;  1U4A A;  2O2V A;  3VUW A;  3PSE B;  2IYD B;  4EZL A;  3L13 A;  2L3Z A;  3PGE A;  1WM2 A;  2ZNV C;  1Z5S B;  1WXV A;  2D11 A;  4EFO A;  3QAQ A;  2V1Y A;  2D2Q A;  3RUL A;  2J0J A;  2MP2 B;  4TQ1 A;  1LQB A;  3N30 A;  3SHQ A;  4NNJ B;  2DZM A;  2ZEQ A;  5DPR A;  2LJ5 A;  2J7Q B;  2MX2 A;  1AAR A;  4IW0 A;  3UQB A;  2LVO A;  1H4R A;  3AUL A;  3APF A;  1ZW7 A;  2GBN A;  3ML9 A;  2C7M B;  3ZKJ C;  4HDQ A;  4W9K A;  1J19 A;  4B95 A;  2KX3 A;  1WX9 A;  1WGR A;  4IM0 A;  1P98 A;  2O6V A;  3PRP B;  3R66 C;  4RM9 A;  2LVQ A;  1WX8 A;  3M63 B;  5AZH A;  4HVB A;  4W9I A;  3ZTD A;  4FAD A;  3UIP B;  2FID A;  3ZLZ A;  3EC8 A;  4MJS B;  3QA8 A;  1TBE A;  2G3Q B;  3U8Z A;  3ZTC A;  3ENE A;  2JT4 B;  2IO2 B;  4PYU A;  2O6V D;  5IA7 A;  2KC2 A;  3DVN V;  2N7D A;  1WXA A;  2B3A A;  1KJT A;  2N1V A;  3SD5 A;  2BKR B;  1CMX B;  4TV3 A;  3ZDT A;  3T9L A;  5LXI B;  1WGD A;  4GDK B;  5KHO A;  2CS4 A;  4AOF A;  4ANW A;  4WJP A;  1X1M A;  4FA6 A;  2KC1 A;  2MBH A;  2A4Z A;  3B1L X;  1WXM A;  4E71 A;  2RPQ A;  3ML8 A;  1J0G A;  1GC6 A;  1XT9 B;  1WMH B;  2CHZ A;  3KVF B;  1ZGU B;  2LVP A;  2O2V B;  1IP9 A;  3QJZ A;  4DHJ B;  5D94 A;  3QQ8 B;  5DCN A;  2LI5 A;  1EUV B;  4NY0 A;  3VH3 B;  4A3P A;  4EEW A;  3H9D A;  4OVU A;  3WAM A;  1E8Y A;  3L54 A;  1SGH A;  3X0W A;  1V5O A;  2DYM A;  5JZE B;  3QX1 A;  3JSV B;  3DQV A;  3OLM D;  4FLH A;  2I1K A;  1Q1O A;  2MBE A;  3PVL A;  3VVW B;  1WR6 E;  2KTR A;  3CF6 E;  1RRB A;  3NZU A;  4IWP A;  2O6V B;  3UIN B;  1I42 A;  1WXS A;  3A4R A;  3ONS A;  4WJN A;  4HK2 A;  2WX1 A;  3ZRC A;  3A1Q A;  4PYZ A;  2ZVN A;  4CYE A;  4KSL C;  1R4N I;  1S3S G;  3IBE A;  3QIJ A;  1GUA B;  2LGY A;  3KW5 B;  3KYC D;  2L76 A;  3AU5 A;  2MSE D;  3DBL I;  3MJW A;  4JQW C;  1LM8 B;  1V80 A;  4M8N A;  2M17 A;  4ASW C;  4G3X B;  1GC7 A;  4DWF A;  3H7P A;  3C0R B;  4KVG B;  4FBJ B;  4IUM B;  2NPT A;  2KO3 A;  1E8W A;  1IYF A;  2C7H A;  2IZV B;  4G11 A;  1OEY J;  2BPS A;  2NS5 A;  4HCP B;  1YJ1 A;  2L05 A;  2MA9 B;  2LZ6 A;  3D32 A;  3IFW B;  2ASQ A;  4KZC A;  4W9F A;  2K8H A;  2KLG A;  5AEK B;  4DHZ E;  2KDI A;  3DPD A;  2KD0 A;  3KUZ A;  3RYT A;  1C1Y B;  3PLV A;  4NQK E;  2LRW A;  4LDT D;  2CR5 A;  2BWE S;  2WWZ A;  2BYF A;  4FN2 A;  2EMS A;  2N9E B;  2KWU B;  2HJ8 A;  2KMA A;  1WI0 A;  1VCB A;  2IY0 B;  4G50 A;  3TBL D;  4LCD E;  2KTR B;  4E74 A;  3EFU A;  3QWZ B;  4ICU A;  5DPS A;  4K1R B;  3APD A;  4MGI E;  2N4F A;  4F1S A;  3BIN A;  2CU1 A;  3DDC B;  3ALB A;  3A1Q B;  5AZG A;  5E6O A;  1GG3 A;  2IO1 B;  3M3J A;  4HLE A;  4BBN C;  4IG7 B;  4DHZ B;  4FJY A;  3EHV A;  3WAN A;  4PS8 A;  3VXW A;  2KKC A;  4K7U A;  4F7Z A; 
#chains in the Genus database with same CATH topology
 4AJY B;  1T0R C;  1VZ6 A;  3BY4 B;  3GB1 A;  3BVG A;  1R4N B;  2PE6 B;  5CTR C;  2K6D B;  2AQ1 B;  2JY6 A;  2MWS B;  3CMM B;  3DBR I;  1UWM A;  2ZCC A;  4GLS C;  2FIF A;  4MT5 A;  1AWD A;  4WIP A;  3TMP B;  2C60 A;  2KJ6 A;  4RF0 A;  4A8X C;  5HKH A;  1PGX A;  4YSX B;  4PS3 A;  1JWA D;  1SIF A;  2DNF A;  1ZDV A;  2HD5 B;  4OVZ A;  5JHB A;  1FEH A;  4HXD A;  4KIK B;  4BVU C;  3FIL A;  3EGR A;  2BBC A;  5BO4 B;  4AP4 C;  4ZRQ A;  2JXT A;  2PE9 A;  1K51 A;  3BYY B;  2L00 B;  2WXL A;  4I6L B;  4WWN A;  1L0Y B;  1L6V A;  3HHM A;  5LXH A;  4GIV A;  2UYZ B;  2L8J A;  4LNI A;  2DAF A;  5G5H A;  2NBU A;  3W5V B;  1D5X C;  3PS6 A;  1D5Z C;  3LB8 C;  3A33 B;  1WZ0 A;  4MGZ E;  2PPH A;  1C77 A;  2KDE B;  1XD3 B;  1YN5 A;  3ZDM C;  2FCM A;  2N1W A;  1E6E B;  3WCQ A;  4C4V A;  1YIW A;  4A3O A;  2KLC A;  1M94 A;  2MLB A;  4N59 A;  5JH5 C;  4KKI A;  3QC8 B;  1HQR D;  2CJN A;  3RPF C;  1TJE A;  2MQJ A;  4GN1 A;  4K7S A;  1RFA A;  2MBO A;  3P1M A;  2OOB B;  5L95 C;  1SBB B;  3MC0 B;  2M19 A;  4MH0 E;  2KVR A;  2V3S A;  3W5U B;  1LXD A;  3GZN B;  3VH4 B;  3NVZ A;  1DOY A;  1V49 A;  5BMH A;  4OZA A;  3ZW3 A;  3A4S C;  3NS8 A;  2JWU A;  4HPL B;  3PV1 A;  4W9E A;  2KDF B;  1L4D B;  1MJD A;  4FUL A;  2RGF A;  2FNJ B;  4K3B A;  2WXI A;  2WU2 B;  4ACF A;  4P1B C;  3NVY A;  3T3O A;  4EZJ A;  5D2M B;  4S0R A;  4W9H A;  5IN7 A;  3NOB A;  1I4P A;  2G1E A;  2L32 A;  3AN1 A;  3V62 A;  2KJR A;  3LJ3 A;  2XK5 A;  3MJ5 A;  3RD2 A;  3A9K B;  1CJE A;  2EEL A;  2QIL A;  1LFD A;  2W3R A;  5EE3 A;  2L7R A;  1FCL A;  1V1O A;  2G9H D;  3BYT B;  1TGZ B;  2C7N B;  4N6E B;  4TKN A;  3Q14 C;  4NQL B;  3VHT C;  3GZN I;  2LRU A;  1UD7 A;  5HI1 A;  3QK0 A;  3NHE B;  1T0Y A;  1UZX B;  2WS3 B;  2KTF A;  2D3B A;  4YT0 B;  1GJZ A;  1QOB A;  2AL6 A;  4AWJ A;  4WQM A;  4GXB A;  4Q2J A;  3E56 A;  3S2A A;  1WR1 A;  2UU7 A;  5BYS A;  1F77 A;  1IBX B;  2J53 A;  4A6Q A;  2IND C;  3PZD A;  1QT9 A;  1FFV A;  3PPA A;  2KFK A;  3N1Y C;  1SXT A;  2Y5C A;  1NDD A;  4GOC A;  2KJH B;  1TS5 A;  2PVG C;  3H7S A;  1WZ3 A;  1ZOY B;  3N1Z C;  4IM2 A;  2AQ3 B;  2NR2 A;  1KLV A;  2MRP A;  4C7Y A;  4FJZ A;  3BZD B;  3VTV A;  3SR6 A;  4NAW A;  3FC4 A;  2ON8 A;  4KGT A;  2WXP A;  4ZHP A;  3I5J C;  1H8C A;  4B6W A;  1I35 A;  4K81 A;  1OGW A;  3B0A A;  4DXF A;  2WXF A;  3W1Y A;  3APC A;  4II3 B;  2E3T A;  1WY8 A;  2KT7 A;  1WJ6 A;  1TS4 A;  2JRI B;  2YEP B;  5EDS A;  4NJ7 A;  3TEW A;  2N9P C;  1F1H A;  4FXC A;  1CZP A;  1Z2M A;  1UBI A;  2NCN A;  4ITK A;  3RNC C;  3IHP C;  4W9G A;  3RMK C;  1UGJ A;  3AXC A;  5IKC M;  3A9J B;  2BKF A;  2M8S A;  2K22 A;  2KZR A;  3VTU A;  1SE2 A;  3R2I A;  3VTW A;  3Q3M C;  5GMV A;  3DWM A;  1RYJ A;  1C4C A;  3P4P B;  3UI3 A;  2EKI A;  1WM2 A;  4EFO A;  2D2Q A;  4TQ1 A;  2MP2 B;  3N30 A;  4NNJ B;  5DPR A;  2MX2 A;  1AAR A;  4IW0 A;  1ROE A;  3ML9 A;  2C7M B;  4HDQ A;  4C7Z A;  2KX3 A;  1WGR A;  1AN8 A;  4W9I A;  2FID A;  3EC8 A;  1PYW D;  1JCK B;  4REZ A;  5IA7 A;  3L4P A;  2B3A A;  3SD5 A;  3ZJV A;  1CMX B;  4XDC A;  2RDG A;  2V3N A;  4MM3 B;  4GDK B;  5KHO A;  4WJP A;  2IGD A;  3V05 A;  4E71 A;  1IGC A;  3U52 E;  1WMH B;  2O2V B;  5D94 A;  2LI5 A;  1EUV B;  1DGJ A;  3H8H A;  4A3P A;  3RNB C;  3H9D A;  3WAM A;  1E8Y A;  2BQQ A;  1KH0 A;  3DQV A;  4FLH A;  1I4H A;  3OLM D;  2MBE A;  1L0X B;  5I4D A;  2O6V B;  2WXM A;  1AW7 A;  2WX1 A;  3ZRC A;  1YN4 A;  4L1B A;  4B0M A;  5HFY A;  3IBE A;  3KW5 B;  3KYC D;  2VZK D;  3AU5 A;  3MJW A;  1LM8 B;  1V80 A;  2HDE A;  5C3J B;  3C0R B;  4FBJ B;  3P63 A;  1E0Z A;  3W9C B;  2KO3 A;  4TSS A;  5BMI A;  1IYF A;  4G11 A;  1OEY J;  2FBW B;  2L05 A;  3D32 A;  2ASQ A;  2JQR B;  3B2G A;  4KZC A;  4P16 A;  4W9F A;  1F0Z A;  1F2R I;  2I2Y A;  1E7P B;  1V8C A;  2GRI A;  2KD0 A;  2KDI A;  3EFC A;  5FR3 A;  1PUT A;  4FN2 A;  2N9E B;  1WI0 A;  3LXF A;  2D3C A;  4LCD E;  4ICU A;  5DPS A;  4YSZ B;  2FE8 A;  2MEK A;  3A1Q B;  4LTU A;  2IO1 B;  1EU4 A;  3M3J A;  4BBN C;  4DHZ B;  4FJY A;  3WAN A;  1BML C;  3N20 C;  4PS8 A;  2LUM A;  4K7U A;  3RNF C;  4KIK A;  4BBN F;  1WE7 A;  1XQQ A;  1JAL A;  4IDI A;  3O13 A;  1QOG A;  1FNV A;  4NJC A;  1WYG A;  4P6V F;  1N63 A;  1V9J A;  2L0F A;  3PRE A;  2REX A;  1QLB B;  3N3K B;  1FXI A;  3ZIM A;  1IGD A;  2GBM A;  2L0T A;  2JUO A;  5G55 A;  5IOI A;  1N60 A;  3P2B A;  2R61 A;  4WWP A;  5FR6 A;  3LYY A;  4BFR A;  1ZP0 B;  2KQ4 X;  4IWO A;  4B9K A;  2D3G A;  4M8M A;  3HK0 A;  2ZCB A;  2J52 A;  2Z59 B;  3TIX A;  2KNB A;  1YNT E;  2HE7 A;  3ABV B;  3SU8 X;  3TUO A;  3AV8 A;  3AE5 B;  4W9D A;  1JQ4 A;  1SF0 A;  1BXT A;  1IPG A;  2JX5 A;  1JWB D;  3DBS A;  3AEF B;  2PVO D;  1T0Q C;  2I1J A;  4NPN A;  4XWT A;  2BGF A;  2MW5 A;  3P4S B;  3RCZ A;  4LNF A;  4URK A;  4HWI B;  2DYO A;  4JWU C;  3DCG A;  1ZXI A;  2VRR B;  2LUE A;  2WYQ A;  3CSF A;  2CKH B;  4KX6 B;  3DBR B;  2MJ3 A;  3P42 A;  2NBW B;  2LGI A;  2LHE A;  4ZOH C;  1C4P A;  1EU3 A;  4KDI C;  2KQS A;  4GDL B;  1RLF A;  1MPE A;  1K52 A;  4HPP A;  3ZRF A;  1YX5 B;  4JX1 C;  2JVC A;  2RD0 A;  4C80 A;  2YVC A;  4ZRI A;  3RFZ B;  1K8R B;  1QZE A;  1TZO A;  1RM6 C;  2V0G A;  1FRR A;  3A9K A;  3O65 B;  3E9S A;  2DLB A;  1GB4 A;  4H2A A;  1JRU A;  4N9F 4;  4TQ0 A;  4HCN B;  4O1N A;  2BB6 A;  3Q8C A;  2GBK A;  3ZNZ B;  1KOT A;  4BOS C;  2K25 A;  3B2F A;  2ZNV B;  1E7U A;  3CWI A;  3DHH C;  4W9J A;  3PRM B;  3RNA C;  4TMA B;  3IVF A;  1EF1 A;  3AE3 B;  4LDT B;  4WJO A;  3DBH B;  3T8M A;  4GB9 A;  1J8C A;  1UBQ A;  3ECI A;  4BKS A;  3R3M A;  4MEL A;  3IT4 B;  4E3C A;  3AEB B;  4FJV B;  2RSU A;  2ZZP B;  1EF5 A;  3Q3F A;  1IBX A;  2GB1 A;  2NVU I;  4PT5 A;  3VQI A;  2KDB A;  2JZP A;  1NI2 A;  1OEY A;  4M00 A;  2BWF A;  3N1X C;  2FUH B;  2DZK A;  4OW0 A;  2BTE A;  2KAJ A;  4K7W A;  1ZKH A;  4US9 A;  5H92 C;  3P4R B;  1V2Y A;  4IOI E;  2OJR A;  3Q6B A;  4XGA B;  2PEA A;  4MGY E;  3BK2 A;  2FUG 1;  3Q8F A;  1SB3 C;  1N62 A;  5TR5 A;  2M56 B;  4MSQ B;  3HIZ A;  3ZNI D;  4RMA A;  2X8X X;  4HKQ A;  4W9C A;  5E6J A;  2V4I B;  2W82 A;  4BZA A;  3UIO B;  3WAL A;  1E8X A;  4JL9 A;  1FXT B;  2KHW B;  4I6P A;  1C9F A;  3DBH I;  1MVK A;  3EEC A;  3PLU A;  1CK1 A;  3J9C A;  2IO3 B;  5JHA A;  4DQO C;  3R2T A;  1WX7 A;  3V6C B;  2AWT A;  3VDZ A;  2K8B A;  3DHG C;  5D6J B;  3AEG B;  1QQR A;  4LK0 M;  4A90 A;  3Q69 A;  3TJP A;  1FO4 A;  2XBB C;  2XEW A;  5HG2 A;  3A9J A;  2LXA A;  2LGX A;  5BMG A;  3AEC B;  4IWQ A;  3AM9 A;  3GOE A;  1L4Z B;  2KWD A;  1UNS A;  2QMT A;  1Y56 A;  4XE0 A;  3AH7 A;  1FM0 D;  2LEK A;  4IM3 A;  3T3N A;  5T8I A;  4UDU C;  3M95 A;  2MP2 A;  2INP E;  3TEZ A;  3DVN U;  1M4V A;  4IC7 B;  2B76 B;  1ZPS A;  1PQS A;  2ZJD A;  4W9L A;  2WXJ A;  3W2D A;  3VRB B;  3SEB A;  1DYQ A;  1E9M A;  4BAX A;  1OTR B;  3KWV A;  2ZW1 A;  4LNN A;  1PGB A;  2JYE A;  4YTP B;  1WGK A;  1TY2 A;  3Q3J A;  4MM3 A;  2OHF A;  4GDK A;  2Z0D B;  2KMM A;  1D5M C;  2DZJ A;  1NBF C;  2BF8 B;  1WMH A;  1U4A A;  2O2V A;  5H8Y E;  3ZXV A;  2IYD B;  1XCT L;  3PGE A;  3B9J A;  1Z5S B;  1WXV A;  3QAQ A;  2V1Y A;  3RUL A;  1N6Z A;  3SHQ A;  2DZM A;  2ZEQ A;  5MPO A;  1BUI C;  2YEP F;  3UQB A;  1YMH E;  3AUL A;  1ZW7 A;  4W9K A;  3HVZ A;  2BS2 B;  5AUI A;  2IGG A;  2O6V A;  1JRP A;  1FMA D;  4HVB A;  4FAD A;  3ZTD A;  3UIP B;  4MJS B;  1FCC C;  1TBE A;  3ZTC A;  2JT4 B;  5EE1 A;  3DVN V;  4QAY A;  2N7D A;  1WXA A;  4XDD A;  3RI7 C;  5LXI B;  3NJT A;  4AOF A;  1NEN B;  1DOI A;  2ONQ A;  5D3D A;  3Q8B A;  1GC6 A;  1XT9 B;  1IP9 A;  2KAC A;  4XWW A;  1ACC A;  1V5O A;  2I1K A;  3VVW B;  1NYQ A;  1WR6 E;  3ZYY X;  1F2R C;  3KLS X;  4WJN A;  1KTK A;  4HK2 A;  3A1Q A;  4PYZ A;  2PLP A;  4CYE A;  1P7F A;  1GUA B;  2L76 A;  2PKO A;  1QOA A;  1GC7 A;  1HTQ A;  1JRO A;  1D4B A;  4S17 A;  1TT5 B;  2BPS A;  1FXA A;  2K8H A;  2KLG A;  3ZXR A;  2QCZ A;  2MJE A;  1GAQ B;  1C1Y B;  4NQK E;  4LDT D;  2CR5 A;  2BWE S;  2EMS A;  2HJ8 A;  2IY0 B;  4E74 A;  3QWZ B;  3EA6 A;  1YN3 A;  4F1S A;  3ZGZ A;  5D3I B;  3DDC B;  5G5G A;  2WP9 B;  1HZ6 A;  1TS2 A;  4IG7 B;  3N9Y C;  1FIQ A;  4HRS A;  3EHV A;  2HTM E;  2KKC A;  2WQY B;  4A9A A;  4ANU A;  2JZZ A;  2VH2 A;  3LDZ E;  2K6Q A;  4CO7 A;  3PO0 A;  1WJ4 A;  2KK8 A;  1BT0 A;  4LNK A;  5EE9 A;  2C5L C;  2BS3 B;  1Y8R C;  2W3S A;  2G4D B;  3AE7 B;  4A55 A;  1HXY D;  2JZ3 B;  3RNG C;  2ZVO A;  2CJO A;  3JSV A;  1FFU A;  3KQ4 A;  3VFK A;  1SE4 A;  2EKE C;  2V9H A;  4YWG G;  4HRO A;  3ZJU A;  1YQB A;  2ZPY A;  2G45 B;  1KLG D;  1ZUD 2;  3CST A;  1ESF A;  3L16 A;  2EMT A;  1JWM D;  2FCS A;  3MHS D;  3AMZ A;  1Q0W B;  2D07 B;  4ZRK A;  1TTN A;  3NY5 A;  4II2 B;  3TEY A;  3WA0 A;  3HRD D;  2NTS A;  2WX0 A;  3VUX A;  2XNA C;  3AEE B;  2FCN A;  2KVZ A;  3HUI A;  3K9O B;  5CHF A;  4GSW A;  1PGA A;  5FK9 C;  3PZ7 A;  1T0S C;  2WLB A;  3RN9 C;  1Q10 A;  2L52 A;  2ACZ B;  1C78 A;  2LMC A;  3ZJT A;  2DHZ A;  1UH6 A;  1E7V A;  1EO6 A;  4RCO A;  2MJD A;  2AYO B;  3U7D A;  1MG8 A;  2J0K A;  1E5W A;  1OFF A;  3ZNG C;  2D10 A;  4HKZ E;  3L10 B;  1HA5 A;  3OAW A;  2MCN B;  2WXG A;  4DK5 A;  2N7E A;  2NMQ A;  3RT3 B;  3PRZ A;  4K3C A;  2K8C A;  1LO5 D;  3Q3N C;  1P1A A;  3L08 A;  2KWV B;  1Q5W B;  2GMI C;  4RNA A;  1J7A A;  3AE9 B;  2YLM A;  1MFW A;  1CQV A;  3UQA A;  1A5R A;  1D3Z A;  3PT2 B;  1I4Q A;  4B0E A;  3U2S C;  2HTH A;  1NI3 A;  3HM3 A;  1PFD A;  3VR8 B;  3KUD B;  5C23 A;  2FAZ A;  4XZ4 A;  5DPT A;  3NZ3 A;  5G2N A;  4WAA A;  2WDR B;  3BII D;  4FHK A;  1R4M B;  3M62 B;  3TL5 A;  2IY1 B;  1ET9 A;  1A70 A;  1R7S A;  1WJN A;  1ZDX A;  5IO9 A;  1WFY A;  1TKG A;  2SEB D;  1SEB D;  1ZE3 D;  4XX5 A;  2D3A A;  2JRH A;  2OJW A;  5E6N A;  4KDL B;  2DYB A;  1F9J A;  4BKS D;  1ISN A;  4RM8 A;  1P3Q U;  4JWS C;  1GPX A;  2IO0 B;  5DPW A;  4OVV A;  3H1U A;  4JIO U;  1WM3 A;  5E6P A;  3W1S A;  3KUC B;  3PTF C;  1UEL A;  3JYU A;  3DWG C;  3MP9 A;  2WHI A;  3I3T B;  4A20 A;  4YXD B;  4N58 A;  4BKG A;  4M01 A;  2AL3 A;  1R4M I;  2LFI A;  1WF9 A;  2DZI A;  1RAX A;  4LJP B;  3NVV A;  1NVI D;  3RNE C;  1T5X D;  4ZHO A;  4GGQ A;  4M0W B;  3TCA A;  1XEE A;  2QEJ C;  2OED A;  4DDG D;  4MGK E;  2TSS A;  3KYD D;  2AQ2 B;  1V5T A;  2KAN A;  2KXJ A;  2HJ1 A;  2WDT B;  2IGH A;  2KQ7 A;  2RPV A;  2KMC A;  2WXH A;  4FHJ A;  4MEM A;  1V1P B;  3I63 C;  4BKT A;  4DDI D;  3PHX B;  3MHZ A;  1F52 A;  2WNM A;  3DHI C;  3ZNH B;  1HTO A;  2LD9 A;  1WGG A;  1FNU A;  1UUP A;  1VD2 A;  3V60 A;  2QIE B;  4RGO S;  3ZUN A;  3NUH B;  3DOW A;  4LJO B;  1C79 A;  2JYT A;  2ZPN A;  2PJH A;  4WQO B;  4DBG A;  2WXR A;  1I4X A;  1XLQ A;  3R7R A;  1RFK A;  2BW2 A;  4WJQ A;  4KKJ A;  3NVW A;  4RGT A;  3W1S C;  2IBI B;  5HHD G;  4MJS A;  2A5U A;  1XLO A;  2W9N A;  1WE6 A;  1YQ3 B;  4EZK A;  2WDQ B;  3N32 A;  1NEK B;  2JF5 A;  2M1M A;  3V61 A;  4CHK A;  2IPK D;  4ANV A;  4WAF A;  4EZL A;  3L13 A;  3DBL B;  2I38 A;  3SFD B;  1TS3 A;  2LJ5 A;  2J7Q B;  3BVM A;  3Q2A C;  3APF A;  3ZKJ C;  1J19 A;  2RMM A;  1WX9 A;  4M02 A;  4IM0 A;  2K0P A;  1P98 A;  3PRP B;  3U4E G;  2LVQ A;  1VDV A;  3M63 B;  4RF1 A;  4XYC A;  4WWM A;  1I4R A;  2CU3 A;  2G3Q B;  4C56 C;  2N9L A;  2O6V D;  2KC2 A;  1XLP A;  2N1V A;  1KJT A;  2BKR B;  3ZDT A;  1VJK A;  4LNO A;  3T9L A;  1JWS D;  2CS4 A;  4FA6 A;  1X1M A;  3B1L X;  1WXM A;  2RPQ A;  2Y3A A;  1J0G A;  2MHJ A;  2LVP A;  1D6E C;  4DHJ B;  3QQ8 B;  2J42 A;  2DBY A;  4NY0 A;  4RGN A;  4JPS A;  5JZE B;  3QX1 A;  2MH7 A;  3IT6 B;  2LJI A;  1Q1O A;  3Q8E A;  1JML A;  1RRB A;  4IWP A;  3UIN B;  2BT6 A;  1I42 A;  3ONS A;  1T3Q A;  4KSL C;  1R4N I;  1TY0 A;  3QIJ A;  1P7E A;  1FPY A;  2MSE D;  3DBL I;  2N9K A;  3I9V 1;  4JQW C;  2M17 A;  4ASW C;  1VZ7 A;  4DWF A;  1IUE A;  1L5P A;  2C7H A;  4HCP B;  2NS5 A;  4HEA 1;  1WRI A;  2H88 B;  2L1A A;  5AEK B;  2J4X A;  4DHZ E;  1FRD A;  3NRZ A;  2GI9 A;  4WH4 A;  3RYT A;  2JU6 X;  1LGR A;  2LRW A;  2X38 A;  3TSS A;  2WWZ A;  2KWU B;  2KMA A;  3TBL D;  2KTR B;  3IAM 1;  2VZK B;  3AE2 B;  4K1R B;  3APD A;  2GLS A;  3IXS A;  2ICI A;  2N4F A;  2Y5P A;  3BIN A;  4YSY B;  1I7H A;  3GE3 C;  3ZQ4 A;  1OQR A;  2SAK A;  5AUK A;  4ARI A;  4HLE A;  2PIA A;  3C8Y A;  5C2T B;  3VXW A;  4F7Z A;  1C4A A;  1HZ5 A;  2NBV B;  3H7P B;  3L0W B;  4ZDV A;  3MTN B;  4C00 A;  2NPT B;  3FKY A;  2KN5 A;  1ENF A;  3MC8 A;  4RFB A;  2RR9 A;  1V6E A;  4CQN A;  1E10 A;  2K39 A;  2LGS A;  1V86 A;  2WXK A;  1YOV B;  2BYV E;  4ZRJ A;  2M0X A;  3QCA A;  2QC8 A;  2H89 B;  4JLC A;  4ZYN A;  2V4L A;  3ZVV A;  3V6E B;  1XO3 A;  3MC9 A;  1WGH A;  4EE2 A;  1WH3 A;  2M4N A;  2WXO A;  3QAR A;  3RUI B;  2N7J A;  1MG4 A;  1K53 A;  3WAP A;  1GOZ A;  2K3U A;  2N0S B;  3VR9 B;  3DVG Y;  1YX6 B;  2MBB B;  1MHH E;  2LGD A;  2QHO A;  4YL8 A;  1SSN A;  2IDY A;  2Y5B B;  4PS7 A;  1VR9 A;  2BB5 A;  3VAW A;  3Q3O C;  3OWE B;  4JGH B;  3IAS 1;  2W54 A;  4HJK A;  4P7I A;  2KX0 A;  4DXA B;  5J18 A;  5KHQ A;  2M0A A;  1N61 A;  5J17 A;  1ZXH A;  3HVD A;  5TSS A;  1C76 A;  3U7Z A;  1DOX A;  3AE8 B;  3NZS A;  4L2Y A;  1OQQ A;  1RWS A;  4EUT A;  1K50 A;  1GB1 A;  3JVZ X;  4NJ6 A;  2DX5 B;  3L17 A;  4D2K A;  3VRA B;  4OZC A;  4DXG A;  2LWP A;  2N9X A;  3OJ4 B;  3BK1 A;  1L7Y A;  1L6U A;  1B1Z A;  1NYR A;  3WIM A;  3VUY A;  4NZL B;  2WGS A;  3FIL B;  3AI5 A;  3FAH A;  1EWC A;  3KH0 A;  2INN E;  3R8B A;  1G6J A;  3X23 A;  4RH6 A;  1KFY B;  2PW9 A;  4P1C C;  1JWU D;  1UGM A;  2CHW A;  1E8Z A;  2MBQ A;  4EKU A;  2J0M A;  2BS4 B;  3AU4 A;  4HPM B;  2K1F A;  3U30 A;  2G4S A;  5CX3 A;  3ZO5 B;  2WXN A;  2QJL A;  4C4V B;  4GMV A;  3OG5 A;  1TYG B;  1KLU D;  4USA A;  1WGY A;  3TEX A;  1WJU A;  4KZ0 A;  1KM7 A;  2JWZ A;  2WDV B;  1YJI A;  2KWC A;  1EWY C;  1L2N A;  3SFE B;  2RDH A;  3UF8 A;  3JW0 X;  1MHX A;  1SJE D;  5CHW A;  2CHX A;  3DVG X;  2JXX A;  4AUQ C;  1N5W A;  3PZ8 A;  2DEN B;  1V81 A;  1VRA B;  1VLB A;  4ICV A;  2Z0E B;  3BVZ A;  3HM6 X;  1HEZ E;  2UWQ A;  1P0R A;  3OJ3 A;  2KYW A;  4I6N B;  4ZYS A;  4HDO A;  5LNK 1;  3SDL C;  2KOX A;  5AZF A;  1T6B X;  4M0W A;  1ET6 A;  1QKZ A;  2BVC A;  4WUR A;  2WXQ A;  4DHJ D;  2WU5 B;  2QDF A;  3B08 A;  2C9W B;  3UGB B;  2DAJ A;  4GDL A;  2BYE A;  4OHJ A;  1STE A;  4RGM A;  1SE9 A;  3RZF A;  3K9P B;  3AED B;  4X57 B;  3NG0 A;  1V1P A;  2LAS A;  4GU2 A;  4F8C B;  1KRH A;  3ETR A;  4MSM B;  2XK5 B;  2IJ0 A;  2INC C;  3P4Q B;  1TKE A;  3R7Q A;  1C3T A;  4XC2 A;  4L23 A;  5L83 A;  1OQY A;  2ZW0 A;  1SJH D;  4YTN B;  3QHT A;  2LXC A;  1P9D U;  1WSP A;  4NAM A;  1WYW B;  4ZRP A;  2AEH A;  1I4G A;  1WWT A;  4AJW A;  2PTL A;  4TUU A;  1FNW A;  4G0N B;  1TZ1 A;  1S1Q B;  4HJG E;  1J7B A;  2L83 A;  4JE3 B;  4MDK E;  2R2O A;  3PHW B;  4EOY A;  1WIA A;  2JPH A;  4OZB A;  1QF6 A;  3RZW C;  5LLI A;  4AS1 A;  3AB5 A;  3IG3 A;  5FKA C;  2R2Q A;  1YJJ A;  4J6I A;  3GE8 C;  4ANX A;  1YD8 U;  1JW9 D;  2KFK B;  3AEA B;  2KFJ A;  1J7C A;  1UWX A;  3AE1 B;  1GNU A;  1WRD B;  3KWL A;  4KSK C;  4MH8 A;  3V3X A;  4BOZ B;  2Z8L A;  1UF0 A;  5IAA C;  5C1Z A;  5D7G A;  3EUB 2;  3GP7 A;  3WAO A;  2GBR A;  1N5X A;  5EE0 A;  4MAC A;  5J2R A;  2FCQ A;  4WWO A;  3GS2 A;  4NAW B;  1E90 A;  5CHV C;  2GBJ A;  1HE8 A;  2K5P A;  4KV2 A;  1YQ4 B;  2E6X A;  1VZ8 A;  2GOW A;  3H6N A;  3VUW A;  4PK1 A;  3PSE B;  4US8 A;  2L3Z A;  1V97 A;  2ZNV C;  2D11 A;  2J0J A;  1LQB A;  2Q5W D;  3CIR B;  1TIF A;  2LVO A;  1H4R A;  2GBN A;  4B95 A;  1PDX A;  2NTT A;  1XLN A;  3I57 A;  2KN4 A;  3R66 C;  4RM9 A;  1WX8 A;  5AZH A;  3NS1 A;  1KF6 B;  3ZLZ A;  1QOF A;  3BWU D;  3QA8 A;  3U8Z A;  3ENE A;  2IO2 B;  4PYU A;  2V3P A;  2BYT A;  4TV3 A;  1WGD A;  2JSV X;  4J3O D;  4ANW A;  2KC1 A;  2XN9 C;  2MBH A;  2A4Z A;  4YTM B;  3ML8 A;  2CHZ A;  3KVF B;  1ZGU B;  3QJZ A;  2VH1 A;  5DCN A;  1QIL A;  1XCQ L;  3VH3 B;  4EEW A;  5JXV A;  4OVU A;  1AYF A;  3L54 A;  1SGH A;  2K9X A;  3X0W A;  2DYM A;  2DWQ A;  3JSV B;  3Q8A A;  3URY A;  3C19 A;  3PVL A;  2KTR A;  4IKG A;  1SE3 A;  2QSD A;  1B9R A;  3CF6 E;  3NZU A;  2D5G A;  5GXG B;  4KGS A;  5BYQ A;  1WXS A;  3A4R A;  2ZVN A;  1S3S G;  1TKY A;  1WXQ A;  1XF5 L;  2LGY A;  2KDM A;  4M8N A;  3MFG A;  1SIJ A;  4G3X B;  4ARC A;  3H7P A;  4KVG B;  4IUM B;  3AE6 B;  2RDB C;  1XXG A;  2NPT A;  1E8W A;  1FD6 A;  2IZV B;  1YJ1 A;  2LHD A;  2LZ6 A;  2MA9 B;  3IFW B;  4AQ7 A;  5BYR A;  4LLG M;  3DPD A;  3KUZ A;  3PLV A;  2PMV A;  2BYF A;  1L0V B;  2AX5 A;  1VCB A;  5IP4 D;  4G50 A;  3EFU A;  4MGI E;  2CU1 A;  3ALB A;  5AZG A;  5E6O A;  1GG3 A;  3AE4 B;  4KGR A;  4R3D A;  1MI0 A;  2W55 A;  1EM7 A; 
#chains in the Genus database with same CATH homology
 3L0W B;  4AJY B;  2NBV B;  3H7P B;  4KIK A;  4BBN F;  1WE7 A;  4ANU A;  4ZDV A;  3MTN B;  1XQQ A;  2JZZ A;  2NPT B;  3LDZ E;  2K6Q A;  2KN5 A;  4CO7 A;  3BY4 B;  2RR9 A;  1V9J A;  1V6E A;  1BT0 A;  1WJ4 A;  2L0F A;  2C5L C;  2KK8 A;  2PE6 B;  3PRE A;  2K39 A;  2REX A;  1Y8R C;  5CTR C;  1V86 A;  2K6D B;  3N3K B;  2G4D B;  3ZIM A;  2GBM A;  2JY6 A;  2JUO A;  2JZ3 B;  2L0T A;  2MWS B;  3CMM B;  3DBR I;  2BYV E;  5G55 A;  4ZRJ A;  2M0X A;  2ZVO A;  2ZCC A;  3JSV A;  3QCA A;  2FIF A;  3VFK A;  3P2B A;  4JLC A;  4ZYN A;  4WWP A;  3TMP B;  5FR6 A;  2EKE C;  2C60 A;  2KJ6 A;  2V4L A;  3ZVV A;  4BFR A;  3V6E B;  4IWO A;  1WGH A;  1WH3 A;  5HKH A;  2M4N A;  4B9K A;  1YQB A;  2ZPY A;  2G45 B;  3QAR A;  2D3G A;  4M8M A;  4PS3 A;  3RUI B;  3WAP A;  3HK0 A;  2ZCB A;  1SIF A;  2Z59 B;  3CST A;  3TIX A;  3DVG Y;  2HD5 B;  2KNB A;  1YX6 B;  3SU8 X;  2HE7 A;  2MBB B;  5JHB A;  2LGD A;  3L16 A;  4HXD A;  2EMT A;  2QHO A;  4YL8 A;  4KIK B;  4W9D A;  4BVU C;  2Y5B B;  2FCS A;  3MHS D;  4PS7 A;  5BO4 B;  3VAW A;  4AP4 C;  1Q0W B;  2D07 B;  1IPG A;  2PE9 A;  4JGH B;  4ZRK A;  1TTN A;  2L00 B;  4HJK A;  4P7I A;  2KX0 A;  4I6L B;  3DBS A;  3NY5 A;  4II2 B;  4WWN A;  4DXA B;  3WA0 A;  3HHM A;  5LXH A;  2WX0 A;  3VUX A;  4GIV A;  5J18 A;  2UYZ B;  2I1J A;  5KHQ A;  2L8J A;  4NPN A;  5J17 A;  2DAF A;  2NBU A;  2FCN A;  3NZS A;  2BGF A;  2MW5 A;  3K9O B;  5CHF A;  3RCZ A;  4URK A;  3PS6 A;  4GSW A;  4HWI B;  2DYO A;  4EUT A;  3A33 B;  1WZ0 A;  4MGZ E;  3DCG A;  2PPH A;  3JVZ X;  4NJ6 A;  2KDE B;  1XD3 B;  3ZDM C;  2DX5 B;  2FCM A;  2N1W A;  3L17 A;  2VRR B;  2LUE A;  2DHZ A;  1UH6 A;  1E7V A;  1EO6 A;  2WYQ A;  1YIW A;  3CSF A;  2CKH B;  2LWP A;  2KLC A;  2N9X A;  1M94 A;  3OJ4 B;  4A3O A;  1L7Y A;  2AYO B;  3U7D A;  2NBW B;  2MLB A;  1MG8 A;  2J0K A;  5JH5 C;  1E5W A;  3QC8 B;  3WIM A;  3VUY A;  3AI5 A;  2MQJ A;  4KDI C;  4GN1 A;  3KH0 A;  2D10 A;  2KQS A;  3ZNG C;  4GDL B;  4K7S A;  1RLF A;  3L10 B;  3OAW A;  4DK5 A;  2MCN B;  3ZRF A;  1RFA A;  2MBO A;  2N7E A;  2OOB B;  1YX5 B;  1G6J A;  2JVC A;  5L95 C;  3X23 A;  2RD0 A;  3RT3 B;  3PRZ A;  2K8C A;  4MH0 E;  2YVC A;  4ZRI A;  2KVR A;  1K8R B;  1QZE A;  1UGM A;  2V3S A;  1P1A A;  2CHW A;  1E8Z A;  2MBQ A;  3L08 A;  3O65 B;  3A9K A;  2J0M A;  4EKU A;  3AU4 A;  1LXD A;  2KWV B;  1Q5W B;  4HPM B;  3VH4 B;  2GMI C;  2K1F A;  1V49 A;  3U30 A;  2YLM A;  1JRU A;  4N9F 4;  3ZW3 A;  2G4S A;  3UQA A;  3A4S C;  4TQ0 A;  4HCN B;  1A5R A;  5CX3 A;  3ZO5 B;  3NS8 A;  3PT2 B;  1D3Z A;  2HTH A;  4HPL B;  2GBK A;  3PV1 A;  4GMV A;  2KDF B;  4W9E A;  3HM3 A;  4FUL A;  3ZNZ B;  1KOT A;  2RGF A;  4BOS C;  2FNJ B;  1WGY A;  2K25 A;  3KUD B;  1WJU A;  4KZ0 A;  2FAZ A;  5C23 A;  4XZ4 A;  5DPT A;  2ZNV B;  1KM7 A;  1E7U A;  5G2N A;  4WAA A;  2JWZ A;  4W9J A;  4FHK A;  2KWC A;  3M62 B;  3PRM B;  5D2M B;  4EZJ A;  3IVF A;  3TL5 A;  2IY1 B;  4W9H A;  1EF1 A;  4LDT B;  3NOB A;  1L2N A;  4WJO A;  3UF8 A;  3JW0 X;  1WJN A;  5CHW A;  2CHX A;  3T8M A;  4GB9 A;  1WFY A;  3DVG X;  2JXX A;  4AUQ C;  1J8C A;  1UBQ A;  4XX5 A;  3ECI A;  4BKS A;  2DEN B;  1V81 A;  3R3M A;  4MEL A;  2JRH A;  3V62 A;  4E3C A;  5E6N A;  2KJR A;  3LJ3 A;  2DYB A;  2XK5 A;  4FJV B;  2RSU A;  2ZZP B;  4KDL B;  1EF5 A;  4ICV A;  3A9K B;  2Z0E B;  3Q3F A;  3RD2 A;  1LFD A;  2L7R A;  1F9J A;  3HM6 X;  4BKS D;  1ISN A;  4RM8 A;  2UWQ A;  2NVU I;  1P0R A;  3OJ3 A;  3VQI A;  1P3Q U;  2KDB A;  4I6N B;  4HDO A;  1NI2 A;  1OEY A;  3SDL C;  2KOX A;  2BWF A;  5AZF A;  2FUH B;  2DZK A;  1TGZ B;  4K7W A;  2C7N B;  1ZKH A;  2IO0 B;  5DPW A;  4TKN A;  4OVV A;  4DHJ D;  3H1U A;  4JIO U;  4NQL B;  3VHT C;  1WM3 A;  5E6P A;  1V2Y A;  3GZN I;  3B08 A;  2LRU A;  1UD7 A;  2C9W B;  2OJR A;  3UGB B;  2PEA A;  2DAJ A;  4GDL A;  3QK0 A;  3NHE B;  3KUC B;  3W1S A;  2BYE A;  1T0Y A;  4MGY E;  3PTF C;  1UZX B;  1UEL A;  1SE9 A;  3RZF A;  3JYU A;  2KTF A;  3K9P B;  4X57 B;  5TR5 A;  1GJZ A;  2LAS A;  4GU2 A;  4MSQ B;  4F8C B;  2AL6 A;  3I3T B;  4AWJ A;  3HIZ A;  4GXB A;  4MSM B;  3S2A A;  2XK5 B;  4A20 A;  3ZNI D;  4RMA A;  1WR1 A;  3R7Q A;  4BKG A;  4W9C A;  2AL3 A;  1R4M I;  1C3T A;  4XC2 A;  5L83 A;  1WF9 A;  3UIO B;  3WAL A;  1E8X A;  3PZD A;  4JL9 A;  2DZI A;  2KHW B;  1FXT B;  1RAX A;  1OQY A;  4I6P A;  4LJP B;  3QHT A;  3DBH I;  2LXC A;  1P9D U;  3PPA A;  2KFK A;  3EEC A;  1NDD A;  3PLU A;  4GOC A;  2IO3 B;  4GGQ A;  4M0W B;  3TCA A;  5JHA A;  2KJH B;  4DDG D;  3H7S A;  4MGK E;  1WX7 A;  3KYD D;  1WYW B;  1V5T A;  1WZ3 A;  3V6C B;  2AWT A;  2KAN A;  4IM2 A;  2KXJ A;  2AEH A;  2NR2 A;  2WDT B;  1KLV A;  2MRP A;  2KQ7 A;  4AJW A;  3VDZ A;  4TUU A;  4G0N B;  4FJZ A;  1TZ1 A;  1S1Q B;  2K8B A;  2KMC A;  5D6J B;  3VTV A;  4MDK E;  4FHJ A;  3TJP A;  4MEM A;  2R2O A;  3PHW B;  4NAW A;  4EOY A;  4DDI D;  4BKT A;  1WIA A;  2JPH A;  3PHX B;  2XBB C;  2XEW A;  3RZW C;  5LLI A;  3A9J A;  2LXA A;  2LGX A;  3IG3 A;  1H8C A;  4IWQ A;  4B6W A;  2R2Q A;  3GOE A;  1I35 A;  4K81 A;  3ZNH B;  1OGW A;  3B0A A;  4J6I A;  2LD9 A;  1WGG A;  4ANX A;  1VD2 A;  1YD8 U;  3V60 A;  4IM3 A;  3W1Y A;  3APC A;  2KFK B;  4II3 B;  3ZUN A;  4LJO B;  1WY8 A;  3DOW A;  2ZPN A;  2KFJ A;  2PJH A;  3M95 A;  4WQO B;  4DBG A;  1WJ6 A;  1GNU A;  2MP2 A;  1WRD B;  4KSK C;  3R7R A;  2JRI B;  4BOZ B;  3DVN U;  4WJQ A;  5EDS A;  4IC7 B;  4NJ7 A;  5IAA C;  5C1Z A;  3W1S C;  5D7G A;  1PQS A;  2ZJD A;  2IBI B;  3WAO A;  4W9L A;  2GBR A;  2N9P C;  5J2R A;  4MJS A;  1Z2M A;  1UBI A;  2FCQ A;  2A5U A;  2NCN A;  1OTR B;  4WWO A;  4NAW B;  1E90 A;  3IHP C;  2W9N A;  4W9G A;  5CHV C;  1WE6 A;  4EZK A;  3AXC A;  2GBJ A;  3N32 A;  3A9J B;  2BKF A;  1HE8 A;  2JF5 A;  2M1M A;  3Q3J A;  2M8S A;  3V61 A;  4MM3 A;  4GDK A;  4CHK A;  2Z0D B;  4KV2 A;  2KZR A;  3VTU A;  4ANV A;  2DZJ A;  2GOW A;  3VTW A;  1NBF C;  3H6N A;  2BF8 B;  1WMH A;  5GMV A;  1U4A A;  2O2V A;  3VUW A;  3PSE B;  2IYD B;  4EZL A;  3L13 A;  2L3Z A;  3PGE A;  1WM2 A;  2ZNV C;  1Z5S B;  1WXV A;  2D11 A;  4EFO A;  3QAQ A;  2V1Y A;  2D2Q A;  3RUL A;  2J0J A;  2MP2 B;  4TQ1 A;  1LQB A;  3N30 A;  3SHQ A;  4NNJ B;  2DZM A;  2ZEQ A;  5DPR A;  2LJ5 A;  2J7Q B;  2MX2 A;  1AAR A;  4IW0 A;  3UQB A;  2LVO A;  1H4R A;  3AUL A;  3APF A;  1ZW7 A;  2GBN A;  3ML9 A;  2C7M B;  3ZKJ C;  4HDQ A;  4W9K A;  1J19 A;  4B95 A;  2KX3 A;  1WX9 A;  1WGR A;  4IM0 A;  1P98 A;  2O6V A;  3PRP B;  3R66 C;  4RM9 A;  2LVQ A;  1WX8 A;  3M63 B;  5AZH A;  4HVB A;  4W9I A;  3ZTD A;  4FAD A;  3UIP B;  2FID A;  3ZLZ A;  3EC8 A;  4MJS B;  3QA8 A;  1TBE A;  2G3Q B;  3U8Z A;  3ZTC A;  3ENE A;  2JT4 B;  2IO2 B;  4PYU A;  2O6V D;  5IA7 A;  2KC2 A;  3DVN V;  2N7D A;  1WXA A;  2B3A A;  1KJT A;  2N1V A;  3SD5 A;  2BKR B;  1CMX B;  4TV3 A;  3ZDT A;  3T9L A;  5LXI B;  1WGD A;  4GDK B;  5KHO A;  2CS4 A;  4AOF A;  4ANW A;  4WJP A;  1X1M A;  4FA6 A;  2KC1 A;  2MBH A;  2A4Z A;  3B1L X;  1WXM A;  4E71 A;  2RPQ A;  3ML8 A;  1J0G A;  1GC6 A;  1XT9 B;  1WMH B;  2CHZ A;  3KVF B;  1ZGU B;  2LVP A;  2O2V B;  1IP9 A;  3QJZ A;  4DHJ B;  5D94 A;  3QQ8 B;  5DCN A;  2LI5 A;  1EUV B;  4NY0 A;  3VH3 B;  4A3P A;  4EEW A;  3H9D A;  4OVU A;  3WAM A;  1E8Y A;  3L54 A;  1SGH A;  3X0W A;  1V5O A;  2DYM A;  5JZE B;  3QX1 A;  3JSV B;  3DQV A;  3OLM D;  4FLH A;  2I1K A;  1Q1O A;  2MBE A;  3PVL A;  3VVW B;  1WR6 E;  2KTR A;  3CF6 E;  1RRB A;  3NZU A;  4IWP A;  2O6V B;  3UIN B;  1I42 A;  1WXS A;  3A4R A;  3ONS A;  4WJN A;  4HK2 A;  2WX1 A;  3ZRC A;  3A1Q A;  4PYZ A;  2ZVN A;  4CYE A;  4KSL C;  1R4N I;  1S3S G;  3IBE A;  3QIJ A;  1GUA B;  2LGY A;  3KW5 B;  3KYC D;  2L76 A;  3AU5 A;  2MSE D;  3DBL I;  3MJW A;  4JQW C;  1LM8 B;  1V80 A;  4M8N A;  2M17 A;  4ASW C;  4G3X B;  1GC7 A;  4DWF A;  3H7P A;  3C0R B;  4KVG B;  4FBJ B;  4IUM B;  2NPT A;  2KO3 A;  1E8W A;  1IYF A;  2C7H A;  2IZV B;  4G11 A;  1OEY J;  2BPS A;  2NS5 A;  4HCP B;  1YJ1 A;  2L05 A;  2MA9 B;  2LZ6 A;  3D32 A;  3IFW B;  2ASQ A;  4KZC A;  4W9F A;  2K8H A;  2KLG A;  5AEK B;  4DHZ E;  2KDI A;  3DPD A;  2KD0 A;  3KUZ A;  3RYT A;  1C1Y B;  3PLV A;  4NQK E;  2LRW A;  4LDT D;  2CR5 A;  2BWE S;  2WWZ A;  2BYF A;  4FN2 A;  2EMS A;  2N9E B;  2KWU B;  2HJ8 A;  2KMA A;  1WI0 A;  1VCB A;  2IY0 B;  4G50 A;  3TBL D;  4LCD E;  2KTR B;  4E74 A;  3EFU A;  3QWZ B;  4ICU A;  5DPS A;  4K1R B;  3APD A;  4MGI E;  2N4F A;  4F1S A;  3BIN A;  2CU1 A;  3DDC B;  3ALB A;  3A1Q B;  5AZG A;  5E6O A;  1GG3 A;  2IO1 B;  3M3J A;  4HLE A;  4BBN C;  4IG7 B;  4DHZ B;  4FJY A;  3EHV A;  3WAN A;  4PS8 A;  3VXW A;  2KKC A;  4K7U A;  4F7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...