1RLPC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1rlpC00
1ZUYA 2KRSA 1FMKA 2EBPA 2YUQA 2EW3A 2A08A 2JM8A 4GLMA 2CH4W 2AZSA 4M4ZA 4K11A 4OMPA 4OMOA 4ORZA 1T0HA 1UDLA 2DL8A 2JM9A 2KROA 2ESWA 2HDAA 4Z8AA 1HD3A 1G83A 2GNCA 2W0ZA 1SHGA 2K6DA 2DRKA 3EGUA 2D1XA 4HVWA 2VVKA 2EYYA 2RQVA 1UG1A 2C0OA 2J05A 4RTVA 2YUNA 2ED0A 2NUZA 2KYBA 4FSSA 4J9FA 3VS0A 1UE9A 1TG0A 1T3LA 2EYXA 2M0YA 4OMQA 1KJWA 1AOJA 4KRTA 1PWTA 2HCKA 4DEXA 1YNZA 1UUEA 4ESRA 1QCFA 2CDTA 2KRNA 2DL7A 1EFNA 2DILA 2KBTA 4JJBA 2FRWA 2LZ6B 4HVVA 2KT1A 4F14A 2LNHB 2H8HA 1W70A 2YDLA 4LUDA 3TSZA 1GBRA 2A37A 2SRCA 3FJ5A 3EG0A 3H0IA 4Z89A 4RUGA 2CSQA 1Z9QA 1QKXA 1HSQA 1G2BA 1AD5A 1RLQC 1I07A 2LQWA 3VRYA 3QWYA 2C0IA 1WI7A 4CC2A 2L3PA 1H8KA 3ULRB 1AWWA 4J9DA 3CQTA 1NYGA 1J3TA 1PKTA 2DA9A 1NYFA 2D0NA 1GRIA 4JJDA 2EQIA 2RF0A 1AWOA 4JZ3A 5I11A 3O5ZA 2DNUA 2D8JA 2GTOA 1ZUUA 1K4US 3REAB 2K79A 3M0TA 1GFDA 2RQWA 3VRZA 3QWXX 1OOTA 1UJYA 2FO0A 4GBQA 1CKAA 3VS3A 4J9IA 5IH2A 1GCPA 2HSPA 3I9QA 4JJCA 1E6HA 2SEMA 3U23A 3M0UA 2KXDA 1TUDA 1WIEA 2LJ1A 2KNBB 4RTWA 1JQQA 2BZXA 3M0RA 1PKSA 4EIKA 2ROTA 4RTTA 1KFZA 3VS1A 4D8KA 2JT4A 3I35A 1Z9ZA 1NEGA 4X1VA 3VS2A 2B86A 2DL4A 3NGPA 1T0JA 2EKHA 1B07A 3I5SA 2DRMA 2W10A 2RMOA 5IXBA 1WLPB 3VS6A 1JO8A 3R6NA 3UA6A 2DBMA 1AWJA 4J9GA 2AZVA 2K2MA 1QKWA 1I0CA 1GCQA 2FEIA 2MOXA 1WFWA 5FW9A 2L3SA 3EG2A 3RBBB 3SEMA 1JU5C 1W6XA 1BBZA 2EVRA 3TVTA 1WX6A 1OPKA 2ECZA 4CC3A 2DBKA 2F2VA 1FYNA 4HVUA 2AKKA 2L2PA 1M3AA 3PE0A 1X6GA 1SEMA 1Y57A 2OI3A 1X2KA 3H0FA 5FWBA 3A98A 2YUOA 1NLOC 2O2OA 2P4RA 1UHFA 3UA7A 2DF6A 4IIOA 5L23A 4OMNA 2YUPA 3UF4A 1UGVA 1SRMA 2GQIA 2KRMA 1X43A 2A36A 2KXCA 1GL5A 2JXBA 4LN2A 1WYXA 1ABOA 2NWMA 4Z88A 1BU1A 3IQLA 3REBB 1AZGB 4JZ4A 5EC7A 1X27A 1UTIA 2X3XD 2DL5A 2I0NA 1WXUA 2KT8A 1T3SA 1NEBA 2LCSA 2M51A 2DX1A 2VWFA 4JPBW 5I22A 2EYWA 1Y0MA 4IIMA 4J9HA 1RUWA 2K9GA 2AK5A 2EYZA 1M3BA 4D8DA 4RTYA 2HEQA 1YWOA 3H41A 1OV3A 1MV3A 1A0NB 1JEGA 1YWPA 1MV0B 1U5SA 2BZ8A 2JTEA 1VYTA 1BK2A 2J6OA 3EHQA 2XMFA 1HJDA 4RTZA 2YSQA 1NG2A 2A28A 5IXFA 3RNJA 1PRLC 1V1CA 4A63B 2ENMA 2DYBA 1BB9A 1AWXA 1W1FA 2RPNA 1ZUKA 2CH4A 5ECAA 1K0SA 1YCSB 1GCQC 5IHNA 2RQTA 1ZSGA 2V1QA 4HXJA 1IO6A 2BTTA 4OMMA 4CC7A 2GBQA 4AFQC 2J7IA 4E6RA 4ZNXA 1JXMA 1ZLMA 3TSWA 4WCIA 1YN8A 2G6FX 2KE9A 2CSIA 1CKBA 2J06A 2KGTA 3LH5A 1X6BA 4RTXA 1UFFA 2KEAA 2F2WA 2O9VA 2ED1A 3C0CA 3ZL7C 2CT4A 2OAWA 2EGAA 2RNAA 2O88A 1SRLA 2JW4A 3SHWA 1ABQA 3EHRA 2KYMA 2LMJA 4F17A 2OJ2A 2LJ3A 2JMCA 3EG1A 2JMAA 3GBQA 1N5ZA 1M8MA 2VKNA 2F2XA 4J9BA 2LX7A 1PHTA 3M0PA 1XOVA 2CT3A 2KR3A 2O31A 1JXOA 1RLPC 2EGCA 2GGRA 3NMZC 1WXBA 3NHNA 4R0KA 4RTUA 2J6KA 4HCKA 3VS4A 4J9EA 2FG0A 4J9CA 3I5RA 1LCKA 2FPEA 4AG1C 2DMOA 1OPLA 2ABLA 2CUDA 3EG3A 1WXTA 3H0HA 1CSKA 1YP5A 1H3HA 1SHFA 2K3BA 4AFUC 1NLPC 1UHCA 3M0QA 5HCKA 1QWEA 5IHKA 1ARKA 1AVZC 2ROLA 4QT7A 3PVLA 5FWCA 3KFVA 1VYVA 3NPFA 1VYUA 2LJ0A 2JS0A 4LNPA 2PTKA 2GTJA 1M30A 2V1RA 2DJQA 1X69A 1U06A 4AFSC 3PVQA 2DLPA 3JV3A 2BZYA 3M0SA 4LUEA 1S1NA 3THKA 1RI9A 2DE0X 2LQNA 1E6GA 1K9AA 1K1ZA 1SPKA 2HBWA 2D8HA 1PRMC 1ZX6A 1I1JA 1PNJA 1WA7A 1B3QA 1WDXA 2AKLA 1OEBA 4LE9A 1UECA 5GJVB 2PNIA 1AZEA 1QWFA 2L3QA 4OMLA 3VS7A 2K7AA 1GFCA 2LP5A 1KIKA 2J6FA 1VA7A 4AG2C 1ZBJA 1UJ0A 2EPDA 2DL3A 4Y92A 2CREA 2DM1A 2DVJA 1X2QA 2IIMA 2JS2A 3UATA 4DEYA 3VS5A 1QLYA 1U3OA 1E7OA 2FPDA 5IHIA 1NM7A 4AFZC 2C0TA 2CUBA 2E5KA 5GJWB 4CC4B 2MIOA 2YT6A 1MUZA 1TUCA 1M3CA 2RQRA 2O9SA 2EGEA 1AEYA 2RQUA 2FRYA 1K76A 1K0XA 1H92A 4F16A 1M27C 1SSHA 1GBQA 2RN8A 2PZ1A 2MCNA 2FPFA 2QDLA 2X3WD 1KSWA 2L0AA
chains in the Genus database with same CATH superfamily
1FWZA 2V8JA 2RA2A 3FDRA 1QCOA 1FMKA 1VQ6A 2YUQA 2EW3A 2ZGWA 1YITQ 2K5IA 1WHGA 1VQ9A 4M4ZA 2AZSA 3G71T 1VQ8A 4FYVB 4OMOA 3SD4A 1UDLA 1QW1A 2R5MA 1YJNA 3M58A 3M54A 1G83A 2W0ZA 1SHGA 2DRKA 4A4GA 5GMKl 2MMPA 4PJOF 4HVWA 4BY6C 1YI2A 4HT8A 2XK0A 2QGGA 1WQ7A 2E64A 3TQ7P 3CD6T 2E6ZA 2QEXA 4LD6A 4RTVA 5IAYA 3C4SA 3S6WA 2RJDA 4FSSA 2LTOA 3NTKA 3VKIA 1FMVA 2XU8A 1UE9A 4KGVB 4Q5WA 1TG0A 3CBOA 3CC2Q 1RACB 2EYXA 2M0YA 4BB7A 1XTDA 4PJLA 1WNLA 2RK1A 3OSSC 1RAHB 2HCKA 4RG2A 4M7AE 2KRNA 2DL7A 1EFNA 1KQSA 1X01A 4JLIA 2LZ6B 1IRXA 2KT1A 1VIEA 2ZPGB 1K8AU 4M7AD 1GBRA 1ZSZA 3FJ5A 3AHUA 2ZPEB 1FMWA 2LQWA 2RHYA 3VRYA 4A4KA 3QWYA 2C0IA 2VGNA 4X9DA 1BCOA 4CC2A 3QZ5B 5L8RE 4IKFA 2QI2A 4F7UF 4J83A 4EMHA 4J9DA 1PKTA 2MYSA 2D0NA 1KHCA 3DB3A 2EJ9A 3O8VA 5I11A 2D8JA 3G4SQ 2P84A 4C8QG 1K4US 3REAB 5GAN5 4FIBA 1UJYA 3GP8A 2OTJT 3I9QA 3EGXB 3U23A 1TUDA 3CCUT 3OYBA 1K8AR 1JQQA 4QKUA 5KE3A 2BUDA 3MO8A 4EIKA 1IHWA 4DA4A 4M78G 5HK0A 3L2WA 5GANj 5KYWA 2JT4A 1Z9ZA 3HHTB 4X1VA 3OYMA 2QYZA 2QTXA 2GCXA 2W10A 2RB6A 1M2VB 1FXXA 1WLPB 3VS6A 2WSEE 3OBWA 3TCJA 1Q7YR 1JO8A 3CMAT 1I5LA 1AWJA 3G71A 2AZVA 3OYCA 2K2MA 3EFRA 1YIJT 2DZ9A 3OS1A 2RO0A 3R6OA 3INZA 2FEIA 2G3RA 2MOXA 4JRPA 5FW9A 4FYXB 4GLKA 2L3SA 3MP1A 4EMKB 3BW1A 1ZA1B 3TVTA 5GMKi 2KMTA 2DJZA 4F04B 5GMKh 4MDXA 5CKDA 2AIRB 1M1KU 1VQLT 2OTLQ 4IUVA 1I4K1 4XTWA 2D9TA 3ZBDA 1I81A 2OI3A 5FWBA 4EMKC 3A98A 1Q82U 1LOJA 1RI0A 2P4RA 4M7DE 1UHFA 2DF6A 1VQ4T 4IIOA 3P8DA 1Q86U 4C8QA 3PNWC 3UF4A 1UGVA 3V8LA 2YLBA 5FRNA 2CP7A 4FCYA 5I2MA 1HK9A 3RIRA 2X35A 5KE2A 4LN2A 1WYXA 1VQ7T 4M7DD 1BU1A 4RMOA 1AZGB 4LDWA 1P92A 4JZ4A 4BE2A 3PT9A 2LQ8A 2KT8A 2DEQA 4M78A 3JCMb 1O75A 4JPBW 2EYWA 5DLOA 1Y0MA 4ANJA 1XJWB 3L2UA 4XQ3A 5GAOq 4RTYA 2HEQA 3BFMA 3C12A 3SB2A 1MV3A 1A0NB 1JEGA 3G6EQ 2E3HA 3EHQA 4RTZA 2YSQA 5HK3A 1M1KR 2A28A 1VQOA 2RHXA 3A8HB 1V76A 3CMEQ 1G8XA 3EH1A 1W1FA 1AWXA 3PMTA 2B8AA 2RPNA 2CH4A 1YCSB 3JB9D 1YJ9T 1Q86R 2OTJA 5CR2A 5IHNA 3A1PA 2V1QA 3OBYA 1R77A 2COWA 2BTTA 3M9QA 4CC7A 2GBQA 1NBEB 1XNIA 2XDPA 3CCUA 2J7IA 5LJ5d 4ZNXA 1MMNA 2H3EB 3CCQA 2F5TX 2VUBA 1KC8C 1F1BB 2HKQB 4HT9A 4RTXA 1D0XA 3EFOB 2E6NA 4M77D 3QBYA 2LNVA 2ED1A 4NL2A 3C0CA 1S72Q 3OYFA 1MGQA 2OAWA 4IUUA 1YITA 2RNAA 2JW4A 4M77B 5FU7B 3RERA 4M75E 5EG2A 2KYMA 5KYXA 2OJ2A 3CC4T 2JMCA 4C5IA 4M7AF 1VQ5T 4YTLA 2F2XA 5LJ5j 3QSUA 3TEEA 4E7LA 3JCMf 2EGCA 4R0KA 4RTUA 4HCKA 3VS4A 3META 4J6WA 3VUBA 2PVDB 1D3BA 3QKJA 4M77C 2FG0A 4J9CA 5FU7C 1YIJA 3BY7A 1MMGA 1RAFB 3CC2A 4AG1C 1VQMQ 2ABLA 2F1LA 3EG3A 1UGRB 3LWIA 1WXTA 4A54A 1CSKA 4Y91A 3VUZA 2COYA 1D09B 1KQ2A 1SKUB 5HCKA 3PIOA 3OY9A 1KQSS 2YRCA 5FWCA 4RKUE 1VYVA 3E1SA 2XG8D 1TOVA 1B7TA 4LNPA 3MEAA 4JS4A 2DJQA 2K5FA 1U06A 3JCMe 3LLRA 4ZN3A 3GOXA 2DLPA 4LUEA 2BZYA 1S1NA 3THKA 4PNOA 2MPXC 2LQNA 2E4HA 1K9AA 5D7UA 2EQUA 2X4WA 5GANh 1VQKT 2HBWA 2EWNA 4FL6A 5KYUA 3PMIA 1I1JA 1B3QA 1WDXA 4LE9A 1UECA 5GJVB 3ZEHA 3RDVA 3HPWA 3DLLA 1AZEA 4OMLA 5LJ5g 1GFCA 1JB0E 2J6FA 1VA7A 3G4SA 1EZZB 1MMDA 2DXTA 4C5HA 2BE9B 5IHIA 2OX7A 5I21A 5LJ3e 1KQSP 3V7SA 2C0TA 2DEUA 2KVQG 5GANf 2MIOA 3CBMA 2RQRA 1G3YA 1YJ9A 3NTIA 4KBMB 4M75G 4QVDA 5CO7A 1S72T 1BI3A 2RHZA 4LD9K 2FPFA 1VQ9T 4P5NA 4E7KA 4QQGA 3UDCA 3X24B 1G3SA 1SF9A 1YJNT 1TWBA 4L5GA 3CCLQ 4BDZA 3A8LB 3JCMQ 1YI2T 3M4GA 3BDLA 2CH4W 4OMPA 2RJFA 2V8KA 4ORZA 1T0HA 1JJ2A 2DL8A 2QA4Q 3V7CA 1Y7XA 2AT1B 1M90U 1WPYA 1WHMA 5GANe 4FSXA 4B9XA 2C0OA 4KH1B 2YUNA 2FZGB 3RKYA 2EKOA 2PVOB 1WHKA 2V8IA 2HKNA 4HCBA 3G7ZA 3LX7A 2VYTA 2R57A 2XDBA 3A8MB 1KJWA 2OTLA 4XU2A 4DEXA 4FYWB 2HAXA 1QCFA 2M9UA 2JJ9A 2CDTA 2KBTA 1MMAA 4PJOG 4JJBA 2FRWA 3C94A 1W70A 4LDXA 3JB9F 4LUDA 4BI4A 2X4JA 3H0IA 4RUGA 2DD5A 5GAN7 2K3YA 4LDUA 2IVWA 2PVGB 1M90R 1I07A 2JVVA 1PD0A 3OA6A 1QCNA 1TUGB 3M5AA 5CKBA 4J6XA 1VQKA 4M75A 8ATCB 4M77F 3E9FA 1ZBXA 1G3TA 1NPRA 3CQTA 1R8OB 4PFOA 3P8BB 3G6EA 1Q81C 2R5AA 2RF0A 3NTHA 1AWOA 4OB1B 1C1AA 5LJ5h 5A0DA 2GTOA 3RUXA 1ZUUA 3CCJQ 2K79A 1GFDA 3QWXX 1EIFA 3VS3A 2CZ7B 4J9IA 4JJCA 1X6OA 2E1HA 4R55A 2QQRA 2SEMA 4KUIA 4C8QE 2KNBB 3OW2A 3EAEA 5KCOA 4F7UG 4Z02A 2XIDA 5CKHA 2ROTA 4C8QD 4CI0C 3OSVA 3LWHA 1KFZA 2CP0A 1UEBA 1NEGA 3EG9A 1S72A 1K9MC 2BIVA 2B86A 1NJIU 3I5SA 3TU4K 2RD1A 4M78E 1N8RC 1KC8R 3J80E 3QO3A 4PJOA 1AHJB 4M78D 4FW1A 1U1TA 1RAAB 2PUKB 2KQWA 3QZ9B 1QKWA 2CP3A 1EX4A 1GCQA 2WSFE 3M55A 4XTXA 4KH0B 3EG2A 4HCZA 1VQMA 2DPPB 1JU5C 1W6XA 1BBZA 2COZA 2YWWA 4C5GA 4JJNK 1RABB 5DLQE 5CAIA 4GY5A 2CS7A 4TVRA 2KI7A 4B6MA 1D1CA 4X9CA 5AYFA 1M3AA 2DERA 4OGCA 2RJCA 5A0GA 2QTVA 1NLOC 1UGQB 2E10A 3G1JA 1NJIR 4OMNA 1SRMA 4IUPA 2GQIA 1X43A 1JBMA 2NUPA 4M7AB 1GL5A 2JXBA 2DXBA 3IQLA 4QVCA 5D6XA 1VQNQ 1X27A 1UTIA 2X3XD 2DL5A 1OYXA 3HTRA 4OP0A 3WXMB 1PM3A 4E47A 3EGDA 1OU9A 3RESA 1Q7YU 5KYXB 1VQPQ 2K2VA 3OS2A 2VGMA 4J9HA 3CCEQ 2K9GA 4M7AC 2GF7A 4EMGA 1G5VA 1VQOT 3JSCA 1K73C 2AHJB 3H41A 4N0AA 1BIBA 1YWPA 2JTEA 1VYTA 1BK2A 2DXCA 2DTOA 3L2ZA 1NG2A 1D3BB 2DVEA 1QMCA 5FROA 2FB7A 3S3MA 2HSEB 1WHHA 5GAMd 2DYBA 2HL3A 3RKXA 2X9HA 3CCQT 1ZUKA 5ECAA 2XDDA 2DETA 1K0SA 1TTHB 1B34A 1OI1A 3OYHA 4XAXB 4HXJA 4PKCC 1ACMB 3EFSA 1WJQA 2VXEA 1V29B 4AFQC 4OF1A 4E6RA 1D0ZA 4KGXB 1JXMA 3HRUA 3VV0A 4WCIA 2VC8A 1YITT 3LH5A 2P0QA 3ZL7C 4BE1A 2CT4A 3JCMJ 5GAMj 4XTVA 4RCCA 2O88A 2KY9A 1BIAA 2A7YA 1JJ2S 3EHRA 1OX9A 2EFIA 3VU3C 4J7IA 2LQKA 4OVAA 1WZOA 2FZCB 4DBQA 2XHCA 1RLPC 3CC2T 2IG0A 3NMZC 3NHNA 2J6KA 5KYYB 2MWPA 2NUTB 1YCYA 3I5RA 4FYYB 2FPEA 4L6V5 5LJ3g 4ZN1A 2CYZB 2CUDA 3RKWA 2RH2A 4NOYA 2ATCB 3MHXA 1YP5A 1SHFA 2K3BA 3CC7Q 2X4YA 1QWEA 1AVZC 2FYKA 2ROLA 5DY9A 2Y4YA 3KUFA 1Y96A 4C92E 1VYUA 2LJ0A 1DJ7B 2PUOB 2V1RA 4C0GA 3MP8A 3CCVQ 1FX7A 1VUBA 3HKSA 3PVQA 3JV3A 3A8OB 4MZMA 4M7DB 4J5YA 2DE0X 2FVUA 1JJ2P 1M1GA 1NZ9A 2CP6A 7AT1B 2D8HA 2PU9B 3JCMV 5GAMg 3HFOA 3CCET 5GAN8 3OYJA 1SG5A 2E70A 2JUFA 3G4ST 5CK9A 2A0FB 3DB4A 1KQ1A 2YRVA 2EAYA 4M7DC 4XU1A 1YBYA 2LP5A 4LDVA 4MDWA 3GNFB 4E7JA 2EPDA 2DM1A 4NL3A 2IIMA 3J81E 2JS2A 4DBFA 3VS5A 1IREB 3GF5A 1Q81R 8AT1B 1E7OA 1NM7A 4AFZC 2CUBA 2CKKA 3V8JA 5GMKe 1MUZA 1TUCA 1M3CA 2HZYA 3OYIA 2EGEA 2ZPIB 3KBGA 3JAME 3FRNA 1GBQA 2Z0WA 3I55Q 2MCNA 5CVIA 3A8GB 1YFNA 4J7FA 4KGZB 4A4EA 4ZTJA 2E12A 1R0CB 3QDFA 4GLMA 1K9MR 4K11A 4M75D 3LH0A 2JM9A 1VIFA 2QDYB 1N8RR 2KROA 2ESWA 2HDAA 4Z8AA 1HD3A 4M75B 2GNCA 2K6DA 3EGUA 5D6YA 2D1XA 2VVKA 1VQ8Q 2EYYA 2RQVA 1UG1A 2J05A 2MK5A 2LX9A 2YHTA 2OTLT 4C92G 1U1SA 3VS0A 1YHQQ 5I2SA 1T3LA 2FHDA 2XI9A 2GFAA 1VOMA 2P0KA 4OMQA 4M75C 2LT4A 5GAOp 2EJFA 2JTFA 1AOJA 2JZ2A 3EGXA 3ME9A 1PWTA 1YNZA 2CZ1B 1Y71A 1WQWA 2XICA 3CCSQ 1YJWQ 2DILA 1NPPA 4MZTA 4E7ZA 3I56Q 2ZAEA 4HVVA 4F14A 2H8HA 3OYDA 3TSZA 5GAN2 3HL8A 2SRCA 3MEVA 1VQNA 3EG0A 4Z89A 4PJOE 3EG9B 2CSQA 4BDYA 5IN1A 2VASA 1QKXA 1M2VA 1IB8A 4DBHA 1BI0A 3M53A 2ZPHB 4PJOD 3G6ET 2L89A 2L3PA 3CCEA 5GAMh 1H8KA 3ULRB 3H8ZA 3ZFJA 4BE0A 1OX8A 4R56A 1NYGA 4E7HA 3CMET 3CEYA 2HNIA 3QYGB 1GRIA 5CKFA 3OYKA 5GAOn 3JB9G 3O5ZA 1LVKA 2RQWA 3VRZA 1K73R 1W2BA 1TH7A 2ZZDA 5FU6B 5IH2A 3CBPA 2IPOB 1K8AC 3M0UA 2KXDA 2HL5C 3S3NA 4M77G 1N6AA 4RTWA 2BZXA 3JB9I 5D6WA 3M0RA 2EJGA 4C92A 4FT2A 2VXFA 4ZGJB 4D8KA 2A3LA 2MWOA 3CCRQ 3LGFA 4F7UE 1ZSZB 3DLMA 5FU6C 3VS2A 3BE3A 4BACA 3RMQA 2DRMA 5IXBA 4IUTA 4WTOB 1QVFA 4C5EA 4ZTFA 4M7DF 3S3OA 3OYLA 3R6NA 3D7SB 4J9GA 2R58A 5KH6A 3EGDB 1VQMT 2YRDA 1QVGA 1ZSZC 1IHVA 1I0CA 1JRIA 4JLGA 3G71Q 1BI1A 1WFWA 3FC3A 4ELZC 1D0YA 1WX6A 4E7SA 1OPKA 4XU0A 3HP9A 3CC7A 3GLXA 4HA8A 3CD6Q 1RADB 3LW5E 1FYNA 3I56T 2AKKA 4PK4A 2L2PA 5AT1B 3PE0A 2RHUA 1X6GA 1X2KA 3OQ5A 6AT1B 2YUOA 3QIIA 3L1AA 2O2OA 3OYGA 3CCVA 2HBPA 3UA7A 3JB9J 3QJYA 2NYSA 2YUPA 4N0AC 3L2QA 5DM7R 4C0DC 5KYWB 2KRMA 4RCBA 4PJNA 2A36A 3HRSA 2QQBA 2NWMA 2K5LA 4M77A 5HKCA 2OAUA 3VYGA 1HYOA 1KC8U 2I0NA 3FIFA 3L2RA 1NEBA 2LCSA 2M51A 2DX1A 2VWFA 5I22A 2FL7A 3SDZA 3AT1B 5CCAA 1RUWA 3E19A 1PCXA 5LL6S 3CMEA 1YWOA 4M75F 1OV3A 1X75C 3A5ZB 1U5SA 2BZ8A 1HJDA 2F69A 3MCAB 1KK7A 4DBRA 5IXFA 3RNJA 1V1CA 1Q82C 3VJPA 1BB9A 3JB9H 4A53A 3OB9A 3ASKA 2WSCE 4XTZA 2DAQA 1KHIA 2Y90A 3CCLT 1R0BG 3SWNA 4C8QB 3CCMQ 2OTJQ 2G6FX 3FEOA 2CSIA 2XKOC 1CKBA 2KGTA 2EIFA 1X6BA 5LJ5f 2QA4T 1UFFA 3CCUQ 2MF2A 1UGSB 4KULA 1BCMA 2E5QA 2EGAA 1ABQA 2LMJA 4F17A 1WJRA 2LJ3A 3JCMd 3X20B 2CGHA 2JMAA 4C8QC 3GBQA 4M78B 1M8MA 2VKNA 1D1AA 4ATOA 1PHTA 3M0PA 2O31A 4FM4B 3RR6A 1JXOA 3HRTA 2GGRA 2JN0A 3V8KA 4JRQA 4E7IA 4C0ZA 4DOWA 1ZHIA 2CZ6B 2RI2A 2YXYA 1YHQA 4JRKA 2BKDN 1LCKA 3CMAQ 2L3RA 1OPLA 1ZQ1A 5LJ5e 3KXTA 1UB4A 3QJ6A 4M78C 1H3HA 1YIJQ 4AFUC 5FLXE 4D6WA 2NLUA 1NLPC 1UHCA 3M0QA 5IHKA 3CCSA 1KG1A 4QT7A 4XU3A 5GAOl 1YJWA 1WJSA 3I56A 2PQWA 2PTKA 1G3WA 4OB3B 1IZ6A 5LJ3d 3L2VA 1OZ2A 1X69A 1TXQA 2K57A 2M02A 1VQLQ 3JCMX 4F7UA 2ZCFB 2HMAA 3CPWA 3T9NA 1K1ZA 4KT0E 5CQXA 1VQ4Q 4B9WA 1SPKA 3J7AF 4RG8A 1RAGB 2DKGA 1PRMC 3OMCA 1QP2A 2K4YA 4WF2A 2EQJA 1VQ7Q 1RL2A 3RMSA 3CCJT 3MP6A 4LXCA 5LJ3j 1QWFA 3VS7A 1KIKA 1PSEA 2K7AA 3ER0A 4IUQA 4AG2C 3LYIA 1ZBJA 1N27A 2DL3A 4FU6A 1X2QA 3F70A 1W2BS 2E65A 5GANd 3Q1JA 4OB0B 2I2LA 1WGSA 2RM4A 4ELYC 2RI5A 1LJOA 2E5KA 4CC4B 2YT6A 1RAEB 3QUIA 3QPHA 3CCMT 3JCMg 2D0QB 5J39A 2O9SA 3GNGA 5KCHA 1AEYA 3VYHB 3X26B 9ATCB 2RQUA 3M56A 2FRYA 4F16A 1M27C 3CCRA 2GQVA 1NE8A 3CCLA 2RN8A 3CXCA 4JS5A 2QDLA 1YJ9Q 2X3WD 1KSWA 2L0AA 1QVFS 1ZUYA 2EYQA 2KRSA 2QA4A 2M0OA 2EBPA 2HQXA 4X34A 2CP2A 2A08A 2JM8A 4OB2B 5KYUB 2EQMA 5GAOr 1IGQA 1KD1C 1QVGS 4ZGDB 3P8HA 4UC4A 3BDUA 1QQJA 1M4ZA 3CC4Q 1W2BP 2ED0A 5FRMA 2NUZA 1UGPB 1VQ5Q 4PFZA 4Y28E 2KYBA 4J9FA 4ZGEB 4OGEA 3E2UA 2O4XA 2LC4A 3CD6A 1TS9A 2V26A 4M7AG 1Q81U 4KRTA 2E41A 1RAIB 1UUEA 4ESRA 2QK0A 3TREA 1VQNT 4C92D 1TSFA 1ZA2B 4MMKA 2QQ9A 4QQDA 4A4FA 1I8FA 2DD4A 2LNHB 3OYNA 4C92B 2YDLA 1QVFP 1M9SA 2A37A 1OULA 1VQPT 4C8QF 5KYNA 2EQKA 1BYMA 5J26A 1M90C 1Z9QA 5HY6A 2ZPBB 2QAZA 1HSQA 1G2BA 1AD5A 1RLQC 5GANg 3FJPA 3M57A 1QVGP 3PGGA 1WI7A 1K9MU 2KAFA 3V7RA 1AWWA 4C92C 2FZKB 1N8RU 4J8OA 1J3TA 2JTMA 3OYAA 2P4TA 3CCJA 4M78F 3JCMc 2DA9A 4L59A 3UT1A 1VQKQ 1NYFA 4JJDA 3WVDB 2EQIA 1H3ZA 4JZ3A 3N5BB 5CIUA 4PL6A 2DNUA 3OYEA 2D6FA 2HQHA 3C95A 3M0TA 4N4GA 3OW2S 1OOTA 2FO0A 2L5QA 4GBQA 1H641 1CKAA 4BUGA 4V2SA 1GCPA 2HSPA 1E6HA 3CPFA 1WIEA 2ZPFB 2LJ1A 2LDMA 2DXUA 1Q82R 4LDYA 2QQSA 3CCMA 1PKSA 4FW2A 5M9OA 3HSBA 3JCMh 2DIGA 4RTTA 4XK8E 4M77E 3VS1A 3I35A 3PIPA 3FB9A 1IXDA 4A4HA 4M7AA 2DL4A 2X4XA 3NGPA 3DKMA 1T0JA 2EKHA 1B07A 2QXFA 2VV5A 1M8VA 4N4HA 2RMOA 2P0PA 2GFUA 4BI3A 2YLCA 1VQ6Q 2DK3A 3UA6A 1BI2A 2RI3A 2DBMA 1PC0A 1VQ9Q 5CKEA 3M59A 1YJNQ 1U8RA 2X51A 1PSFA 4BD3A 3LGLA 1M2OA 1I5OB 1YI2Q 3CC7T 3CMAA 3JCMW 3HFNA 3RBBB 3SEMA 3OW2P 2QEXQ 3H6ZA 2EVRA 4HKEA 5LJ3h 2ECZA 4CC3A 2DBKA 1K73U 1XQHA 3CCVT 3GIBA 4M7DG 2F2VA 1Y07A 3H9NA 4HVUA 2KDSA 2LCLA 5GAN3 4PJJA 1SEMA 1Y57A 1NJIC 4OMFB 3H0FA 4AMCA 2VB6A 5GMKm 5L23A 3QHSA 1VQLA 4O6JA 3X28B 2HQEA 3SWNB 2KXCA 4JDSA 3X25B 3CPWS 1TU0B 1ABOA 4PLLA 4Z88A 3QYHB 3UPUA 2RJEA 4PJMA 4N4IA 1VQ4A 3REBB 1VQPA 5EC7A 5LJ3f 1AT1B 5GAOm 1GXIE 1VQ7A 1WXUA 4EDUA 4PJOB 4IURA 1T3SA 3L42A 2KK4A 4XTYA 3OS5A 4IIMA 2QQAA 2C06A 3SWNC 2DYIA 1HXDA 1WHLA 2AK5A 2EYZA 1M3BA 4D8DA 4JRIA 2MAMA 4EMKA 2DTIA 5KYYA 1OU8A 2DIQA 2O01E 2NUTA 2M16A 1MV0B 1K0XA 2J6OA 4XTUA 2XMFA 4PFPA 2BE7D 4PJOC 2LVMA 1PRLC 3EH2A 1MNEA 3MPUB 4A63B 1KD1U 4C0FA 2ENMA 2M1HA 4E2FB 3I55T 1LNXA 1MHNA 2RK2A 1GCQC 1PD1A 2RQTA 1ZSGA 5GAMf 1OQKA 1IO6A 4OMMA 3OS0A 2E3IA 2DZCA 2Y4XA 1BKBA 3FLGA 4QW2A 3CXCS 1ZLMA 5C0MA 3TSWA 4II1A 4DQ2A 2JNGA 1YN8A 3CPWP 2KE9A 2J06A 5CQYA 1N9SA 2NUPB 2KEAA 4MMLA 2F2WA 2O9VA 1Q7YC 1VQ6T 4M7DA 4C92F 4BI8B 1SRLA 2LCCA 4CRIA 1VQ8T 3SHWA 4F7UB 1Q95G 3EG1A 2DO3A 2MI6A 2QG9B 1N5ZA 2QASA 4J9BA 2LX7A 1SSFA 1YHQT 2H3JA 1XOVA 2CT3A 2KR3A 3PTAA 2CP5A 2QEXT 4QQ6A 1WXBA 5GAMe 3CC4A 2KSSA 1KD1R 1VQ5A 4J9EA 4C0DB 1MNDA 3MEUA 4KUDK 4EPCA 1N9RA 3PFSA 2QGFB 1PG5B 5J3BA 2DMOA 3CCST 1YJWT 4HCCA 3H0HA 3NFCA 1B34B 1ARKA 3GPLA 1O9SA 1C6VX 3PVLA 3KFVA 1QVPA 3NPFA 3CXCP 3QDRB 3JCMP 2JS0A 2GTJA 3QG1A 3EFOA 1M30A 3JRZA 4QVZA 3MEWA 4AFSC 3OYYA 3M0SA 4AT1B 1RI9A 3M4YA 3WVEB 2K3XA 3URGA 4PLIA 1E6GA 4VUBA 2WACA 3OMGA 1M1FA 1M5Q1 4MZPA 5C6SA 1ZX6A 1PNJA 1WA7A 2AKLA 4J6YA 1OEBA 2CZ0B 2PNIA 2L3QA 1M1KC 1W4SA 2DFUA 4NS5A 5GAN6 4FT4A 5GMKj 2DTHA 1UJ0A 3E9GA 4DOVA 4Y92A 1D1BA 2F5KA 2CREA 2DVJA 3SFMA 3UATA 5A0LA 1Q86C 4DEYA 2LRQA 3MKDA 3QXEB 1QLYA 1WHJA 1U3OA 4O5VA 2FPDA 1VQOQ 1C0MA 4ME7A 3UWNA 2JOYA 2O4XB 2RHIA 2L8DA 1IGUA 1LPLA 5GJWB 3CCRT 1QP3A 2HD0A 1Y96B 3I55A 2XD0A 5A2QE 2LT1A 1K76A 3MJXA 1H92A 1SSHA 3CCQQ 2PZ1A 1OZ3A 4BY6B 4JUVA 5IT9E 5GAN4
chains in the Genus database with same CATH topology
1ZUYA 2KRSA 1FMKA 2EBPA 2YUQA 2EW3A 2A08A 2JM8A 4GLMA 2CH4W 2AZSA 4M4ZA 4K11A 4OMPA 4OMOA 4ORZA 1T0HA 1UDLA 2DL8A 2JM9A 2KROA 2ESWA 2HDAA 4Z8AA 1HD3A 1G83A 2GNCA 2W0ZA 1SHGA 2K6DA 2DRKA 3EGUA 2D1XA 4HVWA 2VVKA 2EYYA 2RQVA 1UG1A 2C0OA 2J05A 4RTVA 2YUNA 2ED0A 2NUZA 2KYBA 4FSSA 4J9FA 3VS0A 1UE9A 1TG0A 1T3LA 2EYXA 2M0YA 4OMQA 1KJWA 1AOJA 4KRTA 1PWTA 2HCKA 4DEXA 1YNZA 1UUEA 4ESRA 1QCFA 2CDTA 2KRNA 2DL7A 1EFNA 2DILA 2KBTA 4JJBA 2FRWA 2LZ6B 4HVVA 2KT1A 4F14A 2LNHB 2H8HA 1W70A 2YDLA 4LUDA 3TSZA 1GBRA 2A37A 2SRCA 3FJ5A 3EG0A 3H0IA 4Z89A 4RUGA 2CSQA 1Z9QA 1QKXA 1HSQA 1G2BA 1AD5A 1RLQC 1I07A 2LQWA 3VRYA 3QWYA 2C0IA 1WI7A 4CC2A 2L3PA 1H8KA 3ULRB 1AWWA 4J9DA 3CQTA 1NYGA 1J3TA 1PKTA 2DA9A 1NYFA 2D0NA 1GRIA 4JJDA 2EQIA 2RF0A 1AWOA 4JZ3A 5I11A 3O5ZA 2DNUA 2D8JA 2GTOA 1ZUUA 1K4US 3REAB 2K79A 3M0TA 1GFDA 2RQWA 3VRZA 3QWXX 1OOTA 1UJYA 2FO0A 4GBQA 1CKAA 3VS3A 4J9IA 5IH2A 1GCPA 2HSPA 3I9QA 4JJCA 1E6HA 2SEMA 3U23A 3M0UA 2KXDA 1TUDA 1WIEA 2LJ1A 2KNBB 4RTWA 1JQQA 2BZXA 3M0RA 1PKSA 4EIKA 2ROTA 4RTTA 1KFZA 3VS1A 4D8KA 2JT4A 3I35A 1Z9ZA 1NEGA 4X1VA 3VS2A 2B86A 2DL4A 3NGPA 1T0JA 2EKHA 1B07A 3I5SA 2DRMA 2W10A 2RMOA 5IXBA 1WLPB 3VS6A 1JO8A 3R6NA 3UA6A 2DBMA 1AWJA 4J9GA 2AZVA 2K2MA 1QKWA 1I0CA 1GCQA 2FEIA 2MOXA 1WFWA 5FW9A 2L3SA 3EG2A 3RBBB 3SEMA 1JU5C 1W6XA 1BBZA 2EVRA 3TVTA 1WX6A 1OPKA 2ECZA 4CC3A 2DBKA 2F2VA 1FYNA 4HVUA 2AKKA 2L2PA 1M3AA 3PE0A 1X6GA 1SEMA 1Y57A 2OI3A 1X2KA 3H0FA 5FWBA 3A98A 2YUOA 1NLOC 2O2OA 2P4RA 1UHFA 3UA7A 2DF6A 4IIOA 5L23A 4OMNA 2YUPA 3UF4A 1UGVA 1SRMA 2GQIA 2KRMA 1X43A 2A36A 2KXCA 1GL5A 2JXBA 4LN2A 1WYXA 1ABOA 2NWMA 4Z88A 1BU1A 3IQLA 3REBB 1AZGB 4JZ4A 5EC7A 1X27A 1UTIA 2X3XD 2DL5A 2I0NA 1WXUA 2KT8A 1T3SA 1NEBA 2LCSA 2M51A 2DX1A 2VWFA 4JPBW 5I22A 2EYWA 1Y0MA 4IIMA 4J9HA 1RUWA 2K9GA 2AK5A 2EYZA 1M3BA 4D8DA 4RTYA 2HEQA 1YWOA 3H41A 1OV3A 1MV3A 1A0NB 1JEGA 1YWPA 1MV0B 1U5SA 2BZ8A 2JTEA 1VYTA 1BK2A 2J6OA 3EHQA 2XMFA 1HJDA 4RTZA 2YSQA 1NG2A 2A28A 5IXFA 3RNJA 1PRLC 1V1CA 4A63B 2ENMA 2DYBA 1BB9A 1AWXA 1W1FA 2RPNA 1ZUKA 2CH4A 5ECAA 1K0SA 1YCSB 1GCQC 5IHNA 2RQTA 1ZSGA 2V1QA 4HXJA 1IO6A 2BTTA 4OMMA 4CC7A 2GBQA 4AFQC 2J7IA 4E6RA 4ZNXA 1JXMA 1ZLMA 3TSWA 4WCIA 1YN8A 2G6FX 2KE9A 2CSIA 1CKBA 2J06A 2KGTA 3LH5A 1X6BA 4RTXA 1UFFA 2KEAA 2F2WA 2O9VA 2ED1A 3C0CA 3ZL7C 2CT4A 2OAWA 2EGAA 2RNAA 2O88A 1SRLA 2JW4A 3SHWA 1ABQA 3EHRA 2KYMA 2LMJA 4F17A 2OJ2A 2LJ3A 2JMCA 3EG1A 2JMAA 3GBQA 1N5ZA 1M8MA 2VKNA 2F2XA 4J9BA 2LX7A 1PHTA 3M0PA 1XOVA 2CT3A 2KR3A 2O31A 1JXOA 1RLPC 2EGCA 2GGRA 3NMZC 1WXBA 3NHNA 4R0KA 4RTUA 2J6KA 4HCKA 3VS4A 4J9EA 2FG0A 4J9CA 3I5RA 1LCKA 2FPEA 4AG1C 2DMOA 1OPLA 2ABLA 2CUDA 3EG3A 1WXTA 3H0HA 1CSKA 1YP5A 1H3HA 1SHFA 2K3BA 4AFUC 1NLPC 1UHCA 3M0QA 5HCKA 1QWEA 5IHKA 1ARKA 1AVZC 2ROLA 4QT7A 3PVLA 5FWCA 3KFVA 1VYVA 3NPFA 1VYUA 2LJ0A 2JS0A 4LNPA 2PTKA 2GTJA 1M30A 2V1RA 2DJQA 1X69A 1U06A 4AFSC 3PVQA 2DLPA 3JV3A 2BZYA 3M0SA 4LUEA 1S1NA 3THKA 1RI9A 2DE0X 2LQNA 1E6GA 1K9AA 1K1ZA 1SPKA 2HBWA 2D8HA 1PRMC 1ZX6A 1I1JA 1PNJA 1WA7A 1B3QA 1WDXA 2AKLA 1OEBA 4LE9A 1UECA 5GJVB 2PNIA 1AZEA 1QWFA 2L3QA 4OMLA 3VS7A 2K7AA 1GFCA 2LP5A 1KIKA 2J6FA 1VA7A 4AG2C 1ZBJA 1UJ0A 2EPDA 2DL3A 4Y92A 2CREA 2DM1A 2DVJA 1X2QA 2IIMA 2JS2A 3UATA 4DEYA 3VS5A 1QLYA 1U3OA 1E7OA 2FPDA 5IHIA 1NM7A 4AFZC 2C0TA 2CUBA 2E5KA 5GJWB 4CC4B 2MIOA 2YT6A 1MUZA 1TUCA 1M3CA 2RQRA 2O9SA 2EGEA 1AEYA 2RQUA 2FRYA 1K76A 1K0XA 1H92A 4F16A 1M27C 1SSHA 1GBQA 2RN8A 2PZ1A 2MCNA 2FPFA 2QDLA 2X3WD 1KSWA 2L0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUY A;  2KRS A;  1FMK A;  2EBP A;  2YUQ A;  2EW3 A;  2A08 A;  2JM8 A;  4GLM A;  2CH4 W;  2AZS A;  4M4Z A;  4K11 A;  4OMP A;  4OMO A;  4ORZ A;  1T0H A;  1UDL A;  2DL8 A;  2JM9 A;  2KRO A;  2ESW A;  2HDA A;  4Z8A A;  1HD3 A;  1G83 A;  2GNC A;  2W0Z A;  1SHG A;  2K6D A;  2DRK A;  3EGU A;  2D1X A;  4HVW A;  2VVK A;  2EYY A;  2RQV A;  1UG1 A;  2C0O A;  2J05 A;  4RTV A;  2YUN A;  2ED0 A;  2NUZ A;  2KYB A;  4FSS A;  4J9F A;  3VS0 A;  1UE9 A;  1TG0 A;  1T3L A;  2EYX A;  2M0Y A;  4OMQ A;  1KJW A;  1AOJ A;  4KRT A;  1PWT A;  2HCK A;  4DEX A;  1YNZ A;  1UUE A;  4ESR A;  1QCF A;  2CDT A;  2KRN A;  2DL7 A;  1EFN A;  2DIL A;  2KBT A;  4JJB A;  2FRW A;  2LZ6 B;  4HVV A;  2KT1 A;  4F14 A;  2LNH B;  2H8H A;  1W70 A;  2YDL A;  4LUD A;  3TSZ A;  1GBR A;  2A37 A;  2SRC A;  3FJ5 A;  3EG0 A;  3H0I A;  4Z89 A;  4RUG A;  2CSQ A;  1Z9Q A;  1QKX A;  1HSQ A;  1G2B A;  1AD5 A;  1RLQ C;  1I07 A;  2LQW A;  3VRY A;  3QWY A;  2C0I A;  1WI7 A;  4CC2 A;  2L3P A;  1H8K A;  3ULR B;  1AWW A;  4J9D A;  3CQT A;  1NYG A;  1J3T A;  1PKT A;  2DA9 A;  1NYF A;  2D0N A;  1GRI A;  4JJD A;  2EQI A;  2RF0 A;  1AWO A;  4JZ3 A;  5I11 A;  3O5Z A;  2DNU A;  2D8J A;  2GTO A;  1ZUU A;  1K4U S;  3REA B;  2K79 A;  3M0T A;  1GFD A;  2RQW A;  3VRZ A;  3QWX X;  1OOT A;  1UJY A;  2FO0 A;  4GBQ A;  1CKA A;  3VS3 A;  4J9I A;  5IH2 A;  1GCP A;  2HSP A;  3I9Q A;  4JJC A;  1E6H A;  2SEM A;  3U23 A;  3M0U A;  2KXD A;  1TUD A;  1WIE A;  2LJ1 A;  2KNB B;  4RTW A;  1JQQ A;  2BZX A;  3M0R A;  1PKS A;  4EIK A;  2ROT A;  4RTT A;  1KFZ A;  3VS1 A;  4D8K A;  2JT4 A;  3I35 A;  1Z9Z A;  1NEG A;  4X1V A;  3VS2 A;  2B86 A;  2DL4 A;  3NGP A;  1T0J A;  2EKH A;  1B07 A;  3I5S A;  2DRM A;  2W10 A;  2RMO A;  5IXB A;  1WLP B;  3VS6 A;  1JO8 A;  3R6N A;  3UA6 A;  2DBM A;  1AWJ A;  4J9G A;  2AZV A;  2K2M A;  1QKW A;  1I0C A;  1GCQ A;  2FEI A;  2MOX A;  1WFW A;  5FW9 A;  2L3S A;  3EG2 A;  3RBB B;  3SEM A;  1JU5 C;  1W6X A;  1BBZ A;  2EVR A;  3TVT A;  1WX6 A;  1OPK A;  2ECZ A;  4CC3 A;  2DBK A;  2F2V A;  1FYN A;  4HVU A;  2AKK A;  2L2P A;  1M3A A;  3PE0 A;  1X6G A;  1SEM A;  1Y57 A;  2OI3 A;  1X2K A;  3H0F A;  5FWB A;  3A98 A;  2YUO A;  1NLO C;  2O2O A;  2P4R A;  1UHF A;  3UA7 A;  2DF6 A;  4IIO A;  5L23 A;  4OMN A;  2YUP A;  3UF4 A;  1UGV A;  1SRM A;  2GQI A;  2KRM A;  1X43 A;  2A36 A;  2KXC A;  1GL5 A;  2JXB A;  4LN2 A;  1WYX A;  1ABO A;  2NWM A;  4Z88 A;  1BU1 A;  3IQL A;  3REB B;  1AZG B;  4JZ4 A;  5EC7 A;  1X27 A;  1UTI A;  2X3X D;  2DL5 A;  2I0N A;  1WXU A;  2KT8 A;  1T3S A;  1NEB A;  2LCS A;  2M51 A;  2DX1 A;  2VWF A;  4JPB W;  5I22 A;  2EYW A;  1Y0M A;  4IIM A;  4J9H A;  1RUW A;  2K9G A;  2AK5 A;  2EYZ A;  1M3B A;  4D8D A;  4RTY A;  2HEQ A;  1YWO A;  3H41 A;  1OV3 A;  1MV3 A;  1A0N B;  1JEG A;  1YWP A;  1MV0 B;  1U5S A;  2BZ8 A;  2JTE A;  1VYT A;  1BK2 A;  2J6O A;  3EHQ A;  2XMF A;  1HJD A;  4RTZ A;  2YSQ A;  1NG2 A;  2A28 A;  5IXF A;  3RNJ A;  1PRL C;  1V1C A;  4A63 B;  2ENM A;  2DYB A;  1BB9 A;  1AWX A;  1W1F A;  2RPN A;  1ZUK A;  2CH4 A;  5ECA A;  1K0S A;  1YCS B;  1GCQ C;  5IHN A;  2RQT A;  1ZSG A;  2V1Q A;  4HXJ A;  1IO6 A;  2BTT A;  4OMM A;  4CC7 A;  2GBQ A;  4AFQ C;  2J7I A;  4E6R A;  4ZNX A;  1JXM A;  1ZLM A;  3TSW A;  4WCI A;  1YN8 A;  2G6F X;  2KE9 A;  2CSI A;  1CKB A;  2J06 A;  2KGT A;  3LH5 A;  1X6B A;  4RTX A;  1UFF A;  2KEA A;  2F2W A;  2O9V A;  2ED1 A;  3C0C A;  3ZL7 C;  2CT4 A;  2OAW A;  2EGA A;  2RNA A;  2O88 A;  1SRL A;  2JW4 A;  3SHW A;  1ABQ A;  3EHR A;  2KYM A;  2LMJ A;  4F17 A;  2OJ2 A;  2LJ3 A;  2JMC A;  3EG1 A;  2JMA A;  3GBQ A;  1N5Z A;  1M8M A;  2VKN A;  2F2X A;  4J9B A;  2LX7 A;  1PHT A;  3M0P A;  1XOV A;  2CT3 A;  2KR3 A;  2O31 A;  1JXO A;  1RLP C;  2EGC A;  2GGR A;  3NMZ C;  1WXB A;  3NHN A;  4R0K A;  4RTU A;  2J6K A;  4HCK A;  3VS4 A;  4J9E A;  2FG0 A;  4J9C A;  3I5R A;  1LCK A;  2FPE A;  4AG1 C;  2DMO A;  1OPL A;  2ABL A;  2CUD A;  3EG3 A;  1WXT A;  3H0H A;  1CSK A;  1YP5 A;  1H3H A;  1SHF A;  2K3B A;  4AFU C;  1NLP C;  1UHC A;  3M0Q A;  5HCK A;  1QWE A;  5IHK A;  1ARK A;  1AVZ C;  2ROL A;  4QT7 A;  3PVL A;  5FWC A;  3KFV A;  1VYV A;  3NPF A;  1VYU A;  2LJ0 A;  2JS0 A;  4LNP A;  2PTK A;  2GTJ A;  1M30 A;  2V1R A;  2DJQ A;  1X69 A;  1U06 A;  4AFS C;  3PVQ A;  2DLP A;  3JV3 A;  2BZY A;  3M0S A;  4LUE A;  1S1N A;  3THK A;  1RI9 A;  2DE0 X;  2LQN A;  1E6G A;  1K9A A;  1K1Z A;  1SPK A;  2HBW A;  2D8H A;  1PRM C;  1ZX6 A;  1I1J A;  1PNJ A;  1WA7 A;  1B3Q A;  1WDX A;  2AKL A;  1OEB A;  4LE9 A;  1UEC A;  5GJV B;  2PNI A;  1AZE A;  1QWF A;  2L3Q A;  4OML A;  3VS7 A;  2K7A A;  1GFC A;  2LP5 A;  1KIK A;  2J6F A;  1VA7 A;  4AG2 C;  1ZBJ A;  1UJ0 A;  2EPD A;  2DL3 A;  4Y92 A;  2CRE A;  2DM1 A;  2DVJ A;  1X2Q A;  2IIM A;  2JS2 A;  3UAT A;  4DEY A;  3VS5 A;  1QLY A;  1U3O A;  1E7O A;  2FPD A;  5IHI A;  1NM7 A;  4AFZ C;  2C0T A;  2CUB A;  2E5K A;  5GJW B;  4CC4 B;  2MIO A;  2YT6 A;  1MUZ A;  1TUC A;  1M3C A;  2RQR A;  2O9S A;  2EGE A;  1AEY A;  2RQU A;  2FRY A;  1K76 A;  1K0X A;  1H92 A;  4F16 A;  1M27 C;  1SSH A;  1GBQ A;  2RN8 A;  2PZ1 A;  2MCN A;  2FPF A;  2QDL A;  2X3W D;  1KSW A;  2L0A A; 
#chains in the Genus database with same CATH topology
 1FWZ A;  2V8J A;  2RA2 A;  3FDR A;  1QCO A;  1FMK A;  1VQ6 A;  2YUQ A;  2EW3 A;  2ZGW A;  1YIT Q;  2K5I A;  1WHG A;  1VQ9 A;  4M4Z A;  2AZS A;  3G71 T;  1VQ8 A;  4FYV B;  4OMO A;  3SD4 A;  1UDL A;  1QW1 A;  2R5M A;  1YJN A;  3M58 A;  3M54 A;  1G83 A;  2W0Z A;  1SHG A;  2DRK A;  4A4G A;  5GMK l;  2MMP A;  4PJO F;  4HVW A;  4BY6 C;  1YI2 A;  4HT8 A;  2XK0 A;  2QGG A;  1WQ7 A;  2E64 A;  3TQ7 P;  3CD6 T;  2E6Z A;  2QEX A;  4LD6 A;  4RTV A;  5IAY A;  3C4S A;  3S6W A;  2RJD A;  4FSS A;  2LTO A;  3NTK A;  3VKI A;  1FMV A;  2XU8 A;  1UE9 A;  4KGV B;  4Q5W A;  1TG0 A;  3CBO A;  3CC2 Q;  1RAC B;  2EYX A;  2M0Y A;  4BB7 A;  1XTD A;  4PJL A;  1WNL A;  2RK1 A;  3OSS C;  1RAH B;  2HCK A;  4RG2 A;  4M7A E;  2KRN A;  2DL7 A;  1EFN A;  1KQS A;  1X01 A;  4JLI A;  2LZ6 B;  1IRX A;  2KT1 A;  1VIE A;  2ZPG B;  1K8A U;  4M7A D;  1GBR A;  1ZSZ A;  3FJ5 A;  3AHU A;  2ZPE B;  1FMW A;  2LQW A;  2RHY A;  3VRY A;  4A4K A;  3QWY A;  2C0I A;  2VGN A;  4X9D A;  1BCO A;  4CC2 A;  3QZ5 B;  5L8R E;  4IKF A;  2QI2 A;  4F7U F;  4J83 A;  4EMH A;  4J9D A;  1PKT A;  2MYS A;  2D0N A;  1KHC A;  3DB3 A;  2EJ9 A;  3O8V A;  5I11 A;  2D8J A;  3G4S Q;  2P84 A;  4C8Q G;  1K4U S;  3REA B;  5GAN 5;  4FIB A;  1UJY A;  3GP8 A;  2OTJ T;  3I9Q A;  3EGX B;  3U23 A;  1TUD A;  3CCU T;  3OYB A;  1K8A R;  1JQQ A;  4QKU A;  5KE3 A;  2BUD A;  3MO8 A;  4EIK A;  1IHW A;  4DA4 A;  4M78 G;  5HK0 A;  3L2W A;  5GAN j;  5KYW A;  2JT4 A;  1Z9Z A;  3HHT B;  4X1V A;  3OYM A;  2QYZ A;  2QTX A;  2GCX A;  2W10 A;  2RB6 A;  1M2V B;  1FXX A;  1WLP B;  3VS6 A;  2WSE E;  3OBW A;  3TCJ A;  1Q7Y R;  1JO8 A;  3CMA T;  1I5L A;  1AWJ A;  3G71 A;  2AZV A;  3OYC A;  2K2M A;  3EFR A;  1YIJ T;  2DZ9 A;  3OS1 A;  2RO0 A;  3R6O A;  3INZ A;  2FEI A;  2G3R A;  2MOX A;  4JRP A;  5FW9 A;  4FYX B;  4GLK A;  2L3S A;  3MP1 A;  4EMK B;  3BW1 A;  1ZA1 B;  3TVT A;  5GMK i;  2KMT A;  2DJZ A;  4F04 B;  5GMK h;  4MDX A;  5CKD A;  2AIR B;  1M1K U;  1VQL T;  2OTL Q;  4IUV A;  1I4K 1;  4XTW A;  2D9T A;  3ZBD A;  1I81 A;  2OI3 A;  5FWB A;  4EMK C;  3A98 A;  1Q82 U;  1LOJ A;  1RI0 A;  2P4R A;  4M7D E;  1UHF A;  2DF6 A;  1VQ4 T;  4IIO A;  3P8D A;  1Q86 U;  4C8Q A;  3PNW C;  3UF4 A;  1UGV A;  3V8L A;  2YLB A;  5FRN A;  2CP7 A;  4FCY A;  5I2M A;  1HK9 A;  3RIR A;  2X35 A;  5KE2 A;  4LN2 A;  1WYX A;  1VQ7 T;  4M7D D;  1BU1 A;  4RMO A;  1AZG B;  4LDW A;  1P92 A;  4JZ4 A;  4BE2 A;  3PT9 A;  2LQ8 A;  2KT8 A;  2DEQ A;  4M78 A;  3JCM b;  1O75 A;  4JPB W;  2EYW A;  5DLO A;  1Y0M A;  4ANJ A;  1XJW B;  3L2U A;  4XQ3 A;  5GAO q;  4RTY A;  2HEQ A;  3BFM A;  3C12 A;  3SB2 A;  1MV3 A;  1A0N B;  1JEG A;  3G6E Q;  2E3H A;  3EHQ A;  4RTZ A;  2YSQ A;  5HK3 A;  1M1K R;  2A28 A;  1VQO A;  2RHX A;  3A8H B;  1V76 A;  3CME Q;  1G8X A;  3EH1 A;  1W1F A;  1AWX A;  3PMT A;  2B8A A;  2RPN A;  2CH4 A;  1YCS B;  3JB9 D;  1YJ9 T;  1Q86 R;  2OTJ A;  5CR2 A;  5IHN A;  3A1P A;  2V1Q A;  3OBY A;  1R77 A;  2COW A;  2BTT A;  3M9Q A;  4CC7 A;  2GBQ A;  1NBE B;  1XNI A;  2XDP A;  3CCU A;  2J7I A;  5LJ5 d;  4ZNX A;  1MMN A;  2H3E B;  3CCQ A;  2F5T X;  2VUB A;  1KC8 C;  1F1B B;  2HKQ B;  4HT9 A;  4RTX A;  1D0X A;  3EFO B;  2E6N A;  4M77 D;  3QBY A;  2LNV A;  2ED1 A;  4NL2 A;  3C0C A;  1S72 Q;  3OYF A;  1MGQ A;  2OAW A;  4IUU A;  1YIT A;  2RNA A;  2JW4 A;  4M77 B;  5FU7 B;  3RER A;  4M75 E;  5EG2 A;  2KYM A;  5KYX A;  2OJ2 A;  3CC4 T;  2JMC A;  4C5I A;  4M7A F;  1VQ5 T;  4YTL A;  2F2X A;  5LJ5 j;  3QSU A;  3TEE A;  4E7L A;  3JCM f;  2EGC A;  4R0K A;  4RTU A;  4HCK A;  3VS4 A;  3MET A;  4J6W A;  3VUB A;  2PVD B;  1D3B A;  3QKJ A;  4M77 C;  2FG0 A;  4J9C A;  5FU7 C;  1YIJ A;  3BY7 A;  1MMG A;  1RAF B;  3CC2 A;  4AG1 C;  1VQM Q;  2ABL A;  2F1L A;  3EG3 A;  1UGR B;  3LWI A;  1WXT A;  4A54 A;  1CSK A;  4Y91 A;  3VUZ A;  2COY A;  1D09 B;  1KQ2 A;  1SKU B;  5HCK A;  3PIO A;  3OY9 A;  1KQS S;  2YRC A;  5FWC A;  4RKU E;  1VYV A;  3E1S A;  2XG8 D;  1TOV A;  1B7T A;  4LNP A;  3MEA A;  4JS4 A;  2DJQ A;  2K5F A;  1U06 A;  3JCM e;  3LLR A;  4ZN3 A;  3GOX A;  2DLP A;  4LUE A;  2BZY A;  1S1N A;  3THK A;  4PNO A;  2MPX C;  2LQN A;  2E4H A;  1K9A A;  5D7U A;  2EQU A;  2X4W A;  5GAN h;  1VQK T;  2HBW A;  2EWN A;  4FL6 A;  5KYU A;  3PMI A;  1I1J A;  1B3Q A;  1WDX A;  4LE9 A;  1UEC A;  5GJV B;  3ZEH A;  3RDV A;  3HPW A;  3DLL A;  1AZE A;  4OML A;  5LJ5 g;  1GFC A;  1JB0 E;  2J6F A;  1VA7 A;  3G4S A;  1EZZ B;  1MMD A;  2DXT A;  4C5H A;  2BE9 B;  5IHI A;  2OX7 A;  5I21 A;  5LJ3 e;  1KQS P;  3V7S A;  2C0T A;  2DEU A;  2KVQ G;  5GAN f;  2MIO A;  3CBM A;  2RQR A;  1G3Y A;  1YJ9 A;  3NTI A;  4KBM B;  4M75 G;  4QVD A;  5CO7 A;  1S72 T;  1BI3 A;  2RHZ A;  4LD9 K;  2FPF A;  1VQ9 T;  4P5N A;  4E7K A;  4QQG A;  3UDC A;  3X24 B;  1G3S A;  1SF9 A;  1YJN T;  1TWB A;  4L5G A;  3CCL Q;  4BDZ A;  3A8L B;  3JCM Q;  1YI2 T;  3M4G A;  3BDL A;  2CH4 W;  4OMP A;  2RJF A;  2V8K A;  4ORZ A;  1T0H A;  1JJ2 A;  2DL8 A;  2QA4 Q;  3V7C A;  1Y7X A;  2AT1 B;  1M90 U;  1WPY A;  1WHM A;  5GAN e;  4FSX A;  4B9X A;  2C0O A;  4KH1 B;  2YUN A;  2FZG B;  3RKY A;  2EKO A;  2PVO B;  1WHK A;  2V8I A;  2HKN A;  4HCB A;  3G7Z A;  3LX7 A;  2VYT A;  2R57 A;  2XDB A;  3A8M B;  1KJW A;  2OTL A;  4XU2 A;  4DEX A;  4FYW B;  2HAX A;  1QCF A;  2M9U A;  2JJ9 A;  2CDT A;  2KBT A;  1MMA A;  4PJO G;  4JJB A;  2FRW A;  3C94 A;  1W70 A;  4LDX A;  3JB9 F;  4LUD A;  4BI4 A;  2X4J A;  3H0I A;  4RUG A;  2DD5 A;  5GAN 7;  2K3Y A;  4LDU A;  2IVW A;  2PVG B;  1M90 R;  1I07 A;  2JVV A;  1PD0 A;  3OA6 A;  1QCN A;  1TUG B;  3M5A A;  5CKB A;  4J6X A;  1VQK A;  4M75 A;  8ATC B;  4M77 F;  3E9F A;  1ZBX A;  1G3T A;  1NPR A;  3CQT A;  1R8O B;  4PFO A;  3P8B B;  3G6E A;  1Q81 C;  2R5A A;  2RF0 A;  3NTH A;  1AWO A;  4OB1 B;  1C1A A;  5LJ5 h;  5A0D A;  2GTO A;  3RUX A;  1ZUU A;  3CCJ Q;  2K79 A;  1GFD A;  3QWX X;  1EIF A;  3VS3 A;  2CZ7 B;  4J9I A;  4JJC A;  1X6O A;  2E1H A;  4R55 A;  2QQR A;  2SEM A;  4KUI A;  4C8Q E;  2KNB B;  3OW2 A;  3EAE A;  5KCO A;  4F7U G;  4Z02 A;  2XID A;  5CKH A;  2ROT A;  4C8Q D;  4CI0 C;  3OSV A;  3LWH A;  1KFZ A;  2CP0 A;  1UEB A;  1NEG A;  3EG9 A;  1S72 A;  1K9M C;  2BIV A;  2B86 A;  1NJI U;  3I5S A;  3TU4 K;  2RD1 A;  4M78 E;  1N8R C;  1KC8 R;  3J80 E;  3QO3 A;  4PJO A;  1AHJ B;  4M78 D;  4FW1 A;  1U1T A;  1RAA B;  2PUK B;  2KQW A;  3QZ9 B;  1QKW A;  2CP3 A;  1EX4 A;  1GCQ A;  2WSF E;  3M55 A;  4XTX A;  4KH0 B;  3EG2 A;  4HCZ A;  1VQM A;  2DPP B;  1JU5 C;  1W6X A;  1BBZ A;  2COZ A;  2YWW A;  4C5G A;  4JJN K;  1RAB B;  5DLQ E;  5CAI A;  4GY5 A;  2CS7 A;  4TVR A;  2KI7 A;  4B6M A;  1D1C A;  4X9C A;  5AYF A;  1M3A A;  2DER A;  4OGC A;  2RJC A;  5A0G A;  2QTV A;  1NLO C;  1UGQ B;  2E10 A;  3G1J A;  1NJI R;  4OMN A;  1SRM A;  4IUP A;  2GQI A;  1X43 A;  1JBM A;  2NUP A;  4M7A B;  1GL5 A;  2JXB A;  2DXB A;  3IQL A;  4QVC A;  5D6X A;  1VQN Q;  1X27 A;  1UTI A;  2X3X D;  2DL5 A;  1OYX A;  3HTR A;  4OP0 A;  3WXM B;  1PM3 A;  4E47 A;  3EGD A;  1OU9 A;  3RES A;  1Q7Y U;  5KYX B;  1VQP Q;  2K2V A;  3OS2 A;  2VGM A;  4J9H A;  3CCE Q;  2K9G A;  4M7A C;  2GF7 A;  4EMG A;  1G5V A;  1VQO T;  3JSC A;  1K73 C;  2AHJ B;  3H41 A;  4N0A A;  1BIB A;  1YWP A;  2JTE A;  1VYT A;  1BK2 A;  2DXC A;  2DTO A;  3L2Z A;  1NG2 A;  1D3B B;  2DVE A;  1QMC A;  5FRO A;  2FB7 A;  3S3M A;  2HSE B;  1WHH A;  5GAM d;  2DYB A;  2HL3 A;  3RKX A;  2X9H A;  3CCQ T;  1ZUK A;  5ECA A;  2XDD A;  2DET A;  1K0S A;  1TTH B;  1B34 A;  1OI1 A;  3OYH A;  4XAX B;  4HXJ A;  4PKC C;  1ACM B;  3EFS A;  1WJQ A;  2VXE A;  1V29 B;  4AFQ C;  4OF1 A;  4E6R A;  1D0Z A;  4KGX B;  1JXM A;  3HRU A;  3VV0 A;  4WCI A;  2VC8 A;  1YIT T;  3LH5 A;  2P0Q A;  3ZL7 C;  4BE1 A;  2CT4 A;  3JCM J;  5GAM j;  4XTV A;  4RCC A;  2O88 A;  2KY9 A;  1BIA A;  2A7Y A;  1JJ2 S;  3EHR A;  1OX9 A;  2EFI A;  3VU3 C;  4J7I A;  2LQK A;  4OVA A;  1WZO A;  2FZC B;  4DBQ A;  2XHC A;  1RLP C;  3CC2 T;  2IG0 A;  3NMZ C;  3NHN A;  2J6K A;  5KYY B;  2MWP A;  2NUT B;  1YCY A;  3I5R A;  4FYY B;  2FPE A;  4L6V 5;  5LJ3 g;  4ZN1 A;  2CYZ B;  2CUD A;  3RKW A;  2RH2 A;  4NOY A;  2ATC B;  3MHX A;  1YP5 A;  1SHF A;  2K3B A;  3CC7 Q;  2X4Y A;  1QWE A;  1AVZ C;  2FYK A;  2ROL A;  5DY9 A;  2Y4Y A;  3KUF A;  1Y96 A;  4C92 E;  1VYU A;  2LJ0 A;  1DJ7 B;  2PUO B;  2V1R A;  4C0G A;  3MP8 A;  3CCV Q;  1FX7 A;  1VUB A;  3HKS A;  3PVQ A;  3JV3 A;  3A8O B;  4MZM A;  4M7D B;  4J5Y A;  2DE0 X;  2FVU A;  1JJ2 P;  1M1G A;  1NZ9 A;  2CP6 A;  7AT1 B;  2D8H A;  2PU9 B;  3JCM V;  5GAM g;  3HFO A;  3CCE T;  5GAN 8;  3OYJ A;  1SG5 A;  2E70 A;  2JUF A;  3G4S T;  5CK9 A;  2A0F B;  3DB4 A;  1KQ1 A;  2YRV A;  2EAY A;  4M7D C;  4XU1 A;  1YBY A;  2LP5 A;  4LDV A;  4MDW A;  3GNF B;  4E7J A;  2EPD A;  2DM1 A;  4NL3 A;  2IIM A;  3J81 E;  2JS2 A;  4DBF A;  3VS5 A;  1IRE B;  3GF5 A;  1Q81 R;  8AT1 B;  1E7O A;  1NM7 A;  4AFZ C;  2CUB A;  2CKK A;  3V8J A;  5GMK e;  1MUZ A;  1TUC A;  1M3C A;  2HZY A;  3OYI A;  2EGE A;  2ZPI B;  3KBG A;  3JAM E;  3FRN A;  1GBQ A;  2Z0W A;  3I55 Q;  2MCN A;  5CVI A;  3A8G B;  1YFN A;  4J7F A;  4KGZ B;  4A4E A;  4ZTJ A;  2E12 A;  1R0C B;  3QDF A;  4GLM A;  1K9M R;  4K11 A;  4M75 D;  3LH0 A;  2JM9 A;  1VIF A;  2QDY B;  1N8R R;  2KRO A;  2ESW A;  2HDA A;  4Z8A A;  1HD3 A;  4M75 B;  2GNC A;  2K6D A;  3EGU A;  5D6Y A;  2D1X A;  2VVK A;  1VQ8 Q;  2EYY A;  2RQV A;  1UG1 A;  2J05 A;  2MK5 A;  2LX9 A;  2YHT A;  2OTL T;  4C92 G;  1U1S A;  3VS0 A;  1YHQ Q;  5I2S A;  1T3L A;  2FHD A;  2XI9 A;  2GFA A;  1VOM A;  2P0K A;  4OMQ A;  4M75 C;  2LT4 A;  5GAO p;  2EJF A;  2JTF A;  1AOJ A;  2JZ2 A;  3EGX A;  3ME9 A;  1PWT A;  1YNZ A;  2CZ1 B;  1Y71 A;  1WQW A;  2XIC A;  3CCS Q;  1YJW Q;  2DIL A;  1NPP A;  4MZT A;  4E7Z A;  3I56 Q;  2ZAE A;  4HVV A;  4F14 A;  2H8H A;  3OYD A;  3TSZ A;  5GAN 2;  3HL8 A;  2SRC A;  3MEV A;  1VQN A;  3EG0 A;  4Z89 A;  4PJO E;  3EG9 B;  2CSQ A;  4BDY A;  5IN1 A;  2VAS A;  1QKX A;  1M2V A;  1IB8 A;  4DBH A;  1BI0 A;  3M53 A;  2ZPH B;  4PJO D;  3G6E T;  2L89 A;  2L3P A;  3CCE A;  5GAM h;  1H8K A;  3ULR B;  3H8Z A;  3ZFJ A;  4BE0 A;  1OX8 A;  4R56 A;  1NYG A;  4E7H A;  3CME T;  3CEY A;  2HNI A;  3QYG B;  1GRI A;  5CKF A;  3OYK A;  5GAO n;  3JB9 G;  3O5Z A;  1LVK A;  2RQW A;  3VRZ A;  1K73 R;  1W2B A;  1TH7 A;  2ZZD A;  5FU6 B;  5IH2 A;  3CBP A;  2IPO B;  1K8A C;  3M0U A;  2KXD A;  2HL5 C;  3S3N A;  4M77 G;  1N6A A;  4RTW A;  2BZX A;  3JB9 I;  5D6W A;  3M0R A;  2EJG A;  4C92 A;  4FT2 A;  2VXF A;  4ZGJ B;  4D8K A;  2A3L A;  2MWO A;  3CCR Q;  3LGF A;  4F7U E;  1ZSZ B;  3DLM A;  5FU6 C;  3VS2 A;  3BE3 A;  4BAC A;  3RMQ A;  2DRM A;  5IXB A;  4IUT A;  4WTO B;  1QVF A;  4C5E A;  4ZTF A;  4M7D F;  3S3O A;  3OYL A;  3R6N A;  3D7S B;  4J9G A;  2R58 A;  5KH6 A;  3EGD B;  1VQM T;  2YRD A;  1QVG A;  1ZSZ C;  1IHV A;  1I0C A;  1JRI A;  4JLG A;  3G71 Q;  1BI1 A;  1WFW A;  3FC3 A;  4ELZ C;  1D0Y A;  1WX6 A;  4E7S A;  1OPK A;  4XU0 A;  3HP9 A;  3CC7 A;  3GLX A;  4HA8 A;  3CD6 Q;  1RAD B;  3LW5 E;  1FYN A;  3I56 T;  2AKK A;  4PK4 A;  2L2P A;  5AT1 B;  3PE0 A;  2RHU A;  1X6G A;  1X2K A;  3OQ5 A;  6AT1 B;  2YUO A;  3QII A;  3L1A A;  2O2O A;  3OYG A;  3CCV A;  2HBP A;  3UA7 A;  3JB9 J;  3QJY A;  2NYS A;  2YUP A;  4N0A C;  3L2Q A;  5DM7 R;  4C0D C;  5KYW B;  2KRM A;  4RCB A;  4PJN A;  2A36 A;  3HRS A;  2QQB A;  2NWM A;  2K5L A;  4M77 A;  5HKC A;  2OAU A;  3VYG A;  1HYO A;  1KC8 U;  2I0N A;  3FIF A;  3L2R A;  1NEB A;  2LCS A;  2M51 A;  2DX1 A;  2VWF A;  5I22 A;  2FL7 A;  3SDZ A;  3AT1 B;  5CCA A;  1RUW A;  3E19 A;  1PCX A;  5LL6 S;  3CME A;  1YWO A;  4M75 F;  1OV3 A;  1X75 C;  3A5Z B;  1U5S A;  2BZ8 A;  1HJD A;  2F69 A;  3MCA B;  1KK7 A;  4DBR A;  5IXF A;  3RNJ A;  1V1C A;  1Q82 C;  3VJP A;  1BB9 A;  3JB9 H;  4A53 A;  3OB9 A;  3ASK A;  2WSC E;  4XTZ A;  2DAQ A;  1KHI A;  2Y90 A;  3CCL T;  1R0B G;  3SWN A;  4C8Q B;  3CCM Q;  2OTJ Q;  2G6F X;  3FEO A;  2CSI A;  2XKO C;  1CKB A;  2KGT A;  2EIF A;  1X6B A;  5LJ5 f;  2QA4 T;  1UFF A;  3CCU Q;  2MF2 A;  1UGS B;  4KUL A;  1BCM A;  2E5Q A;  2EGA A;  1ABQ A;  2LMJ A;  4F17 A;  1WJR A;  2LJ3 A;  3JCM d;  3X20 B;  2CGH A;  2JMA A;  4C8Q C;  3GBQ A;  4M78 B;  1M8M A;  2VKN A;  1D1A A;  4ATO A;  1PHT A;  3M0P A;  2O31 A;  4FM4 B;  3RR6 A;  1JXO A;  3HRT A;  2GGR A;  2JN0 A;  3V8K A;  4JRQ A;  4E7I A;  4C0Z A;  4DOW A;  1ZHI A;  2CZ6 B;  2RI2 A;  2YXY A;  1YHQ A;  4JRK A;  2BKD N;  1LCK A;  3CMA Q;  2L3R A;  1OPL A;  1ZQ1 A;  5LJ5 e;  3KXT A;  1UB4 A;  3QJ6 A;  4M78 C;  1H3H A;  1YIJ Q;  4AFU C;  5FLX E;  4D6W A;  2NLU A;  1NLP C;  1UHC A;  3M0Q A;  5IHK A;  3CCS A;  1KG1 A;  4QT7 A;  4XU3 A;  5GAO l;  1YJW A;  1WJS A;  3I56 A;  2PQW A;  2PTK A;  1G3W A;  4OB3 B;  1IZ6 A;  5LJ3 d;  3L2V A;  1OZ2 A;  1X69 A;  1TXQ A;  2K57 A;  2M02 A;  1VQL Q;  3JCM X;  4F7U A;  2ZCF B;  2HMA A;  3CPW A;  3T9N A;  1K1Z A;  4KT0 E;  5CQX A;  1VQ4 Q;  4B9W A;  1SPK A;  3J7A F;  4RG8 A;  1RAG B;  2DKG A;  1PRM C;  3OMC A;  1QP2 A;  2K4Y A;  4WF2 A;  2EQJ A;  1VQ7 Q;  1RL2 A;  3RMS A;  3CCJ T;  3MP6 A;  4LXC A;  5LJ3 j;  1QWF A;  3VS7 A;  1KIK A;  1PSE A;  2K7A A;  3ER0 A;  4IUQ A;  4AG2 C;  3LYI A;  1ZBJ A;  1N27 A;  2DL3 A;  4FU6 A;  1X2Q A;  3F70 A;  1W2B S;  2E65 A;  5GAN d;  3Q1J A;  4OB0 B;  2I2L A;  1WGS A;  2RM4 A;  4ELY C;  2RI5 A;  1LJO A;  2E5K A;  4CC4 B;  2YT6 A;  1RAE B;  3QUI A;  3QPH A;  3CCM T;  3JCM g;  2D0Q B;  5J39 A;  2O9S A;  3GNG A;  5KCH A;  1AEY A;  3VYH B;  3X26 B;  9ATC B;  2RQU A;  3M56 A;  2FRY A;  4F16 A;  1M27 C;  3CCR A;  2GQV A;  1NE8 A;  3CCL A;  2RN8 A;  3CXC A;  4JS5 A;  2QDL A;  1YJ9 Q;  2X3W D;  1KSW A;  2L0A A;  1QVF S;  1ZUY A;  2EYQ A;  2KRS A;  2QA4 A;  2M0O A;  2EBP A;  2HQX A;  4X34 A;  2CP2 A;  2A08 A;  2JM8 A;  4OB2 B;  5KYU B;  2EQM A;  5GAO r;  1IGQ A;  1KD1 C;  1QVG S;  4ZGD B;  3P8H A;  4UC4 A;  3BDU A;  1QQJ A;  1M4Z A;  3CC4 Q;  1W2B P;  2ED0 A;  5FRM A;  2NUZ A;  1UGP B;  1VQ5 Q;  4PFZ A;  4Y28 E;  2KYB A;  4J9F A;  4ZGE B;  4OGE A;  3E2U A;  2O4X A;  2LC4 A;  3CD6 A;  1TS9 A;  2V26 A;  4M7A G;  1Q81 U;  4KRT A;  2E41 A;  1RAI B;  1UUE A;  4ESR A;  2QK0 A;  3TRE A;  1VQN T;  4C92 D;  1TSF A;  1ZA2 B;  4MMK A;  2QQ9 A;  4QQD A;  4A4F A;  1I8F A;  2DD4 A;  2LNH B;  3OYN A;  4C92 B;  2YDL A;  1QVF P;  1M9S A;  2A37 A;  1OUL A;  1VQP T;  4C8Q F;  5KYN A;  2EQK A;  1BYM A;  5J26 A;  1M90 C;  1Z9Q A;  5HY6 A;  2ZPB B;  2QAZ A;  1HSQ A;  1G2B A;  1AD5 A;  1RLQ C;  5GAN g;  3FJP A;  3M57 A;  1QVG P;  3PGG A;  1WI7 A;  1K9M U;  2KAF A;  3V7R A;  1AWW A;  4C92 C;  2FZK B;  1N8R U;  4J8O A;  1J3T A;  2JTM A;  3OYA A;  2P4T A;  3CCJ A;  4M78 F;  3JCM c;  2DA9 A;  4L59 A;  3UT1 A;  1VQK Q;  1NYF A;  4JJD A;  3WVD B;  2EQI A;  1H3Z A;  4JZ3 A;  3N5B B;  5CIU A;  4PL6 A;  2DNU A;  3OYE A;  2D6F A;  2HQH A;  3C95 A;  3M0T A;  4N4G A;  3OW2 S;  1OOT A;  2FO0 A;  2L5Q A;  4GBQ A;  1H64 1;  1CKA A;  4BUG A;  4V2S A;  1GCP A;  2HSP A;  1E6H A;  3CPF A;  1WIE A;  2ZPF B;  2LJ1 A;  2LDM A;  2DXU A;  1Q82 R;  4LDY A;  2QQS A;  3CCM A;  1PKS A;  4FW2 A;  5M9O A;  3HSB A;  3JCM h;  2DIG A;  4RTT A;  4XK8 E;  4M77 E;  3VS1 A;  3I35 A;  3PIP A;  3FB9 A;  1IXD A;  4A4H A;  4M7A A;  2DL4 A;  2X4X A;  3NGP A;  3DKM A;  1T0J A;  2EKH A;  1B07 A;  2QXF A;  2VV5 A;  1M8V A;  4N4H A;  2RMO A;  2P0P A;  2GFU A;  4BI3 A;  2YLC A;  1VQ6 Q;  2DK3 A;  3UA6 A;  1BI2 A;  2RI3 A;  2DBM A;  1PC0 A;  1VQ9 Q;  5CKE A;  3M59 A;  1YJN Q;  1U8R A;  2X51 A;  1PSF A;  4BD3 A;  3LGL A;  1M2O A;  1I5O B;  1YI2 Q;  3CC7 T;  3CMA A;  3JCM W;  3HFN A;  3RBB B;  3SEM A;  3OW2 P;  2QEX Q;  3H6Z A;  2EVR A;  4HKE A;  5LJ3 h;  2ECZ A;  4CC3 A;  2DBK A;  1K73 U;  1XQH A;  3CCV T;  3GIB A;  4M7D G;  2F2V A;  1Y07 A;  3H9N A;  4HVU A;  2KDS A;  2LCL A;  5GAN 3;  4PJJ A;  1SEM A;  1Y57 A;  1NJI C;  4OMF B;  3H0F A;  4AMC A;  2VB6 A;  5GMK m;  5L23 A;  3QHS A;  1VQL A;  4O6J A;  3X28 B;  2HQE A;  3SWN B;  2KXC A;  4JDS A;  3X25 B;  3CPW S;  1TU0 B;  1ABO A;  4PLL A;  4Z88 A;  3QYH B;  3UPU A;  2RJE A;  4PJM A;  4N4I A;  1VQ4 A;  3REB B;  1VQP A;  5EC7 A;  5LJ3 f;  1AT1 B;  5GAO m;  1GXI E;  1VQ7 A;  1WXU A;  4EDU A;  4PJO B;  4IUR A;  1T3S A;  3L42 A;  2KK4 A;  4XTY A;  3OS5 A;  4IIM A;  2QQA A;  2C06 A;  3SWN C;  2DYI A;  1HXD A;  1WHL A;  2AK5 A;  2EYZ A;  1M3B A;  4D8D A;  4JRI A;  2MAM A;  4EMK A;  2DTI A;  5KYY A;  1OU8 A;  2DIQ A;  2O01 E;  2NUT A;  2M16 A;  1MV0 B;  1K0X A;  2J6O A;  4XTU A;  2XMF A;  4PFP A;  2BE7 D;  4PJO C;  2LVM A;  1PRL C;  3EH2 A;  1MNE A;  3MPU B;  4A63 B;  1KD1 U;  4C0F A;  2ENM A;  2M1H A;  4E2F B;  3I55 T;  1LNX A;  1MHN A;  2RK2 A;  1GCQ C;  1PD1 A;  2RQT A;  1ZSG A;  5GAM f;  1OQK A;  1IO6 A;  4OMM A;  3OS0 A;  2E3I A;  2DZC A;  2Y4X A;  1BKB A;  3FLG A;  4QW2 A;  3CXC S;  1ZLM A;  5C0M A;  3TSW A;  4II1 A;  4DQ2 A;  2JNG A;  1YN8 A;  3CPW P;  2KE9 A;  2J06 A;  5CQY A;  1N9S A;  2NUP B;  2KEA A;  4MML A;  2F2W A;  2O9V A;  1Q7Y C;  1VQ6 T;  4M7D A;  4C92 F;  4BI8 B;  1SRL A;  2LCC A;  4CRI A;  1VQ8 T;  3SHW A;  4F7U B;  1Q95 G;  3EG1 A;  2DO3 A;  2MI6 A;  2QG9 B;  1N5Z A;  2QAS A;  4J9B A;  2LX7 A;  1SSF A;  1YHQ T;  2H3J A;  1XOV A;  2CT3 A;  2KR3 A;  3PTA A;  2CP5 A;  2QEX T;  4QQ6 A;  1WXB A;  5GAM e;  3CC4 A;  2KSS A;  1KD1 R;  1VQ5 A;  4J9E A;  4C0D B;  1MND A;  3MEU A;  4KUD K;  4EPC A;  1N9R A;  3PFS A;  2QGF B;  1PG5 B;  5J3B A;  2DMO A;  3CCS T;  1YJW T;  4HCC A;  3H0H A;  3NFC A;  1B34 B;  1ARK A;  3GPL A;  1O9S A;  1C6V X;  3PVL A;  3KFV A;  1QVP A;  3NPF A;  3CXC P;  3QDR B;  3JCM P;  2JS0 A;  2GTJ A;  3QG1 A;  3EFO A;  1M30 A;  3JRZ A;  4QVZ A;  3MEW A;  4AFS C;  3OYY A;  3M0S A;  4AT1 B;  1RI9 A;  3M4Y A;  3WVE B;  2K3X A;  3URG A;  4PLI A;  1E6G A;  4VUB A;  2WAC A;  3OMG A;  1M1F A;  1M5Q 1;  4MZP A;  5C6S A;  1ZX6 A;  1PNJ A;  1WA7 A;  2AKL A;  4J6Y A;  1OEB A;  2CZ0 B;  2PNI A;  2L3Q A;  1M1K C;  1W4S A;  2DFU A;  4NS5 A;  5GAN 6;  4FT4 A;  5GMK j;  2DTH A;  1UJ0 A;  3E9G A;  4DOV A;  4Y92 A;  1D1B A;  2F5K A;  2CRE A;  2DVJ A;  3SFM A;  3UAT A;  5A0L A;  1Q86 C;  4DEY A;  2LRQ A;  3MKD A;  3QXE B;  1QLY A;  1WHJ A;  1U3O A;  4O5V A;  2FPD A;  1VQO Q;  1C0M A;  4ME7 A;  3UWN A;  2JOY A;  2O4X B;  2RHI A;  2L8D A;  1IGU A;  1LPL A;  5GJW B;  3CCR T;  1QP3 A;  2HD0 A;  1Y96 B;  3I55 A;  2XD0 A;  5A2Q E;  2LT1 A;  1K76 A;  3MJX A;  1H92 A;  1SSH A;  3CCQ Q;  2PZ1 A;  1OZ3 A;  4BY6 B;  4JUV A;  5IT9 E;  5GAN 4; 
#chains in the Genus database with same CATH homology
 1ZUY A;  2KRS A;  1FMK A;  2EBP A;  2YUQ A;  2EW3 A;  2A08 A;  2JM8 A;  4GLM A;  2CH4 W;  2AZS A;  4M4Z A;  4K11 A;  4OMP A;  4OMO A;  4ORZ A;  1T0H A;  1UDL A;  2DL8 A;  2JM9 A;  2KRO A;  2ESW A;  2HDA A;  4Z8A A;  1HD3 A;  1G83 A;  2GNC A;  2W0Z A;  1SHG A;  2K6D A;  2DRK A;  3EGU A;  2D1X A;  4HVW A;  2VVK A;  2EYY A;  2RQV A;  1UG1 A;  2C0O A;  2J05 A;  4RTV A;  2YUN A;  2ED0 A;  2NUZ A;  2KYB A;  4FSS A;  4J9F A;  3VS0 A;  1UE9 A;  1TG0 A;  1T3L A;  2EYX A;  2M0Y A;  4OMQ A;  1KJW A;  1AOJ A;  4KRT A;  1PWT A;  2HCK A;  4DEX A;  1YNZ A;  1UUE A;  4ESR A;  1QCF A;  2CDT A;  2KRN A;  2DL7 A;  1EFN A;  2DIL A;  2KBT A;  4JJB A;  2FRW A;  2LZ6 B;  4HVV A;  2KT1 A;  4F14 A;  2LNH B;  2H8H A;  1W70 A;  2YDL A;  4LUD A;  3TSZ A;  1GBR A;  2A37 A;  2SRC A;  3FJ5 A;  3EG0 A;  3H0I A;  4Z89 A;  4RUG A;  2CSQ A;  1Z9Q A;  1QKX A;  1HSQ A;  1G2B A;  1AD5 A;  1RLQ C;  1I07 A;  2LQW A;  3VRY A;  3QWY A;  2C0I A;  1WI7 A;  4CC2 A;  2L3P A;  1H8K A;  3ULR B;  1AWW A;  4J9D A;  3CQT A;  1NYG A;  1J3T A;  1PKT A;  2DA9 A;  1NYF A;  2D0N A;  1GRI A;  4JJD A;  2EQI A;  2RF0 A;  1AWO A;  4JZ3 A;  5I11 A;  3O5Z A;  2DNU A;  2D8J A;  2GTO A;  1ZUU A;  1K4U S;  3REA B;  2K79 A;  3M0T A;  1GFD A;  2RQW A;  3VRZ A;  3QWX X;  1OOT A;  1UJY A;  2FO0 A;  4GBQ A;  1CKA A;  3VS3 A;  4J9I A;  5IH2 A;  1GCP A;  2HSP A;  3I9Q A;  4JJC A;  1E6H A;  2SEM A;  3U23 A;  3M0U A;  2KXD A;  1TUD A;  1WIE A;  2LJ1 A;  2KNB B;  4RTW A;  1JQQ A;  2BZX A;  3M0R A;  1PKS A;  4EIK A;  2ROT A;  4RTT A;  1KFZ A;  3VS1 A;  4D8K A;  2JT4 A;  3I35 A;  1Z9Z A;  1NEG A;  4X1V A;  3VS2 A;  2B86 A;  2DL4 A;  3NGP A;  1T0J A;  2EKH A;  1B07 A;  3I5S A;  2DRM A;  2W10 A;  2RMO A;  5IXB A;  1WLP B;  3VS6 A;  1JO8 A;  3R6N A;  3UA6 A;  2DBM A;  1AWJ A;  4J9G A;  2AZV A;  2K2M A;  1QKW A;  1I0C A;  1GCQ A;  2FEI A;  2MOX A;  1WFW A;  5FW9 A;  2L3S A;  3EG2 A;  3RBB B;  3SEM A;  1JU5 C;  1W6X A;  1BBZ A;  2EVR A;  3TVT A;  1WX6 A;  1OPK A;  2ECZ A;  4CC3 A;  2DBK A;  2F2V A;  1FYN A;  4HVU A;  2AKK A;  2L2P A;  1M3A A;  3PE0 A;  1X6G A;  1SEM A;  1Y57 A;  2OI3 A;  1X2K A;  3H0F A;  5FWB A;  3A98 A;  2YUO A;  1NLO C;  2O2O A;  2P4R A;  1UHF A;  3UA7 A;  2DF6 A;  4IIO A;  5L23 A;  4OMN A;  2YUP A;  3UF4 A;  1UGV A;  1SRM A;  2GQI A;  2KRM A;  1X43 A;  2A36 A;  2KXC A;  1GL5 A;  2JXB A;  4LN2 A;  1WYX A;  1ABO A;  2NWM A;  4Z88 A;  1BU1 A;  3IQL A;  3REB B;  1AZG B;  4JZ4 A;  5EC7 A;  1X27 A;  1UTI A;  2X3X D;  2DL5 A;  2I0N A;  1WXU A;  2KT8 A;  1T3S A;  1NEB A;  2LCS A;  2M51 A;  2DX1 A;  2VWF A;  4JPB W;  5I22 A;  2EYW A;  1Y0M A;  4IIM A;  4J9H A;  1RUW A;  2K9G A;  2AK5 A;  2EYZ A;  1M3B A;  4D8D A;  4RTY A;  2HEQ A;  1YWO A;  3H41 A;  1OV3 A;  1MV3 A;  1A0N B;  1JEG A;  1YWP A;  1MV0 B;  1U5S A;  2BZ8 A;  2JTE A;  1VYT A;  1BK2 A;  2J6O A;  3EHQ A;  2XMF A;  1HJD A;  4RTZ A;  2YSQ A;  1NG2 A;  2A28 A;  5IXF A;  3RNJ A;  1PRL C;  1V1C A;  4A63 B;  2ENM A;  2DYB A;  1BB9 A;  1AWX A;  1W1F A;  2RPN A;  1ZUK A;  2CH4 A;  5ECA A;  1K0S A;  1YCS B;  1GCQ C;  5IHN A;  2RQT A;  1ZSG A;  2V1Q A;  4HXJ A;  1IO6 A;  2BTT A;  4OMM A;  4CC7 A;  2GBQ A;  4AFQ C;  2J7I A;  4E6R A;  4ZNX A;  1JXM A;  1ZLM A;  3TSW A;  4WCI A;  1YN8 A;  2G6F X;  2KE9 A;  2CSI A;  1CKB A;  2J06 A;  2KGT A;  3LH5 A;  1X6B A;  4RTX A;  1UFF A;  2KEA A;  2F2W A;  2O9V A;  2ED1 A;  3C0C A;  3ZL7 C;  2CT4 A;  2OAW A;  2EGA A;  2RNA A;  2O88 A;  1SRL A;  2JW4 A;  3SHW A;  1ABQ A;  3EHR A;  2KYM A;  2LMJ A;  4F17 A;  2OJ2 A;  2LJ3 A;  2JMC A;  3EG1 A;  2JMA A;  3GBQ A;  1N5Z A;  1M8M A;  2VKN A;  2F2X A;  4J9B A;  2LX7 A;  1PHT A;  3M0P A;  1XOV A;  2CT3 A;  2KR3 A;  2O31 A;  1JXO A;  1RLP C;  2EGC A;  2GGR A;  3NMZ C;  1WXB A;  3NHN A;  4R0K A;  4RTU A;  2J6K A;  4HCK A;  3VS4 A;  4J9E A;  2FG0 A;  4J9C A;  3I5R A;  1LCK A;  2FPE A;  4AG1 C;  2DMO A;  1OPL A;  2ABL A;  2CUD A;  3EG3 A;  1WXT A;  3H0H A;  1CSK A;  1YP5 A;  1H3H A;  1SHF A;  2K3B A;  4AFU C;  1NLP C;  1UHC A;  3M0Q A;  5HCK A;  1QWE A;  5IHK A;  1ARK A;  1AVZ C;  2ROL A;  4QT7 A;  3PVL A;  5FWC A;  3KFV A;  1VYV A;  3NPF A;  1VYU A;  2LJ0 A;  2JS0 A;  4LNP A;  2PTK A;  2GTJ A;  1M30 A;  2V1R A;  2DJQ A;  1X69 A;  1U06 A;  4AFS C;  3PVQ A;  2DLP A;  3JV3 A;  2BZY A;  3M0S A;  4LUE A;  1S1N A;  3THK A;  1RI9 A;  2DE0 X;  2LQN A;  1E6G A;  1K9A A;  1K1Z A;  1SPK A;  2HBW A;  2D8H A;  1PRM C;  1ZX6 A;  1I1J A;  1PNJ A;  1WA7 A;  1B3Q A;  1WDX A;  2AKL A;  1OEB A;  4LE9 A;  1UEC A;  5GJV B;  2PNI A;  1AZE A;  1QWF A;  2L3Q A;  4OML A;  3VS7 A;  2K7A A;  1GFC A;  2LP5 A;  1KIK A;  2J6F A;  1VA7 A;  4AG2 C;  1ZBJ A;  1UJ0 A;  2EPD A;  2DL3 A;  4Y92 A;  2CRE A;  2DM1 A;  2DVJ A;  1X2Q A;  2IIM A;  2JS2 A;  3UAT A;  4DEY A;  3VS5 A;  1QLY A;  1U3O A;  1E7O A;  2FPD A;  5IHI A;  1NM7 A;  4AFZ C;  2C0T A;  2CUB A;  2E5K A;  5GJW B;  4CC4 B;  2MIO A;  2YT6 A;  1MUZ A;  1TUC A;  1M3C A;  2RQR A;  2O9S A;  2EGE A;  1AEY A;  2RQU A;  2FRY A;  1K76 A;  1K0X A;  1H92 A;  4F16 A;  1M27 C;  1SSH A;  1GBQ A;  2RN8 A;  2PZ1 A;  2MCN A;  2FPF A;  2QDL A;  2X3W D;  1KSW A;  2L0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...