1RLFA

Structure determination of the ras-binding domain of the ral-specific guanine nucleotide exchange factor rlf, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
90
structure length
90
Chain Sequence
GSSDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEFELVQLLPGDRELTIPHSANVFYAMDGASHDFLLRQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure determination of the Ras-binding domain of the Ral-specific guanine nucleotide exchange factor Rlf.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction protein
molecule keywords RLF
total genus 12
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1rlfA00
2JRIB 4HCPB 3ZDTA 1L7YA 1WYWB 3KW5B 4W9JA 5L95C 4TQ0A 4GDKA 1V6EA 3ZNID 2OOBB 3L10B 4G50A 4K7SA 1S1QB 3VH3B 2G3QB 2N9EB 2MP2B 3AXCA 4ZYNA 2KFJA 2AL6A 2KJRA 1WGGA 1WRDB 4PS8A 2ZPYA 4DXAB 3PPAA 1WGRA 3A9JB 4JQWC 2LD9A 4BVUC 1LFDA 1XD3B 2MBQA 5J2RA 2DZJA 3PHWB 4BKGA 3QC8B 4TV3A 3U7DA 3H7PB 3RT3B 4M8MA 3VUWA 3A4RA 4ZRKA 4KIKA 4RMAA 3KUCB 3JW0X 2WDTB 2M0XA 2KDFB 2ZVNA 2N9PC 3V61A 3RUIB 4KVGB 3UF8A 3UINB 2BWES 3NHEB 3WAMA 1AARA 5FR6A 3CMMB 4XZ4A 2BGFA 2JF5A 3PGEA 3VFKA 2A5UA 4FADA 2UWQA 4BOZB 1T0YA 2KTRA 3OJ4B 4WJQA 4AJWA 3KVFB 5D6JB 2DYBA 3U8ZA 5JHAA 1IYFA 2Y5BB 1WX7A 2G45B 2BPSA 2MA9B 3GOEA 2XEWA 3HM3A 2D10A 3R7RA 2CHXA 2KK8A 4HDQA 3ML9A 4RM9A 1WY8A 2DAJA 2LXAA 2MP2A 1E90A 2AYOB 4EOYA 3L54A 5AZFA 3IBEA 4IG7B 4TUUA 3QIJA 2Z0EB 4NQLB 2J0KA 2LASA 2DZIA 3KYCD 1YD8U 4IM0A 4MGIE 3S2AA 3O65B 5JZEB 3DCGA 2RPQA 5BO4B 1J19A 3V6EB 3DBLI 1C1YB 3H7SA 3DVNV 4ICUA 4LJPB 4AWJA 1YX6B 3ML8A 3WAPA 2AEHA 2IZVB 4FLHA 4W9KA 3WANA 2NS5A 1Q0WB 2XK5A 1KJTA 1EF5A 4I6PA 4WJPA 2KFKB 2KMAA 1WE6A 4KDIC 2WX1A 2MQJA 3R66C 4JIOU 1WMHB 4JGHB 3ECIA 1OEYJ 4AOFA 2KO3A 4DDGD 3Q3FA 4W9FA 2ZCCA 3IG3A 4HPMB 2GMIC 2C60A 2GBJA 4W9EA 1VCBA 3DBSA 3BINA 5EDSA 4NAWA 1TTNA 1R4MI 2PE6B 5JHBA 2NR2A 2L76A 2MX2A 3L16A 3VUXA 3I3TB 3JSVB 2FAZA 2O6VB 3OLMD 2LZ6A 1ZKHA 4NY0A 2BKFA 4G3XB 3SHQA 1TZ1A 1FXTB 2FNJB 4ASWC 2NPTB 3ONSA 2KC1A 5AZHA 4BFRA 4A20A 3VVWB 4HDOA 2JZZA 4OVUA 4W9CA 2CHWA 2JPHA 1BT0A 2WYQA 1EF1A 3UIPB 1NI2A 4PYUA 4F7ZA 1E7VA 3QARA 1UD7A 4TQ1A 1GG3A 4JLCA 3A1QB 3WALA 2C7MB 1LM8B 2BF8B 3RZWC 1JRUA 1YX5B 2XBBC 1I42A 2D11A 3M63B 4WQOB 3VH4B 2KXJA 2N9XA 4EZKA 4KSKC 2KWVB 1OTRB 1EO6A 2KX3A 2MBBB 1Q5WB 3AULA 4ANUA 2L05A 2PE9A 2QHOA 4I6LB 1I35A 4ANWA 3DVNU 3IHPC 1IPGA 2O2VB 4BBNF 2L3ZA 2BKRB 2M1MA 3H9DA 2K8BA 4KSLC 1G6JA 1LQBA 4DHZE 1F9JA 1RFAA 2LVOA 2NBWB 3AI5A 3PRPB 4IWOA 1E8YA 2CS4A 1V49A 3JSVA 4NJ6A 3KYDD 3DBHI 4IWQA 2HTHA 3UGBB 1Q1OA 3PLUA 1J8CA 2DYMA 2C5LC 4FHKA 3ZNGC 2V4LA 2ZNVC 2N1VA 4XC2A 5CTRC 2GOWA 2KWCA 1P1AA 2MBOA 3X0WA 4GIVA 1KLVA 2FCSA 4G0NB 4A3OA 1WJNA 2N4FA 2C9WB 5AZGA 4BKSD 3A33B 2IY0B 3PRMB 2G4SA 2N7EA 3EFUA 3APDA 3W1SC 2K1FA 2CR5A 2LGYA 4AJYB 1WGHA 2ZCBA 3W1YA 5KHOA 4AUQC 1WF9A 3DVGY 3X23A 4BBNC 2I1KA 2EKEC 4GB9A 2LGDA 5CHFA 3ZTCA 2FIDA 1L2NA 2KLCA 2L00B 2KJHB 2MRPA 4N9F4 4A3PA 2ZPNA 5D2MB 5DPRA 1NBFC 4BKSA 3H7PA 4LDTD 4W9LA 3DPDA 2DENB 2KOXA 3QCAA 2UYZB 2KX0A 2EMTA 3ZNHB 1A5RA 1R4NI 5E6PA 4DK5A 3M95A 2MLBA 2RSUA 4MH0E 4AP4C 2KQSA 4E74A 4KIKB 4X57B 3Q3JA 2LRUA 1C3TA 4B95A 2KTRB 2LJ5A 3JYUA 2KWUB 4FN2A 3PZDA 4WAAA 2ZNVB 5KHQA 1NDDA 2V3SA 1V9JA 2HE7A 3NOBA 1WXSA 2JRHA 3CSTA 2GBMA 3M3JA 1P98A 2FCMA 3R3MA 4MGKE 3MTNB 1Z2MA 4ZDVA 4P7IA 3GZNI 4MSQB 3M62B 3A9KA 2CU1A 1TGZB 4GDLB 3K9OB 1OQYA 2MWSB 5LXIB 3TMPB 4GGQA 2N1WA 2REXA 4BOSC 2IBIB 3BY4B 3TL5A 1QZEA 3A9JA 3TJPA 1WI0A 4JL9A 2M8SA 3CF6E 3N30A 3L08A 2KDEB 2ZEQA 2WX0A 1VD2A 3RZFA 3ZLZA 4DHZB 2EMSA 1UGMA 2KANA 2R2QA 2RGFA 4K7WA 3VQIA 4IM2A 1P3QU 3QA8A 5CHWA 5HKHA 4FBJB 2NCNA 5D94A 2KLGA 2KDIA 4CO7A 1V2YA 3APFA 1WZ0A 1E8WA 1YQBA 2KKCA 4FHJA 4I6NB 4MJSA 4PS7A 3SU8X 2ZZPB 4NAWB 4MELA 1GC7A 2DZKA 1WGYA 2J0MA 3KH0A 1H8CA 4GDKB 4MEMA 3NY5A 2W9NA 4J6IA 3VTUA 3B1LX 2YLMA 2D2QA 4YL8A 4EZLA 1V5TA 2JXXA 2LGXA 2Z0DB 3ZIMA 1IP9A 2I1JA 1UH6A 3D32A 3AU4A 3PLVA 4PYZA 4FJYA 2JZ3B 4GXBA 1GJZA 3OAWA 3DQVA 1U4AA 4LCDE 4KDLB 3VHTC 2BYVE 2KMCA 2BYEA 4ICVA 3PHXB 3PRZA 2MSED 3A4SC 5CHVC 3ENEA 3KUZA 5DPWA 3L17A 4II3B 2GBNA 1E8ZA 2L0TA 2K8CA 5CX3A 4HPLB 4W9GA 4DWFA 2HD5B 3NZSA 4GU2A 3JVZX 5D7GA 2O2VA 3QAQA 2D3GA 1UBIA 4DHJB 3OJ3A 4W9IA 4DHJD 4GOCA 2YVCA 3QWZB 2MCNB 1LXDA 2KJ6A 3PVLA 2IO0B 4KZ0A 4DDID 3ZKJC 2LUEA 2LI5A 3APCA 3B0AA 2M17A 1K8RB 1P0RA 3U30A 4EUTA 2NBUA 3IFWB 3NZUA 3N32A 5DCNA 3VUYA 4NPNA 3ZO5B 2FIFA 2R2OA 5E6OA 1V80A 4PS3A 3T9LA 2XK5B 3AU5A 4HVBA 1GUAB 1YIWA 1WXVA 2BYFA 2HJ8A 5IA7A 2KC2A 1MG8A 4MGZE 1ZGUB 4K81A 2LRWA 1XT9B 3C0RB 2L8JA 1CMXB 2MW5A 2DZMA 4RM8A 4FA6A 4WWNA 1PQSA 1V5OA 5IAAC 2KZRA 5TR5A 2FCQA 2KD0A 5JH5C 1WGDA 3EECA 5GMVA 3P2BA 2DYOA 4W9DA 2O6VA 4HCNB 3ZTDA 3H1UA 3L0WB 2DX5B 2KVRA 4WWOA 1WJUA 5J18A 1SGHA 1WXAA 3WA0A 5G2NA 3LJ3A 1WM2A 2LVPA 1OGWA 5L83A 3RULA 2FUHB 1HE8A 4IC7B 2C7HA 2ZVOA 3A1QA 3MHSD 3R7QA 1WXMA 3W1SA 1E8XA 3QHTA 2IYDB 1V86A 3L13A 4XX5A 1D3ZA 4HK2A 5DPTA 2GBRA 2K39A 2KHWB 3DDCB 4HJKA 3EHVA 4MSMB 3VTWA 4HXDA 1WH3A 2G4DB 2K6DB 4ZRIA 2VRRB 1WFYA 1M94A 1H4RA 1WX8A 2LVQA 4WJNA 1S3SG 1KOTA 4E3CA 4KV2A 4II2B 5DPSA 1WR6E 2BWFA 2WWZA 3DOWA 4MGYE 3PV1A 4CHKA 3DBRI 2RR9A 5G55A 3V60A 1P9DU 1WIAA 1YJ1A 2KQ7A 3HM6X 1ISNA 5LLIA 3RCZA 2D07B 2J7QB 5C1ZA 2L0FA 4HLEA 4M0WB 3HHMA 4TKNA 4B9KA 1Y8RC 4FJZA 4KZCA 1RAXA 3ZVVA 4ANXA 4MJSB 4EZJA 2L7RA 1SIFA 3VAWA 1RRBA 2RD0A 4GSWA 4ANVA 3ZRFA 3ZDMC 2ASQA 3PREA 4NNJB 1EUVB 4M8NA 3WIMA 4LDTB 4MM3A 1UELA 3V62A 3UQAA 4FULA 4B6WA 3ZRCA 3PS6A 2KFKA 2MBHA 4EKUA 3RYTA 1GC6A 1WE7A 2FCNA 2C7NB 5AEKB 5LXHA 2PEAA 2K6QA 3DVGX 1WJ4A 3NS8A 3EC8A 3RD2A 2JWZA 2NVUI 3N3KB 2K8HA 4CYEA 1WX9A 3VDZA 2GBKA 4IUMB 1WM3A 2PJHA 3ZW3A 1SE9A 1OEYA 4OVVA 1GNUA 2LWPA 3B08A 3IVFA 3KUDB 3UQBA 2N7DA 2JUOA 2V1YA 2AL3A 2KTFA 3T8MA 3QX1A 2CKHB 3H6NA 4DBGA 3HIZA 4URKA 4G11A 2NPTA 3SD5A 1UZXB 2OJRA 2Z59B 1WZ3A 3QQ8B 4WWPA 4NQKE 2PPHA 2KNBA 4HWIB 4K7UA 2KN5A 4F8CB 4K1RB 2JT4B 1E5WA 2IO3B 4W9HA 3WAOA 3ZUNA 2JY6A 3PTFC 3TBLD 1WR1A 5J17A 1ZW7A 3UIOB 1RLFA 4IW0A 4ZRJA 5C23A 1WJ6A 2K25A 3A9KB 4GDLA 3TCAA 4EFOA 4F1SA 4FJVB 1UBQA 1WMHA 1Z5SB 2MBEA 2DAFA 2DHZA 3K9PB 1V81A 1E7UA 2KDBA 3PSEB 4BKTA 1X1MA 2JVCA 4EEWA 2AWTA 2M4NA 3ALBA 4GN1A 2ZJDA 3VXWA 4LJOB 4GMVA 4MDKE 3TIXA 3V6CB 3QJZA 1J0GA 2B3AA 2IY1B 2IO1B 1KM7A 3CSFA 3LDZE 3SDLC 3HK0A 4IWPA 3MJWA 5E6NA 3QK0A 4E71A 2O6VD 3ZNZB 4IM3A 4NJ7A 1TBEA 4WJOA 2CHZA 3PT2B 3VTVA 2A4ZA 2NBVB 2J0JA 2IO2B 1XQQA 2LXCA
chains in the Genus database with same CATH superfamily
4HCPB 1V1PB 1WYWB 4W9JA 2M56B 3Q8FA 4BAXA 1KFYB 3VH3B 2G3QB 2MP2B 2KFJA 4KGTA 4CQNA 3AE6B 2KJRA 1WRDB 2HDEA 2ZPYA 3DBRB 2BS2B 4JQWC 2JX5A 2XN9C 4KGSA 1FXIA 3PO0A 3H7PB 3A4RA 4ZRKA 4KIKA 2WDTB 1FCLA 3UINB 1I4GA 2KN4A 2JF5A 3VFKA 1HTOA 4FADA 2INCC 3Q14C 4BOZB 1T0YA 2KTRA 4WJQA 1VZ7A 5D6JB 1IYFA 2Y5BB 1WX7A 3GOEA 1N60A 2VZKB 2D10A 4ZHPA 2CHXA 3MP9A 2LXAA 1E90A 2AYOB 2KAJA 3L54A 4TUUA 2PLPA 4DXGA 3QIJA 5FKAC 2AQ3B 3KYCD 1SXTA 3W5VB 5BO4B 3H7SA 3DVNV 3WAPA 1VZ6A 1J7BA 2IZVB 1SJHD 3WANA 3BVMA 1KJTA 1YNTE 3Q2AC 4JGHB 2QILA 1WWTA 2KO3A 3Q3FA 4W9FA 4HPMB 3I63C 4W9EA 1VCBA 3DBSA 4NAWA 3U7ZA 1L0XB 2PE6B 3P42A 2MX2A 3VUXA 1NYRA 3I3TB 3OLMD 2QDFA 2RDHA 3H8HA 5C2TB 2FNJB 4YTNB 4ARCA 3ONSA 3VR8B 4HDOA 4OVUA 4W9CA 1MVKA 1BT0A 2WYQA 2I38A 5BMIA 4MACA 4JLCA 3WALA 1JRUA 2D11A 4RF0A 3E56A 3IXSA 2N9XA 2FE8A 1OTRB 2KX3A 1TKYA 2L05A 2PE9A 1TJEA 1I35A 3Q6BA 4ANWA 3DVNU 3IHPC 4BBNF 1WGKA 4WWMA 2BBCA 2M1MA 4KSLC 3P4PB 1F9JA 2LGSA 1V49A 4XYCA 3JSVA 1C77A 2GB1A 2KWCA 2MBOA 3P4QB 2H89B 2N4FA 1K52A 2OJWA 4BKSD 3PRMB 2IY0B 3W1SC 2B76B 3APDA 1WGHA 1M4VA 2E3TA 2W3SA 4LNOA 2BB5A 3KWVA 3URYA 2EKEC 5CHFA 2FIDA 2L00B 1YJJA 5D3DA 2MRPA 5DPRA 1NBFC 2DENB 2IDYA 2LMCA 2KX0A 1RFKA 5E6JA 3RN9C 4DK5A 2WXMA 3M95A 3KQ4A 4KIKB 1VR9A 3RNEC 4X57B 3Q3JA 4A90A 2LRUA 1NENB 2LJ5A 2WLBA 1NDDA 2HE7A 1PUTA 4JX1C 3N1YC 2IGHA 4MGKE 5IP4D 3MTNB 4ZDVA 1V1PA 1STEA 4WAFA 2CU1A 1TGZB 3TMPB 2AX5A 2J42A 4BOSC 3BY4B 3TJPA 4JL9A 3TEXA 1EU4A 5IN7A 1UGMA 2KANA 2RGFA 2JZPA 3Q69A 1YN3A 3VQIA 1P3QU 3RNGC 4FBJB 1V2YA 1YQBA 2Z8LA 4NAWB 2ZZPB 4MELA 1GC7A 1HTQA 2J0MA 3VTUA 4J6IA 2YLMA 4EZLA 1V5TA 1XF5L 2I1JA 1T6BX 4PYZA 4RCOA 2CU3A 3GB1A 3OAWA 1F52A 1P7EA 1GPXA 4ICVA 3PHXB 3PRZA 5T8IA 2WU5B 5CHVC 1L6UA 3KUZA 1PYWD 3RI7C 1TS2A 3L4PA 3P1MA 1GAQB 2HD5B 3NS1A 3JVZX 2YEPB 3QAQA 3OJ3A 2BW2A 2K22A 2L83A 2ON8A 1LXDA 3AEEB 2KJ6A 2V9HA 3SFDB 2IO0B 4KZ0A 4DDID 3NVWA 2LI5A 2M17A 3U30A 4YT0B 4LNNA 4EUTA 4KX6B 3AEGB 4OW0A 2FIFA 2R2OA 1SJED 2QMTA 2XK5B 3AU5A 2BYFA 4MGZE 2X38A 3NJTA 1L4ZB 1OFFA 1ZXHA 5JXVA 4HROA 4RM8A 1R7SA 3AE2B 1JWSD 3BVGA 2J52A 2KD0A 1MHXA 4W9DA 3IAM1 2K5PA 4XE0A 3ZTDA 3L0WB 2DX5B 1A70A 4WWOA 5FR3A 4ARIA 1WXAA 1WM2A 1SB3C 5C3JB 1HE8A 2JXTA 3A1QA 3R7QA 1V86A 4XX5A 2JSVX 2KHWB 3EHVA 1WH3A 2K6DB 4WJNA 1S3SG 1BUIC 2V0GA 5DPSA 1WR6E 4MGYE 2BWFA 2IPKD 4CHKA 3EGRA 2RR9A 3GE8C 5I4DA 1P9DU 5LLIA 1ISNA 2KMMA 5BMGA 4L1BA 2L0FA 4M0WB 3HHMA 4TKNA 2L32A 4MJSB 4EZJA 2L7RA 2MJDA 5IKCM 2K9XA 4LTUA 3VAWA 2RD0A 4GSWA 4YTMB 3B2FA 2IGDA 2KQ4X 1ROEA 3V62A 1VLBA 1VJKA 3DWMA 3UQAA 1I4RA 5G5HA 3ZJTA 2KFKA 2PVGC 5LXHA 1T5XD 1HZ6A 3DHGC 1ET9A 3DVGX 4MT5A 3KWLA 2M0AA 3EC8A 1QF6A 3N3KB 1WX9A 3VDZA 2PJHA 3ZW3A 4LNFA 3ZJUA 1ZDXA 2JUOA 2MJ3A 2BS3B 3SD5A 3J9CA 2Z59B 1SBBB 2KN5A 3P4RB 3BZDB 2IO3B 3WAOA 2LGIA 3O13A 3TBLD 4D2KA 2WU2B 4IW0A 5EE9A 5C23A 2K25A 4UDUC 4EFOA 2H88B 1UBQA 2MBEA 2KYWA 4MH8A 1V81A 1C79A 1FRRA 1KH0A 2INDC 1X1MA 2JVCA 2AWTA 2XNAC 4BZAA 3V6CB 4M01A 2B3AA 3LDZE 3SDLC 3QK0A 4YXDB 2O6VD 3BYTB 4C80A 3ZNZB 2CHZA 4ZRQA 2IO2B 2OOBB 1XQQA 3CIRB 2LFIA 4DXAB 1WGGA 2D3AA 2LD9A 3Q3OC 4US8A 2MBQA 3PHWB 2RDGA 1EU3A 3U7DA 3GE3C 3VUWA 3KUCB 3FC4A 2M0XA 1AW7A 1N62A 1CK1A 3NHEB 3WAMA 5FR6A 1IUEA 3PGEA 3NUHB 2LHEA 2UWQA 3HRDD 3AMZA 2EKIA 2MA9B 3HM3A 3R7RA 4KGRA 2KK8A 4RM9A 1WY8A 2DAJA 4IG7B 3CWIA 2J0KA 1I4PA 1GB1A 4IM0A 1J19A 3DBLI 1N5XA 4ICUA 4XWWA 2AEHA 4I6PA 2KFKB 2KMAA 2V3PA 4KDIC 2ONQA 1SE3A 3AN1A 3R66C 1OEYJ 1E7PB 2BQQA 2ZCCA 2NTSA 4C7YA 3BINA 2KT7A 1FIQA 2QIEB 5MPOA 2L76A 4KKJA 1PFDA 1ZKHA 2BKFA 1FFVA 4NAMA 1TZ1A 1FXTB 2NPTB 3AM9A 4A20A 4RGMA 3BIID 3AE1B 3UIPB 1DYQA 1NI2A 2QCZA 3QARA 1GG3A 1ZUD2 3A1QB 4NJCA 5HG2A 1YX5B 1I42A 1PGBA 2MBBB 3WCQA 2QHOA 3BK2A 2O2VB 4P6VF 2L52A 2WXOA 1G6JA 4DHZE 4A6QA 4RNAA 2LVOA 3AI5A 2CS4A 5HI1A 1QILA 3DHIC 4IWQA 1Q1OA 3PLUA 1MFWA 2DYMA 2X8XX 3I57A 2C5LC 4M00A 3ZNGC 5CTRC 4XC2A 2GOWA 3X0WA 1BXTA 2PTLA 4GIVA 4Q2JA 2FCSA 2C9WB 5AZGA 4R3DA 1N63A 2CR5A 4AJYB 3W1YA 1I7HA 4GB9A 3NVYA 2LGDA 3ZTCA 1TKGA 4OZAA 2W54A 4N9F4 4A3PA 3VRBB 3I9V1 1FM0D 1V1OA 4W9LA 3DPDA 1TT5B 1UUPA 3V05A 3ZNHB 2N0SB 5E6PA 2PIAA 4MH0E 2FUG1 4IOIE 4E74A 1UGJA 1NEKB 3RPFC 2ACZB 2KWUB 5KHQA 3PZDA 2ZNVB 1V9JA 3CSTA 3M3JA 1NI3A 1QOGA 2FCMA 2WGSA 3GZNI 4S17A 4RGNA 3K9OB 2MWSB 2DBYA 4GGQA 2IBIB 2R61A 5H92C 3TL5A 3RNBC 3N30A 2KDEB 2L1AA 2WX0A 3ZLZA 3IAS1 2INPE 2KVZA 2NCNA 5D94A 2KLGA 2KDIA 4CO7A 2Y3AA 2KKCA 3HVZA 1C3TA 1TIFA 2PKOA 3KH0A 4MEMA 3B1LX 3LB8C 4YL8A 1ZDVA 2WXLA 4MM3B 4C4VA 3ZIMA 1KF6B 1TYGB 1QLBB 5EE0A 1L4DB 4LCDE 2HTME 3BVZA 1SIJA 3L17A 3NG0A 2GBNA 1E8ZA 2L0TA 2SAKA 4WQMA 4HPLB 4W9GA 1T0RC 4DWFA 1VDVA 3NZSA 3Q8BA 5D7GA 3AEAB 4DHJD 4DHJB 4GOCA 1R4MB 3B0AA 3KLSX 1QOFA 3NZUA 4NPNA 1BMLC 5E6OA 1V80A 4PS3A 3T9LA 1WXVA 2HJ8A 5IA7A 1OQRA 4K81A 3Q3NC 1QOAA 3C0RB 1J7CA 1CMXB 1FMAD 4FA6A 4RF1A 1V5OA 5TR5A 2LUMA 2FCQA 3Q8EA 5JH5C 3P2BA 2WDRB 2O6VA 2NTTA 1F1HA 1C4AA 2KVRA 1UWMA 1WJUA 3WA0A 3LJ3A 1OGWA 5L83A 1VZ8A 2JWUA 2MEKA 4IC7B 2C7HA 2ZVOA 1WXMA 3AEFB 2IYDB 3DBLB 3IT6B 3DDCB 4HXDA 3RMKC 1CJEA 2LVQA 4KV2A 4II2B 2WWZA 3Q8CA 3FAHA 5G55A 1V8CA 3EUB2 2J7QB 4FJZA 4KZCA 1RAXA 3ZVVA 4HJGE 2WQYB 1FPYA 3RNCC 1RRBA 3LYYA 3ZRFA 3NRZA 3AECB 3MHZA 5BYSA 4M02A 2RDBC 1UELA 2VH2A 4YSYB 1E9MA 4B0MA 2MBHA 4EKUA 1WE7A 2FCNA 2D3BA 1PDXA 5AEKB 3W5UB 2PEAA 4RGTA 1WJ4A 1FD6A 3TEZA 2NVUI 2K8HA 4IUMB 1E6EB 1ESFA 1SE9A 1OEYA 1GNUA 3UQBA 2N7JA 3T3OA 1K50A 2WDVB 2V1YA 1HA5A 4FXCA 4DBGA 1N5WA 3HIZA 3QQ8B 4H2AA 1WZ3A 2WXJA 1SF0A 3P4SB 3AH7A 4W9HA 3ZUNA 3PTFC 2AQ2B 1ZW7A 1GOZA 3NZ3A 1RLFA 4GLSC 1HQRD 1XCQL 4F1SA 4FJVB 5EE1A 3K9PB 3P63A 2KDBA 4BKTA 5AUIA 4EEWA 3GS2A 3VXWA 4MDKE 3TIXA 3ZGZA 5BYRA 2IO1B 3CSFA 5E6NA 4IM3A 1TBEA 1XLNA 4OVZA 1WXQA 4WJOA 4JWUC 2A4ZA 1XO3A 3ZDTA 5L95C 3U2SC 1V6EA 4LNIA 3IT4B 4G50A 1S1QB 2N9EB 3AXCA 3N9YC 1IBXA 2AL6A 1AYFA 4PS8A 3PPAA 2QC8A 3B9JA 4BVUC 1XD3B 5BMHA 3N20C 2E6XA 4XDCA 5J2RA 4LK0M 1WSPA 1XLQA 4RMAA 3JW0X 2KDFB 3RUIB 3UF8A 1V97A 3AEDB 3NVVA 2TSSA 4XZ4A 2BGFA 4P16A 2A5UA 3OJ4B 4DQOC 3KVFB 2DYBA 5JHAA 2G45B 2XEWA 4AS1A 1C78A 1ACCA 4L2YA 2IJ0A 1KRHA 1J7AA 2LASA 3BK1A 2DZIA 2PW9A 3O65B 3V6EB 2RPQA 3ETRA 1C1YB 3VRAB 2GLSA 5EE3A 2NMQA 4FLHA 2DWQA 1Q0WB 2NS5A 1EF5A 4WJPA 1WE6A 2Y5PA 1VRAB 2MQJA 4B0EA 4DDGD 4LNKA 3IG3A 1R4NB 3EFCA 2C60A 1NVID 2WXNA 4HEA1 4OZCA 2W55A 1R4MI 5JHBA 2QEJC 2JYTA 2GRIA 2O6VB 2LZ6A 3AE8B 3RNAC 4XGAB 4G3XB 3SHQA 4ASWC 2KC1A 5AZHA 1UF0A 3VVWB 4ZRPA 1ZP0B 2BTEA 5TSSA 2CHWA 2JPHA 4YTPB 2WXFA 1YQ4B 4PYUA 4F7ZA 4TQ1A 1UD7A 2C7MB 5G5GA 3Q3MC 4WQOB 3M63B 2KXJA 2KWVB 1Q5WB 3AULA 1CZPA 2L3ZA 2BKRB 3H9DA 1RFAA 2NBWB 1E8YA 3BYYB 3DBHI 3AE5B 3UGBB 1MG4A 1J8CA 1PGXA 4FHKA 2Q5WD 2V4LA 1HEZE 1JWBD 2N1VA 1P1AA 1DOIA 1B1ZA 2GI9A 1WJNA 4A9AA 3A33B 2G4SA 2G9HD 2K1FA 2PMVA 2ZCBA 3GZNB 5KHOA 4AUQC 3X23A 2I1KA 2MH7A 1K53A 1L2NA 1XEEA 2KJHB 2ZPNA 4XWTA 1ZE3D 4BKSA 2BT6A 3H7PA 4LDTD 2KOXA 1TY2A 1A5RA 1DOYA 2KQSA 2VH1A 1YN4A 3B2GA 2KTRB 2V3SA 3FILB 3ZYYX 1P98A 1Y56A 2PVOD 1KLUD 3R3MA 1Z2MA 2VZKD 2FBWB 4MSQB 1C4CA 3M62B 3A9KA 4GDLB 1OQYA 3AE9B 3DWGC 2REXA 2SEBD 1QZEA 4J3OD 2M8SA 3CF6E 1N6ZA 2ZEQA 3L08A 2WNMA 3UI3A 4OHJA 2WXQA 3LXFA 2R2QA 4IM2A 4I6NB 1WZ0A 4L23A 4K3BA 1JRPA 1H8CA 3W2DA 4GDKB 3NY5A 1TS5A 2D2QA 1JWUD 2Z0DB 3RFZB 4HKZE 1IP9A 1YQ3B 3PLVA 4WURA 1GJZA 3DQVA 1ZXIA 1U4AA 4KDLB 3VHTC 2BYEA 5HFYA 3A4SC 4II3B 1I4XA 3DBHB 2K8CA 2MCNB 1L5PA 1UWXA 4ZYSA 3PVLA 1FNUA 4KKIA 1XLOA 2LUEA 3ZKJC 2NBUA 4NZLB 3N32A 5DCNA 3VUYA 4HVBA 1SE2A 2KC2A 1MG8A 2LRWA 1XT9B 1XXGA 2L8JA 2MW5A 3MC9A 2DZMA 1LO5D 5IAAC 1CQVA 2KDMA 4A55A 1K51A 1WGDA 1WRIA 4QAYA 2HJ1A 1F2RI 4HCNB 1MPEA 2EELA 1Q10A 1JCKB 4US9A 4JWSC 3RULA 2FUHB 1EM7A 1RYJA 3MHSD 2BYTA 1D3ZA 4HK2A 5DPTA 4ZHOA 4HJKA 1LGRA 3VTWA 1AWDA 2G4DB 2WXGA 1M94A 2WP9B 4PT5A 1KOTA 3ABVB 4E3CA 3T3NA 3DOWA 5IO9A 1JWMD 1WIAA 3HM6X 2KQ7A 1WYGA 2D07B 5C1ZA 1ENFA 4HLEA 1YJIA 4ANXA 1SIFA 4YWGG 3W9CB 2ASQA 3PREA 4NNJB 4M8NA 4MM3A 4C4VB 4RH6A 3GP7A 4FULA 3AB5A 1ZOYB 3ZRCA 3MFGA 2C7NB 1KLGD 4WH4A 1C4PA 2K6QA 3NS8A 3AV8A 4A8XC 2JWZA 1WM3A 1I4QA 2LWPA 3B08A 3IVFA 2RPVA 3QX1A 1AN8A 2CKHB 3H6NA 4URKA 4G11A 2NPTA 1UZXB 2OHFA 2PPHA 2KNBA 4P1BC 4K7UA 2M19A 1GB4A 4USAA 2RMMA 2JT4B 2ICIA 2WXKA 5HHDG 3UIOB 1D6EC 4S0RA 4ZRJA 4AQ7A 3R2TA 3TCAA 4EE2A 1E10A 1WMHA 1Z5SB 2DAFA 2DHZA 2WHIA 1IBXB 1DOXA 1D4BA 3ALBA 4GN1A 2ZJDA 4LJOB 4C00A 3FILA 4C7ZA 3QJZA 3RNFC 2YEPF 1YN5A 3ZXVA 3HK0A 3MJWA 3ZQ4A 4E71A 1B9RA 3VTVA 2NBVB 2QJLA 2LXCA 2V3NA 2JRIB 2BB6A 1L7YA 3KW5B 4TQ0A 4GDKA 3ZNID 1TY0A 3L10B 4K7SA 4ZYNA 3N1ZC 3TSSA 1WGRA 1EWYC 3A9JB 1IGDA 5LNK1 4TSSA 1LFDA 3HUIA 2DZJA 4BKGA 3QC8B 4TV3A 3RT3B 3AE4B 4M8MA 3R2IA 1FRDA 2ZVNA 3U52E 2N9PC 3V61A 3SFEB 4KVGB 2BWES 1AARA 3CMMB 3PZ8A 5FK9C 1NYQA 4AJWA 1SSNA 3U8ZA 2BPSA 1I4HA 2BVCA 3V3XA 4HDQA 3ML9A 3MC0B 4N59A 2MP2A 4EOYA 5AZFA 1RM6C 3IBEA 2Z0EB 4NQLB 5IOIA 1YD8U 1TKEA 4MGIE 3S2AA 5JZEB 3DCGA 1PGAA 3EA6A 5BYQA 4LJPB 4AWJA 2V4IB 1YX6B 3ML8A 2ZW0A 4N58A 1HZ5A 4W9KA 2XK5A 1L0VB 2WX1A 4HRSA 4JIOU 1WMHB 4AOFA 3ECIA 1TS4A 2AQ1B 1JMLA 2GMIC 3DHHC 2GBJA 4PK1A 1FEHA 5EDSA 2QSDA 1TTNA 2NR2A 2D3CA 3L16A 1MHHE 3JSVB 4TMAB 2FAZA 1TS3A 4NY0A 3AE3B 2JU6X 4BFRA 2CJNA 2JZZA 1EF1A 4HKQA 1FNVA 2JYEA 1E7VA 3C8YA 3SR6A 2WDQB 1LM8B 1UNSA 2BF8B 2XBBC 3RZWC 3VH4B 4EZKA 4KSKC 1EO6A 5AUKA 2G1EA 4ANUA 4I6LB 3R8BA 1TZOA 1IPGA 2ZW1A 2K8BA 2INNE 1LQBA 1JQ4A 3PRPB 4IWOA 1JROA 4NJ6A 3KYDD 2HTHA 2N9KA 1F77A 2ZNVC 2LJIA 3FKYA 1JWAD 1KLVA 4G0NB 4A3OA 1HXYD 3ZXRA 1IGCA 2N7EA 3Q8AA 2WXPA 3EFUA 2LGYA 1WF9A 3DVGY 4BBNC 2OEDA 3MC8A 2KLCA 4REZA 4RFBA 5D2MB 3QCAA 1F0ZA 2UYZB 1JW9D 2EMTA 2WXHA 4K3CA 1R4NI 2MLBA 2RSUA 4AP4C 2W82A 4B95A 4FN2A 2J4XA 3JYUA 4WAAA 2KACA 2JQRB 3NOBA 3BWUD 1WXSA 2JRHA 1C9FA 2GBMA 2BS4B 4JE3B 4OZBA 4P1CC 1MJDA 1FFUA 4P7IA 2LHDA 1QQRA 5LXIB 2N1WA 4ITKA 3A9JA 1WI0A 1ET6A 3RZFA 1VD2A 2DLBA 4DHZB 4DXFA 1DGJA 2EMSA 2K0PA 4K7WA 3QA8A 5HKHA 5CHWA 2WS3B 4XDDA 3APFA 4FHJA 4PS7A 1E8WA 3SU8X 4MJSA 2DZKA 1WGYA 2W9NA 2JXXA 2LGXA 1UH6A 3D32A 3AU4A 4JPSA 4HPPA 1SE4A 3MJ5A 4FJYA 2JZ3B 4GXBA 2KWDA 2BYVE 2KMCA 1KTKA 3C19A 2MSED 5H8YE 3ENEA 5DPWA 1ZPSA 1F2RC 5CX3A 3HVDA 4GU2A 2O2VA 1D5MC 2D3GA 1UBIA 4W9IA 2YVCA 3QWZB 3AE7B 4YSXB 3APCA 1XLPA 1YOVB 2J53A 1K8RB 1P0RA 1T0SC 1XCTL 3IFWB 1E0ZA 4IKGA 1FO4A 2N9LA 3ZO5B 1QT9A 3ZJVA 1GUAB 1YIWA 1ZGUB 4ACFA 3OG5A 3U4EG 4WWNA 1PQSA 2KZRA 3AEBB 3EECA 5GMVA 4YSZB 2DYOA 5GXGB 4M0WA 1L0YB 4RGOS 3H1UA 4N6EB 3TEYA 1SEBD 5J18A 1SGHA 5G2NA 2LVPA 1T3QA 1D5XC 3W1SA 1E8XA 3QHTA 3L13A 3SEBA 2GBRA 2K39A 4MSMB 1EWCA 4ZRIA 2VRRB 1WFYA 1H4RA 1WX8A 2WXIA 4C56C 2LEKA 3PV1A 3DBRI 3V60A 1YJ1A 1T0QC 3RCZA 2I2YA 4B9KA 1Y8RC 4ANVA 1MI0A 3ZDMC 3PZ7A 1EUVB 1QOBA 3WIMA 1FXAA 4LDTB 2WXRA 4B6WA 3VR9B 2MHJA 5D3IB 3PS6A 2K3UA 3RYTA 4O1NA 1JALA 1GC6A 3RD2A 4CYEA 2GBKA 1FCCC 3I5JC 2DNFA 1N61A 4OVVA 2D5GA 1L6VA 3KUDB 2N7DA 2UU7A 4ZOHC 2AL3A 1P7FA 2KTFA 3T8MA 1OQQA 2OJRA 4WWPA 4NQKE 4HWIB 1C76A 3TEWA 4F8CB 4K1RB 1FNWA 1E5WA 2JY6A 5J17A 1WR1A 1D5ZC 1WJ6A 3A9KB 4GDLA 3OWEB 3NVZA 1QKZA 1RWSA 2CJOA 1E7UA 3PSEB 4WIPA 2M4NA 4GMVA 3E9SA 1J0GA 2IY1B 1YMHE 3N1XC 1KM7A 4IWPA 4NJ7A 4LLGM 3PT2B 4IDIA 2J0JA 2MJEA 2Y5CA 3TUOA 2W3RA 2IGGA
chains in the Genus database with same CATH topology
2JRIB 4HCPB 3ZDTA 1L7YA 1WYWB 3KW5B 4W9JA 5L95C 4TQ0A 4GDKA 1V6EA 3ZNID 2OOBB 3L10B 4G50A 4K7SA 1S1QB 3VH3B 2G3QB 2N9EB 2MP2B 3AXCA 4ZYNA 2KFJA 2AL6A 2KJRA 1WGGA 1WRDB 4PS8A 2ZPYA 4DXAB 3PPAA 1WGRA 3A9JB 4JQWC 2LD9A 4BVUC 1LFDA 1XD3B 2MBQA 5J2RA 2DZJA 3PHWB 4BKGA 3QC8B 4TV3A 3U7DA 3H7PB 3RT3B 4M8MA 3VUWA 3A4RA 4ZRKA 4KIKA 4RMAA 3KUCB 3JW0X 2WDTB 2M0XA 2KDFB 2ZVNA 2N9PC 3V61A 3RUIB 4KVGB 3UF8A 3UINB 2BWES 3NHEB 3WAMA 1AARA 5FR6A 3CMMB 4XZ4A 2BGFA 2JF5A 3PGEA 3VFKA 2A5UA 4FADA 2UWQA 4BOZB 1T0YA 2KTRA 3OJ4B 4WJQA 4AJWA 3KVFB 5D6JB 2DYBA 3U8ZA 5JHAA 1IYFA 2Y5BB 1WX7A 2G45B 2BPSA 2MA9B 3GOEA 2XEWA 3HM3A 2D10A 3R7RA 2CHXA 2KK8A 4HDQA 3ML9A 4RM9A 1WY8A 2DAJA 2LXAA 2MP2A 1E90A 2AYOB 4EOYA 3L54A 5AZFA 3IBEA 4IG7B 4TUUA 3QIJA 2Z0EB 4NQLB 2J0KA 2LASA 2DZIA 3KYCD 1YD8U 4IM0A 4MGIE 3S2AA 3O65B 5JZEB 3DCGA 2RPQA 5BO4B 1J19A 3V6EB 3DBLI 1C1YB 3H7SA 3DVNV 4ICUA 4LJPB 4AWJA 1YX6B 3ML8A 3WAPA 2AEHA 2IZVB 4FLHA 4W9KA 3WANA 2NS5A 1Q0WB 2XK5A 1KJTA 1EF5A 4I6PA 4WJPA 2KFKB 2KMAA 1WE6A 4KDIC 2WX1A 2MQJA 3R66C 4JIOU 1WMHB 4JGHB 3ECIA 1OEYJ 4AOFA 2KO3A 4DDGD 3Q3FA 4W9FA 2ZCCA 3IG3A 4HPMB 2GMIC 2C60A 2GBJA 4W9EA 1VCBA 3DBSA 3BINA 5EDSA 4NAWA 1TTNA 1R4MI 2PE6B 5JHBA 2NR2A 2L76A 2MX2A 3L16A 3VUXA 3I3TB 3JSVB 2FAZA 2O6VB 3OLMD 2LZ6A 1ZKHA 4NY0A 2BKFA 4G3XB 3SHQA 1TZ1A 1FXTB 2FNJB 4ASWC 2NPTB 3ONSA 2KC1A 5AZHA 4BFRA 4A20A 3VVWB 4HDOA 2JZZA 4OVUA 4W9CA 2CHWA 2JPHA 1BT0A 2WYQA 1EF1A 3UIPB 1NI2A 4PYUA 4F7ZA 1E7VA 3QARA 1UD7A 4TQ1A 1GG3A 4JLCA 3A1QB 3WALA 2C7MB 1LM8B 2BF8B 3RZWC 1JRUA 1YX5B 2XBBC 1I42A 2D11A 3M63B 4WQOB 3VH4B 2KXJA 2N9XA 4EZKA 4KSKC 2KWVB 1OTRB 1EO6A 2KX3A 2MBBB 1Q5WB 3AULA 4ANUA 2L05A 2PE9A 2QHOA 4I6LB 1I35A 4ANWA 3DVNU 3IHPC 1IPGA 2O2VB 4BBNF 2L3ZA 2BKRB 2M1MA 3H9DA 2K8BA 4KSLC 1G6JA 1LQBA 4DHZE 1F9JA 1RFAA 2LVOA 2NBWB 3AI5A 3PRPB 4IWOA 1E8YA 2CS4A 1V49A 3JSVA 4NJ6A 3KYDD 3DBHI 4IWQA 2HTHA 3UGBB 1Q1OA 3PLUA 1J8CA 2DYMA 2C5LC 4FHKA 3ZNGC 2V4LA 2ZNVC 2N1VA 4XC2A 5CTRC 2GOWA 2KWCA 1P1AA 2MBOA 3X0WA 4GIVA 1KLVA 2FCSA 4G0NB 4A3OA 1WJNA 2N4FA 2C9WB 5AZGA 4BKSD 3A33B 2IY0B 3PRMB 2G4SA 2N7EA 3EFUA 3APDA 3W1SC 2K1FA 2CR5A 2LGYA 4AJYB 1WGHA 2ZCBA 3W1YA 5KHOA 4AUQC 1WF9A 3DVGY 3X23A 4BBNC 2I1KA 2EKEC 4GB9A 2LGDA 5CHFA 3ZTCA 2FIDA 1L2NA 2KLCA 2L00B 2KJHB 2MRPA 4N9F4 4A3PA 2ZPNA 5D2MB 5DPRA 1NBFC 4BKSA 3H7PA 4LDTD 4W9LA 3DPDA 2DENB 2KOXA 3QCAA 2UYZB 2KX0A 2EMTA 3ZNHB 1A5RA 1R4NI 5E6PA 4DK5A 3M95A 2MLBA 2RSUA 4MH0E 4AP4C 2KQSA 4E74A 4KIKB 4X57B 3Q3JA 2LRUA 1C3TA 4B95A 2KTRB 2LJ5A 3JYUA 2KWUB 4FN2A 3PZDA 4WAAA 2ZNVB 5KHQA 1NDDA 2V3SA 1V9JA 2HE7A 3NOBA 1WXSA 2JRHA 3CSTA 2GBMA 3M3JA 1P98A 2FCMA 3R3MA 4MGKE 3MTNB 1Z2MA 4ZDVA 4P7IA 3GZNI 4MSQB 3M62B 3A9KA 2CU1A 1TGZB 4GDLB 3K9OB 1OQYA 2MWSB 5LXIB 3TMPB 4GGQA 2N1WA 2REXA 4BOSC 2IBIB 3BY4B 3TL5A 1QZEA 3A9JA 3TJPA 1WI0A 4JL9A 2M8SA 3CF6E 3N30A 3L08A 2KDEB 2ZEQA 2WX0A 1VD2A 3RZFA 3ZLZA 4DHZB 2EMSA 1UGMA 2KANA 2R2QA 2RGFA 4K7WA 3VQIA 4IM2A 1P3QU 3QA8A 5CHWA 5HKHA 4FBJB 2NCNA 5D94A 2KLGA 2KDIA 4CO7A 1V2YA 3APFA 1WZ0A 1E8WA 1YQBA 2KKCA 4FHJA 4I6NB 4MJSA 4PS7A 3SU8X 2ZZPB 4NAWB 4MELA 1GC7A 2DZKA 1WGYA 2J0MA 3KH0A 1H8CA 4GDKB 4MEMA 3NY5A 2W9NA 4J6IA 3VTUA 3B1LX 2YLMA 2D2QA 4YL8A 4EZLA 1V5TA 2JXXA 2LGXA 2Z0DB 3ZIMA 1IP9A 2I1JA 1UH6A 3D32A 3AU4A 3PLVA 4PYZA 4FJYA 2JZ3B 4GXBA 1GJZA 3OAWA 3DQVA 1U4AA 4LCDE 4KDLB 3VHTC 2BYVE 2KMCA 2BYEA 4ICVA 3PHXB 3PRZA 2MSED 3A4SC 5CHVC 3ENEA 3KUZA 5DPWA 3L17A 4II3B 2GBNA 1E8ZA 2L0TA 2K8CA 5CX3A 4HPLB 4W9GA 4DWFA 2HD5B 3NZSA 4GU2A 3JVZX 5D7GA 2O2VA 3QAQA 2D3GA 1UBIA 4DHJB 3OJ3A 4W9IA 4DHJD 4GOCA 2YVCA 3QWZB 2MCNB 1LXDA 2KJ6A 3PVLA 2IO0B 4KZ0A 4DDID 3ZKJC 2LUEA 2LI5A 3APCA 3B0AA 2M17A 1K8RB 1P0RA 3U30A 4EUTA 2NBUA 3IFWB 3NZUA 3N32A 5DCNA 3VUYA 4NPNA 3ZO5B 2FIFA 2R2OA 5E6OA 1V80A 4PS3A 3T9LA 2XK5B 3AU5A 4HVBA 1GUAB 1YIWA 1WXVA 2BYFA 2HJ8A 5IA7A 2KC2A 1MG8A 4MGZE 1ZGUB 4K81A 2LRWA 1XT9B 3C0RB 2L8JA 1CMXB 2MW5A 2DZMA 4RM8A 4FA6A 4WWNA 1PQSA 1V5OA 5IAAC 2KZRA 5TR5A 2FCQA 2KD0A 5JH5C 1WGDA 3EECA 5GMVA 3P2BA 2DYOA 4W9DA 2O6VA 4HCNB 3ZTDA 3H1UA 3L0WB 2DX5B 2KVRA 4WWOA 1WJUA 5J18A 1SGHA 1WXAA 3WA0A 5G2NA 3LJ3A 1WM2A 2LVPA 1OGWA 5L83A 3RULA 2FUHB 1HE8A 4IC7B 2C7HA 2ZVOA 3A1QA 3MHSD 3R7QA 1WXMA 3W1SA 1E8XA 3QHTA 2IYDB 1V86A 3L13A 4XX5A 1D3ZA 4HK2A 5DPTA 2GBRA 2K39A 2KHWB 3DDCB 4HJKA 3EHVA 4MSMB 3VTWA 4HXDA 1WH3A 2G4DB 2K6DB 4ZRIA 2VRRB 1WFYA 1M94A 1H4RA 1WX8A 2LVQA 4WJNA 1S3SG 1KOTA 4E3CA 4KV2A 4II2B 5DPSA 1WR6E 2BWFA 2WWZA 3DOWA 4MGYE 3PV1A 4CHKA 3DBRI 2RR9A 5G55A 3V60A 1P9DU 1WIAA 1YJ1A 2KQ7A 3HM6X 1ISNA 5LLIA 3RCZA 2D07B 2J7QB 5C1ZA 2L0FA 4HLEA 4M0WB 3HHMA 4TKNA 4B9KA 1Y8RC 4FJZA 4KZCA 1RAXA 3ZVVA 4ANXA 4MJSB 4EZJA 2L7RA 1SIFA 3VAWA 1RRBA 2RD0A 4GSWA 4ANVA 3ZRFA 3ZDMC 2ASQA 3PREA 4NNJB 1EUVB 4M8NA 3WIMA 4LDTB 4MM3A 1UELA 3V62A 3UQAA 4FULA 4B6WA 3ZRCA 3PS6A 2KFKA 2MBHA 4EKUA 3RYTA 1GC6A 1WE7A 2FCNA 2C7NB 5AEKB 5LXHA 2PEAA 2K6QA 3DVGX 1WJ4A 3NS8A 3EC8A 3RD2A 2JWZA 2NVUI 3N3KB 2K8HA 4CYEA 1WX9A 3VDZA 2GBKA 4IUMB 1WM3A 2PJHA 3ZW3A 1SE9A 1OEYA 4OVVA 1GNUA 2LWPA 3B08A 3IVFA 3KUDB 3UQBA 2N7DA 2JUOA 2V1YA 2AL3A 2KTFA 3T8MA 3QX1A 2CKHB 3H6NA 4DBGA 3HIZA 4URKA 4G11A 2NPTA 3SD5A 1UZXB 2OJRA 2Z59B 1WZ3A 3QQ8B 4WWPA 4NQKE 2PPHA 2KNBA 4HWIB 4K7UA 2KN5A 4F8CB 4K1RB 2JT4B 1E5WA 2IO3B 4W9HA 3WAOA 3ZUNA 2JY6A 3PTFC 3TBLD 1WR1A 5J17A 1ZW7A 3UIOB 1RLFA 4IW0A 4ZRJA 5C23A 1WJ6A 2K25A 3A9KB 4GDLA 3TCAA 4EFOA 4F1SA 4FJVB 1UBQA 1WMHA 1Z5SB 2MBEA 2DAFA 2DHZA 3K9PB 1V81A 1E7UA 2KDBA 3PSEB 4BKTA 1X1MA 2JVCA 4EEWA 2AWTA 2M4NA 3ALBA 4GN1A 2ZJDA 3VXWA 4LJOB 4GMVA 4MDKE 3TIXA 3V6CB 3QJZA 1J0GA 2B3AA 2IY1B 2IO1B 1KM7A 3CSFA 3LDZE 3SDLC 3HK0A 4IWPA 3MJWA 5E6NA 3QK0A 4E71A 2O6VD 3ZNZB 4IM3A 4NJ7A 1TBEA 4WJOA 2CHZA 3PT2B 3VTVA 2A4ZA 2NBVB 2J0JA 2IO2B 1XQQA 2LXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI B;  4HCP B;  3ZDT A;  1L7Y A;  1WYW B;  3KW5 B;  4W9J A;  5L95 C;  4TQ0 A;  4GDK A;  1V6E A;  3ZNI D;  2OOB B;  3L10 B;  4G50 A;  4K7S A;  1S1Q B;  3VH3 B;  2G3Q B;  2N9E B;  2MP2 B;  3AXC A;  4ZYN A;  2KFJ A;  2AL6 A;  2KJR A;  1WGG A;  1WRD B;  4PS8 A;  2ZPY A;  4DXA B;  3PPA A;  1WGR A;  3A9J B;  4JQW C;  2LD9 A;  4BVU C;  1LFD A;  1XD3 B;  2MBQ A;  5J2R A;  2DZJ A;  3PHW B;  4BKG A;  3QC8 B;  4TV3 A;  3U7D A;  3H7P B;  3RT3 B;  4M8M A;  3VUW A;  3A4R A;  4ZRK A;  4KIK A;  4RMA A;  3KUC B;  3JW0 X;  2WDT B;  2M0X A;  2KDF B;  2ZVN A;  2N9P C;  3V61 A;  3RUI B;  4KVG B;  3UF8 A;  3UIN B;  2BWE S;  3NHE B;  3WAM A;  1AAR A;  5FR6 A;  3CMM B;  4XZ4 A;  2BGF A;  2JF5 A;  3PGE A;  3VFK A;  2A5U A;  4FAD A;  2UWQ A;  4BOZ B;  1T0Y A;  2KTR A;  3OJ4 B;  4WJQ A;  4AJW A;  3KVF B;  5D6J B;  2DYB A;  3U8Z A;  5JHA A;  1IYF A;  2Y5B B;  1WX7 A;  2G45 B;  2BPS A;  2MA9 B;  3GOE A;  2XEW A;  3HM3 A;  2D10 A;  3R7R A;  2CHX A;  2KK8 A;  4HDQ A;  3ML9 A;  4RM9 A;  1WY8 A;  2DAJ A;  2LXA A;  2MP2 A;  1E90 A;  2AYO B;  4EOY A;  3L54 A;  5AZF A;  3IBE A;  4IG7 B;  4TUU A;  3QIJ A;  2Z0E B;  4NQL B;  2J0K A;  2LAS A;  2DZI A;  3KYC D;  1YD8 U;  4IM0 A;  4MGI E;  3S2A A;  3O65 B;  5JZE B;  3DCG A;  2RPQ A;  5BO4 B;  1J19 A;  3V6E B;  3DBL I;  1C1Y B;  3H7S A;  3DVN V;  4ICU A;  4LJP B;  4AWJ A;  1YX6 B;  3ML8 A;  3WAP A;  2AEH A;  2IZV B;  4FLH A;  4W9K A;  3WAN A;  2NS5 A;  1Q0W B;  2XK5 A;  1KJT A;  1EF5 A;  4I6P A;  4WJP A;  2KFK B;  2KMA A;  1WE6 A;  4KDI C;  2WX1 A;  2MQJ A;  3R66 C;  4JIO U;  1WMH B;  4JGH B;  3ECI A;  1OEY J;  4AOF A;  2KO3 A;  4DDG D;  3Q3F A;  4W9F A;  2ZCC A;  3IG3 A;  4HPM B;  2GMI C;  2C60 A;  2GBJ A;  4W9E A;  1VCB A;  3DBS A;  3BIN A;  5EDS A;  4NAW A;  1TTN A;  1R4M I;  2PE6 B;  5JHB A;  2NR2 A;  2L76 A;  2MX2 A;  3L16 A;  3VUX A;  3I3T B;  3JSV B;  2FAZ A;  2O6V B;  3OLM D;  2LZ6 A;  1ZKH A;  4NY0 A;  2BKF A;  4G3X B;  3SHQ A;  1TZ1 A;  1FXT B;  2FNJ B;  4ASW C;  2NPT B;  3ONS A;  2KC1 A;  5AZH A;  4BFR A;  4A20 A;  3VVW B;  4HDO A;  2JZZ A;  4OVU A;  4W9C A;  2CHW A;  2JPH A;  1BT0 A;  2WYQ A;  1EF1 A;  3UIP B;  1NI2 A;  4PYU A;  4F7Z A;  1E7V A;  3QAR A;  1UD7 A;  4TQ1 A;  1GG3 A;  4JLC A;  3A1Q B;  3WAL A;  2C7M B;  1LM8 B;  2BF8 B;  3RZW C;  1JRU A;  1YX5 B;  2XBB C;  1I42 A;  2D11 A;  3M63 B;  4WQO B;  3VH4 B;  2KXJ A;  2N9X A;  4EZK A;  4KSK C;  2KWV B;  1OTR B;  1EO6 A;  2KX3 A;  2MBB B;  1Q5W B;  3AUL A;  4ANU A;  2L05 A;  2PE9 A;  2QHO A;  4I6L B;  1I35 A;  4ANW A;  3DVN U;  3IHP C;  1IPG A;  2O2V B;  4BBN F;  2L3Z A;  2BKR B;  2M1M A;  3H9D A;  2K8B A;  4KSL C;  1G6J A;  1LQB A;  4DHZ E;  1F9J A;  1RFA A;  2LVO A;  2NBW B;  3AI5 A;  3PRP B;  4IWO A;  1E8Y A;  2CS4 A;  1V49 A;  3JSV A;  4NJ6 A;  3KYD D;  3DBH I;  4IWQ A;  2HTH A;  3UGB B;  1Q1O A;  3PLU A;  1J8C A;  2DYM A;  2C5L C;  4FHK A;  3ZNG C;  2V4L A;  2ZNV C;  2N1V A;  4XC2 A;  5CTR C;  2GOW A;  2KWC A;  1P1A A;  2MBO A;  3X0W A;  4GIV A;  1KLV A;  2FCS A;  4G0N B;  4A3O A;  1WJN A;  2N4F A;  2C9W B;  5AZG A;  4BKS D;  3A33 B;  2IY0 B;  3PRM B;  2G4S A;  2N7E A;  3EFU A;  3APD A;  3W1S C;  2K1F A;  2CR5 A;  2LGY A;  4AJY B;  1WGH A;  2ZCB A;  3W1Y A;  5KHO A;  4AUQ C;  1WF9 A;  3DVG Y;  3X23 A;  4BBN C;  2I1K A;  2EKE C;  4GB9 A;  2LGD A;  5CHF A;  3ZTC A;  2FID A;  1L2N A;  2KLC A;  2L00 B;  2KJH B;  2MRP A;  4N9F 4;  4A3P A;  2ZPN A;  5D2M B;  5DPR A;  1NBF C;  4BKS A;  3H7P A;  4LDT D;  4W9L A;  3DPD A;  2DEN B;  2KOX A;  3QCA A;  2UYZ B;  2KX0 A;  2EMT A;  3ZNH B;  1A5R A;  1R4N I;  5E6P A;  4DK5 A;  3M95 A;  2MLB A;  2RSU A;  4MH0 E;  4AP4 C;  2KQS A;  4E74 A;  4KIK B;  4X57 B;  3Q3J A;  2LRU A;  1C3T A;  4B95 A;  2KTR B;  2LJ5 A;  3JYU A;  2KWU B;  4FN2 A;  3PZD A;  4WAA A;  2ZNV B;  5KHQ A;  1NDD A;  2V3S A;  1V9J A;  2HE7 A;  3NOB A;  1WXS A;  2JRH A;  3CST A;  2GBM A;  3M3J A;  1P98 A;  2FCM A;  3R3M A;  4MGK E;  3MTN B;  1Z2M A;  4ZDV A;  4P7I A;  3GZN I;  4MSQ B;  3M62 B;  3A9K A;  2CU1 A;  1TGZ B;  4GDL B;  3K9O B;  1OQY A;  2MWS B;  5LXI B;  3TMP B;  4GGQ A;  2N1W A;  2REX A;  4BOS C;  2IBI B;  3BY4 B;  3TL5 A;  1QZE A;  3A9J A;  3TJP A;  1WI0 A;  4JL9 A;  2M8S A;  3CF6 E;  3N30 A;  3L08 A;  2KDE B;  2ZEQ A;  2WX0 A;  1VD2 A;  3RZF A;  3ZLZ A;  4DHZ B;  2EMS A;  1UGM A;  2KAN A;  2R2Q A;  2RGF A;  4K7W A;  3VQI A;  4IM2 A;  1P3Q U;  3QA8 A;  5CHW A;  5HKH A;  4FBJ B;  2NCN A;  5D94 A;  2KLG A;  2KDI A;  4CO7 A;  1V2Y A;  3APF A;  1WZ0 A;  1E8W A;  1YQB A;  2KKC A;  4FHJ A;  4I6N B;  4MJS A;  4PS7 A;  3SU8 X;  2ZZP B;  4NAW B;  4MEL A;  1GC7 A;  2DZK A;  1WGY A;  2J0M A;  3KH0 A;  1H8C A;  4GDK B;  4MEM A;  3NY5 A;  2W9N A;  4J6I A;  3VTU A;  3B1L X;  2YLM A;  2D2Q A;  4YL8 A;  4EZL A;  1V5T A;  2JXX A;  2LGX A;  2Z0D B;  3ZIM A;  1IP9 A;  2I1J A;  1UH6 A;  3D32 A;  3AU4 A;  3PLV A;  4PYZ A;  4FJY A;  2JZ3 B;  4GXB A;  1GJZ A;  3OAW A;  3DQV A;  1U4A A;  4LCD E;  4KDL B;  3VHT C;  2BYV E;  2KMC A;  2BYE A;  4ICV A;  3PHX B;  3PRZ A;  2MSE D;  3A4S C;  5CHV C;  3ENE A;  3KUZ A;  5DPW A;  3L17 A;  4II3 B;  2GBN A;  1E8Z A;  2L0T A;  2K8C A;  5CX3 A;  4HPL B;  4W9G A;  4DWF A;  2HD5 B;  3NZS A;  4GU2 A;  3JVZ X;  5D7G A;  2O2V A;  3QAQ A;  2D3G A;  1UBI A;  4DHJ B;  3OJ3 A;  4W9I A;  4DHJ D;  4GOC A;  2YVC A;  3QWZ B;  2MCN B;  1LXD A;  2KJ6 A;  3PVL A;  2IO0 B;  4KZ0 A;  4DDI D;  3ZKJ C;  2LUE A;  2LI5 A;  3APC A;  3B0A A;  2M17 A;  1K8R B;  1P0R A;  3U30 A;  4EUT A;  2NBU A;  3IFW B;  3NZU A;  3N32 A;  5DCN A;  3VUY A;  4NPN A;  3ZO5 B;  2FIF A;  2R2O A;  5E6O A;  1V80 A;  4PS3 A;  3T9L A;  2XK5 B;  3AU5 A;  4HVB A;  1GUA B;  1YIW A;  1WXV A;  2BYF A;  2HJ8 A;  5IA7 A;  2KC2 A;  1MG8 A;  4MGZ E;  1ZGU B;  4K81 A;  2LRW A;  1XT9 B;  3C0R B;  2L8J A;  1CMX B;  2MW5 A;  2DZM A;  4RM8 A;  4FA6 A;  4WWN A;  1PQS A;  1V5O A;  5IAA C;  2KZR A;  5TR5 A;  2FCQ A;  2KD0 A;  5JH5 C;  1WGD A;  3EEC A;  5GMV A;  3P2B A;  2DYO A;  4W9D A;  2O6V A;  4HCN B;  3ZTD A;  3H1U A;  3L0W B;  2DX5 B;  2KVR A;  4WWO A;  1WJU A;  5J18 A;  1SGH A;  1WXA A;  3WA0 A;  5G2N A;  3LJ3 A;  1WM2 A;  2LVP A;  1OGW A;  5L83 A;  3RUL A;  2FUH B;  1HE8 A;  4IC7 B;  2C7H A;  2ZVO A;  3A1Q A;  3MHS D;  3R7Q A;  1WXM A;  3W1S A;  1E8X A;  3QHT A;  2IYD B;  1V86 A;  3L13 A;  4XX5 A;  1D3Z A;  4HK2 A;  5DPT A;  2GBR A;  2K39 A;  2KHW B;  3DDC B;  4HJK A;  3EHV A;  4MSM B;  3VTW A;  4HXD A;  1WH3 A;  2G4D B;  2K6D B;  4ZRI A;  2VRR B;  1WFY A;  1M94 A;  1H4R A;  1WX8 A;  2LVQ A;  4WJN A;  1S3S G;  1KOT A;  4E3C A;  4KV2 A;  4II2 B;  5DPS A;  1WR6 E;  2BWF A;  2WWZ A;  3DOW A;  4MGY E;  3PV1 A;  4CHK A;  3DBR I;  2RR9 A;  5G55 A;  3V60 A;  1P9D U;  1WIA A;  1YJ1 A;  2KQ7 A;  3HM6 X;  1ISN A;  5LLI A;  3RCZ A;  2D07 B;  2J7Q B;  5C1Z A;  2L0F A;  4HLE A;  4M0W B;  3HHM A;  4TKN A;  4B9K A;  1Y8R C;  4FJZ A;  4KZC A;  1RAX A;  3ZVV A;  4ANX A;  4MJS B;  4EZJ A;  2L7R A;  1SIF A;  3VAW A;  1RRB A;  2RD0 A;  4GSW A;  4ANV A;  3ZRF A;  3ZDM C;  2ASQ A;  3PRE A;  4NNJ B;  1EUV B;  4M8N A;  3WIM A;  4LDT B;  4MM3 A;  1UEL A;  3V62 A;  3UQA A;  4FUL A;  4B6W A;  3ZRC A;  3PS6 A;  2KFK A;  2MBH A;  4EKU A;  3RYT A;  1GC6 A;  1WE7 A;  2FCN A;  2C7N B;  5AEK B;  5LXH A;  2PEA A;  2K6Q A;  3DVG X;  1WJ4 A;  3NS8 A;  3EC8 A;  3RD2 A;  2JWZ A;  2NVU I;  3N3K B;  2K8H A;  4CYE A;  1WX9 A;  3VDZ A;  2GBK A;  4IUM B;  1WM3 A;  2PJH A;  3ZW3 A;  1SE9 A;  1OEY A;  4OVV A;  1GNU A;  2LWP A;  3B08 A;  3IVF A;  3KUD B;  3UQB A;  2N7D A;  2JUO A;  2V1Y A;  2AL3 A;  2KTF A;  3T8M A;  3QX1 A;  2CKH B;  3H6N A;  4DBG A;  3HIZ A;  4URK A;  4G11 A;  2NPT A;  3SD5 A;  1UZX B;  2OJR A;  2Z59 B;  1WZ3 A;  3QQ8 B;  4WWP A;  4NQK E;  2PPH A;  2KNB A;  4HWI B;  4K7U A;  2KN5 A;  4F8C B;  4K1R B;  2JT4 B;  1E5W A;  2IO3 B;  4W9H A;  3WAO A;  3ZUN A;  2JY6 A;  3PTF C;  3TBL D;  1WR1 A;  5J17 A;  1ZW7 A;  3UIO B;  1RLF A;  4IW0 A;  4ZRJ A;  5C23 A;  1WJ6 A;  2K25 A;  3A9K B;  4GDL A;  3TCA A;  4EFO A;  4F1S A;  4FJV B;  1UBQ A;  1WMH A;  1Z5S B;  2MBE A;  2DAF A;  2DHZ A;  3K9P B;  1V81 A;  1E7U A;  2KDB A;  3PSE B;  4BKT A;  1X1M A;  2JVC A;  4EEW A;  2AWT A;  2M4N A;  3ALB A;  4GN1 A;  2ZJD A;  3VXW A;  4LJO B;  4GMV A;  4MDK E;  3TIX A;  3V6C B;  3QJZ A;  1J0G A;  2B3A A;  2IY1 B;  2IO1 B;  1KM7 A;  3CSF A;  3LDZ E;  3SDL C;  3HK0 A;  4IWP A;  3MJW A;  5E6N A;  3QK0 A;  4E71 A;  2O6V D;  3ZNZ B;  4IM3 A;  4NJ7 A;  1TBE A;  4WJO A;  2CHZ A;  3PT2 B;  3VTV A;  2A4Z A;  2NBV B;  2J0J A;  2IO2 B;  1XQQ A;  2LXC A; 
#chains in the Genus database with same CATH topology
 4HCP B;  1V1P B;  1WYW B;  4W9J A;  2M56 B;  3Q8F A;  4BAX A;  1KFY B;  3VH3 B;  2G3Q B;  2MP2 B;  2KFJ A;  4KGT A;  4CQN A;  3AE6 B;  2KJR A;  1WRD B;  2HDE A;  2ZPY A;  3DBR B;  2BS2 B;  4JQW C;  2JX5 A;  2XN9 C;  4KGS A;  1FXI A;  3PO0 A;  3H7P B;  3A4R A;  4ZRK A;  4KIK A;  2WDT B;  1FCL A;  3UIN B;  1I4G A;  2KN4 A;  2JF5 A;  3VFK A;  1HTO A;  4FAD A;  2INC C;  3Q14 C;  4BOZ B;  1T0Y A;  2KTR A;  4WJQ A;  1VZ7 A;  5D6J B;  1IYF A;  2Y5B B;  1WX7 A;  3GOE A;  1N60 A;  2VZK B;  2D10 A;  4ZHP A;  2CHX A;  3MP9 A;  2LXA A;  1E90 A;  2AYO B;  2KAJ A;  3L54 A;  4TUU A;  2PLP A;  4DXG A;  3QIJ A;  5FKA C;  2AQ3 B;  3KYC D;  1SXT A;  3W5V B;  5BO4 B;  3H7S A;  3DVN V;  3WAP A;  1VZ6 A;  1J7B A;  2IZV B;  1SJH D;  3WAN A;  3BVM A;  1KJT A;  1YNT E;  3Q2A C;  4JGH B;  2QIL A;  1WWT A;  2KO3 A;  3Q3F A;  4W9F A;  4HPM B;  3I63 C;  4W9E A;  1VCB A;  3DBS A;  4NAW A;  3U7Z A;  1L0X B;  2PE6 B;  3P42 A;  2MX2 A;  3VUX A;  1NYR A;  3I3T B;  3OLM D;  2QDF A;  2RDH A;  3H8H A;  5C2T B;  2FNJ B;  4YTN B;  4ARC A;  3ONS A;  3VR8 B;  4HDO A;  4OVU A;  4W9C A;  1MVK A;  1BT0 A;  2WYQ A;  2I38 A;  5BMI A;  4MAC A;  4JLC A;  3WAL A;  1JRU A;  2D11 A;  4RF0 A;  3E56 A;  3IXS A;  2N9X A;  2FE8 A;  1OTR B;  2KX3 A;  1TKY A;  2L05 A;  2PE9 A;  1TJE A;  1I35 A;  3Q6B A;  4ANW A;  3DVN U;  3IHP C;  4BBN F;  1WGK A;  4WWM A;  2BBC A;  2M1M A;  4KSL C;  3P4P B;  1F9J A;  2LGS A;  1V49 A;  4XYC A;  3JSV A;  1C77 A;  2GB1 A;  2KWC A;  2MBO A;  3P4Q B;  2H89 B;  2N4F A;  1K52 A;  2OJW A;  4BKS D;  3PRM B;  2IY0 B;  3W1S C;  2B76 B;  3APD A;  1WGH A;  1M4V A;  2E3T A;  2W3S A;  4LNO A;  2BB5 A;  3KWV A;  3URY A;  2EKE C;  5CHF A;  2FID A;  2L00 B;  1YJJ A;  5D3D A;  2MRP A;  5DPR A;  1NBF C;  2DEN B;  2IDY A;  2LMC A;  2KX0 A;  1RFK A;  5E6J A;  3RN9 C;  4DK5 A;  2WXM A;  3M95 A;  3KQ4 A;  4KIK B;  1VR9 A;  3RNE C;  4X57 B;  3Q3J A;  4A90 A;  2LRU A;  1NEN B;  2LJ5 A;  2WLB A;  1NDD A;  2HE7 A;  1PUT A;  4JX1 C;  3N1Y C;  2IGH A;  4MGK E;  5IP4 D;  3MTN B;  4ZDV A;  1V1P A;  1STE A;  4WAF A;  2CU1 A;  1TGZ B;  3TMP B;  2AX5 A;  2J42 A;  4BOS C;  3BY4 B;  3TJP A;  4JL9 A;  3TEX A;  1EU4 A;  5IN7 A;  1UGM A;  2KAN A;  2RGF A;  2JZP A;  3Q69 A;  1YN3 A;  3VQI A;  1P3Q U;  3RNG C;  4FBJ B;  1V2Y A;  1YQB A;  2Z8L A;  4NAW B;  2ZZP B;  4MEL A;  1GC7 A;  1HTQ A;  2J0M A;  3VTU A;  4J6I A;  2YLM A;  4EZL A;  1V5T A;  1XF5 L;  2I1J A;  1T6B X;  4PYZ A;  4RCO A;  2CU3 A;  3GB1 A;  3OAW A;  1F52 A;  1P7E A;  1GPX A;  4ICV A;  3PHX B;  3PRZ A;  5T8I A;  2WU5 B;  5CHV C;  1L6U A;  3KUZ A;  1PYW D;  3RI7 C;  1TS2 A;  3L4P A;  3P1M A;  1GAQ B;  2HD5 B;  3NS1 A;  3JVZ X;  2YEP B;  3QAQ A;  3OJ3 A;  2BW2 A;  2K22 A;  2L83 A;  2ON8 A;  1LXD A;  3AEE B;  2KJ6 A;  2V9H A;  3SFD B;  2IO0 B;  4KZ0 A;  4DDI D;  3NVW A;  2LI5 A;  2M17 A;  3U30 A;  4YT0 B;  4LNN A;  4EUT A;  4KX6 B;  3AEG B;  4OW0 A;  2FIF A;  2R2O A;  1SJE D;  2QMT A;  2XK5 B;  3AU5 A;  2BYF A;  4MGZ E;  2X38 A;  3NJT A;  1L4Z B;  1OFF A;  1ZXH A;  5JXV A;  4HRO A;  4RM8 A;  1R7S A;  3AE2 B;  1JWS D;  3BVG A;  2J52 A;  2KD0 A;  1MHX A;  4W9D A;  3IAM 1;  2K5P A;  4XE0 A;  3ZTD A;  3L0W B;  2DX5 B;  1A70 A;  4WWO A;  5FR3 A;  4ARI A;  1WXA A;  1WM2 A;  1SB3 C;  5C3J B;  1HE8 A;  2JXT A;  3A1Q A;  3R7Q A;  1V86 A;  4XX5 A;  2JSV X;  2KHW B;  3EHV A;  1WH3 A;  2K6D B;  4WJN A;  1S3S G;  1BUI C;  2V0G A;  5DPS A;  1WR6 E;  4MGY E;  2BWF A;  2IPK D;  4CHK A;  3EGR A;  2RR9 A;  3GE8 C;  5I4D A;  1P9D U;  5LLI A;  1ISN A;  2KMM A;  5BMG A;  4L1B A;  2L0F A;  4M0W B;  3HHM A;  4TKN A;  2L32 A;  4MJS B;  4EZJ A;  2L7R A;  2MJD A;  5IKC M;  2K9X A;  4LTU A;  3VAW A;  2RD0 A;  4GSW A;  4YTM B;  3B2F A;  2IGD A;  2KQ4 X;  1ROE A;  3V62 A;  1VLB A;  1VJK A;  3DWM A;  3UQA A;  1I4R A;  5G5H A;  3ZJT A;  2KFK A;  2PVG C;  5LXH A;  1T5X D;  1HZ6 A;  3DHG C;  1ET9 A;  3DVG X;  4MT5 A;  3KWL A;  2M0A A;  3EC8 A;  1QF6 A;  3N3K B;  1WX9 A;  3VDZ A;  2PJH A;  3ZW3 A;  4LNF A;  3ZJU A;  1ZDX A;  2JUO A;  2MJ3 A;  2BS3 B;  3SD5 A;  3J9C A;  2Z59 B;  1SBB B;  2KN5 A;  3P4R B;  3BZD B;  2IO3 B;  3WAO A;  2LGI A;  3O13 A;  3TBL D;  4D2K A;  2WU2 B;  4IW0 A;  5EE9 A;  5C23 A;  2K25 A;  4UDU C;  4EFO A;  2H88 B;  1UBQ A;  2MBE A;  2KYW A;  4MH8 A;  1V81 A;  1C79 A;  1FRR A;  1KH0 A;  2IND C;  1X1M A;  2JVC A;  2AWT A;  2XNA C;  4BZA A;  3V6C B;  4M01 A;  2B3A A;  3LDZ E;  3SDL C;  3QK0 A;  4YXD B;  2O6V D;  3BYT B;  4C80 A;  3ZNZ B;  2CHZ A;  4ZRQ A;  2IO2 B;  2OOB B;  1XQQ A;  3CIR B;  2LFI A;  4DXA B;  1WGG A;  2D3A A;  2LD9 A;  3Q3O C;  4US8 A;  2MBQ A;  3PHW B;  2RDG A;  1EU3 A;  3U7D A;  3GE3 C;  3VUW A;  3KUC B;  3FC4 A;  2M0X A;  1AW7 A;  1N62 A;  1CK1 A;  3NHE B;  3WAM A;  5FR6 A;  1IUE A;  3PGE A;  3NUH B;  2LHE A;  2UWQ A;  3HRD D;  3AMZ A;  2EKI A;  2MA9 B;  3HM3 A;  3R7R A;  4KGR A;  2KK8 A;  4RM9 A;  1WY8 A;  2DAJ A;  4IG7 B;  3CWI A;  2J0K A;  1I4P A;  1GB1 A;  4IM0 A;  1J19 A;  3DBL I;  1N5X A;  4ICU A;  4XWW A;  2AEH A;  4I6P A;  2KFK B;  2KMA A;  2V3P A;  4KDI C;  2ONQ A;  1SE3 A;  3AN1 A;  3R66 C;  1OEY J;  1E7P B;  2BQQ A;  2ZCC A;  2NTS A;  4C7Y A;  3BIN A;  2KT7 A;  1FIQ A;  2QIE B;  5MPO A;  2L76 A;  4KKJ A;  1PFD A;  1ZKH A;  2BKF A;  1FFV A;  4NAM A;  1TZ1 A;  1FXT B;  2NPT B;  3AM9 A;  4A20 A;  4RGM A;  3BII D;  3AE1 B;  3UIP B;  1DYQ A;  1NI2 A;  2QCZ A;  3QAR A;  1GG3 A;  1ZUD 2;  3A1Q B;  4NJC A;  5HG2 A;  1YX5 B;  1I42 A;  1PGB A;  2MBB B;  3WCQ A;  2QHO A;  3BK2 A;  2O2V B;  4P6V F;  2L52 A;  2WXO A;  1G6J A;  4DHZ E;  4A6Q A;  4RNA A;  2LVO A;  3AI5 A;  2CS4 A;  5HI1 A;  1QIL A;  3DHI C;  4IWQ A;  1Q1O A;  3PLU A;  1MFW A;  2DYM A;  2X8X X;  3I57 A;  2C5L C;  4M00 A;  3ZNG C;  5CTR C;  4XC2 A;  2GOW A;  3X0W A;  1BXT A;  2PTL A;  4GIV A;  4Q2J A;  2FCS A;  2C9W B;  5AZG A;  4R3D A;  1N63 A;  2CR5 A;  4AJY B;  3W1Y A;  1I7H A;  4GB9 A;  3NVY A;  2LGD A;  3ZTC A;  1TKG A;  4OZA A;  2W54 A;  4N9F 4;  4A3P A;  3VRB B;  3I9V 1;  1FM0 D;  1V1O A;  4W9L A;  3DPD A;  1TT5 B;  1UUP A;  3V05 A;  3ZNH B;  2N0S B;  5E6P A;  2PIA A;  4MH0 E;  2FUG 1;  4IOI E;  4E74 A;  1UGJ A;  1NEK B;  3RPF C;  2ACZ B;  2KWU B;  5KHQ A;  3PZD A;  2ZNV B;  1V9J A;  3CST A;  3M3J A;  1NI3 A;  1QOG A;  2FCM A;  2WGS A;  3GZN I;  4S17 A;  4RGN A;  3K9O B;  2MWS B;  2DBY A;  4GGQ A;  2IBI B;  2R61 A;  5H92 C;  3TL5 A;  3RNB C;  3N30 A;  2KDE B;  2L1A A;  2WX0 A;  3ZLZ A;  3IAS 1;  2INP E;  2KVZ A;  2NCN A;  5D94 A;  2KLG A;  2KDI A;  4CO7 A;  2Y3A A;  2KKC A;  3HVZ A;  1C3T A;  1TIF A;  2PKO A;  3KH0 A;  4MEM A;  3B1L X;  3LB8 C;  4YL8 A;  1ZDV A;  2WXL A;  4MM3 B;  4C4V A;  3ZIM A;  1KF6 B;  1TYG B;  1QLB B;  5EE0 A;  1L4D B;  4LCD E;  2HTM E;  3BVZ A;  1SIJ A;  3L17 A;  3NG0 A;  2GBN A;  1E8Z A;  2L0T A;  2SAK A;  4WQM A;  4HPL B;  4W9G A;  1T0R C;  4DWF A;  1VDV A;  3NZS A;  3Q8B A;  5D7G A;  3AEA B;  4DHJ D;  4DHJ B;  4GOC A;  1R4M B;  3B0A A;  3KLS X;  1QOF A;  3NZU A;  4NPN A;  1BML C;  5E6O A;  1V80 A;  4PS3 A;  3T9L A;  1WXV A;  2HJ8 A;  5IA7 A;  1OQR A;  4K81 A;  3Q3N C;  1QOA A;  3C0R B;  1J7C A;  1CMX B;  1FMA D;  4FA6 A;  4RF1 A;  1V5O A;  5TR5 A;  2LUM A;  2FCQ A;  3Q8E A;  5JH5 C;  3P2B A;  2WDR B;  2O6V A;  2NTT A;  1F1H A;  1C4A A;  2KVR A;  1UWM A;  1WJU A;  3WA0 A;  3LJ3 A;  1OGW A;  5L83 A;  1VZ8 A;  2JWU A;  2MEK A;  4IC7 B;  2C7H A;  2ZVO A;  1WXM A;  3AEF B;  2IYD B;  3DBL B;  3IT6 B;  3DDC B;  4HXD A;  3RMK C;  1CJE A;  2LVQ A;  4KV2 A;  4II2 B;  2WWZ A;  3Q8C A;  3FAH A;  5G55 A;  1V8C A;  3EUB 2;  2J7Q B;  4FJZ A;  4KZC A;  1RAX A;  3ZVV A;  4HJG E;  2WQY B;  1FPY A;  3RNC C;  1RRB A;  3LYY A;  3ZRF A;  3NRZ A;  3AEC B;  3MHZ A;  5BYS A;  4M02 A;  2RDB C;  1UEL A;  2VH2 A;  4YSY B;  1E9M A;  4B0M A;  2MBH A;  4EKU A;  1WE7 A;  2FCN A;  2D3B A;  1PDX A;  5AEK B;  3W5U B;  2PEA A;  4RGT A;  1WJ4 A;  1FD6 A;  3TEZ A;  2NVU I;  2K8H A;  4IUM B;  1E6E B;  1ESF A;  1SE9 A;  1OEY A;  1GNU A;  3UQB A;  2N7J A;  3T3O A;  1K50 A;  2WDV B;  2V1Y A;  1HA5 A;  4FXC A;  4DBG A;  1N5W A;  3HIZ A;  3QQ8 B;  4H2A A;  1WZ3 A;  2WXJ A;  1SF0 A;  3P4S B;  3AH7 A;  4W9H A;  3ZUN A;  3PTF C;  2AQ2 B;  1ZW7 A;  1GOZ A;  3NZ3 A;  1RLF A;  4GLS C;  1HQR D;  1XCQ L;  4F1S A;  4FJV B;  5EE1 A;  3K9P B;  3P63 A;  2KDB A;  4BKT A;  5AUI A;  4EEW A;  3GS2 A;  3VXW A;  4MDK E;  3TIX A;  3ZGZ A;  5BYR A;  2IO1 B;  3CSF A;  5E6N A;  4IM3 A;  1TBE A;  1XLN A;  4OVZ A;  1WXQ A;  4WJO A;  4JWU C;  2A4Z A;  1XO3 A;  3ZDT A;  5L95 C;  3U2S C;  1V6E A;  4LNI A;  3IT4 B;  4G50 A;  1S1Q B;  2N9E B;  3AXC A;  3N9Y C;  1IBX A;  2AL6 A;  1AYF A;  4PS8 A;  3PPA A;  2QC8 A;  3B9J A;  4BVU C;  1XD3 B;  5BMH A;  3N20 C;  2E6X A;  4XDC A;  5J2R A;  4LK0 M;  1WSP A;  1XLQ A;  4RMA A;  3JW0 X;  2KDF B;  3RUI B;  3UF8 A;  1V97 A;  3AED B;  3NVV A;  2TSS A;  4XZ4 A;  2BGF A;  4P16 A;  2A5U A;  3OJ4 B;  4DQO C;  3KVF B;  2DYB A;  5JHA A;  2G45 B;  2XEW A;  4AS1 A;  1C78 A;  1ACC A;  4L2Y A;  2IJ0 A;  1KRH A;  1J7A A;  2LAS A;  3BK1 A;  2DZI A;  2PW9 A;  3O65 B;  3V6E B;  2RPQ A;  3ETR A;  1C1Y B;  3VRA B;  2GLS A;  5EE3 A;  2NMQ A;  4FLH A;  2DWQ A;  1Q0W B;  2NS5 A;  1EF5 A;  4WJP A;  1WE6 A;  2Y5P A;  1VRA B;  2MQJ A;  4B0E A;  4DDG D;  4LNK A;  3IG3 A;  1R4N B;  3EFC A;  2C60 A;  1NVI D;  2WXN A;  4HEA 1;  4OZC A;  2W55 A;  1R4M I;  5JHB A;  2QEJ C;  2JYT A;  2GRI A;  2O6V B;  2LZ6 A;  3AE8 B;  3RNA C;  4XGA B;  4G3X B;  3SHQ A;  4ASW C;  2KC1 A;  5AZH A;  1UF0 A;  3VVW B;  4ZRP A;  1ZP0 B;  2BTE A;  5TSS A;  2CHW A;  2JPH A;  4YTP B;  2WXF A;  1YQ4 B;  4PYU A;  4F7Z A;  4TQ1 A;  1UD7 A;  2C7M B;  5G5G A;  3Q3M C;  4WQO B;  3M63 B;  2KXJ A;  2KWV B;  1Q5W B;  3AUL A;  1CZP A;  2L3Z A;  2BKR B;  3H9D A;  1RFA A;  2NBW B;  1E8Y A;  3BYY B;  3DBH I;  3AE5 B;  3UGB B;  1MG4 A;  1J8C A;  1PGX A;  4FHK A;  2Q5W D;  2V4L A;  1HEZ E;  1JWB D;  2N1V A;  1P1A A;  1DOI A;  1B1Z A;  2GI9 A;  1WJN A;  4A9A A;  3A33 B;  2G4S A;  2G9H D;  2K1F A;  2PMV A;  2ZCB A;  3GZN B;  5KHO A;  4AUQ C;  3X23 A;  2I1K A;  2MH7 A;  1K53 A;  1L2N A;  1XEE A;  2KJH B;  2ZPN A;  4XWT A;  1ZE3 D;  4BKS A;  2BT6 A;  3H7P A;  4LDT D;  2KOX A;  1TY2 A;  1A5R A;  1DOY A;  2KQS A;  2VH1 A;  1YN4 A;  3B2G A;  2KTR B;  2V3S A;  3FIL B;  3ZYY X;  1P98 A;  1Y56 A;  2PVO D;  1KLU D;  3R3M A;  1Z2M A;  2VZK D;  2FBW B;  4MSQ B;  1C4C A;  3M62 B;  3A9K A;  4GDL B;  1OQY A;  3AE9 B;  3DWG C;  2REX A;  2SEB D;  1QZE A;  4J3O D;  2M8S A;  3CF6 E;  1N6Z A;  2ZEQ A;  3L08 A;  2WNM A;  3UI3 A;  4OHJ A;  2WXQ A;  3LXF A;  2R2Q A;  4IM2 A;  4I6N B;  1WZ0 A;  4L23 A;  4K3B A;  1JRP A;  1H8C A;  3W2D A;  4GDK B;  3NY5 A;  1TS5 A;  2D2Q A;  1JWU D;  2Z0D B;  3RFZ B;  4HKZ E;  1IP9 A;  1YQ3 B;  3PLV A;  4WUR A;  1GJZ A;  3DQV A;  1ZXI A;  1U4A A;  4KDL B;  3VHT C;  2BYE A;  5HFY A;  3A4S C;  4II3 B;  1I4X A;  3DBH B;  2K8C A;  2MCN B;  1L5P A;  1UWX A;  4ZYS A;  3PVL A;  1FNU A;  4KKI A;  1XLO A;  2LUE A;  3ZKJ C;  2NBU A;  4NZL B;  3N32 A;  5DCN A;  3VUY A;  4HVB A;  1SE2 A;  2KC2 A;  1MG8 A;  2LRW A;  1XT9 B;  1XXG A;  2L8J A;  2MW5 A;  3MC9 A;  2DZM A;  1LO5 D;  5IAA C;  1CQV A;  2KDM A;  4A55 A;  1K51 A;  1WGD A;  1WRI A;  4QAY A;  2HJ1 A;  1F2R I;  4HCN B;  1MPE A;  2EEL A;  1Q10 A;  1JCK B;  4US9 A;  4JWS C;  3RUL A;  2FUH B;  1EM7 A;  1RYJ A;  3MHS D;  2BYT A;  1D3Z A;  4HK2 A;  5DPT A;  4ZHO A;  4HJK A;  1LGR A;  3VTW A;  1AWD A;  2G4D B;  2WXG A;  1M94 A;  2WP9 B;  4PT5 A;  1KOT A;  3ABV B;  4E3C A;  3T3N A;  3DOW A;  5IO9 A;  1JWM D;  1WIA A;  3HM6 X;  2KQ7 A;  1WYG A;  2D07 B;  5C1Z A;  1ENF A;  4HLE A;  1YJI A;  4ANX A;  1SIF A;  4YWG G;  3W9C B;  2ASQ A;  3PRE A;  4NNJ B;  4M8N A;  4MM3 A;  4C4V B;  4RH6 A;  3GP7 A;  4FUL A;  3AB5 A;  1ZOY B;  3ZRC A;  3MFG A;  2C7N B;  1KLG D;  4WH4 A;  1C4P A;  2K6Q A;  3NS8 A;  3AV8 A;  4A8X C;  2JWZ A;  1WM3 A;  1I4Q A;  2LWP A;  3B08 A;  3IVF A;  2RPV A;  3QX1 A;  1AN8 A;  2CKH B;  3H6N A;  4URK A;  4G11 A;  2NPT A;  1UZX B;  2OHF A;  2PPH A;  2KNB A;  4P1B C;  4K7U A;  2M19 A;  1GB4 A;  4USA A;  2RMM A;  2JT4 B;  2ICI A;  2WXK A;  5HHD G;  3UIO B;  1D6E C;  4S0R A;  4ZRJ A;  4AQ7 A;  3R2T A;  3TCA A;  4EE2 A;  1E10 A;  1WMH A;  1Z5S B;  2DAF A;  2DHZ A;  2WHI A;  1IBX B;  1DOX A;  1D4B A;  3ALB A;  4GN1 A;  2ZJD A;  4LJO B;  4C00 A;  3FIL A;  4C7Z A;  3QJZ A;  3RNF C;  2YEP F;  1YN5 A;  3ZXV A;  3HK0 A;  3MJW A;  3ZQ4 A;  4E71 A;  1B9R A;  3VTV A;  2NBV B;  2QJL A;  2LXC A;  2V3N A;  2JRI B;  2BB6 A;  1L7Y A;  3KW5 B;  4TQ0 A;  4GDK A;  3ZNI D;  1TY0 A;  3L10 B;  4K7S A;  4ZYN A;  3N1Z C;  3TSS A;  1WGR A;  1EWY C;  3A9J B;  1IGD A;  5LNK 1;  4TSS A;  1LFD A;  3HUI A;  2DZJ A;  4BKG A;  3QC8 B;  4TV3 A;  3RT3 B;  3AE4 B;  4M8M A;  3R2I A;  1FRD A;  2ZVN A;  3U52 E;  2N9P C;  3V61 A;  3SFE B;  4KVG B;  2BWE S;  1AAR A;  3CMM B;  3PZ8 A;  5FK9 C;  1NYQ A;  4AJW A;  1SSN A;  3U8Z A;  2BPS A;  1I4H A;  2BVC A;  3V3X A;  4HDQ A;  3ML9 A;  3MC0 B;  4N59 A;  2MP2 A;  4EOY A;  5AZF A;  1RM6 C;  3IBE A;  2Z0E B;  4NQL B;  5IOI A;  1YD8 U;  1TKE A;  4MGI E;  3S2A A;  5JZE B;  3DCG A;  1PGA A;  3EA6 A;  5BYQ A;  4LJP B;  4AWJ A;  2V4I B;  1YX6 B;  3ML8 A;  2ZW0 A;  4N58 A;  1HZ5 A;  4W9K A;  2XK5 A;  1L0V B;  2WX1 A;  4HRS A;  4JIO U;  1WMH B;  4AOF A;  3ECI A;  1TS4 A;  2AQ1 B;  1JML A;  2GMI C;  3DHH C;  2GBJ A;  4PK1 A;  1FEH A;  5EDS A;  2QSD A;  1TTN A;  2NR2 A;  2D3C A;  3L16 A;  1MHH E;  3JSV B;  4TMA B;  2FAZ A;  1TS3 A;  4NY0 A;  3AE3 B;  2JU6 X;  4BFR A;  2CJN A;  2JZZ A;  1EF1 A;  4HKQ A;  1FNV A;  2JYE A;  1E7V A;  3C8Y A;  3SR6 A;  2WDQ B;  1LM8 B;  1UNS A;  2BF8 B;  2XBB C;  3RZW C;  3VH4 B;  4EZK A;  4KSK C;  1EO6 A;  5AUK A;  2G1E A;  4ANU A;  4I6L B;  3R8B A;  1TZO A;  1IPG A;  2ZW1 A;  2K8B A;  2INN E;  1LQB A;  1JQ4 A;  3PRP B;  4IWO A;  1JRO A;  4NJ6 A;  3KYD D;  2HTH A;  2N9K A;  1F77 A;  2ZNV C;  2LJI A;  3FKY A;  1JWA D;  1KLV A;  4G0N B;  4A3O A;  1HXY D;  3ZXR A;  1IGC A;  2N7E A;  3Q8A A;  2WXP A;  3EFU A;  2LGY A;  1WF9 A;  3DVG Y;  4BBN C;  2OED A;  3MC8 A;  2KLC A;  4REZ A;  4RFB A;  5D2M B;  3QCA A;  1F0Z A;  2UYZ B;  1JW9 D;  2EMT A;  2WXH A;  4K3C A;  1R4N I;  2MLB A;  2RSU A;  4AP4 C;  2W82 A;  4B95 A;  4FN2 A;  2J4X A;  3JYU A;  4WAA A;  2KAC A;  2JQR B;  3NOB A;  3BWU D;  1WXS A;  2JRH A;  1C9F A;  2GBM A;  2BS4 B;  4JE3 B;  4OZB A;  4P1C C;  1MJD A;  1FFU A;  4P7I A;  2LHD A;  1QQR A;  5LXI B;  2N1W A;  4ITK A;  3A9J A;  1WI0 A;  1ET6 A;  3RZF A;  1VD2 A;  2DLB A;  4DHZ B;  4DXF A;  1DGJ A;  2EMS A;  2K0P A;  4K7W A;  3QA8 A;  5HKH A;  5CHW A;  2WS3 B;  4XDD A;  3APF A;  4FHJ A;  4PS7 A;  1E8W A;  3SU8 X;  4MJS A;  2DZK A;  1WGY A;  2W9N A;  2JXX A;  2LGX A;  1UH6 A;  3D32 A;  3AU4 A;  4JPS A;  4HPP A;  1SE4 A;  3MJ5 A;  4FJY A;  2JZ3 B;  4GXB A;  2KWD A;  2BYV E;  2KMC A;  1KTK A;  3C19 A;  2MSE D;  5H8Y E;  3ENE A;  5DPW A;  1ZPS A;  1F2R C;  5CX3 A;  3HVD A;  4GU2 A;  2O2V A;  1D5M C;  2D3G A;  1UBI A;  4W9I A;  2YVC A;  3QWZ B;  3AE7 B;  4YSX B;  3APC A;  1XLP A;  1YOV B;  2J53 A;  1K8R B;  1P0R A;  1T0S C;  1XCT L;  3IFW B;  1E0Z A;  4IKG A;  1FO4 A;  2N9L A;  3ZO5 B;  1QT9 A;  3ZJV A;  1GUA B;  1YIW A;  1ZGU B;  4ACF A;  3OG5 A;  3U4E G;  4WWN A;  1PQS A;  2KZR A;  3AEB B;  3EEC A;  5GMV A;  4YSZ B;  2DYO A;  5GXG B;  4M0W A;  1L0Y B;  4RGO S;  3H1U A;  4N6E B;  3TEY A;  1SEB D;  5J18 A;  1SGH A;  5G2N A;  2LVP A;  1T3Q A;  1D5X C;  3W1S A;  1E8X A;  3QHT A;  3L13 A;  3SEB A;  2GBR A;  2K39 A;  4MSM B;  1EWC A;  4ZRI A;  2VRR B;  1WFY A;  1H4R A;  1WX8 A;  2WXI A;  4C56 C;  2LEK A;  3PV1 A;  3DBR I;  3V60 A;  1YJ1 A;  1T0Q C;  3RCZ A;  2I2Y A;  4B9K A;  1Y8R C;  4ANV A;  1MI0 A;  3ZDM C;  3PZ7 A;  1EUV B;  1QOB A;  3WIM A;  1FXA A;  4LDT B;  2WXR A;  4B6W A;  3VR9 B;  2MHJ A;  5D3I B;  3PS6 A;  2K3U A;  3RYT A;  4O1N A;  1JAL A;  1GC6 A;  3RD2 A;  4CYE A;  2GBK A;  1FCC C;  3I5J C;  2DNF A;  1N61 A;  4OVV A;  2D5G A;  1L6V A;  3KUD B;  2N7D A;  2UU7 A;  4ZOH C;  2AL3 A;  1P7F A;  2KTF A;  3T8M A;  1OQQ A;  2OJR A;  4WWP A;  4NQK E;  4HWI B;  1C76 A;  3TEW A;  4F8C B;  4K1R B;  1FNW A;  1E5W A;  2JY6 A;  5J17 A;  1WR1 A;  1D5Z C;  1WJ6 A;  3A9K B;  4GDL A;  3OWE B;  3NVZ A;  1QKZ A;  1RWS A;  2CJO A;  1E7U A;  3PSE B;  4WIP A;  2M4N A;  4GMV A;  3E9S A;  1J0G A;  2IY1 B;  1YMH E;  3N1X C;  1KM7 A;  4IWP A;  4NJ7 A;  4LLG M;  3PT2 B;  4IDI A;  2J0J A;  2MJE A;  2Y5C A;  3TUO A;  2W3R A;  2IGG A; 
#chains in the Genus database with same CATH homology
 2JRI B;  4HCP B;  3ZDT A;  1L7Y A;  1WYW B;  3KW5 B;  4W9J A;  5L95 C;  4TQ0 A;  4GDK A;  1V6E A;  3ZNI D;  2OOB B;  3L10 B;  4G50 A;  4K7S A;  1S1Q B;  3VH3 B;  2G3Q B;  2N9E B;  2MP2 B;  3AXC A;  4ZYN A;  2KFJ A;  2AL6 A;  2KJR A;  1WGG A;  1WRD B;  4PS8 A;  2ZPY A;  4DXA B;  3PPA A;  1WGR A;  3A9J B;  4JQW C;  2LD9 A;  4BVU C;  1LFD A;  1XD3 B;  2MBQ A;  5J2R A;  2DZJ A;  3PHW B;  4BKG A;  3QC8 B;  4TV3 A;  3U7D A;  3H7P B;  3RT3 B;  4M8M A;  3VUW A;  3A4R A;  4ZRK A;  4KIK A;  4RMA A;  3KUC B;  3JW0 X;  2WDT B;  2M0X A;  2KDF B;  2ZVN A;  2N9P C;  3V61 A;  3RUI B;  4KVG B;  3UF8 A;  3UIN B;  2BWE S;  3NHE B;  3WAM A;  1AAR A;  5FR6 A;  3CMM B;  4XZ4 A;  2BGF A;  2JF5 A;  3PGE A;  3VFK A;  2A5U A;  4FAD A;  2UWQ A;  4BOZ B;  1T0Y A;  2KTR A;  3OJ4 B;  4WJQ A;  4AJW A;  3KVF B;  5D6J B;  2DYB A;  3U8Z A;  5JHA A;  1IYF A;  2Y5B B;  1WX7 A;  2G45 B;  2BPS A;  2MA9 B;  3GOE A;  2XEW A;  3HM3 A;  2D10 A;  3R7R A;  2CHX A;  2KK8 A;  4HDQ A;  3ML9 A;  4RM9 A;  1WY8 A;  2DAJ A;  2LXA A;  2MP2 A;  1E90 A;  2AYO B;  4EOY A;  3L54 A;  5AZF A;  3IBE A;  4IG7 B;  4TUU A;  3QIJ A;  2Z0E B;  4NQL B;  2J0K A;  2LAS A;  2DZI A;  3KYC D;  1YD8 U;  4IM0 A;  4MGI E;  3S2A A;  3O65 B;  5JZE B;  3DCG A;  2RPQ A;  5BO4 B;  1J19 A;  3V6E B;  3DBL I;  1C1Y B;  3H7S A;  3DVN V;  4ICU A;  4LJP B;  4AWJ A;  1YX6 B;  3ML8 A;  3WAP A;  2AEH A;  2IZV B;  4FLH A;  4W9K A;  3WAN A;  2NS5 A;  1Q0W B;  2XK5 A;  1KJT A;  1EF5 A;  4I6P A;  4WJP A;  2KFK B;  2KMA A;  1WE6 A;  4KDI C;  2WX1 A;  2MQJ A;  3R66 C;  4JIO U;  1WMH B;  4JGH B;  3ECI A;  1OEY J;  4AOF A;  2KO3 A;  4DDG D;  3Q3F A;  4W9F A;  2ZCC A;  3IG3 A;  4HPM B;  2GMI C;  2C60 A;  2GBJ A;  4W9E A;  1VCB A;  3DBS A;  3BIN A;  5EDS A;  4NAW A;  1TTN A;  1R4M I;  2PE6 B;  5JHB A;  2NR2 A;  2L76 A;  2MX2 A;  3L16 A;  3VUX A;  3I3T B;  3JSV B;  2FAZ A;  2O6V B;  3OLM D;  2LZ6 A;  1ZKH A;  4NY0 A;  2BKF A;  4G3X B;  3SHQ A;  1TZ1 A;  1FXT B;  2FNJ B;  4ASW C;  2NPT B;  3ONS A;  2KC1 A;  5AZH A;  4BFR A;  4A20 A;  3VVW B;  4HDO A;  2JZZ A;  4OVU A;  4W9C A;  2CHW A;  2JPH A;  1BT0 A;  2WYQ A;  1EF1 A;  3UIP B;  1NI2 A;  4PYU A;  4F7Z A;  1E7V A;  3QAR A;  1UD7 A;  4TQ1 A;  1GG3 A;  4JLC A;  3A1Q B;  3WAL A;  2C7M B;  1LM8 B;  2BF8 B;  3RZW C;  1JRU A;  1YX5 B;  2XBB C;  1I42 A;  2D11 A;  3M63 B;  4WQO B;  3VH4 B;  2KXJ A;  2N9X A;  4EZK A;  4KSK C;  2KWV B;  1OTR B;  1EO6 A;  2KX3 A;  2MBB B;  1Q5W B;  3AUL A;  4ANU A;  2L05 A;  2PE9 A;  2QHO A;  4I6L B;  1I35 A;  4ANW A;  3DVN U;  3IHP C;  1IPG A;  2O2V B;  4BBN F;  2L3Z A;  2BKR B;  2M1M A;  3H9D A;  2K8B A;  4KSL C;  1G6J A;  1LQB A;  4DHZ E;  1F9J A;  1RFA A;  2LVO A;  2NBW B;  3AI5 A;  3PRP B;  4IWO A;  1E8Y A;  2CS4 A;  1V49 A;  3JSV A;  4NJ6 A;  3KYD D;  3DBH I;  4IWQ A;  2HTH A;  3UGB B;  1Q1O A;  3PLU A;  1J8C A;  2DYM A;  2C5L C;  4FHK A;  3ZNG C;  2V4L A;  2ZNV C;  2N1V A;  4XC2 A;  5CTR C;  2GOW A;  2KWC A;  1P1A A;  2MBO A;  3X0W A;  4GIV A;  1KLV A;  2FCS A;  4G0N B;  4A3O A;  1WJN A;  2N4F A;  2C9W B;  5AZG A;  4BKS D;  3A33 B;  2IY0 B;  3PRM B;  2G4S A;  2N7E A;  3EFU A;  3APD A;  3W1S C;  2K1F A;  2CR5 A;  2LGY A;  4AJY B;  1WGH A;  2ZCB A;  3W1Y A;  5KHO A;  4AUQ C;  1WF9 A;  3DVG Y;  3X23 A;  4BBN C;  2I1K A;  2EKE C;  4GB9 A;  2LGD A;  5CHF A;  3ZTC A;  2FID A;  1L2N A;  2KLC A;  2L00 B;  2KJH B;  2MRP A;  4N9F 4;  4A3P A;  2ZPN A;  5D2M B;  5DPR A;  1NBF C;  4BKS A;  3H7P A;  4LDT D;  4W9L A;  3DPD A;  2DEN B;  2KOX A;  3QCA A;  2UYZ B;  2KX0 A;  2EMT A;  3ZNH B;  1A5R A;  1R4N I;  5E6P A;  4DK5 A;  3M95 A;  2MLB A;  2RSU A;  4MH0 E;  4AP4 C;  2KQS A;  4E74 A;  4KIK B;  4X57 B;  3Q3J A;  2LRU A;  1C3T A;  4B95 A;  2KTR B;  2LJ5 A;  3JYU A;  2KWU B;  4FN2 A;  3PZD A;  4WAA A;  2ZNV B;  5KHQ A;  1NDD A;  2V3S A;  1V9J A;  2HE7 A;  3NOB A;  1WXS A;  2JRH A;  3CST A;  2GBM A;  3M3J A;  1P98 A;  2FCM A;  3R3M A;  4MGK E;  3MTN B;  1Z2M A;  4ZDV A;  4P7I A;  3GZN I;  4MSQ B;  3M62 B;  3A9K A;  2CU1 A;  1TGZ B;  4GDL B;  3K9O B;  1OQY A;  2MWS B;  5LXI B;  3TMP B;  4GGQ A;  2N1W A;  2REX A;  4BOS C;  2IBI B;  3BY4 B;  3TL5 A;  1QZE A;  3A9J A;  3TJP A;  1WI0 A;  4JL9 A;  2M8S A;  3CF6 E;  3N30 A;  3L08 A;  2KDE B;  2ZEQ A;  2WX0 A;  1VD2 A;  3RZF A;  3ZLZ A;  4DHZ B;  2EMS A;  1UGM A;  2KAN A;  2R2Q A;  2RGF A;  4K7W A;  3VQI A;  4IM2 A;  1P3Q U;  3QA8 A;  5CHW A;  5HKH A;  4FBJ B;  2NCN A;  5D94 A;  2KLG A;  2KDI A;  4CO7 A;  1V2Y A;  3APF A;  1WZ0 A;  1E8W A;  1YQB A;  2KKC A;  4FHJ A;  4I6N B;  4MJS A;  4PS7 A;  3SU8 X;  2ZZP B;  4NAW B;  4MEL A;  1GC7 A;  2DZK A;  1WGY A;  2J0M A;  3KH0 A;  1H8C A;  4GDK B;  4MEM A;  3NY5 A;  2W9N A;  4J6I A;  3VTU A;  3B1L X;  2YLM A;  2D2Q A;  4YL8 A;  4EZL A;  1V5T A;  2JXX A;  2LGX A;  2Z0D B;  3ZIM A;  1IP9 A;  2I1J A;  1UH6 A;  3D32 A;  3AU4 A;  3PLV A;  4PYZ A;  4FJY A;  2JZ3 B;  4GXB A;  1GJZ A;  3OAW A;  3DQV A;  1U4A A;  4LCD E;  4KDL B;  3VHT C;  2BYV E;  2KMC A;  2BYE A;  4ICV A;  3PHX B;  3PRZ A;  2MSE D;  3A4S C;  5CHV C;  3ENE A;  3KUZ A;  5DPW A;  3L17 A;  4II3 B;  2GBN A;  1E8Z A;  2L0T A;  2K8C A;  5CX3 A;  4HPL B;  4W9G A;  4DWF A;  2HD5 B;  3NZS A;  4GU2 A;  3JVZ X;  5D7G A;  2O2V A;  3QAQ A;  2D3G A;  1UBI A;  4DHJ B;  3OJ3 A;  4W9I A;  4DHJ D;  4GOC A;  2YVC A;  3QWZ B;  2MCN B;  1LXD A;  2KJ6 A;  3PVL A;  2IO0 B;  4KZ0 A;  4DDI D;  3ZKJ C;  2LUE A;  2LI5 A;  3APC A;  3B0A A;  2M17 A;  1K8R B;  1P0R A;  3U30 A;  4EUT A;  2NBU A;  3IFW B;  3NZU A;  3N32 A;  5DCN A;  3VUY A;  4NPN A;  3ZO5 B;  2FIF A;  2R2O A;  5E6O A;  1V80 A;  4PS3 A;  3T9L A;  2XK5 B;  3AU5 A;  4HVB A;  1GUA B;  1YIW A;  1WXV A;  2BYF A;  2HJ8 A;  5IA7 A;  2KC2 A;  1MG8 A;  4MGZ E;  1ZGU B;  4K81 A;  2LRW A;  1XT9 B;  3C0R B;  2L8J A;  1CMX B;  2MW5 A;  2DZM A;  4RM8 A;  4FA6 A;  4WWN A;  1PQS A;  1V5O A;  5IAA C;  2KZR A;  5TR5 A;  2FCQ A;  2KD0 A;  5JH5 C;  1WGD A;  3EEC A;  5GMV A;  3P2B A;  2DYO A;  4W9D A;  2O6V A;  4HCN B;  3ZTD A;  3H1U A;  3L0W B;  2DX5 B;  2KVR A;  4WWO A;  1WJU A;  5J18 A;  1SGH A;  1WXA A;  3WA0 A;  5G2N A;  3LJ3 A;  1WM2 A;  2LVP A;  1OGW A;  5L83 A;  3RUL A;  2FUH B;  1HE8 A;  4IC7 B;  2C7H A;  2ZVO A;  3A1Q A;  3MHS D;  3R7Q A;  1WXM A;  3W1S A;  1E8X A;  3QHT A;  2IYD B;  1V86 A;  3L13 A;  4XX5 A;  1D3Z A;  4HK2 A;  5DPT A;  2GBR A;  2K39 A;  2KHW B;  3DDC B;  4HJK A;  3EHV A;  4MSM B;  3VTW A;  4HXD A;  1WH3 A;  2G4D B;  2K6D B;  4ZRI A;  2VRR B;  1WFY A;  1M94 A;  1H4R A;  1WX8 A;  2LVQ A;  4WJN A;  1S3S G;  1KOT A;  4E3C A;  4KV2 A;  4II2 B;  5DPS A;  1WR6 E;  2BWF A;  2WWZ A;  3DOW A;  4MGY E;  3PV1 A;  4CHK A;  3DBR I;  2RR9 A;  5G55 A;  3V60 A;  1P9D U;  1WIA A;  1YJ1 A;  2KQ7 A;  3HM6 X;  1ISN A;  5LLI A;  3RCZ A;  2D07 B;  2J7Q B;  5C1Z A;  2L0F A;  4HLE A;  4M0W B;  3HHM A;  4TKN A;  4B9K A;  1Y8R C;  4FJZ A;  4KZC A;  1RAX A;  3ZVV A;  4ANX A;  4MJS B;  4EZJ A;  2L7R A;  1SIF A;  3VAW A;  1RRB A;  2RD0 A;  4GSW A;  4ANV A;  3ZRF A;  3ZDM C;  2ASQ A;  3PRE A;  4NNJ B;  1EUV B;  4M8N A;  3WIM A;  4LDT B;  4MM3 A;  1UEL A;  3V62 A;  3UQA A;  4FUL A;  4B6W A;  3ZRC A;  3PS6 A;  2KFK A;  2MBH A;  4EKU A;  3RYT A;  1GC6 A;  1WE7 A;  2FCN A;  2C7N B;  5AEK B;  5LXH A;  2PEA A;  2K6Q A;  3DVG X;  1WJ4 A;  3NS8 A;  3EC8 A;  3RD2 A;  2JWZ A;  2NVU I;  3N3K B;  2K8H A;  4CYE A;  1WX9 A;  3VDZ A;  2GBK A;  4IUM B;  1WM3 A;  2PJH A;  3ZW3 A;  1SE9 A;  1OEY A;  4OVV A;  1GNU A;  2LWP A;  3B08 A;  3IVF A;  3KUD B;  3UQB A;  2N7D A;  2JUO A;  2V1Y A;  2AL3 A;  2KTF A;  3T8M A;  3QX1 A;  2CKH B;  3H6N A;  4DBG A;  3HIZ A;  4URK A;  4G11 A;  2NPT A;  3SD5 A;  1UZX B;  2OJR A;  2Z59 B;  1WZ3 A;  3QQ8 B;  4WWP A;  4NQK E;  2PPH A;  2KNB A;  4HWI B;  4K7U A;  2KN5 A;  4F8C B;  4K1R B;  2JT4 B;  1E5W A;  2IO3 B;  4W9H A;  3WAO A;  3ZUN A;  2JY6 A;  3PTF C;  3TBL D;  1WR1 A;  5J17 A;  1ZW7 A;  3UIO B;  1RLF A;  4IW0 A;  4ZRJ A;  5C23 A;  1WJ6 A;  2K25 A;  3A9K B;  4GDL A;  3TCA A;  4EFO A;  4F1S A;  4FJV B;  1UBQ A;  1WMH A;  1Z5S B;  2MBE A;  2DAF A;  2DHZ A;  3K9P B;  1V81 A;  1E7U A;  2KDB A;  3PSE B;  4BKT A;  1X1M A;  2JVC A;  4EEW A;  2AWT A;  2M4N A;  3ALB A;  4GN1 A;  2ZJD A;  3VXW A;  4LJO B;  4GMV A;  4MDK E;  3TIX A;  3V6C B;  3QJZ A;  1J0G A;  2B3A A;  2IY1 B;  2IO1 B;  1KM7 A;  3CSF A;  3LDZ E;  3SDL C;  3HK0 A;  4IWP A;  3MJW A;  5E6N A;  3QK0 A;  4E71 A;  2O6V D;  3ZNZ B;  4IM3 A;  4NJ7 A;  1TBE A;  4WJO A;  2CHZ A;  3PT2 B;  3VTV A;  2A4Z A;  2NBV B;  2J0J A;  2IO2 B;  1XQQ A;  2LXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...