1RLFA

Structure determination of the ras-binding domain of the ral-specific guanine nucleotide exchange factor rlf, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
b'GSSDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEFELVQLLPGDRELTIPHSANVFYAMDGASHDFLLRQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RLF
publication title Structure determination of the Ras-binding domain of the Ral-specific guanine nucleotide exchange factor Rlf.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction protein
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1rlfA00
3D32A 1Z2MA 2MX2A 4MJSB 3ZVVA 4I6NB 1WMHB 3APFA 1E7VA 3ZNGC 1Q1OA 1WGGA 1C1YB 5E6PA 2CS4A 2DYMA 5DPSA 2FIDA 1PQSA 3DBSA 2BPSA 2JT4B 2JZ3B 2LXAA 4KDLB 5J2RA 2OJRA 3CSTA 3N3KB 3NY5A 3UF8A 4RM9A 1R4NI 1WE7A 2LI5A 2KTRA 3A9KA 3M95A 3DVGY 4BKTA 1WR6E 2KLGA 3A9JA 3UQAA 2HE7A 4IC7B 4DHZB 2Z0DB 3C0RB 1GC6A 1UH6A 2ZZPB 1XQQA 1WM3A 1E8XA 4A20A 4KSLC 2RD0A 2VRRB 2PE6B 4GMVA 4PS7A 4HWIB 1E7UA 2LRUA 4ZRJA 4FHKA 4W9HA 4I6PA 1OEYJ 1SIFA 4WJQA 1KOTA 2FCNA 2IBIB 2Z0EB 3Q3FA 1V6EA 3PLVA 4FLHA 4WQOB 3VTVA 3ZNZB 2HD5B 3CSFA 2L05A 2WX0A 2BWFA 3HK0A 2DZJA 2KFJA 2ASQA 2KQSA 1BT0A 2K6QA 4ICVA 4FBJB 3WANA 3PVLA 5BO4B 1WYWB 4FJVB 4BVUC 4HCPB 3N30A 1YIWA 1L7YA 4MEMA 2W9NA 4GGQA 4HDQA 4NAWA 4WWOA 5C23A 5C1ZA 3QC8B 3B08A 2AL6A 2BYFA 1V5TA 4HXDA 4ICUA 4MSQB 2N7EA 2EMTA 4HK2A 3VDZA 1A5RA 1RFAA 4GB9A 2KJ6A 3BINA 2D11A 4GIVA 2FNJB 2J0JA 2NBWB 1YX6B 3H1UA 5AZFA 2C5LC 2GOWA 2L8JA 2UWQA 2FIFA 2L0TA 4EOYA 4DK5A 1D3ZA 4BFRA 2MQJA 4EZKA 2L76A 1IP9A 1AARA 1FXTB 3RZFA 3PSEB 1UBQA 2N1VA 3KUZA 3U7DA 1WGRA 4WWPA 4A3PA 3KYDD 1R4MI 3JSVA 2DENB 2KANA 4XX5A 3KW5B 2KKCA 3R7QA 2KWUB 2KLCA 3JSVB 2BWES 3WAPA 1NDDA 2LVOA 2KFKA 1WX9A 3DOWA 1P1AA 4G0NB 2JRHA 2DYOA 3KH0A 2DAFA 2KFKB 4EFOA 2HJ8A 4II3B 2N9PC 3AI5A 4BBNC 5LXHA 2RGFA 4M8MA 1IYFA 1WH3A 4ANWA 4W9IA 3TL5A 2NR2A 2NBVB 4M0WB 3EHVA 2I1KA 5CTRC 3PZDA 2MA9B 3OLMD 5LLIA 3U8ZA 4DHJD 2K25A 3S2AA 2YVCA 1V49A 1WI0A 2M17A 3V62A 2JF5A 1H8CA 2AEHA 4I6LB 1GC7A 4NY0A 2DZMA 2XBBC 4TQ0A 2KX0A 3IFWB 3IBEA 2O2VA 1P0RA 1KJTA 3JVZX 3O65B 4E74A 5JHAA 4NQKE 5E6NA 4CYEA 4IW0A 4ASWC 2LXCA 5EDSA 1GG3A 1SGHA 2O2VB 3LJ3A 2MBBB 4HDOA 5GMVA 4DXAB 5L83A 2G45B 3EECA 1H4RA 2YLMA 1XD3B 2DAJA 3WIMA 4W9DA 3TJPA 1CMXB 3ZLZA 1WGYA 2KX3A 1E8ZA 4IUMB 1RRBA 2N7DA 5JHBA 1UZXB 1WRDB 1E8YA 3A4RA 3KYCD 3ZUNA 2G4SA 4ZRIA 3OAWA 4W9JA 3X0WA 1EF5A 4EEWA 1OTRB 4MH0E 3NS8A 3NZUA 2K39A 3L13A 1HE8A 3AU4A 2KHWB 3A9KB 2KTRB 2Z59B 2NS5A 5TR5A 2KDFB 3QIJA 3A9JB 3AULA 3DPDA 2CHZA 4LCDE 1TZ1A 2FCSA 2ZVNA 3IVFA 3LDZE 4K7WA 2KC1A 1OQYA 1X1MA 5AZHA 4F7ZA 4DWFA 2DHZA 4AP4C 1I35A 3HM3A 3PRMB 2G4DB 5D2MB 2KD0A 2O6VA 2BGFA 2PJHA 3DBRI 3QHTA 1L2NA 4W9GA 3VUYA 2AYOB 4GOCA 2G3QB 2KMAA 1YQBA 2D07B 2GBKA 3H6NA 4IWPA 2CHWA 4GSWA 4W9LA 3NHEB 1WXMA 3WAMA 2KJRA 1E90A 4HPMB 2XK5A 5L95C 3L08A 2LGDA 1UELA 4DDID 1XT9B 4MM3A 4DHZE 2XK5B 3ZNHB 1IPGA 1WM2A 2WDTB 2J0MA 3RUIB 2BYVE 2DZKA 2KQ7A 4BKSA 3GZNI 1S1QB 3UGBB 4AWJA 1WY8A 2WYQA 3SDLC 1WXAA 1SE9A 2C9WB 2LUEA 3RT3B 3ZRCA 1V9JA 5G2NA 1Y8RC 2N4FA 3ZIMA 3DQVA 2KDIA 3W1SC 5FR6A 2FCMA 4NAWB 3PT2B 2C60A 3PPAA 3OJ3A 4EKUA 4TKNA 3RYTA 3T9LA 2NVUI 3VTUA 2KN5A 3H7SA 2LZ6A 1TGZB 5KHOA 3SD5A 1QZEA 4G50A 1NI2A 3RCZA 5DCNA 2CU1A 5J18A 3QQ8B 2KK8A 3QJZA 3TMPB 1UBIA 2L7RA 3AU5A 4IM0A 4IWQA 3QARA 2ZNVC 4XC2A 4IM3A 3ZNID 1ZW7A 2M0XA 2MBQA 3DCGA 3L10B 2D10A 4WJNA 2R2OA 2D2QA 3APCA 2JUOA 2ZCCA 3ZO5B 2DYBA 3ZDTA 2MSED 4KVGB 3WA0A 3QA8A 2EMSA 3V6CB 3DDCB 3PRZA 1OEYA 1WFYA 5IAAC 4KDIC 3PGEA 4GDKA 4WJOA 2V3SA 5LXIB 1J19A 1Z5SB 4W9CA 3WALA 1VCBA 2FAZA 2RPQA 3R66C 1WF9A 4IM2A 3PRPB 4NJ7A 4FJYA 3ML9A 2LGXA 4NPNA 3PS6A 4K7SA 1E8WA 3TIXA 1P9DU 5D6JB 2LD9A 4AUQC 1WIAA 4PYZA 4YL8A 3V60A 1GJZA 4HCNB 5DPWA 3H9DA 2BF8B 2IYDB 1EO6A 3M62B 4ZRKA 1VD2A 3B1LX 3VQIA 1TTNA 1V86A 3QWZB 4X57B 5CHWA 3KUCB 4BKGA 3CMMB 3ZW3A 2KMCA 2GMIC 1ZKHA 3HM6X 1EF1A 4CHKA 1RLFA 2JPHA 4B6WA 3DBLI 3ZRFA 1LM8B 4GDLA 3TBLD 2DZIA 2KC2A 1Q0WB 4M8NA 2KDBA 4K7UA 2ZPYA 2IZVB 2K8HA 3W1YA 4B9KA 3H7PA 3VUXA 1WJ4A 4IG7B 2L3ZA 4RM8A 2NCNA 4A3OA 4PS8A 1WX8A 3U30A 1UD7A 1ZGUB 1WE6A 2CHXA 4PS3A 5E6OA 3W1SA 1S3SG 2IO1B 4FADA 5KHQA 3KUDB 2KJHB 2MBHA 2GBRA 4JQWC 2AWTA 4MGIE 3VTWA 1KM7A 2JY6A 4WJPA 4HJKA 2WWZA 2KXJA 2K8CA 2IO0B 4HVBA 1UGMA 4FA6A 4W9EA 3IHPC 4N9F4 4JGHB 3EC8A 3TCAA 1WJ6A 2KO3A 4NNJB 4OVUA 4URKA 3RULA 4WAAA 5CHFA 3A4SC 4KSKC 2CR5A 2RSUA 2Y5BB 4MJSA 4KIKA 1G6JA 4ANVA 4EZJA 3ENEA 3ONSA 3PREA 2RR9A 3UINB 4IWOA 4AOFA 2ZCBA 2ZVOA 3GOEA 3M63B 4KIKB 3K9PB 2M4NA 2PE9A 3ML8A 1WGHA 5HKHA 4OVVA 3WAOA 2O6VD 1WJNA 2C7HA 2PEAA 1V81A 1J0GA 2ZPNA 3PLUA 3PTFC 2ZEQA 2LWPA 3HIZA 2MRPA 3JYUA 4P7IA 2FCQA 2MCNB 2HTHA 2IY0B 3R3MA 3BY4B 1WXVA 2BYEA 2O6VB 3CF6E 4W9KA 2K6DB 4BOSC 4FULA 4J6IA 5G55A 2GBNA 3L17A 3B0AA 3V6EB 2MW5A 3L54A 4FN2A 4BKSD 4RMAA 1JRUA 4BBNF 2UYZB 5AZGA 1WZ3A 3Q3JA 3P2BA 2KTFA 2MWSB 1V80A 2EKEC 2MLBA 2J7QB 3RZWC 4ANUA 3VUWA 5D94A 4KZCA 3VFKA 2N1WA 5DPTA 2LGYA 3OJ4B 1WZ0A 3NOBA 2NBUA 2QHOA 3A33B 4FHJA 2L00B 4JIOU 3T8MA 5CX3A 4E3CA 3VAWA 2IO3B 3MHSD 2AL3A 1LQBA 3DBHI 4JL9A 1TBEA 3I3TB 1WX7A 1LFDA 3V61A 1J8CA 4B95A 3KVFB 2WX1A 3L0WB 1GNUA 1M94A 4CO7A 2L0FA 2BKRB 2KOXA 3X23A 1WJUA 4EZLA 4MSMB 2JXXA 4TQ1A 4MDKE 2K8BA 2GBMA 4GU2A 1C3TA 3UIPB 2OOBB 4EUTA 2MBOA 3K9OB 3PV1A 2N9EB 2JVCA 4FJZA 3ZTCA 3HHMA 5JH5C 3DVNU 4ZDVA 3R7RA 3JW0X 3ECIA 3VVWB 2C7NB 1WR1A 3QK0A 1P3QU 2KVRA 1YX5B 4F8CB 5CHVC 2IO2B 1I42A 4PYUA 4GDKB 3RD2A 1KLVA 3ZKJC 1V2YA 2N9XA 2M8SA 2LJ5A 4MGZE 4NJ6A 4HLEA 4AJWA 2V4LA 2I1JA 3VH3B 3QAQA 3QCAA 2LVPA 3NZSA 2GBJA 3APDA 3VH4B 2KWVB 2MP2A 2JRIB 2KNBA 2R2QA 4K81A 4II2B 4LJPB 1T0YA 5JZEB 4WWNA 4K1RB 5DPRA 4GN1A 4TUUA 2MP2B 1GUAB 4MELA 5AEKB 3MTNB 3A1QA 4W9FA 4LJOB 2A5UA 2NPTA 4HPLB 4ANXA 1NBFC 2MBEA 4G3XB 3ZTDA 2C7MB 3A1QB 1F9JA 2D3GA 2NPTB 4MGKE 4DBGA 3L16A 1V5OA 1P98A 4GXBA 4KZ0A 3QX1A 2REXA 2KZRA 3AXCA 1RAXA 3VHTC 3SU8X 2V1YA 1OGWA 4GDLB 1LXDA 4JLCA 2KWCA 2LASA 2PPHA 4BOZB 2ZJDA 3H7PB 2JWZA 1U4AA 2IY1B 1YJ1A 3VXWA 3EFUA 3ZDMC 4NQLB 4F1SA 3MJWA 2BKFA 2LRWA 2FUHB 1WXSA 4TV3A 5D7GA 2LVQA 4KV2A 2KDEB 1WGDA 4XZ4A 1EUVB 2K1FA 4MGYE 4LDTD 1MG8A 3UQBA 4G11A 1ISNA 2XEWA 2DX5B 3DVNV 1K8RB 2JZZA 4DHJB 3ALBA 1YD8U 2A4ZA 2B3AA 5IA7A 3UIOB 3N32A 4ZYNA 4LDTB 4E71A 2ZNVB 2CKHB 3DVGX 3M3JA 4AJYB 5J17A 1Q5WB 3SHQA 4DDGD 1WMHA 3PHXB 3IG3A 2J0KA 3PHWB 2M1MA 1E5WA
chains in the Genus database with same CATH superfamily
3ZVVA 4OZAA 5GXGB 2ONQA 3CIRB 1HQRD 2CS4A 2DYMA 5DPSA 2FIDA 2BPSA 2N7JA 5J2RA 2LXAA 3N3KB 2H88B 1M4VA 3MP9A 2KTRA 1TKEA 1ZDXA 1WR6E 4N6EB 2KLGA 4DQOC 2HE7A 4IC7B 2ZZPB 3SR6A 3N1YC 1XQQA 4PS7A 4GMVA 3I9V1 1R4NB 4JE3B 4HRSA 4FHKA 2FCNA 2IBIB 3U4EG 1V6EA 3PLVA 2WXHA 3GB1A 4HKQA 3VTVA 1QF6A 3RNBC 2BTEA 4C7ZA 2ASQA 1BT0A 4ICVA 4FBJB 1GAQB 3PVLA 3N30A 2AQ3B 1GB4A 4M01A 2W9NA 4HDQA 4NAWA 3QC8B 3DHIC 1ZE3D 4AQ7A 2KDMA 3ZXRA 3BK1A 4C80A 4MSQB 3Q8BA 2N7EA 1RFAA 2Y5CA 2NBWB 3H1UA 1I4RA 4EOYA 3W5VB 2LGIA 4BFRA 3AE9B 2WDQB 4TSSA 1AARA 1FXTB 3Q14C 1N62A 3PSEB 4WWPA 3TEZA 3KYDD 2KANA 3JSVB 1MI0A 3KWVA 2JRHA 4C4VB 2N9PC 3AI5A 5D3IB 4BBNC 1STEA 4NZLB 1IYFA 1WH3A 2PKOA 4ANWA 4W9IA 2NR2A 3U52E 3PZDA 2MA9B 1ZDVA 3S2AA 2YVCA 5BYSA 1V49A 3PZ8A 3C8YA 1FO4A 3B2FA 4E74A 4NQKE 3IAS1 2WDRB 5L83A 4DXAB 3BZDB 5FR3A 3U2SC 3WIMA 4XWTA 3DWMA 3ZLZA 2KX3A 4N59A 2N7DA 1YN4A 1UZXB 1E8YA 3ZUNA 2G4SA 2VZKB 1EF5A 1QOBA 3NZUA 3EA6A 3Q8CA 4XWWA 3AU4A 2Z59B 1SIJA 3AH7A 5TR5A 3A9JB 2KYWA 4OW0A 2FCSA 4K7WA 2ZVNA 1T3QA 4KGTA 2DHZA 3NS1A 3P4PB 4KGRA 1FCLA 1I7HA 2PJHA 3DBRI 3N1ZC 3QHTA 1L2NA 1YQBA 2CHWA 4W9LA 1TY0A 4HPMB 4B0EA 5L95C 3L08A 1TYGB 1E6EB 4DDID 4WWMA 3ZNHB 1NYRA 4JX1C 1HTOA 2WDTB 2DZKA 3W2DA 1S1QB 3UGBB 1WY8A 2C9WB 1V9JA 1DOXA 2BB5A 2FCMA 1V97A 3H7SA 2LZ6A 3SD5A 3HVZA 5J18A 2M56B 3QJZA 3TMPB 2CJOA 1UBIA 3AU5A 1AW7A 4IM0A 4WJNA 2DYBA 3WA0A 4NJCA 4WJOA 2BVCA 3WALA 1WF9A 4NJ7A 3PS6A 4UDUC 1E8WA 1VZ8A 3NG0A 3PO0A 1WIAA 4HCNB 5DPWA 4YSXB 1VD2A 1TIFA 3VQIA 4IKGA 3QWZB 3NRZA 2KMCA 3HM6X 1OFFA 2KACA 2BYTA 2JPHA 4B6WA 1C4AA 1LM8B 3TBLD 1Q0WB 4M8NA 3H7PA 4LNOA 4A3OA 3U30A 1ZGUB 2CHXA 4PS3A 5E6OA 5KHQA 2IO1B 3KUDB 1KM7A 2JY6A 1MG4A 1JWUD 1QT9A 2H89B 4JGHB 2KO3A 4ARCA 4NNJB 4OVUA 4URKA 2PTLA 1HZ6A 4WAAA 3LXFA 2XN9C 2D3AA 2E3TA 1F0ZA 2INCC 2CR5A 1CJEA 2QC8A 3W9CB 3BVGA 3VRBB 2ZW1A 1IGDA 1JMLA 3UINB 3GOEA 2O6VD 1C4CA 3PLUA 2LWPA 1WXVA 4W9KA 1VRAB 1I4PA 1EM7A 5HHDG 2GRIA 3L17A 3B0AA 3IT6B 4C00A 3L54A 1AWDA 4M00A 3ZGZA 3P2BA 2J7QB 4FXCA 5D94A 2N1WA 3OJ4B 3A33B 3AMZA 2L00B 1P7EA 2IGDA 3DBHI 4JL9A 3GZNB 1LFDA 1J8CA 3KVFB 1NVID 4BAXA 4OZBA 4EZLA 4MSMB 1TZOA 4TQ1A 2K8BA 4GU2A 3UIPB 2HJ1A 3MFGA 3PV1A 4ARIA 2N9EB 3HHMA 3R7RA 3AM9A 3ECIA 3QK0A 1P3QU 2KVRA 4F8CB 3VR9B 2NTTA 1KLVA 5D3DA 2V4LA 2I1JA 4JPSA 3NZSA 3APDA 2MP2A 3GE8C 2V3PA 4II2B 5JZEB 5DPRA 4TUUA 4P6VF 3RNGC 4LJOB 2WNMA 2NPTB 2KZRA 3VHTC 4ZOHC 4GDLB 1PUTA 1LXDA 3AEFB 2PPHA 4BOZB 5C2TB 1K51A 2JQRB 4NQLB 1FRRA 2LVQA 1VDVA 1KF6B 2KDEB 1EUVB 2K1FA 4LDTD 1MG8A 1ISNA 1K8RB 2PVGC 4ZYNA 1PGXA 4E71A 1Q5WB 3SHQA 5IP4D 1ZXHA 2MLBA 1E5WA 2MX2A 1WYGA 2N9LA 3ZNGC 2WXOA 1YMHE 3VRAB 2JT4B 2JZ3B 1SEBD 1WE7A 3M95A 4HEA1 3DVGY 4BKTA 4REZA 2LGSA 3A9JA 2TSSA 4J3OD 1BXTA 3NVWA 1N63A 1WM3A 2PIAA 2PE6B 2LRUA 3BVMA 5AUIA 4WJQA 1DGJA 2WXQA 1VZ7A 2QIEB 1KLUD 2HD5B 3HK0A 3EFCA 2DZJA 2KFJA 2KQSA 2RDHA 2K6QA 3WANA 1RWSA 1BMLC 1WYWB 4FJVB 4HCPB 1I4GA 1L7YA 5C1ZA 4GGQA 2DLBA 2WXJA 1UUPA 2Y3AA 2UU7A 1FM0D 2W3SA 2CU3A 2M0AA 1PDXA 1YX6B 3ABVB 1KLGD 1JW9D 2C5LC 2FUG1 5AZFA 2GOWA 4C7YA 2LJIA 1HXYD 2FIFA 2L0TA 4DK5A 3AE3B 3FILB 1I4QA 1UBQA 1N60A 2N1VA 1WGRA 1JRPA 2WXRA 4CQNA 2IPKD 1FMAD 3WAPA 2ACZB 2LVOA 2KFKA 4JWUC 3NUHB 1P1AA 4G0NB 2DAFA 3H8HA 3MC0B 2JXTA 4EE2A 4P1BC 2D3BA 4MACA 4M0WB 3AEDB 2JYEA 5CTRC 3OLMD 1SJED 3I5JC 3UI3A 3U8ZA 2BS4B 2K25A 4HPPA 4PK1A 4I6LB 3NVZA 2DZMA 4TQ0A 3C19A 3BYTB 1P0RA 1KJTA 2RPVA 4CYEA 4ASWC 2PMVA 1K53A 2IJ0A 1GG3A 1SGHA 2O2VB 4HDOA 1IGCA 2I38A 2G45B 2GI9A 2DAJA 1HA5A 3AE7B 1AN8A 1YN5A 4W9DA 2WHIA 3TJPA 2WXKA 5JHBA 1WRDB 3KYCD 4ZRIA 2HDEA 4W9JA 1NI3A 4LLGM 3X0WA 3NS8A 1VLBA 2PW9A 1Q10A 2NS5A 2KDFB 2AQ1B 3AULA 3DPDA 3LDZE 1X1MA 5AZHA 1I35A 3HM3A 3PRMB 3FAHA 4YSZB 5D2MB 4LK0M 2L52A 4D2KA 3VUYA 2AYOB 2WXNA 2D07B 3H6NA 1FFVA 3NHEB 3WAMA 2AQ2B 2KJRA 1E90A 2XK5A 1MJDA 3DBRB 1SBBB 1DOIA 1IBXB 1C79A 1WM2A 2B76B 2KQ7A 4MM3B 1EU4A 2WYQA 1WXAA 1Y8RC 3AB5A 5TSSA 3ZIMA 4A55A 2KDIA 4N58A 3PT2B 2C60A 3PPAA 3OJ3A 4EKUA 3T9LA 2NVUI 3VTUA 2D5GA 4RGNA 2L32A 2MHJA 2XNAC 1QZEA 3RCZA 3QQ8B 3PZ7A 2L7RA 4IWQA 2ZNVC 4XC2A 1ET6A 4IM3A 1ZW7A 1T0QC 2D10A 2KWDA 2R2OA 2FBWB 2JUOA 3ZDTA 2OJWA 3QA8A 1TS3A 3PRZA 1OEYA 1WFYA 5IKCM 4KDIC 2V3SA 5LXIB 1J19A 1Z5SB 3AEBB 2FAZA 2RPQA 4IM2A 1GPXA 4FJYA 3I57A 3GE3C 2LGXA 4S17A 2W82A 1CZPA 1R4MB 5D6JB 2BT6A 3V60A 4PYZA 4YL8A 2IYDB 4ZRKA 4YXDB 1V86A 5CHWA 1RM6C 3KUCB 3CMMB 5IOIA 5MPOA 3ZRFA 4GDLA 2KC2A 3AE6B 4WH4A 4K7UA 4B9KA 1YN3A 2W3RA 2SEBD 4LNIA 3W1SA 2BS3B 3DHHC 3Q69A 1S3SG 1ESFA 2KJHB 2GBRA 2AWTA 3VTWA 1XLOA 4HJKA 1V8CA 4HVBA 1UGMA 4FA6A 1GB1A 1L0XB 2WXGA 4K3CA 1T0SC 3GP7A 3MC8A 2RMMA 2N0SB 1V1PB 1L4ZB 3RULA 4KSKC 4LNNA 2RSUA 3FKYA 4KIKA 1G6JA 4EZJA 3U7ZA 3PREA 2RR9A 1TJEA 2ZCBA 3ML8A 1WGHA 4OVVA 4A9AA 1V81A 2IGHA 1ZXIA 2HTHA 2IY0B 3R3MA 2QCZA 1KH0A 3MHZA 4H2AA 3V6EB 2Z8LA 2MW5A 3L4PA 2ZW0A 2UYZB 1WZ3A 3Q3JA 1F52A 1V80A 1L4DB 1ET9A 3KLSX 4KZCA 1C9FA 2LGYA 4FHJA 2QHOA 4YWGG 1LQBA 1TBEA 1WX7A 4ZHOA 1MFWA 4LNFA 1QOGA 2BKRB 1ZOYB 4MDKE 2GBMA 1MVKA 3DBHB 2MBOA 3K9OB 1MPEA 4FJZA 1SE4A 3VVWB 2C7NB 1XCTL 2LUMA 2IO2B 3LB8C 3RD2A 3FILA 3ZKJC 1KRHA 2M8SA 4NJ6A 3QCAA 2LVPA 2J52A 2JRIB 2KNBA 2R2QA 3P42A 2L1AA 4WWNA 1IUEA 3A1QA 4W9FA 1NBFC 3EGRA 3LYYA 1F9JA 2D3GA 4KZ0A 3OG5A 2ON8A 2REXA 1OGWA 2KWCA 1WGKA 4M0WA 2ZJDA 2INNE 2FUHB 4KV2A 1B1ZA 3UQBA 1MHHE 2PLPA 2XEWA 2JZZA 2A4ZA 5IA7A 2CKHB 4AJYB 2HTME 4ACFA 4XDCA 3IG3A 4O1NA 1V1OA 1Z2MA 1WMHB 4OZCA 3APFA 5T8IA 2WDVB 1C1YB 1PGAA 4IOIE 1PQSA 3DBSA 2KVZA 4KDLB 2OJRA 3NY5A 3Q8AA 5C3JB 4DXFA 2QMTA 4RM9A 2LI5A 3AE2B 1DYQA 3UQAA 2YEPB 2Z0DB 4HROA 1GC6A 1UH6A 4LTUA 4US8A 2E6XA 4KSLC 2RD0A 2VRRB 4A20A 5BMIA 1D4BA 4HWIB 1E7UA 3Q8FA 4I6PA 3MC9A 1SXTA 3RN9C 2WLBA 2J53A 3ZNZB 3J9CA 3CSFA 2L05A 2WX0A 2BWFA 2WXIA 2I2YA 1OQRA 2X38A 1RYJA 4KX6B 4BVUC 5C23A 1LGRA 3P1MA 3B08A 2AL6A 3E56A 2BYFA 1V5TA 4ICUA 2EMTA 4HK2A 2RDBC 1A5RA 2KJ6A 2D11A 4GIVA 2NTSA 4A8XC 2UWQA 3AE4B 5H92C 1D3ZA 2MQJA 5G5HA 1JWBD 3NJTA 2L76A 1IP9A 3U7DA 3JSVA 1FNVA 1N5XA 1HZ5A 3KW5B 2JX5A 2KKCA 3R7QA 4C4VA 3SFDB 3RNCC 3V3XA 2SAKA 3DOWA 3KH0A 2HJ8A 1WXQA 1J7BA 3TL5A 1E10A 2NBVB 4RGTA 1YQ3B 1TS4A 3EHVA 5LLIA 1L0VB 1TKYA 4HJGE 5BMHA 2VH1A 4DHJD 3IXSA 2M17A 3NVVA 3V62A 2JF5A 1H8CA 3Q8EA 1GC7A 4NY0A 2KX0A 3IFWB 5JHAA 3JVZX 3P4RB 2JYTA 5E6NA 1C78A 4IW0A 2MBBB 5GMVA 1H4RA 2W55A 1XD3B 1D5ZC 1CMXB 4A6QA 1WGYA 1E8ZA 4IUMB 1RRBA 1D5MC 4US9A 4RFBA 3A4RA 4L2YA 2BQQA 4R3DA 2VH2A 4GLSC 1OTRB 3AE8B 5BMGA 4WQMA 3A9KB 4RNAA 3QIJA 4LCDE 2CHZA 3N1XC 1TZ1A 2KC1A 4MH8A 1SE2A 4DWFA 2K0PA 1FPYA 2G4DB 4W9GA 2G3QB 1JWMD 5BYQA 1N6ZA 4GSWA 3RI7C 1WXMA 3HUIA 1C4PA 1QQRA 1N5WA 2LGDA 1UELA 2M19A 1IPGA 2K9XA 3BVZA 2BYVE 4BKSA 3GZNI 4AWJA 3RT3B 3ZRCA 4BZAA 2N4FA 4M02A 3W1SC 2KAJA 5FR6A 1EU3A 3B9JA 1T0RC 3RYTA 1TGZB 4RGMA 1F2RC 1RFKA 2J4XA 2V3NA 1NYQA 1VZ6A 4OHJA 3ZNID 2MBQA 3DCGA 3V05A 1QILA 3ZO5B 2IGGA 3APCA 2ZCCA 4YTNB 2MSED 4KVGB 2NMQA 3V6CB 2EMSA 4WURA 4RH6A 1D6EC 1VCBA 3PRPB 2K22A 4NPNA 1FNUA 1FFUA 5H8YE 3H9DA 3ZXVA 1EO6A 3M62B 4X57B 2GMIC 1ZKHA 3HRDD 1GOZA 1EF1A 3DBLI 2ZPYA 1UNSA 2IZVB 3W1YA 1WJ4A 2L3ZA 4RM8A 2NCNA 4PS8A 1F2RI 1UD7A 1WE6A 2DWQA 4FADA 1QOAA 4JQWC 2MBHA 4MGIE 2K8CA 4W9EA 3IHPC 3MJ5A 1PFDA 1FXAA 1WJ6A 4HKZE 1TT5B 2R61A 2EKIA 3AN1A 1SB3C 3N20C 3ENEA 3ONSA 4PT5A 4AOFA 2DBYA 3M63B 1TY2A 3B2GA 1UWMA 1FCCC 1E7PB 2M4NA 2MJEA 2FE8A 3WAOA 3AV8A 1WJNA 2C7HA 1TS2A 3T3NA 2ZEQA 3HIZA 2MCNB 2MRPA 4K3BA 2FCQA 4P7IA 3TSSA 2G1EA 3BY4B 2O6VB 3CF6E 1DOYA 1L0YB 2K6DB 2GB1A 4BOSC 4FULA 1KFYB 1PYWD 1LO5D 2GBNA 4RMAA 2OEDA 1JRUA 4BBNF 2MEKA 5AZGA 2MWSB 1HEZE 5FKAC 5E6JA 1XF5L 5DPTA 4JIOU 4A90A 1WZ0A 3T8MA 4KKIA 2WGSA 3VAWA 2LHDA 3I3TB 3V61A 4B95A 2WX1A 1B9RA 1GNUA 1M94A 2L0FA 4IDIA 2G9HD 2KOXA 3X23A 3Q6BA 2JXXA 1JALA 2OOBB 3RMKC 4ZDVA 3JW0X 1C77A 3IAM1 3EUB2 1YX5B 1I42A 1PGBA 1F1HA 4GDKB 3ZJVA 3Q3MC 4MGZE 5EE1A 3VH3B 5I4DA 4P16A 2GBJA 4K81A 1T0YA 3BIID 5G5GA 3TEXA 3P63A 2MP2B 2INDC 5AEKB 3MTNB 2NPTA 4HPLB 4ANXA 5EE3A 2MBEA 3ZTDA 4MGKE 4DBGA 3L16A 1P98A 3QX1A 3GS2A 1XXGA 1XLPA 2BW2A 1RAXA 2V1YA 3FC4A 3ZJTA 1CQVA 1ENFA 2AX5A 5JXVA 4YT0B 2EELA 2BS2B 2WP9B 2JWZA 3RNEC 3ZDMC 3HVDA 1R7SA 4F1SA 3MJWA 1JCKB 2LRWA 1WXSA 4B0MA 4KKJA 2QDFA 2RDGA 1WGDA 4XZ4A 3ETRA 3CWIA 4G11A 3P4QB 3DVNV 4DHJB 3ALBA 2B3AA 4RGOS 4LDTB 1ZPSA 3DVGX 2K5PA 5HI1A 5J17A 4DDGD 2J0KA 3ZQ4A 2M1MA 5JH5C 3D32A 4MJSB 4I6NB 1E7VA 2MJ3A 1Q1OA 1WGGA 5E6PA 4C56C 3CSTA 5BYRA 3UF8A 2LFIA 1R4NI 3A9KA 4DHZB 3I63C 3WCQA 3C0RB 1E8XA 1JROA 1UGJA 3R2TA 4ZRJA 4W9HA 1OEYJ 1SIFA 1XLNA 1KOTA 3TEYA 2Z0EB 3Q3FA 4FLHA 4WQOB 2QILA 4YSYB 1QKZA 4L1BA 1NEKB 1XCQL 5BO4B 2LEKA 1JWSD 1YIWA 5FK9C 3Q3NC 4MEMA 4WWOA 2JU6X 5HFYA 4HXDA 2KQ4X 3VDZA 4GB9A 1WSPA 3BINA 2FNJB 2J0JA 4QAYA 1SF0A 2L8JA 3KQ4A 1JWAD 3BK2A 5AUKA 3BWUD 4EZKA 5IN7A 1FIQA 3RZFA 4DXGA 3KUZA 4A3PA 1D5XC 1R4MI 4P1CC 2DENB 4L23A 1MHXA 3IT4B 4XX5A 2KWUB 2KLCA 2BWES 4OVZA 1NDDA 1WRIA 3AE5B 1WX9A 2DYOA 4LNKA 2KFKB 3R8BA 4EFOA 4II3B 4RF0A 3Q2AC 5LXHA 2RGFA 4M8MA 2INPE 2J42A 3ZYYX 4KGSA 2I1KA 3TEWA 4WIPA 1SSNA 1WI0A 2WXMA 3AEAB 2AEHA 1J7CA 2XBBC 3IBEA 2O2VA 3O65B 2BBCA 2LXCA 5EDSA 3LJ3A 4AS1A 3EECA 2YLMA 2WU2B 1NENB 1XLQA 2Q5WD 3OAWA 4EEWA 4MH0E 2K39A 3L13A 1HE8A 2KHWB 2KTRB 1SE3A 3IVFA 3OWEB 1OQYA 4F7ZA 2YEPF 1K52A 4AP4C 1SJHD 5HG2A 4ZYSA 2KD0A 2O6VA 2BGFA 4GOCA 2KMAA 4IWPA 2GBKA 2QJLA 1BUIC 4S0RA 1IBXA 1FD6A 3NZ3A 4DHZE 1XT9B 3R2IA 4MM3A 2XK5B 1YNTE 5LNK1 2J0MA 1I4HA 3RNAC 3RUIB 1T6BX 3SDLC 2ICIA 1SE9A 2LUEA 1I4XA 5G2NA 1UWXA 3SEBA 3DQVA 4NAWB 3DWGC 4TKNA 2KN5A 4WAFA 5KHOA 4G50A 1NI2A 5DCNA 2CU1A 4RCOA 1QOFA 2KK8A 5EE0A 3QARA 2M0XA 3L10B 1ACCA 2D2QA 2MH7A 1XO3A 3DDCB 5IAAC 3PGEA 3AEGB 4GDKA 2BB6A 4W9CA 3R66C 2WXPA 3ML9A 4K7SA 1OQQA 2K3UA 1YJIA 3TIXA 2IDYA 3AE1B 2JSVX 1P9DU 4AUQC 2LD9A 1GJZA 2WXLA 1L6VA 2BF8B 2KT7A 2V0GA 1HTQA 3B1LX 1TTNA 4BKGA 3ZW3A 1FXIA 2DNFA 2GLSA 4CHKA 4XGAB 1RLFA 2WU5B 4USAA 2DZIA 3URYA 2CJNA 2KDBA 1JQ4A 2K8HA 1EWCA 3VUXA 4IG7B 1WX8A 1P7FA 3VR8B 4ZHPA 1VR9A 3DBLB 4JWSC 1E9MA 4WJPA 2WWZA 2KXJA 2IO0B 1VJKA 1E0ZA 2KN4A 1TS5A 4XDDA 4N9F4 5EE9A 3EC8A 2VZKD 3TCAA 2JWUA 1V1PA 1L6UA 2LMCA 5CHFA 3A4SC 2N9KA 2JZPA 2Y5BB 4MJSA 4ANVA 3BYYB 4IWOA 2WS3B 2ZVOA 4KIKB 3K9PB 2PE9A 5HKHA 2D3CA 1YJJA 1N61A 2PEAA 1J0GA 2ZPNA 3PTFC 4YTPB 3E9SA 3JYUA 1FNWA 3NVYA 2BYEA 4J6IA 5G55A 3O13A 4FN2A 4BKSD 3SFEB 2WQYB 2KTFA 4NAMA 2EKEC 3RZWC 1L5PA 4ANUA 3VUWA 3VFKA 3NOBA 2NBUA 1ZP0B 2WXFA 5CX3A 4E3CA 2IO3B 3MHSD 2AL3A 2MJDA 3RFZB 2V4IB 3L0WB 3AEEB 4CO7A 1WJUA 2KMMA 2PVOD 1C3TA 4EUTA 4ZRQA 2JVCA 3ZTCA 3ZJUA 3DVNU 3Q3OC 1WR1A 2V9HA 3RPFC 1TKGA 1YOVB 5CHVC 1ZUD2 2QEJC 4PYUA 4ITKA 2QSDA 3W5UB 1FRDA 1V2YA 2N9XA 2LJ5A 4HLEA 4XYCA 4AJWA 1QLBB 3QAQA 3VH4B 2KWVB 3RNFC 4ZRPA 1KTKA 1K50A 4LJPB 4K1RB 3TUOA 4GN1A 3AECB 3P4SB 1GUAB 4MELA 4Q2JA 1J7AA 2A5UA 2W54A 2X8XX 4G3XB 1UF0A 2C7MB 3A1QB 1CK1A 1EWYC 1V5OA 4GXBA 3KWLA 3AXCA 2OHFA 3SU8X 1ROEA 4JLCA 1Y56A 2LASA 2Y5PA 3H7PB 1U4AA 1WWTA 2IY1B 1YJ1A 3VXWA 3EFUA 3T3OA 1F77A 1YQ4B 2BKFA 4TV3A 1AYFA 5D7GA 5IO9A 1A70A 4MGYE 1T5XD 1C76A 4RF1A 3DHGC 2DX5B 1FEHA 2LHEA 2L83A 4MT5A 4XE0A 1YD8U 3UIOB 3N32A 1XEEA 3N9YC 2ZNVB 3M3JA 4TMAB 1WMHA 3PHXB 4YTMB 3PHWB
chains in the Genus database with same CATH topology
3D32A 1Z2MA 2MX2A 4MJSB 3ZVVA 4I6NB 1WMHB 3APFA 1E7VA 3ZNGC 1Q1OA 1WGGA 1C1YB 5E6PA 2CS4A 2DYMA 5DPSA 2FIDA 1PQSA 3DBSA 2BPSA 2JT4B 2JZ3B 2LXAA 4KDLB 5J2RA 2OJRA 3CSTA 3N3KB 3NY5A 3UF8A 4RM9A 1R4NI 1WE7A 2LI5A 2KTRA 3A9KA 3M95A 3DVGY 4BKTA 1WR6E 2KLGA 3A9JA 3UQAA 2HE7A 4IC7B 4DHZB 2Z0DB 3C0RB 1GC6A 1UH6A 2ZZPB 1XQQA 1WM3A 1E8XA 4A20A 4KSLC 2RD0A 2VRRB 2PE6B 4GMVA 4PS7A 4HWIB 1E7UA 2LRUA 4ZRJA 4FHKA 4W9HA 4I6PA 1OEYJ 1SIFA 4WJQA 1KOTA 2FCNA 2IBIB 2Z0EB 3Q3FA 1V6EA 3PLVA 4FLHA 4WQOB 3VTVA 3ZNZB 2HD5B 3CSFA 2L05A 2WX0A 2BWFA 3HK0A 2DZJA 2KFJA 2ASQA 2KQSA 1BT0A 2K6QA 4ICVA 4FBJB 3WANA 3PVLA 5BO4B 1WYWB 4FJVB 4BVUC 4HCPB 3N30A 1YIWA 1L7YA 4MEMA 2W9NA 4GGQA 4HDQA 4NAWA 4WWOA 5C23A 5C1ZA 3QC8B 3B08A 2AL6A 2BYFA 1V5TA 4HXDA 4ICUA 4MSQB 2N7EA 2EMTA 4HK2A 3VDZA 1A5RA 1RFAA 4GB9A 2KJ6A 3BINA 2D11A 4GIVA 2FNJB 2J0JA 2NBWB 1YX6B 3H1UA 5AZFA 2C5LC 2GOWA 2L8JA 2UWQA 2FIFA 2L0TA 4EOYA 4DK5A 1D3ZA 4BFRA 2MQJA 4EZKA 2L76A 1IP9A 1AARA 1FXTB 3RZFA 3PSEB 1UBQA 2N1VA 3KUZA 3U7DA 1WGRA 4WWPA 4A3PA 3KYDD 1R4MI 3JSVA 2DENB 2KANA 4XX5A 3KW5B 2KKCA 3R7QA 2KWUB 2KLCA 3JSVB 2BWES 3WAPA 1NDDA 2LVOA 2KFKA 1WX9A 3DOWA 1P1AA 4G0NB 2JRHA 2DYOA 3KH0A 2DAFA 2KFKB 4EFOA 2HJ8A 4II3B 2N9PC 3AI5A 4BBNC 5LXHA 2RGFA 4M8MA 1IYFA 1WH3A 4ANWA 4W9IA 3TL5A 2NR2A 2NBVB 4M0WB 3EHVA 2I1KA 5CTRC 3PZDA 2MA9B 3OLMD 5LLIA 3U8ZA 4DHJD 2K25A 3S2AA 2YVCA 1V49A 1WI0A 2M17A 3V62A 2JF5A 1H8CA 2AEHA 4I6LB 1GC7A 4NY0A 2DZMA 2XBBC 4TQ0A 2KX0A 3IFWB 3IBEA 2O2VA 1P0RA 1KJTA 3JVZX 3O65B 4E74A 5JHAA 4NQKE 5E6NA 4CYEA 4IW0A 4ASWC 2LXCA 5EDSA 1GG3A 1SGHA 2O2VB 3LJ3A 2MBBB 4HDOA 5GMVA 4DXAB 5L83A 2G45B 3EECA 1H4RA 2YLMA 1XD3B 2DAJA 3WIMA 4W9DA 3TJPA 1CMXB 3ZLZA 1WGYA 2KX3A 1E8ZA 4IUMB 1RRBA 2N7DA 5JHBA 1UZXB 1WRDB 1E8YA 3A4RA 3KYCD 3ZUNA 2G4SA 4ZRIA 3OAWA 4W9JA 3X0WA 1EF5A 4EEWA 1OTRB 4MH0E 3NS8A 3NZUA 2K39A 3L13A 1HE8A 3AU4A 2KHWB 3A9KB 2KTRB 2Z59B 2NS5A 5TR5A 2KDFB 3QIJA 3A9JB 3AULA 3DPDA 2CHZA 4LCDE 1TZ1A 2FCSA 2ZVNA 3IVFA 3LDZE 4K7WA 2KC1A 1OQYA 1X1MA 5AZHA 4F7ZA 4DWFA 2DHZA 4AP4C 1I35A 3HM3A 3PRMB 2G4DB 5D2MB 2KD0A 2O6VA 2BGFA 2PJHA 3DBRI 3QHTA 1L2NA 4W9GA 3VUYA 2AYOB 4GOCA 2G3QB 2KMAA 1YQBA 2D07B 2GBKA 3H6NA 4IWPA 2CHWA 4GSWA 4W9LA 3NHEB 1WXMA 3WAMA 2KJRA 1E90A 4HPMB 2XK5A 5L95C 3L08A 2LGDA 1UELA 4DDID 1XT9B 4MM3A 4DHZE 2XK5B 3ZNHB 1IPGA 1WM2A 2WDTB 2J0MA 3RUIB 2BYVE 2DZKA 2KQ7A 4BKSA 3GZNI 1S1QB 3UGBB 4AWJA 1WY8A 2WYQA 3SDLC 1WXAA 1SE9A 2C9WB 2LUEA 3RT3B 3ZRCA 1V9JA 5G2NA 1Y8RC 2N4FA 3ZIMA 3DQVA 2KDIA 3W1SC 5FR6A 2FCMA 4NAWB 3PT2B 2C60A 3PPAA 3OJ3A 4EKUA 4TKNA 3RYTA 3T9LA 2NVUI 3VTUA 2KN5A 3H7SA 2LZ6A 1TGZB 5KHOA 3SD5A 1QZEA 4G50A 1NI2A 3RCZA 5DCNA 2CU1A 5J18A 3QQ8B 2KK8A 3QJZA 3TMPB 1UBIA 2L7RA 3AU5A 4IM0A 4IWQA 3QARA 2ZNVC 4XC2A 4IM3A 3ZNID 1ZW7A 2M0XA 2MBQA 3DCGA 3L10B 2D10A 4WJNA 2R2OA 2D2QA 3APCA 2JUOA 2ZCCA 3ZO5B 2DYBA 3ZDTA 2MSED 4KVGB 3WA0A 3QA8A 2EMSA 3V6CB 3DDCB 3PRZA 1OEYA 1WFYA 5IAAC 4KDIC 3PGEA 4GDKA 4WJOA 2V3SA 5LXIB 1J19A 1Z5SB 4W9CA 3WALA 1VCBA 2FAZA 2RPQA 3R66C 1WF9A 4IM2A 3PRPB 4NJ7A 4FJYA 3ML9A 2LGXA 4NPNA 3PS6A 4K7SA 1E8WA 3TIXA 1P9DU 5D6JB 2LD9A 4AUQC 1WIAA 4PYZA 4YL8A 3V60A 1GJZA 4HCNB 5DPWA 3H9DA 2BF8B 2IYDB 1EO6A 3M62B 4ZRKA 1VD2A 3B1LX 3VQIA 1TTNA 1V86A 3QWZB 4X57B 5CHWA 3KUCB 4BKGA 3CMMB 3ZW3A 2KMCA 2GMIC 1ZKHA 3HM6X 1EF1A 4CHKA 1RLFA 2JPHA 4B6WA 3DBLI 3ZRFA 1LM8B 4GDLA 3TBLD 2DZIA 2KC2A 1Q0WB 4M8NA 2KDBA 4K7UA 2ZPYA 2IZVB 2K8HA 3W1YA 4B9KA 3H7PA 3VUXA 1WJ4A 4IG7B 2L3ZA 4RM8A 2NCNA 4A3OA 4PS8A 1WX8A 3U30A 1UD7A 1ZGUB 1WE6A 2CHXA 4PS3A 5E6OA 3W1SA 1S3SG 2IO1B 4FADA 5KHQA 3KUDB 2KJHB 2MBHA 2GBRA 4JQWC 2AWTA 4MGIE 3VTWA 1KM7A 2JY6A 4WJPA 4HJKA 2WWZA 2KXJA 2K8CA 2IO0B 4HVBA 1UGMA 4FA6A 4W9EA 3IHPC 4N9F4 4JGHB 3EC8A 3TCAA 1WJ6A 2KO3A 4NNJB 4OVUA 4URKA 3RULA 4WAAA 5CHFA 3A4SC 4KSKC 2CR5A 2RSUA 2Y5BB 4MJSA 4KIKA 1G6JA 4ANVA 4EZJA 3ENEA 3ONSA 3PREA 2RR9A 3UINB 4IWOA 4AOFA 2ZCBA 2ZVOA 3GOEA 3M63B 4KIKB 3K9PB 2M4NA 2PE9A 3ML8A 1WGHA 5HKHA 4OVVA 3WAOA 2O6VD 1WJNA 2C7HA 2PEAA 1V81A 1J0GA 2ZPNA 3PLUA 3PTFC 2ZEQA 2LWPA 3HIZA 2MRPA 3JYUA 4P7IA 2FCQA 2MCNB 2HTHA 2IY0B 3R3MA 3BY4B 1WXVA 2BYEA 2O6VB 3CF6E 4W9KA 2K6DB 4BOSC 4FULA 4J6IA 5G55A 2GBNA 3L17A 3B0AA 3V6EB 2MW5A 3L54A 4FN2A 4BKSD 4RMAA 1JRUA 4BBNF 2UYZB 5AZGA 1WZ3A 3Q3JA 3P2BA 2KTFA 2MWSB 1V80A 2EKEC 2MLBA 2J7QB 3RZWC 4ANUA 3VUWA 5D94A 4KZCA 3VFKA 2N1WA 5DPTA 2LGYA 3OJ4B 1WZ0A 3NOBA 2NBUA 2QHOA 3A33B 4FHJA 2L00B 4JIOU 3T8MA 5CX3A 4E3CA 3VAWA 2IO3B 3MHSD 2AL3A 1LQBA 3DBHI 4JL9A 1TBEA 3I3TB 1WX7A 1LFDA 3V61A 1J8CA 4B95A 3KVFB 2WX1A 3L0WB 1GNUA 1M94A 4CO7A 2L0FA 2BKRB 2KOXA 3X23A 1WJUA 4EZLA 4MSMB 2JXXA 4TQ1A 4MDKE 2K8BA 2GBMA 4GU2A 1C3TA 3UIPB 2OOBB 4EUTA 2MBOA 3K9OB 3PV1A 2N9EB 2JVCA 4FJZA 3ZTCA 3HHMA 5JH5C 3DVNU 4ZDVA 3R7RA 3JW0X 3ECIA 3VVWB 2C7NB 1WR1A 3QK0A 1P3QU 2KVRA 1YX5B 4F8CB 5CHVC 2IO2B 1I42A 4PYUA 4GDKB 3RD2A 1KLVA 3ZKJC 1V2YA 2N9XA 2M8SA 2LJ5A 4MGZE 4NJ6A 4HLEA 4AJWA 2V4LA 2I1JA 3VH3B 3QAQA 3QCAA 2LVPA 3NZSA 2GBJA 3APDA 3VH4B 2KWVB 2MP2A 2JRIB 2KNBA 2R2QA 4K81A 4II2B 4LJPB 1T0YA 5JZEB 4WWNA 4K1RB 5DPRA 4GN1A 4TUUA 2MP2B 1GUAB 4MELA 5AEKB 3MTNB 3A1QA 4W9FA 4LJOB 2A5UA 2NPTA 4HPLB 4ANXA 1NBFC 2MBEA 4G3XB 3ZTDA 2C7MB 3A1QB 1F9JA 2D3GA 2NPTB 4MGKE 4DBGA 3L16A 1V5OA 1P98A 4GXBA 4KZ0A 3QX1A 2REXA 2KZRA 3AXCA 1RAXA 3VHTC 3SU8X 2V1YA 1OGWA 4GDLB 1LXDA 4JLCA 2KWCA 2LASA 2PPHA 4BOZB 2ZJDA 3H7PB 2JWZA 1U4AA 2IY1B 1YJ1A 3VXWA 3EFUA 3ZDMC 4NQLB 4F1SA 3MJWA 2BKFA 2LRWA 2FUHB 1WXSA 4TV3A 5D7GA 2LVQA 4KV2A 2KDEB 1WGDA 4XZ4A 1EUVB 2K1FA 4MGYE 4LDTD 1MG8A 3UQBA 4G11A 1ISNA 2XEWA 2DX5B 3DVNV 1K8RB 2JZZA 4DHJB 3ALBA 1YD8U 2A4ZA 2B3AA 5IA7A 3UIOB 3N32A 4ZYNA 4LDTB 4E71A 2ZNVB 2CKHB 3DVGX 3M3JA 4AJYB 5J17A 1Q5WB 3SHQA 4DDGD 1WMHA 3PHXB 3IG3A 2J0KA 3PHWB 2M1MA 1E5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D32 A;  1Z2M A;  2MX2 A;  4MJS B;  3ZVV A;  4I6N B;  1WMH B;  3APF A;  1E7V A;  3ZNG C;  1Q1O A;  1WGG A;  1C1Y B;  5E6P A;  2CS4 A;  2DYM A;  5DPS A;  2FID A;  1PQS A;  3DBS A;  2BPS A;  2JT4 B;  2JZ3 B;  2LXA A;  4KDL B;  5J2R A;  2OJR A;  3CST A;  3N3K B;  3NY5 A;  3UF8 A;  4RM9 A;  1R4N I;  1WE7 A;  2LI5 A;  2KTR A;  3A9K A;  3M95 A;  3DVG Y;  4BKT A;  1WR6 E;  2KLG A;  3A9J A;  3UQA A;  2HE7 A;  4IC7 B;  4DHZ B;  2Z0D B;  3C0R B;  1GC6 A;  1UH6 A;  2ZZP B;  1XQQ A;  1WM3 A;  1E8X A;  4A20 A;  4KSL C;  2RD0 A;  2VRR B;  2PE6 B;  4GMV A;  4PS7 A;  4HWI B;  1E7U A;  2LRU A;  4ZRJ A;  4FHK A;  4W9H A;  4I6P A;  1OEY J;  1SIF A;  4WJQ A;  1KOT A;  2FCN A;  2IBI B;  2Z0E B;  3Q3F A;  1V6E A;  3PLV A;  4FLH A;  4WQO B;  3VTV A;  3ZNZ B;  2HD5 B;  3CSF A;  2L05 A;  2WX0 A;  2BWF A;  3HK0 A;  2DZJ A;  2KFJ A;  2ASQ A;  2KQS A;  1BT0 A;  2K6Q A;  4ICV A;  4FBJ B;  3WAN A;  3PVL A;  5BO4 B;  1WYW B;  4FJV B;  4BVU C;  4HCP B;  3N30 A;  1YIW A;  1L7Y A;  4MEM A;  2W9N A;  4GGQ A;  4HDQ A;  4NAW A;  4WWO A;  5C23 A;  5C1Z A;  3QC8 B;  3B08 A;  2AL6 A;  2BYF A;  1V5T A;  4HXD A;  4ICU A;  4MSQ B;  2N7E A;  2EMT A;  4HK2 A;  3VDZ A;  1A5R A;  1RFA A;  4GB9 A;  2KJ6 A;  3BIN A;  2D11 A;  4GIV A;  2FNJ B;  2J0J A;  2NBW B;  1YX6 B;  3H1U A;  5AZF A;  2C5L C;  2GOW A;  2L8J A;  2UWQ A;  2FIF A;  2L0T A;  4EOY A;  4DK5 A;  1D3Z A;  4BFR A;  2MQJ A;  4EZK A;  2L76 A;  1IP9 A;  1AAR A;  1FXT B;  3RZF A;  3PSE B;  1UBQ A;  2N1V A;  3KUZ A;  3U7D A;  1WGR A;  4WWP A;  4A3P A;  3KYD D;  1R4M I;  3JSV A;  2DEN B;  2KAN A;  4XX5 A;  3KW5 B;  2KKC A;  3R7Q A;  2KWU B;  2KLC A;  3JSV B;  2BWE S;  3WAP A;  1NDD A;  2LVO A;  2KFK A;  1WX9 A;  3DOW A;  1P1A A;  4G0N B;  2JRH A;  2DYO A;  3KH0 A;  2DAF A;  2KFK B;  4EFO A;  2HJ8 A;  4II3 B;  2N9P C;  3AI5 A;  4BBN C;  5LXH A;  2RGF A;  4M8M A;  1IYF A;  1WH3 A;  4ANW A;  4W9I A;  3TL5 A;  2NR2 A;  2NBV B;  4M0W B;  3EHV A;  2I1K A;  5CTR C;  3PZD A;  2MA9 B;  3OLM D;  5LLI A;  3U8Z A;  4DHJ D;  2K25 A;  3S2A A;  2YVC A;  1V49 A;  1WI0 A;  2M17 A;  3V62 A;  2JF5 A;  1H8C A;  2AEH A;  4I6L B;  1GC7 A;  4NY0 A;  2DZM A;  2XBB C;  4TQ0 A;  2KX0 A;  3IFW B;  3IBE A;  2O2V A;  1P0R A;  1KJT A;  3JVZ X;  3O65 B;  4E74 A;  5JHA A;  4NQK E;  5E6N A;  4CYE A;  4IW0 A;  4ASW C;  2LXC A;  5EDS A;  1GG3 A;  1SGH A;  2O2V B;  3LJ3 A;  2MBB B;  4HDO A;  5GMV A;  4DXA B;  5L83 A;  2G45 B;  3EEC A;  1H4R A;  2YLM A;  1XD3 B;  2DAJ A;  3WIM A;  4W9D A;  3TJP A;  1CMX B;  3ZLZ A;  1WGY A;  2KX3 A;  1E8Z A;  4IUM B;  1RRB A;  2N7D A;  5JHB A;  1UZX B;  1WRD B;  1E8Y A;  3A4R A;  3KYC D;  3ZUN A;  2G4S A;  4ZRI A;  3OAW A;  4W9J A;  3X0W A;  1EF5 A;  4EEW A;  1OTR B;  4MH0 E;  3NS8 A;  3NZU A;  2K39 A;  3L13 A;  1HE8 A;  3AU4 A;  2KHW B;  3A9K B;  2KTR B;  2Z59 B;  2NS5 A;  5TR5 A;  2KDF B;  3QIJ A;  3A9J B;  3AUL A;  3DPD A;  2CHZ A;  4LCD E;  1TZ1 A;  2FCS A;  2ZVN A;  3IVF A;  3LDZ E;  4K7W A;  2KC1 A;  1OQY A;  1X1M A;  5AZH A;  4F7Z A;  4DWF A;  2DHZ A;  4AP4 C;  1I35 A;  3HM3 A;  3PRM B;  2G4D B;  5D2M B;  2KD0 A;  2O6V A;  2BGF A;  2PJH A;  3DBR I;  3QHT A;  1L2N A;  4W9G A;  3VUY A;  2AYO B;  4GOC A;  2G3Q B;  2KMA A;  1YQB A;  2D07 B;  2GBK A;  3H6N A;  4IWP A;  2CHW A;  4GSW A;  4W9L A;  3NHE B;  1WXM A;  3WAM A;  2KJR A;  1E90 A;  4HPM B;  2XK5 A;  5L95 C;  3L08 A;  2LGD A;  1UEL A;  4DDI D;  1XT9 B;  4MM3 A;  4DHZ E;  2XK5 B;  3ZNH B;  1IPG A;  1WM2 A;  2WDT B;  2J0M A;  3RUI B;  2BYV E;  2DZK A;  2KQ7 A;  4BKS A;  3GZN I;  1S1Q B;  3UGB B;  4AWJ A;  1WY8 A;  2WYQ A;  3SDL C;  1WXA A;  1SE9 A;  2C9W B;  2LUE A;  3RT3 B;  3ZRC A;  1V9J A;  5G2N A;  1Y8R C;  2N4F A;  3ZIM A;  3DQV A;  2KDI A;  3W1S C;  5FR6 A;  2FCM A;  4NAW B;  3PT2 B;  2C60 A;  3PPA A;  3OJ3 A;  4EKU A;  4TKN A;  3RYT A;  3T9L A;  2NVU I;  3VTU A;  2KN5 A;  3H7S A;  2LZ6 A;  1TGZ B;  5KHO A;  3SD5 A;  1QZE A;  4G50 A;  1NI2 A;  3RCZ A;  5DCN A;  2CU1 A;  5J18 A;  3QQ8 B;  2KK8 A;  3QJZ A;  3TMP B;  1UBI A;  2L7R A;  3AU5 A;  4IM0 A;  4IWQ A;  3QAR A;  2ZNV C;  4XC2 A;  4IM3 A;  3ZNI D;  1ZW7 A;  2M0X A;  2MBQ A;  3DCG A;  3L10 B;  2D10 A;  4WJN A;  2R2O A;  2D2Q A;  3APC A;  2JUO A;  2ZCC A;  3ZO5 B;  2DYB A;  3ZDT A;  2MSE D;  4KVG B;  3WA0 A;  3QA8 A;  2EMS A;  3V6C B;  3DDC B;  3PRZ A;  1OEY A;  1WFY A;  5IAA C;  4KDI C;  3PGE A;  4GDK A;  4WJO A;  2V3S A;  5LXI B;  1J19 A;  1Z5S B;  4W9C A;  3WAL A;  1VCB A;  2FAZ A;  2RPQ A;  3R66 C;  1WF9 A;  4IM2 A;  3PRP B;  4NJ7 A;  4FJY A;  3ML9 A;  2LGX A;  4NPN A;  3PS6 A;  4K7S A;  1E8W A;  3TIX A;  1P9D U;  5D6J B;  2LD9 A;  4AUQ C;  1WIA A;  4PYZ A;  4YL8 A;  3V60 A;  1GJZ A;  4HCN B;  5DPW A;  3H9D A;  2BF8 B;  2IYD B;  1EO6 A;  3M62 B;  4ZRK A;  1VD2 A;  3B1L X;  3VQI A;  1TTN A;  1V86 A;  3QWZ B;  4X57 B;  5CHW A;  3KUC B;  4BKG A;  3CMM B;  3ZW3 A;  2KMC A;  2GMI C;  1ZKH A;  3HM6 X;  1EF1 A;  4CHK A;  1RLF A;  2JPH A;  4B6W A;  3DBL I;  3ZRF A;  1LM8 B;  4GDL A;  3TBL D;  2DZI A;  2KC2 A;  1Q0W B;  4M8N A;  2KDB A;  4K7U A;  2ZPY A;  2IZV B;  2K8H A;  3W1Y A;  4B9K A;  3H7P A;  3VUX A;  1WJ4 A;  4IG7 B;  2L3Z A;  4RM8 A;  2NCN A;  4A3O A;  4PS8 A;  1WX8 A;  3U30 A;  1UD7 A;  1ZGU B;  1WE6 A;  2CHX A;  4PS3 A;  5E6O A;  3W1S A;  1S3S G;  2IO1 B;  4FAD A;  5KHQ A;  3KUD B;  2KJH B;  2MBH A;  2GBR A;  4JQW C;  2AWT A;  4MGI E;  3VTW A;  1KM7 A;  2JY6 A;  4WJP A;  4HJK A;  2WWZ A;  2KXJ A;  2K8C A;  2IO0 B;  4HVB A;  1UGM A;  4FA6 A;  4W9E A;  3IHP C;  4N9F 4;  4JGH B;  3EC8 A;  3TCA A;  1WJ6 A;  2KO3 A;  4NNJ B;  4OVU A;  4URK A;  3RUL A;  4WAA A;  5CHF A;  3A4S C;  4KSK C;  2CR5 A;  2RSU A;  2Y5B B;  4MJS A;  4KIK A;  1G6J A;  4ANV A;  4EZJ A;  3ENE A;  3ONS A;  3PRE A;  2RR9 A;  3UIN B;  4IWO A;  4AOF A;  2ZCB A;  2ZVO A;  3GOE A;  3M63 B;  4KIK B;  3K9P B;  2M4N A;  2PE9 A;  3ML8 A;  1WGH A;  5HKH A;  4OVV A;  3WAO A;  2O6V D;  1WJN A;  2C7H A;  2PEA A;  1V81 A;  1J0G A;  2ZPN A;  3PLU A;  3PTF C;  2ZEQ A;  2LWP A;  3HIZ A;  2MRP A;  3JYU A;  4P7I A;  2FCQ A;  2MCN B;  2HTH A;  2IY0 B;  3R3M A;  3BY4 B;  1WXV A;  2BYE A;  2O6V B;  3CF6 E;  4W9K A;  2K6D B;  4BOS C;  4FUL A;  4J6I A;  5G55 A;  2GBN A;  3L17 A;  3B0A A;  3V6E B;  2MW5 A;  3L54 A;  4FN2 A;  4BKS D;  4RMA A;  1JRU A;  4BBN F;  2UYZ B;  5AZG A;  1WZ3 A;  3Q3J A;  3P2B A;  2KTF A;  2MWS B;  1V80 A;  2EKE C;  2MLB A;  2J7Q B;  3RZW C;  4ANU A;  3VUW A;  5D94 A;  4KZC A;  3VFK A;  2N1W A;  5DPT A;  2LGY A;  3OJ4 B;  1WZ0 A;  3NOB A;  2NBU A;  2QHO A;  3A33 B;  4FHJ A;  2L00 B;  4JIO U;  3T8M A;  5CX3 A;  4E3C A;  3VAW A;  2IO3 B;  3MHS D;  2AL3 A;  1LQB A;  3DBH I;  4JL9 A;  1TBE A;  3I3T B;  1WX7 A;  1LFD A;  3V61 A;  1J8C A;  4B95 A;  3KVF B;  2WX1 A;  3L0W B;  1GNU A;  1M94 A;  4CO7 A;  2L0F A;  2BKR B;  2KOX A;  3X23 A;  1WJU A;  4EZL A;  4MSM B;  2JXX A;  4TQ1 A;  4MDK E;  2K8B A;  2GBM A;  4GU2 A;  1C3T A;  3UIP B;  2OOB B;  4EUT A;  2MBO A;  3K9O B;  3PV1 A;  2N9E B;  2JVC A;  4FJZ A;  3ZTC A;  3HHM A;  5JH5 C;  3DVN U;  4ZDV A;  3R7R A;  3JW0 X;  3ECI A;  3VVW B;  2C7N B;  1WR1 A;  3QK0 A;  1P3Q U;  2KVR A;  1YX5 B;  4F8C B;  5CHV C;  2IO2 B;  1I42 A;  4PYU A;  4GDK B;  3RD2 A;  1KLV A;  3ZKJ C;  1V2Y A;  2N9X A;  2M8S A;  2LJ5 A;  4MGZ E;  4NJ6 A;  4HLE A;  4AJW A;  2V4L A;  2I1J A;  3VH3 B;  3QAQ A;  3QCA A;  2LVP A;  3NZS A;  2GBJ A;  3APD A;  3VH4 B;  2KWV B;  2MP2 A;  2JRI B;  2KNB A;  2R2Q A;  4K81 A;  4II2 B;  4LJP B;  1T0Y A;  5JZE B;  4WWN A;  4K1R B;  5DPR A;  4GN1 A;  4TUU A;  2MP2 B;  1GUA B;  4MEL A;  5AEK B;  3MTN B;  3A1Q A;  4W9F A;  4LJO B;  2A5U A;  2NPT A;  4HPL B;  4ANX A;  1NBF C;  2MBE A;  4G3X B;  3ZTD A;  2C7M B;  3A1Q B;  1F9J A;  2D3G A;  2NPT B;  4MGK E;  4DBG A;  3L16 A;  1V5O A;  1P98 A;  4GXB A;  4KZ0 A;  3QX1 A;  2REX A;  2KZR A;  3AXC A;  1RAX A;  3VHT C;  3SU8 X;  2V1Y A;  1OGW A;  4GDL B;  1LXD A;  4JLC A;  2KWC A;  2LAS A;  2PPH A;  4BOZ B;  2ZJD A;  3H7P B;  2JWZ A;  1U4A A;  2IY1 B;  1YJ1 A;  3VXW A;  3EFU A;  3ZDM C;  4NQL B;  4F1S A;  3MJW A;  2BKF A;  2LRW A;  2FUH B;  1WXS A;  4TV3 A;  5D7G A;  2LVQ A;  4KV2 A;  2KDE B;  1WGD A;  4XZ4 A;  1EUV B;  2K1F A;  4MGY E;  4LDT D;  1MG8 A;  3UQB A;  4G11 A;  1ISN A;  2XEW A;  2DX5 B;  3DVN V;  1K8R B;  2JZZ A;  4DHJ B;  3ALB A;  1YD8 U;  2A4Z A;  2B3A A;  5IA7 A;  3UIO B;  3N32 A;  4ZYN A;  4LDT B;  4E71 A;  2ZNV B;  2CKH B;  3DVG X;  3M3J A;  4AJY B;  5J17 A;  1Q5W B;  3SHQ A;  4DDG D;  1WMH A;  3PHX B;  3IG3 A;  2J0K A;  3PHW B;  2M1M A;  1E5W A; 
#chains in the Genus database with same CATH topology
 3ZVV A;  4OZA A;  5GXG B;  2ONQ A;  3CIR B;  1HQR D;  2CS4 A;  2DYM A;  5DPS A;  2FID A;  2BPS A;  2N7J A;  5J2R A;  2LXA A;  3N3K B;  2H88 B;  1M4V A;  3MP9 A;  2KTR A;  1TKE A;  1ZDX A;  1WR6 E;  4N6E B;  2KLG A;  4DQO C;  2HE7 A;  4IC7 B;  2ZZP B;  3SR6 A;  3N1Y C;  1XQQ A;  4PS7 A;  4GMV A;  3I9V 1;  1R4N B;  4JE3 B;  4HRS A;  4FHK A;  2FCN A;  2IBI B;  3U4E G;  1V6E A;  3PLV A;  2WXH A;  3GB1 A;  4HKQ A;  3VTV A;  1QF6 A;  3RNB C;  2BTE A;  4C7Z A;  2ASQ A;  1BT0 A;  4ICV A;  4FBJ B;  1GAQ B;  3PVL A;  3N30 A;  2AQ3 B;  1GB4 A;  4M01 A;  2W9N A;  4HDQ A;  4NAW A;  3QC8 B;  3DHI C;  1ZE3 D;  4AQ7 A;  2KDM A;  3ZXR A;  3BK1 A;  4C80 A;  4MSQ B;  3Q8B A;  2N7E A;  1RFA A;  2Y5C A;  2NBW B;  3H1U A;  1I4R A;  4EOY A;  3W5V B;  2LGI A;  4BFR A;  3AE9 B;  2WDQ B;  4TSS A;  1AAR A;  1FXT B;  3Q14 C;  1N62 A;  3PSE B;  4WWP A;  3TEZ A;  3KYD D;  2KAN A;  3JSV B;  1MI0 A;  3KWV A;  2JRH A;  4C4V B;  2N9P C;  3AI5 A;  5D3I B;  4BBN C;  1STE A;  4NZL B;  1IYF A;  1WH3 A;  2PKO A;  4ANW A;  4W9I A;  2NR2 A;  3U52 E;  3PZD A;  2MA9 B;  1ZDV A;  3S2A A;  2YVC A;  5BYS A;  1V49 A;  3PZ8 A;  3C8Y A;  1FO4 A;  3B2F A;  4E74 A;  4NQK E;  3IAS 1;  2WDR B;  5L83 A;  4DXA B;  3BZD B;  5FR3 A;  3U2S C;  3WIM A;  4XWT A;  3DWM A;  3ZLZ A;  2KX3 A;  4N59 A;  2N7D A;  1YN4 A;  1UZX B;  1E8Y A;  3ZUN A;  2G4S A;  2VZK B;  1EF5 A;  1QOB A;  3NZU A;  3EA6 A;  3Q8C A;  4XWW A;  3AU4 A;  2Z59 B;  1SIJ A;  3AH7 A;  5TR5 A;  3A9J B;  2KYW A;  4OW0 A;  2FCS A;  4K7W A;  2ZVN A;  1T3Q A;  4KGT A;  2DHZ A;  3NS1 A;  3P4P B;  4KGR A;  1FCL A;  1I7H A;  2PJH A;  3DBR I;  3N1Z C;  3QHT A;  1L2N A;  1YQB A;  2CHW A;  4W9L A;  1TY0 A;  4HPM B;  4B0E A;  5L95 C;  3L08 A;  1TYG B;  1E6E B;  4DDI D;  4WWM A;  3ZNH B;  1NYR A;  4JX1 C;  1HTO A;  2WDT B;  2DZK A;  3W2D A;  1S1Q B;  3UGB B;  1WY8 A;  2C9W B;  1V9J A;  1DOX A;  2BB5 A;  2FCM A;  1V97 A;  3H7S A;  2LZ6 A;  3SD5 A;  3HVZ A;  5J18 A;  2M56 B;  3QJZ A;  3TMP B;  2CJO A;  1UBI A;  3AU5 A;  1AW7 A;  4IM0 A;  4WJN A;  2DYB A;  3WA0 A;  4NJC A;  4WJO A;  2BVC A;  3WAL A;  1WF9 A;  4NJ7 A;  3PS6 A;  4UDU C;  1E8W A;  1VZ8 A;  3NG0 A;  3PO0 A;  1WIA A;  4HCN B;  5DPW A;  4YSX B;  1VD2 A;  1TIF A;  3VQI A;  4IKG A;  3QWZ B;  3NRZ A;  2KMC A;  3HM6 X;  1OFF A;  2KAC A;  2BYT A;  2JPH A;  4B6W A;  1C4A A;  1LM8 B;  3TBL D;  1Q0W B;  4M8N A;  3H7P A;  4LNO A;  4A3O A;  3U30 A;  1ZGU B;  2CHX A;  4PS3 A;  5E6O A;  5KHQ A;  2IO1 B;  3KUD B;  1KM7 A;  2JY6 A;  1MG4 A;  1JWU D;  1QT9 A;  2H89 B;  4JGH B;  2KO3 A;  4ARC A;  4NNJ B;  4OVU A;  4URK A;  2PTL A;  1HZ6 A;  4WAA A;  3LXF A;  2XN9 C;  2D3A A;  2E3T A;  1F0Z A;  2INC C;  2CR5 A;  1CJE A;  2QC8 A;  3W9C B;  3BVG A;  3VRB B;  2ZW1 A;  1IGD A;  1JML A;  3UIN B;  3GOE A;  2O6V D;  1C4C A;  3PLU A;  2LWP A;  1WXV A;  4W9K A;  1VRA B;  1I4P A;  1EM7 A;  5HHD G;  2GRI A;  3L17 A;  3B0A A;  3IT6 B;  4C00 A;  3L54 A;  1AWD A;  4M00 A;  3ZGZ A;  3P2B A;  2J7Q B;  4FXC A;  5D94 A;  2N1W A;  3OJ4 B;  3A33 B;  3AMZ A;  2L00 B;  1P7E A;  2IGD A;  3DBH I;  4JL9 A;  3GZN B;  1LFD A;  1J8C A;  3KVF B;  1NVI D;  4BAX A;  4OZB A;  4EZL A;  4MSM B;  1TZO A;  4TQ1 A;  2K8B A;  4GU2 A;  3UIP B;  2HJ1 A;  3MFG A;  3PV1 A;  4ARI A;  2N9E B;  3HHM A;  3R7R A;  3AM9 A;  3ECI A;  3QK0 A;  1P3Q U;  2KVR A;  4F8C B;  3VR9 B;  2NTT A;  1KLV A;  5D3D A;  2V4L A;  2I1J A;  4JPS A;  3NZS A;  3APD A;  2MP2 A;  3GE8 C;  2V3P A;  4II2 B;  5JZE B;  5DPR A;  4TUU A;  4P6V F;  3RNG C;  4LJO B;  2WNM A;  2NPT B;  2KZR A;  3VHT C;  4ZOH C;  4GDL B;  1PUT A;  1LXD A;  3AEF B;  2PPH A;  4BOZ B;  5C2T B;  1K51 A;  2JQR B;  4NQL B;  1FRR A;  2LVQ A;  1VDV A;  1KF6 B;  2KDE B;  1EUV B;  2K1F A;  4LDT D;  1MG8 A;  1ISN A;  1K8R B;  2PVG C;  4ZYN A;  1PGX A;  4E71 A;  1Q5W B;  3SHQ A;  5IP4 D;  1ZXH A;  2MLB A;  1E5W A;  2MX2 A;  1WYG A;  2N9L A;  3ZNG C;  2WXO A;  1YMH E;  3VRA B;  2JT4 B;  2JZ3 B;  1SEB D;  1WE7 A;  3M95 A;  4HEA 1;  3DVG Y;  4BKT A;  4REZ A;  2LGS A;  3A9J A;  2TSS A;  4J3O D;  1BXT A;  3NVW A;  1N63 A;  1WM3 A;  2PIA A;  2PE6 B;  2LRU A;  3BVM A;  5AUI A;  4WJQ A;  1DGJ A;  2WXQ A;  1VZ7 A;  2QIE B;  1KLU D;  2HD5 B;  3HK0 A;  3EFC A;  2DZJ A;  2KFJ A;  2KQS A;  2RDH A;  2K6Q A;  3WAN A;  1RWS A;  1BML C;  1WYW B;  4FJV B;  4HCP B;  1I4G A;  1L7Y A;  5C1Z A;  4GGQ A;  2DLB A;  2WXJ A;  1UUP A;  2Y3A A;  2UU7 A;  1FM0 D;  2W3S A;  2CU3 A;  2M0A A;  1PDX A;  1YX6 B;  3ABV B;  1KLG D;  1JW9 D;  2C5L C;  2FUG 1;  5AZF A;  2GOW A;  4C7Y A;  2LJI A;  1HXY D;  2FIF A;  2L0T A;  4DK5 A;  3AE3 B;  3FIL B;  1I4Q A;  1UBQ A;  1N60 A;  2N1V A;  1WGR A;  1JRP A;  2WXR A;  4CQN A;  2IPK D;  1FMA D;  3WAP A;  2ACZ B;  2LVO A;  2KFK A;  4JWU C;  3NUH B;  1P1A A;  4G0N B;  2DAF A;  3H8H A;  3MC0 B;  2JXT A;  4EE2 A;  4P1B C;  2D3B A;  4MAC A;  4M0W B;  3AED B;  2JYE A;  5CTR C;  3OLM D;  1SJE D;  3I5J C;  3UI3 A;  3U8Z A;  2BS4 B;  2K25 A;  4HPP A;  4PK1 A;  4I6L B;  3NVZ A;  2DZM A;  4TQ0 A;  3C19 A;  3BYT B;  1P0R A;  1KJT A;  2RPV A;  4CYE A;  4ASW C;  2PMV A;  1K53 A;  2IJ0 A;  1GG3 A;  1SGH A;  2O2V B;  4HDO A;  1IGC A;  2I38 A;  2G45 B;  2GI9 A;  2DAJ A;  1HA5 A;  3AE7 B;  1AN8 A;  1YN5 A;  4W9D A;  2WHI A;  3TJP A;  2WXK A;  5JHB A;  1WRD B;  3KYC D;  4ZRI A;  2HDE A;  4W9J A;  1NI3 A;  4LLG M;  3X0W A;  3NS8 A;  1VLB A;  2PW9 A;  1Q10 A;  2NS5 A;  2KDF B;  2AQ1 B;  3AUL A;  3DPD A;  3LDZ E;  1X1M A;  5AZH A;  1I35 A;  3HM3 A;  3PRM B;  3FAH A;  4YSZ B;  5D2M B;  4LK0 M;  2L52 A;  4D2K A;  3VUY A;  2AYO B;  2WXN A;  2D07 B;  3H6N A;  1FFV A;  3NHE B;  3WAM A;  2AQ2 B;  2KJR A;  1E90 A;  2XK5 A;  1MJD A;  3DBR B;  1SBB B;  1DOI A;  1IBX B;  1C79 A;  1WM2 A;  2B76 B;  2KQ7 A;  4MM3 B;  1EU4 A;  2WYQ A;  1WXA A;  1Y8R C;  3AB5 A;  5TSS A;  3ZIM A;  4A55 A;  2KDI A;  4N58 A;  3PT2 B;  2C60 A;  3PPA A;  3OJ3 A;  4EKU A;  3T9L A;  2NVU I;  3VTU A;  2D5G A;  4RGN A;  2L32 A;  2MHJ A;  2XNA C;  1QZE A;  3RCZ A;  3QQ8 B;  3PZ7 A;  2L7R A;  4IWQ A;  2ZNV C;  4XC2 A;  1ET6 A;  4IM3 A;  1ZW7 A;  1T0Q C;  2D10 A;  2KWD A;  2R2O A;  2FBW B;  2JUO A;  3ZDT A;  2OJW A;  3QA8 A;  1TS3 A;  3PRZ A;  1OEY A;  1WFY A;  5IKC M;  4KDI C;  2V3S A;  5LXI B;  1J19 A;  1Z5S B;  3AEB B;  2FAZ A;  2RPQ A;  4IM2 A;  1GPX A;  4FJY A;  3I57 A;  3GE3 C;  2LGX A;  4S17 A;  2W82 A;  1CZP A;  1R4M B;  5D6J B;  2BT6 A;  3V60 A;  4PYZ A;  4YL8 A;  2IYD B;  4ZRK A;  4YXD B;  1V86 A;  5CHW A;  1RM6 C;  3KUC B;  3CMM B;  5IOI A;  5MPO A;  3ZRF A;  4GDL A;  2KC2 A;  3AE6 B;  4WH4 A;  4K7U A;  4B9K A;  1YN3 A;  2W3R A;  2SEB D;  4LNI A;  3W1S A;  2BS3 B;  3DHH C;  3Q69 A;  1S3S G;  1ESF A;  2KJH B;  2GBR A;  2AWT A;  3VTW A;  1XLO A;  4HJK A;  1V8C A;  4HVB A;  1UGM A;  4FA6 A;  1GB1 A;  1L0X B;  2WXG A;  4K3C A;  1T0S C;  3GP7 A;  3MC8 A;  2RMM A;  2N0S B;  1V1P B;  1L4Z B;  3RUL A;  4KSK C;  4LNN A;  2RSU A;  3FKY A;  4KIK A;  1G6J A;  4EZJ A;  3U7Z A;  3PRE A;  2RR9 A;  1TJE A;  2ZCB A;  3ML8 A;  1WGH A;  4OVV A;  4A9A A;  1V81 A;  2IGH A;  1ZXI A;  2HTH A;  2IY0 B;  3R3M A;  2QCZ A;  1KH0 A;  3MHZ A;  4H2A A;  3V6E B;  2Z8L A;  2MW5 A;  3L4P A;  2ZW0 A;  2UYZ B;  1WZ3 A;  3Q3J A;  1F52 A;  1V80 A;  1L4D B;  1ET9 A;  3KLS X;  4KZC A;  1C9F A;  2LGY A;  4FHJ A;  2QHO A;  4YWG G;  1LQB A;  1TBE A;  1WX7 A;  4ZHO A;  1MFW A;  4LNF A;  1QOG A;  2BKR B;  1ZOY B;  4MDK E;  2GBM A;  1MVK A;  3DBH B;  2MBO A;  3K9O B;  1MPE A;  4FJZ A;  1SE4 A;  3VVW B;  2C7N B;  1XCT L;  2LUM A;  2IO2 B;  3LB8 C;  3RD2 A;  3FIL A;  3ZKJ C;  1KRH A;  2M8S A;  4NJ6 A;  3QCA A;  2LVP A;  2J52 A;  2JRI B;  2KNB A;  2R2Q A;  3P42 A;  2L1A A;  4WWN A;  1IUE A;  3A1Q A;  4W9F A;  1NBF C;  3EGR A;  3LYY A;  1F9J A;  2D3G A;  4KZ0 A;  3OG5 A;  2ON8 A;  2REX A;  1OGW A;  2KWC A;  1WGK A;  4M0W A;  2ZJD A;  2INN E;  2FUH B;  4KV2 A;  1B1Z A;  3UQB A;  1MHH E;  2PLP A;  2XEW A;  2JZZ A;  2A4Z A;  5IA7 A;  2CKH B;  4AJY B;  2HTM E;  4ACF A;  4XDC A;  3IG3 A;  4O1N A;  1V1O A;  1Z2M A;  1WMH B;  4OZC A;  3APF A;  5T8I A;  2WDV B;  1C1Y B;  1PGA A;  4IOI E;  1PQS A;  3DBS A;  2KVZ A;  4KDL B;  2OJR A;  3NY5 A;  3Q8A A;  5C3J B;  4DXF A;  2QMT A;  4RM9 A;  2LI5 A;  3AE2 B;  1DYQ A;  3UQA A;  2YEP B;  2Z0D B;  4HRO A;  1GC6 A;  1UH6 A;  4LTU A;  4US8 A;  2E6X A;  4KSL C;  2RD0 A;  2VRR B;  4A20 A;  5BMI A;  1D4B A;  4HWI B;  1E7U A;  3Q8F A;  4I6P A;  3MC9 A;  1SXT A;  3RN9 C;  2WLB A;  2J53 A;  3ZNZ B;  3J9C A;  3CSF A;  2L05 A;  2WX0 A;  2BWF A;  2WXI A;  2I2Y A;  1OQR A;  2X38 A;  1RYJ A;  4KX6 B;  4BVU C;  5C23 A;  1LGR A;  3P1M A;  3B08 A;  2AL6 A;  3E56 A;  2BYF A;  1V5T A;  4ICU A;  2EMT A;  4HK2 A;  2RDB C;  1A5R A;  2KJ6 A;  2D11 A;  4GIV A;  2NTS A;  4A8X C;  2UWQ A;  3AE4 B;  5H92 C;  1D3Z A;  2MQJ A;  5G5H A;  1JWB D;  3NJT A;  2L76 A;  1IP9 A;  3U7D A;  3JSV A;  1FNV A;  1N5X A;  1HZ5 A;  3KW5 B;  2JX5 A;  2KKC A;  3R7Q A;  4C4V A;  3SFD B;  3RNC C;  3V3X A;  2SAK A;  3DOW A;  3KH0 A;  2HJ8 A;  1WXQ A;  1J7B A;  3TL5 A;  1E10 A;  2NBV B;  4RGT A;  1YQ3 B;  1TS4 A;  3EHV A;  5LLI A;  1L0V B;  1TKY A;  4HJG E;  5BMH A;  2VH1 A;  4DHJ D;  3IXS A;  2M17 A;  3NVV A;  3V62 A;  2JF5 A;  1H8C A;  3Q8E A;  1GC7 A;  4NY0 A;  2KX0 A;  3IFW B;  5JHA A;  3JVZ X;  3P4R B;  2JYT A;  5E6N A;  1C78 A;  4IW0 A;  2MBB B;  5GMV A;  1H4R A;  2W55 A;  1XD3 B;  1D5Z C;  1CMX B;  4A6Q A;  1WGY A;  1E8Z A;  4IUM B;  1RRB A;  1D5M C;  4US9 A;  4RFB A;  3A4R A;  4L2Y A;  2BQQ A;  4R3D A;  2VH2 A;  4GLS C;  1OTR B;  3AE8 B;  5BMG A;  4WQM A;  3A9K B;  4RNA A;  3QIJ A;  4LCD E;  2CHZ A;  3N1X C;  1TZ1 A;  2KC1 A;  4MH8 A;  1SE2 A;  4DWF A;  2K0P A;  1FPY A;  2G4D B;  4W9G A;  2G3Q B;  1JWM D;  5BYQ A;  1N6Z A;  4GSW A;  3RI7 C;  1WXM A;  3HUI A;  1C4P A;  1QQR A;  1N5W A;  2LGD A;  1UEL A;  2M19 A;  1IPG A;  2K9X A;  3BVZ A;  2BYV E;  4BKS A;  3GZN I;  4AWJ A;  3RT3 B;  3ZRC A;  4BZA A;  2N4F A;  4M02 A;  3W1S C;  2KAJ A;  5FR6 A;  1EU3 A;  3B9J A;  1T0R C;  3RYT A;  1TGZ B;  4RGM A;  1F2R C;  1RFK A;  2J4X A;  2V3N A;  1NYQ A;  1VZ6 A;  4OHJ A;  3ZNI D;  2MBQ A;  3DCG A;  3V05 A;  1QIL A;  3ZO5 B;  2IGG A;  3APC A;  2ZCC A;  4YTN B;  2MSE D;  4KVG B;  2NMQ A;  3V6C B;  2EMS A;  4WUR A;  4RH6 A;  1D6E C;  1VCB A;  3PRP B;  2K22 A;  4NPN A;  1FNU A;  1FFU A;  5H8Y E;  3H9D A;  3ZXV A;  1EO6 A;  3M62 B;  4X57 B;  2GMI C;  1ZKH A;  3HRD D;  1GOZ A;  1EF1 A;  3DBL I;  2ZPY A;  1UNS A;  2IZV B;  3W1Y A;  1WJ4 A;  2L3Z A;  4RM8 A;  2NCN A;  4PS8 A;  1F2R I;  1UD7 A;  1WE6 A;  2DWQ A;  4FAD A;  1QOA A;  4JQW C;  2MBH A;  4MGI E;  2K8C A;  4W9E A;  3IHP C;  3MJ5 A;  1PFD A;  1FXA A;  1WJ6 A;  4HKZ E;  1TT5 B;  2R61 A;  2EKI A;  3AN1 A;  1SB3 C;  3N20 C;  3ENE A;  3ONS A;  4PT5 A;  4AOF A;  2DBY A;  3M63 B;  1TY2 A;  3B2G A;  1UWM A;  1FCC C;  1E7P B;  2M4N A;  2MJE A;  2FE8 A;  3WAO A;  3AV8 A;  1WJN A;  2C7H A;  1TS2 A;  3T3N A;  2ZEQ A;  3HIZ A;  2MCN B;  2MRP A;  4K3B A;  2FCQ A;  4P7I A;  3TSS A;  2G1E A;  3BY4 B;  2O6V B;  3CF6 E;  1DOY A;  1L0Y B;  2K6D B;  2GB1 A;  4BOS C;  4FUL A;  1KFY B;  1PYW D;  1LO5 D;  2GBN A;  4RMA A;  2OED A;  1JRU A;  4BBN F;  2MEK A;  5AZG A;  2MWS B;  1HEZ E;  5FKA C;  5E6J A;  1XF5 L;  5DPT A;  4JIO U;  4A90 A;  1WZ0 A;  3T8M A;  4KKI A;  2WGS A;  3VAW A;  2LHD A;  3I3T B;  3V61 A;  4B95 A;  2WX1 A;  1B9R A;  1GNU A;  1M94 A;  2L0F A;  4IDI A;  2G9H D;  2KOX A;  3X23 A;  3Q6B A;  2JXX A;  1JAL A;  2OOB B;  3RMK C;  4ZDV A;  3JW0 X;  1C77 A;  3IAM 1;  3EUB 2;  1YX5 B;  1I42 A;  1PGB A;  1F1H A;  4GDK B;  3ZJV A;  3Q3M C;  4MGZ E;  5EE1 A;  3VH3 B;  5I4D A;  4P16 A;  2GBJ A;  4K81 A;  1T0Y A;  3BII D;  5G5G A;  3TEX A;  3P63 A;  2MP2 B;  2IND C;  5AEK B;  3MTN B;  2NPT A;  4HPL B;  4ANX A;  5EE3 A;  2MBE A;  3ZTD A;  4MGK E;  4DBG A;  3L16 A;  1P98 A;  3QX1 A;  3GS2 A;  1XXG A;  1XLP A;  2BW2 A;  1RAX A;  2V1Y A;  3FC4 A;  3ZJT A;  1CQV A;  1ENF A;  2AX5 A;  5JXV A;  4YT0 B;  2EEL A;  2BS2 B;  2WP9 B;  2JWZ A;  3RNE C;  3ZDM C;  3HVD A;  1R7S A;  4F1S A;  3MJW A;  1JCK B;  2LRW A;  1WXS A;  4B0M A;  4KKJ A;  2QDF A;  2RDG A;  1WGD A;  4XZ4 A;  3ETR A;  3CWI A;  4G11 A;  3P4Q B;  3DVN V;  4DHJ B;  3ALB A;  2B3A A;  4RGO S;  4LDT B;  1ZPS A;  3DVG X;  2K5P A;  5HI1 A;  5J17 A;  4DDG D;  2J0K A;  3ZQ4 A;  2M1M A;  5JH5 C;  3D32 A;  4MJS B;  4I6N B;  1E7V A;  2MJ3 A;  1Q1O A;  1WGG A;  5E6P A;  4C56 C;  3CST A;  5BYR A;  3UF8 A;  2LFI A;  1R4N I;  3A9K A;  4DHZ B;  3I63 C;  3WCQ A;  3C0R B;  1E8X A;  1JRO A;  1UGJ A;  3R2T A;  4ZRJ A;  4W9H A;  1OEY J;  1SIF A;  1XLN A;  1KOT A;  3TEY A;  2Z0E B;  3Q3F A;  4FLH A;  4WQO B;  2QIL A;  4YSY B;  1QKZ A;  4L1B A;  1NEK B;  1XCQ L;  5BO4 B;  2LEK A;  1JWS D;  1YIW A;  5FK9 C;  3Q3N C;  4MEM A;  4WWO A;  2JU6 X;  5HFY A;  4HXD A;  2KQ4 X;  3VDZ A;  4GB9 A;  1WSP A;  3BIN A;  2FNJ B;  2J0J A;  4QAY A;  1SF0 A;  2L8J A;  3KQ4 A;  1JWA D;  3BK2 A;  5AUK A;  3BWU D;  4EZK A;  5IN7 A;  1FIQ A;  3RZF A;  4DXG A;  3KUZ A;  4A3P A;  1D5X C;  1R4M I;  4P1C C;  2DEN B;  4L23 A;  1MHX A;  3IT4 B;  4XX5 A;  2KWU B;  2KLC A;  2BWE S;  4OVZ A;  1NDD A;  1WRI A;  3AE5 B;  1WX9 A;  2DYO A;  4LNK A;  2KFK B;  3R8B A;  4EFO A;  4II3 B;  4RF0 A;  3Q2A C;  5LXH A;  2RGF A;  4M8M A;  2INP E;  2J42 A;  3ZYY X;  4KGS A;  2I1K A;  3TEW A;  4WIP A;  1SSN A;  1WI0 A;  2WXM A;  3AEA B;  2AEH A;  1J7C A;  2XBB C;  3IBE A;  2O2V A;  3O65 B;  2BBC A;  2LXC A;  5EDS A;  3LJ3 A;  4AS1 A;  3EEC A;  2YLM A;  2WU2 B;  1NEN B;  1XLQ A;  2Q5W D;  3OAW A;  4EEW A;  4MH0 E;  2K39 A;  3L13 A;  1HE8 A;  2KHW B;  2KTR B;  1SE3 A;  3IVF A;  3OWE B;  1OQY A;  4F7Z A;  2YEP F;  1K52 A;  4AP4 C;  1SJH D;  5HG2 A;  4ZYS A;  2KD0 A;  2O6V A;  2BGF A;  4GOC A;  2KMA A;  4IWP A;  2GBK A;  2QJL A;  1BUI C;  4S0R A;  1IBX A;  1FD6 A;  3NZ3 A;  4DHZ E;  1XT9 B;  3R2I A;  4MM3 A;  2XK5 B;  1YNT E;  5LNK 1;  2J0M A;  1I4H A;  3RNA C;  3RUI B;  1T6B X;  3SDL C;  2ICI A;  1SE9 A;  2LUE A;  1I4X A;  5G2N A;  1UWX A;  3SEB A;  3DQV A;  4NAW B;  3DWG C;  4TKN A;  2KN5 A;  4WAF A;  5KHO A;  4G50 A;  1NI2 A;  5DCN A;  2CU1 A;  4RCO A;  1QOF A;  2KK8 A;  5EE0 A;  3QAR A;  2M0X A;  3L10 B;  1ACC A;  2D2Q A;  2MH7 A;  1XO3 A;  3DDC B;  5IAA C;  3PGE A;  3AEG B;  4GDK A;  2BB6 A;  4W9C A;  3R66 C;  2WXP A;  3ML9 A;  4K7S A;  1OQQ A;  2K3U A;  1YJI A;  3TIX A;  2IDY A;  3AE1 B;  2JSV X;  1P9D U;  4AUQ C;  2LD9 A;  1GJZ A;  2WXL A;  1L6V A;  2BF8 B;  2KT7 A;  2V0G A;  1HTQ A;  3B1L X;  1TTN A;  4BKG A;  3ZW3 A;  1FXI A;  2DNF A;  2GLS A;  4CHK A;  4XGA B;  1RLF A;  2WU5 B;  4USA A;  2DZI A;  3URY A;  2CJN A;  2KDB A;  1JQ4 A;  2K8H A;  1EWC A;  3VUX A;  4IG7 B;  1WX8 A;  1P7F A;  3VR8 B;  4ZHP A;  1VR9 A;  3DBL B;  4JWS C;  1E9M A;  4WJP A;  2WWZ A;  2KXJ A;  2IO0 B;  1VJK A;  1E0Z A;  2KN4 A;  1TS5 A;  4XDD A;  4N9F 4;  5EE9 A;  3EC8 A;  2VZK D;  3TCA A;  2JWU A;  1V1P A;  1L6U A;  2LMC A;  5CHF A;  3A4S C;  2N9K A;  2JZP A;  2Y5B B;  4MJS A;  4ANV A;  3BYY B;  4IWO A;  2WS3 B;  2ZVO A;  4KIK B;  3K9P B;  2PE9 A;  5HKH A;  2D3C A;  1YJJ A;  1N61 A;  2PEA A;  1J0G A;  2ZPN A;  3PTF C;  4YTP B;  3E9S A;  3JYU A;  1FNW A;  3NVY A;  2BYE A;  4J6I A;  5G55 A;  3O13 A;  4FN2 A;  4BKS D;  3SFE B;  2WQY B;  2KTF A;  4NAM A;  2EKE C;  3RZW C;  1L5P A;  4ANU A;  3VUW A;  3VFK A;  3NOB A;  2NBU A;  1ZP0 B;  2WXF A;  5CX3 A;  4E3C A;  2IO3 B;  3MHS D;  2AL3 A;  2MJD A;  3RFZ B;  2V4I B;  3L0W B;  3AEE B;  4CO7 A;  1WJU A;  2KMM A;  2PVO D;  1C3T A;  4EUT A;  4ZRQ A;  2JVC A;  3ZTC A;  3ZJU A;  3DVN U;  3Q3O C;  1WR1 A;  2V9H A;  3RPF C;  1TKG A;  1YOV B;  5CHV C;  1ZUD 2;  2QEJ C;  4PYU A;  4ITK A;  2QSD A;  3W5U B;  1FRD A;  1V2Y A;  2N9X A;  2LJ5 A;  4HLE A;  4XYC A;  4AJW A;  1QLB B;  3QAQ A;  3VH4 B;  2KWV B;  3RNF C;  4ZRP A;  1KTK A;  1K50 A;  4LJP B;  4K1R B;  3TUO A;  4GN1 A;  3AEC B;  3P4S B;  1GUA B;  4MEL A;  4Q2J A;  1J7A A;  2A5U A;  2W54 A;  2X8X X;  4G3X B;  1UF0 A;  2C7M B;  3A1Q B;  1CK1 A;  1EWY C;  1V5O A;  4GXB A;  3KWL A;  3AXC A;  2OHF A;  3SU8 X;  1ROE A;  4JLC A;  1Y56 A;  2LAS A;  2Y5P A;  3H7P B;  1U4A A;  1WWT A;  2IY1 B;  1YJ1 A;  3VXW A;  3EFU A;  3T3O A;  1F77 A;  1YQ4 B;  2BKF A;  4TV3 A;  1AYF A;  5D7G A;  5IO9 A;  1A70 A;  4MGY E;  1T5X D;  1C76 A;  4RF1 A;  3DHG C;  2DX5 B;  1FEH A;  2LHE A;  2L83 A;  4MT5 A;  4XE0 A;  1YD8 U;  3UIO B;  3N32 A;  1XEE A;  3N9Y C;  2ZNV B;  3M3J A;  4TMA B;  1WMH A;  3PHX B;  4YTM B;  3PHW B; 
#chains in the Genus database with same CATH homology
 3D32 A;  1Z2M A;  2MX2 A;  4MJS B;  3ZVV A;  4I6N B;  1WMH B;  3APF A;  1E7V A;  3ZNG C;  1Q1O A;  1WGG A;  1C1Y B;  5E6P A;  2CS4 A;  2DYM A;  5DPS A;  2FID A;  1PQS A;  3DBS A;  2BPS A;  2JT4 B;  2JZ3 B;  2LXA A;  4KDL B;  5J2R A;  2OJR A;  3CST A;  3N3K B;  3NY5 A;  3UF8 A;  4RM9 A;  1R4N I;  1WE7 A;  2LI5 A;  2KTR A;  3A9K A;  3M95 A;  3DVG Y;  4BKT A;  1WR6 E;  2KLG A;  3A9J A;  3UQA A;  2HE7 A;  4IC7 B;  4DHZ B;  2Z0D B;  3C0R B;  1GC6 A;  1UH6 A;  2ZZP B;  1XQQ A;  1WM3 A;  1E8X A;  4A20 A;  4KSL C;  2RD0 A;  2VRR B;  2PE6 B;  4GMV A;  4PS7 A;  4HWI B;  1E7U A;  2LRU A;  4ZRJ A;  4FHK A;  4W9H A;  4I6P A;  1OEY J;  1SIF A;  4WJQ A;  1KOT A;  2FCN A;  2IBI B;  2Z0E B;  3Q3F A;  1V6E A;  3PLV A;  4FLH A;  4WQO B;  3VTV A;  3ZNZ B;  2HD5 B;  3CSF A;  2L05 A;  2WX0 A;  2BWF A;  3HK0 A;  2DZJ A;  2KFJ A;  2ASQ A;  2KQS A;  1BT0 A;  2K6Q A;  4ICV A;  4FBJ B;  3WAN A;  3PVL A;  5BO4 B;  1WYW B;  4FJV B;  4BVU C;  4HCP B;  3N30 A;  1YIW A;  1L7Y A;  4MEM A;  2W9N A;  4GGQ A;  4HDQ A;  4NAW A;  4WWO A;  5C23 A;  5C1Z A;  3QC8 B;  3B08 A;  2AL6 A;  2BYF A;  1V5T A;  4HXD A;  4ICU A;  4MSQ B;  2N7E A;  2EMT A;  4HK2 A;  3VDZ A;  1A5R A;  1RFA A;  4GB9 A;  2KJ6 A;  3BIN A;  2D11 A;  4GIV A;  2FNJ B;  2J0J A;  2NBW B;  1YX6 B;  3H1U A;  5AZF A;  2C5L C;  2GOW A;  2L8J A;  2UWQ A;  2FIF A;  2L0T A;  4EOY A;  4DK5 A;  1D3Z A;  4BFR A;  2MQJ A;  4EZK A;  2L76 A;  1IP9 A;  1AAR A;  1FXT B;  3RZF A;  3PSE B;  1UBQ A;  2N1V A;  3KUZ A;  3U7D A;  1WGR A;  4WWP A;  4A3P A;  3KYD D;  1R4M I;  3JSV A;  2DEN B;  2KAN A;  4XX5 A;  3KW5 B;  2KKC A;  3R7Q A;  2KWU B;  2KLC A;  3JSV B;  2BWE S;  3WAP A;  1NDD A;  2LVO A;  2KFK A;  1WX9 A;  3DOW A;  1P1A A;  4G0N B;  2JRH A;  2DYO A;  3KH0 A;  2DAF A;  2KFK B;  4EFO A;  2HJ8 A;  4II3 B;  2N9P C;  3AI5 A;  4BBN C;  5LXH A;  2RGF A;  4M8M A;  1IYF A;  1WH3 A;  4ANW A;  4W9I A;  3TL5 A;  2NR2 A;  2NBV B;  4M0W B;  3EHV A;  2I1K A;  5CTR C;  3PZD A;  2MA9 B;  3OLM D;  5LLI A;  3U8Z A;  4DHJ D;  2K25 A;  3S2A A;  2YVC A;  1V49 A;  1WI0 A;  2M17 A;  3V62 A;  2JF5 A;  1H8C A;  2AEH A;  4I6L B;  1GC7 A;  4NY0 A;  2DZM A;  2XBB C;  4TQ0 A;  2KX0 A;  3IFW B;  3IBE A;  2O2V A;  1P0R A;  1KJT A;  3JVZ X;  3O65 B;  4E74 A;  5JHA A;  4NQK E;  5E6N A;  4CYE A;  4IW0 A;  4ASW C;  2LXC A;  5EDS A;  1GG3 A;  1SGH A;  2O2V B;  3LJ3 A;  2MBB B;  4HDO A;  5GMV A;  4DXA B;  5L83 A;  2G45 B;  3EEC A;  1H4R A;  2YLM A;  1XD3 B;  2DAJ A;  3WIM A;  4W9D A;  3TJP A;  1CMX B;  3ZLZ A;  1WGY A;  2KX3 A;  1E8Z A;  4IUM B;  1RRB A;  2N7D A;  5JHB A;  1UZX B;  1WRD B;  1E8Y A;  3A4R A;  3KYC D;  3ZUN A;  2G4S A;  4ZRI A;  3OAW A;  4W9J A;  3X0W A;  1EF5 A;  4EEW A;  1OTR B;  4MH0 E;  3NS8 A;  3NZU A;  2K39 A;  3L13 A;  1HE8 A;  3AU4 A;  2KHW B;  3A9K B;  2KTR B;  2Z59 B;  2NS5 A;  5TR5 A;  2KDF B;  3QIJ A;  3A9J B;  3AUL A;  3DPD A;  2CHZ A;  4LCD E;  1TZ1 A;  2FCS A;  2ZVN A;  3IVF A;  3LDZ E;  4K7W A;  2KC1 A;  1OQY A;  1X1M A;  5AZH A;  4F7Z A;  4DWF A;  2DHZ A;  4AP4 C;  1I35 A;  3HM3 A;  3PRM B;  2G4D B;  5D2M B;  2KD0 A;  2O6V A;  2BGF A;  2PJH A;  3DBR I;  3QHT A;  1L2N A;  4W9G A;  3VUY A;  2AYO B;  4GOC A;  2G3Q B;  2KMA A;  1YQB A;  2D07 B;  2GBK A;  3H6N A;  4IWP A;  2CHW A;  4GSW A;  4W9L A;  3NHE B;  1WXM A;  3WAM A;  2KJR A;  1E90 A;  4HPM B;  2XK5 A;  5L95 C;  3L08 A;  2LGD A;  1UEL A;  4DDI D;  1XT9 B;  4MM3 A;  4DHZ E;  2XK5 B;  3ZNH B;  1IPG A;  1WM2 A;  2WDT B;  2J0M A;  3RUI B;  2BYV E;  2DZK A;  2KQ7 A;  4BKS A;  3GZN I;  1S1Q B;  3UGB B;  4AWJ A;  1WY8 A;  2WYQ A;  3SDL C;  1WXA A;  1SE9 A;  2C9W B;  2LUE A;  3RT3 B;  3ZRC A;  1V9J A;  5G2N A;  1Y8R C;  2N4F A;  3ZIM A;  3DQV A;  2KDI A;  3W1S C;  5FR6 A;  2FCM A;  4NAW B;  3PT2 B;  2C60 A;  3PPA A;  3OJ3 A;  4EKU A;  4TKN A;  3RYT A;  3T9L A;  2NVU I;  3VTU A;  2KN5 A;  3H7S A;  2LZ6 A;  1TGZ B;  5KHO A;  3SD5 A;  1QZE A;  4G50 A;  1NI2 A;  3RCZ A;  5DCN A;  2CU1 A;  5J18 A;  3QQ8 B;  2KK8 A;  3QJZ A;  3TMP B;  1UBI A;  2L7R A;  3AU5 A;  4IM0 A;  4IWQ A;  3QAR A;  2ZNV C;  4XC2 A;  4IM3 A;  3ZNI D;  1ZW7 A;  2M0X A;  2MBQ A;  3DCG A;  3L10 B;  2D10 A;  4WJN A;  2R2O A;  2D2Q A;  3APC A;  2JUO A;  2ZCC A;  3ZO5 B;  2DYB A;  3ZDT A;  2MSE D;  4KVG B;  3WA0 A;  3QA8 A;  2EMS A;  3V6C B;  3DDC B;  3PRZ A;  1OEY A;  1WFY A;  5IAA C;  4KDI C;  3PGE A;  4GDK A;  4WJO A;  2V3S A;  5LXI B;  1J19 A;  1Z5S B;  4W9C A;  3WAL A;  1VCB A;  2FAZ A;  2RPQ A;  3R66 C;  1WF9 A;  4IM2 A;  3PRP B;  4NJ7 A;  4FJY A;  3ML9 A;  2LGX A;  4NPN A;  3PS6 A;  4K7S A;  1E8W A;  3TIX A;  1P9D U;  5D6J B;  2LD9 A;  4AUQ C;  1WIA A;  4PYZ A;  4YL8 A;  3V60 A;  1GJZ A;  4HCN B;  5DPW A;  3H9D A;  2BF8 B;  2IYD B;  1EO6 A;  3M62 B;  4ZRK A;  1VD2 A;  3B1L X;  3VQI A;  1TTN A;  1V86 A;  3QWZ B;  4X57 B;  5CHW A;  3KUC B;  4BKG A;  3CMM B;  3ZW3 A;  2KMC A;  2GMI C;  1ZKH A;  3HM6 X;  1EF1 A;  4CHK A;  1RLF A;  2JPH A;  4B6W A;  3DBL I;  3ZRF A;  1LM8 B;  4GDL A;  3TBL D;  2DZI A;  2KC2 A;  1Q0W B;  4M8N A;  2KDB A;  4K7U A;  2ZPY A;  2IZV B;  2K8H A;  3W1Y A;  4B9K A;  3H7P A;  3VUX A;  1WJ4 A;  4IG7 B;  2L3Z A;  4RM8 A;  2NCN A;  4A3O A;  4PS8 A;  1WX8 A;  3U30 A;  1UD7 A;  1ZGU B;  1WE6 A;  2CHX A;  4PS3 A;  5E6O A;  3W1S A;  1S3S G;  2IO1 B;  4FAD A;  5KHQ A;  3KUD B;  2KJH B;  2MBH A;  2GBR A;  4JQW C;  2AWT A;  4MGI E;  3VTW A;  1KM7 A;  2JY6 A;  4WJP A;  4HJK A;  2WWZ A;  2KXJ A;  2K8C A;  2IO0 B;  4HVB A;  1UGM A;  4FA6 A;  4W9E A;  3IHP C;  4N9F 4;  4JGH B;  3EC8 A;  3TCA A;  1WJ6 A;  2KO3 A;  4NNJ B;  4OVU A;  4URK A;  3RUL A;  4WAA A;  5CHF A;  3A4S C;  4KSK C;  2CR5 A;  2RSU A;  2Y5B B;  4MJS A;  4KIK A;  1G6J A;  4ANV A;  4EZJ A;  3ENE A;  3ONS A;  3PRE A;  2RR9 A;  3UIN B;  4IWO A;  4AOF A;  2ZCB A;  2ZVO A;  3GOE A;  3M63 B;  4KIK B;  3K9P B;  2M4N A;  2PE9 A;  3ML8 A;  1WGH A;  5HKH A;  4OVV A;  3WAO A;  2O6V D;  1WJN A;  2C7H A;  2PEA A;  1V81 A;  1J0G A;  2ZPN A;  3PLU A;  3PTF C;  2ZEQ A;  2LWP A;  3HIZ A;  2MRP A;  3JYU A;  4P7I A;  2FCQ A;  2MCN B;  2HTH A;  2IY0 B;  3R3M A;  3BY4 B;  1WXV A;  2BYE A;  2O6V B;  3CF6 E;  4W9K A;  2K6D B;  4BOS C;  4FUL A;  4J6I A;  5G55 A;  2GBN A;  3L17 A;  3B0A A;  3V6E B;  2MW5 A;  3L54 A;  4FN2 A;  4BKS D;  4RMA A;  1JRU A;  4BBN F;  2UYZ B;  5AZG A;  1WZ3 A;  3Q3J A;  3P2B A;  2KTF A;  2MWS B;  1V80 A;  2EKE C;  2MLB A;  2J7Q B;  3RZW C;  4ANU A;  3VUW A;  5D94 A;  4KZC A;  3VFK A;  2N1W A;  5DPT A;  2LGY A;  3OJ4 B;  1WZ0 A;  3NOB A;  2NBU A;  2QHO A;  3A33 B;  4FHJ A;  2L00 B;  4JIO U;  3T8M A;  5CX3 A;  4E3C A;  3VAW A;  2IO3 B;  3MHS D;  2AL3 A;  1LQB A;  3DBH I;  4JL9 A;  1TBE A;  3I3T B;  1WX7 A;  1LFD A;  3V61 A;  1J8C A;  4B95 A;  3KVF B;  2WX1 A;  3L0W B;  1GNU A;  1M94 A;  4CO7 A;  2L0F A;  2BKR B;  2KOX A;  3X23 A;  1WJU A;  4EZL A;  4MSM B;  2JXX A;  4TQ1 A;  4MDK E;  2K8B A;  2GBM A;  4GU2 A;  1C3T A;  3UIP B;  2OOB B;  4EUT A;  2MBO A;  3K9O B;  3PV1 A;  2N9E B;  2JVC A;  4FJZ A;  3ZTC A;  3HHM A;  5JH5 C;  3DVN U;  4ZDV A;  3R7R A;  3JW0 X;  3ECI A;  3VVW B;  2C7N B;  1WR1 A;  3QK0 A;  1P3Q U;  2KVR A;  1YX5 B;  4F8C B;  5CHV C;  2IO2 B;  1I42 A;  4PYU A;  4GDK B;  3RD2 A;  1KLV A;  3ZKJ C;  1V2Y A;  2N9X A;  2M8S A;  2LJ5 A;  4MGZ E;  4NJ6 A;  4HLE A;  4AJW A;  2V4L A;  2I1J A;  3VH3 B;  3QAQ A;  3QCA A;  2LVP A;  3NZS A;  2GBJ A;  3APD A;  3VH4 B;  2KWV B;  2MP2 A;  2JRI B;  2KNB A;  2R2Q A;  4K81 A;  4II2 B;  4LJP B;  1T0Y A;  5JZE B;  4WWN A;  4K1R B;  5DPR A;  4GN1 A;  4TUU A;  2MP2 B;  1GUA B;  4MEL A;  5AEK B;  3MTN B;  3A1Q A;  4W9F A;  4LJO B;  2A5U A;  2NPT A;  4HPL B;  4ANX A;  1NBF C;  2MBE A;  4G3X B;  3ZTD A;  2C7M B;  3A1Q B;  1F9J A;  2D3G A;  2NPT B;  4MGK E;  4DBG A;  3L16 A;  1V5O A;  1P98 A;  4GXB A;  4KZ0 A;  3QX1 A;  2REX A;  2KZR A;  3AXC A;  1RAX A;  3VHT C;  3SU8 X;  2V1Y A;  1OGW A;  4GDL B;  1LXD A;  4JLC A;  2KWC A;  2LAS A;  2PPH A;  4BOZ B;  2ZJD A;  3H7P B;  2JWZ A;  1U4A A;  2IY1 B;  1YJ1 A;  3VXW A;  3EFU A;  3ZDM C;  4NQL B;  4F1S A;  3MJW A;  2BKF A;  2LRW A;  2FUH B;  1WXS A;  4TV3 A;  5D7G A;  2LVQ A;  4KV2 A;  2KDE B;  1WGD A;  4XZ4 A;  1EUV B;  2K1F A;  4MGY E;  4LDT D;  1MG8 A;  3UQB A;  4G11 A;  1ISN A;  2XEW A;  2DX5 B;  3DVN V;  1K8R B;  2JZZ A;  4DHJ B;  3ALB A;  1YD8 U;  2A4Z A;  2B3A A;  5IA7 A;  3UIO B;  3N32 A;  4ZYN A;  4LDT B;  4E71 A;  2ZNV B;  2CKH B;  3DVG X;  3M3J A;  4AJY B;  5J17 A;  1Q5W B;  3SHQ A;  4DDG D;  1WMH A;  3PHX B;  3IG3 A;  2J0K A;  3PHW B;  2M1M A;  1E5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...