1RLPC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1rlpC00
4HXJA 1QWFA 1NEBA 1GFDA 1YN8A 2DRMA 2DYBA 4OMLA 1NLOC 4WCIA 2DBMA 2DL5A 1PRMC 3UA7A 2JW4A 3UA6A 2CSQA 2KRNA 3U23A 1VA7A 1ZSGA 1M8MA 2K7AA 1PNJA 1XOVA 4HVWA 1OPLA 1K1ZA 4JZ3A 4J9DA 1GL5A 1WXTA 3EG3A 3VRZA 3TVTA 2C0TA 4JJDA 2EGEA 1GBQA 2DL7A 2B86A 1G2BA 3UF4A 3REAB 2ROTA 1U3OA 2KT1A 1JXOA 4J9HA 2EW3A 2DVJA 2L3PA 2EGAA 2FEIA 2EYWA 5ECAA 3QWYA 2QDLA 1BBZA 2E5KA 1X27A 3M0UA 3TSZA 2BZ8A 1H8KA 4EIKA 1OEBA 4ORZA 2DA9A 2EKHA 1WYXA 2MCNA 2DMOA 1JU5C 2GBQA 2HBWA 1X6GA 3EHRA 2RQWA 4JZ4A 1U06A 2FRYA 2VVKA 4HCKA 2F2VA 2AKKA 1CKAA 2JTEA 4F17A 1T0JA 2XMFA 2OJ2A 2DRKA 4D8DA 1X43A 4ZNXA 2CSIA 2FO0A 2HEQA 3O5ZA 1I07A 1N5ZA 1WIEA 5IXFA 1SRLA 4CC2A 2L3SA 1GCQC 3ZL7C 4OMOA 1WA7A 1YNZA 2DLPA 3M0RA 2BZYA 2F2XA 2V1QA 1UDLA 3M0SA 1OOTA 2EYZA 4JJCA 3VS1A 2GGRA 1K9AA 1E6GA 1ZX6A 4LNPA 4QT7A 1JEGA 2J6FA 4LN2A 3NGPA 1PKSA 2OI3A 1PWTA 2KNBB 2DF6A 1WX6A 2EGCA 1E7OA 4X1VA 1KFZA 3VRYA 5IHNA 1Y57A 2A08A 1UHCA 2O31A 2O9VA 4OMPA 2GNCA 3LH5A 3RBBB 4JJBA 2D0NA 2RQVA 3THKA 2EPDA 1AD5A 4K11A 1SRMA 1FYNA 3VS5A 1WLPB 2LZ6B 1ZLMA 2KRSA 2MOXA 2YUOA 2PTKA 5I11A 1AZEA 3A98A 2YT6A 2DJQA 1YCSB 3IQLA 2JS2A 4J9BA 2YDLA 4Z89A 2D8HA 1ZUKA 4OMMA 2RPNA 1RLPC 2LNHB 1AWOA 4GLMA 3VS4A 2YUNA 1GCQA 2JM9A 2EYYA 2CREA 4CC7A 5FWBA 5GJVB 2X3WD 1G83A 1K4US 2SRCA 3VS3A 1NEGA 1HSQA 2KXDA 1WDXA 2ED0A 4HVUA 1NYFA 3REBB 2ECZA 2D1XA 4Y92A 1WXBA 1NLPC 2FRWA 4J9EA 2H8HA 4DEXA 3VS7A 2A36A 4J9CA 4RTYA 1IO6A 1KJWA 4AFUC 2KE9A 3SEMA 2LCSA 2KYMA 1UGVA 1Y0MA 5IH2A 2EYXA 1RLQC 1ZUYA 1E6HA 1BK2A 1I1JA 4J9GA 1JXMA 4AG1C 5HCKA 2EBPA 1Z9QA 3QWXX 1QKXA 1OV3A 2C0IA 1B07A 2J7IA 2IIMA 4DEYA 2K79A 1FMKA 1UFFA 3EG1A 2ROLA 3EG0A 1M3BA 2JT4A 2HDAA 1UJ0A 1U5SA 2F2WA 2V1RA 2FG0A 1BB9A 1SPKA 1TUCA 4AFSC 1UE9A 2DNUA 1W1FA 3H0HA 2O9SA 1M30A 3H0FA 2LJ0A 1GRIA 1M3CA 2ESWA 1K0SA 2JMCA 3EGUA 5FWCA 1B3QA 1NM7A 1CSKA 2HSPA 1LCKA 3I5SA 3NPFA 2KRMA 1I0CA 1UECA 2O2OA 1K0XA 2KGTA 4RTWA 1GCPA 2BTTA 1UUEA 2RQTA 1MV0B 5IXBA 1AWWA 1VYVA 2NUZA 5IHIA 3H0IA 2C0OA 4F14A 5FW9A 2ED1A 2X3XD 4FSSA 2SEMA 1ZUUA 1AWXA 2RQRA 4J9IA 4J9FA 1UTIA 2YSQA 2CUDA 3TSWA 2LMJA 1X2KA 2M51A 4HVVA 2J6OA 1QCFA 2DL3A 1NYGA 2YUPA 4Z88A 2G6FX 3FJ5A 3NHNA 4LE9A 2YUQA 2KR3A 2DM1A 2ENMA 4RTXA 1YP5A 3GBQA 1UG1A 1QLYA 2W10A 4CC4B 2DL8A 4D8KA 1UHFA 3M0TA 2GQIA 2KROA 2ABLA 1AEYA 4JPBW 2EQIA 1UJYA 2KT8A 1TUDA 1MV3A 1GBRA 4R0KA 1QWEA 4ESRA 1KSWA 1PRLC 4AG2C 2K2MA 1VYTA 1W6XA 1J3TA 1A0NB 1V1CA 1WI7A 1ZBJA 3KFVA 2FPEA 1PKTA 1M3AA 1W70A 2BZXA 2GTOA 4RTVA 2FPDA 2CH4A 2KXCA 2JM8A 3CQTA 1OPKA 4OMQA 1AZGB 2AK5A 2L0AA 2AZVA 4RUGA 3NMZC 3JV3A 1VYUA 1AWJA 2LJ1A 2KEAA 2J06A 4M4ZA 1CKBA 2DL4A 2CDTA 1BU1A 4RTZA 2A28A 2PZ1A 2KYBA 1PHTA 2LJ3A 2LQNA 1HD3A 2RNAA 1JQQA 1SSHA 2LX7A 3I35A 4OMNA 5IHKA 2OAWA 4CC3A 1M27C 1X69A 1NG2A 2JXBA 5I22A 2DX1A 3EHQA 4F16A 1X6BA 2JS0A 1ARKA 2AKLA 2RF0A 1SEMA 1GFCA 2CUBA 1K76A 2L3QA 4Z8AA 3VS2A 1YWPA 3SHWA 2I0NA 2LP5A 2DILA 1T3LA 1Z9ZA 3I9QA 4E6RA 3PVLA 1MUZA 2FPFA 1JO8A 3C0CA 2K6DA 1H3HA 1EFNA 4IIMA 3M0QA 4AFZC 2W0ZA 2JMAA 4RTUA 4IIOA 1KIKA 2VKNA 1TG0A 2KBTA 2L2PA 2P4RA 1SHFA 2EVRA 2NWMA 2CT4A 2M0YA 1X2QA 2J05A 4GBQA 1T0HA 3UATA 3ULRB 1HJDA 3H41A 1SHGA 2K9GA 3RNJA 1ABQA 1YWOA 4KRTA 1H92A 1S1NA 2CH4W 1WFWA 2RN8A 4AFQC 1RI9A 3PE0A 4RTTA 4LUEA 2DBKA 1RUWA 1WXUA 2HCKA 1T3SA 3EG2A 5EC7A 2D8JA 2MIOA 3I5RA 5GJWB 2O88A 2AZSA 2DE0X 2RMOA 2J6KA 2CT3A 2GTJA 4A63B 3R6NA 3VS6A 1ABOA 3PVQA 2PNIA 2RQUA 3VS0A 1QKWA 3M0PA 2VWFA 2A37A 2LQWA 1AVZC 5L23A 2K3BA 1AOJA 4LUDA
chains in the Genus database with same CATH superfamily
3MP1A 1LOJA 4B9WA 1NEBA 2O4XA 1YI2A 4DBFA 1TTHB 5KYYB 1YN8A 2K2VA 2XDBA 2DYBA 2KQWA 3CCET 2EQUA 2DBMA 1PRMC 3HRUA 2CP7A 2VC8A 3CC4Q 2L5QA 3A5ZB 1IHVA 3CCEA 5CR2A 1M8MA 2P84A 3JB9H 1OPLA 2R5AA 4PNOA 3A8LB 2E12A 2QQSA 2MAMA 3VRZA 1IGQA 2DL7A 3N5BB 2KT1A 1JXOA 3QPHA 4ATOA 3CCJT 3D7SB 4E2FB 2VXEA 2A3LA 3ZEHA 3JCMg 4F7UA 1YI2Q 4PFZA 3CCJA 2QQBA 3L2VA 5KYXA 5LJ5g 3JCMc 5GAMf 2GFAA 2R58A 4IUPA 4ELYC 2BZ8A 1H8KA 3NFCA 4ORZA 3CCEQ 2H3EB 1KQ2A 2PVGB 2MCNA 1Q81U 2DMOA 1X6GA 4M75E 4C5HA 3QXEB 2RQWA 2QDYB 2CZ0B 2OTJT 2F2VA 1I4K1 1CKAA 2Y90A 1D3BB 3JSCA 1MMDA 2OJ2A 2OTJA 1X75C 2MYSA 3MEUA 1WJQA 4A4FA 4A54A 5I2SA 5IXFA 1SRLA 1M2OA 3ZL7C 3NTIA 3RESA 4OMOA 3CCJQ 5AYFA 1TSFA 2DLPA 1ZA2B 1K9MR 1RAHB 4M77A 3X24B 4JJCA 1K9AA 1E6GA 4BACA 4V2SA 4AT1B 4LNPA 4M78C 1VQKT 3NGPA 2LC4A 4C92A 4F7UF 1Y07A 4PKCC 1VQKA 5GANg 3O8VA 3JB9D 4PK4A 1RAIB 3OYEA 2ZPIB 3QYHB 3M5AA 2OTJQ 4FW1A 3THKA 1FYNA 2CKKA 3QHSA 1XQHA 2PVOB 5IN1A 3OYHA 5GAOr 1S72T 1WLPB 1KD1U 2DTHA 1VOMA 4O5VA 1QVFA 1AZEA 4M7AE 2DJQA 1S72A 4HCBA 1G3YA 4J9BA 3BE3A 1Y71A 4Z02A 3PT9A 2JJ9A 2RI3A 3KXTA 3VS4A 2YUNA 1VQKQ 1GCQA 2JM9A 1FX7A 4CC7A 1SF9A 5LJ3e 1G83A 2ZZDA 2SRCA 4C5EA 1M90U 3G6ET 1BIAA 2D0QB 1C6VX 5CVIA 1KC8C 2GCXA 1KQSS 2K5IA 3G6EA 3REBB 1YHQT 1ACMB 4Y92A 1HXDA 1ZSZA 4J9EA 2EIFA 3CBOA 4DEXA 2QASA 5HK0A 4J6WA 2CP3A 4J9CA 3OW2S 3EG9B 8ATCB 1VQ8T 3LH0A 2YHTA 4AFUC 2LCSA 3TREA 3MP8A 5IH2A 3RMQA 2EYXA 2NUPB 1HK9A 1ZUYA 1BK2A 5GAMh 4J9GA 1JXMA 1AT1B 3FEOA 2QQ9A 1QKXA 1OV3A 4M7DE 4LDVA 2LCCA 4C0DC 1YJNA 3UPUA 4ANJA 4MMLA 3OB9A 1YJ9T 2V1RA 1QVGS 4BI4A 3CC2A 4FU6A 1YJ9A 2LJ0A 5GAOp 2HMAA 4MZMA 4KUIA 5GAN5 2VASA 3JCMb 2JMCA 2HL5C 3EGUA 5FWCA 1NM7A 2BUDA 1IB8A 3EGDB 3MP6A 4KH1B 4NL2A 5GAOl 4ZGJB 3M4GA 2O2OA 2KGTA 4RTWA 1KK7A 2ZAEA 2BTTA 2K57A 1D0YA 1MV0B 1PD1A 1VYVA 3P8DA 2C0OA 4F14A 4J5YA 1Q81C 1YJNQ 4M75G 5FW9A 2JNGA 2X3XD 4N4GA 2YSQA 3A8HB 1X2KA 5LJ5j 2DL3A 3OSSC 1WHMA 3PMIA 3CC2Q 1YJ9Q 1PD0A 2KR3A 2ENMA 3H8ZA 1YP5A 1O9SA 2HQXA 1UG1A 4PJOD 2DL8A 1M4ZA 3CCQT 2KROA 4KGZB 2FL7A 2RHIA 2EQIA 3EH2A 1TUDA 5KE3A 1BKBA 4ESRA 1KSWA 2KAFA 4C0DB 1A0NB 2DXTA 1RAFB 2FPEA 1M3AA 2GTOA 4JRKA 2KXCA 1VQ7A 2LX9A 2PU9B 2L0AA 4RUGA 4C8QF 2X4WA 4QQ6A 1U1SA 1ZQ1A 4L5GA 2J06A 4HKEA 3JAME 1RABB 2IG0A 3SWNA 5GMKm 3L2ZA 4RG8A 2E10A 4XTVA 2RJEA 3OQ5A 3V7RA 1KD1C 1Q86R 2AIRB 5GANj 1PHTA 5KYWB 4M7AG 3VKIA 3CD6T 4C0FA 3HTRA 3S3MA 5I22A 3CD6A 2FZGB 1NZ9A 1VQ7Q 3BFMA 2VYTA 1X6BA 1ARKA 2AKLA 3SD4A 2DKGA 3UT1A 2NYSA 4WF2A 1M90C 5AT1B 2DXUA 2VGMA 3M9QA 5IT9E 2FHDA 3SHWA 5KYXB 2I0NA 3RIRA 1T3LA 1JBMA 3UWNA 3LGLA 1MUZA 2QXFA 5GAN2 1KQSA 3C0CA 4WTOB 1H3HA 4OGEA 2XHCA 3DLMA 2W0ZA 2DEQA 3GP8A 1VQ4A 5D7UA 4IIOA 2FB7A 4LD9K 1TG0A 2P4RA 3CD6Q 3CMAQ 3QZ9B 1MGQA 2QK0A 2J05A 3CCLT 1HJDA 5L8RE 4F7UE 4M7DG 3H41A 1N6AA 4XTWA 3HFOA 1VQOT 1ABQA 2P4TA 1BCMA 4KRTA 3WVDB 3CCLA 1S1NA 1R0CB 1BIBA 2CH4W 4L6V5 3SB2A 1MMGA 4E7IA 4LUEA 1WXUA 6AT1B 2HCKA 1T3SA 4FT4A 3LW5E 3QDFA 1VQPT 2D8JA 1BYMA 2DE0X 2HAXA 4DBRA 1VQPA 3R6NA 3VS6A 3QYGB 5GAMe 1QKWA 1VQ4Q 1QVGA 1VQ6T 1AOJA 1JJ2S 1Q7YR 2DRMA 1D09B 3H6ZA 2RD1A 4WCIA 3OYNA 4PFPA 3CMET 5LJ5e 3OYFA 4R55A 2JW4A 1I8FA 3EFRA 1WHHA 2F5TX 2OTLQ 3CXCS 3CMEA 3CCLQ 5DY9A 1XOVA 3P8HA 4A53A 5A0DA 4HT8A 5DLQE 1D0ZA 1TXQA 1UGQB 2D9TA 1GXIE 1VQPQ 3CEYA 3UF4A 3WXMB 3CCUT 1R8OB 4JS4A 4MZPA 3LLRA 3EGXA 2DVJA 2L3PA 3HRTA 1TH7A 5ECAA 3JB9I 2QDLA 5KE2A 2RH2A 3A8OB 2RB6A 3I55T 1D1AA 1YITA 2JN0A 1B34B 2RHYA 4JLGA 4N4HA 2M02A 2DA9A 2EKHA 3I55A 2V8IA 4HA8A 2L89A 1FXXA 2HSEB 4JZ4A 1U06A 4HCKA 4M75C 2JTEA 3OYYA 1T0JA 2XMFA 3ER0A 2DRKA 4D8DA 1C1AA 4ZNXA 4QVZA 2HEQA 3O5ZA 1N5ZA 2GFUA 3OS5A 4XTZA 1M1KU 1W2BS 7AT1B 4C0ZA 2F2XA 3CC4T 4PFOA 1O75A 3PIPA 2M9UA 1YITQ 3A1PA 3CC4A 1IRXA 3I55Q 2J6FA 4LN2A 1PKSA 4M78F 2OI3A 2DF6A 2PUOB 5I21A 1M1GA 4X1VA 3QDRB 1WJRA 3VRYA 5IHNA 3ZBDA 1Y57A 3LYIA 3PTAA 1MNDA 3P8BB 3LH5A 4JJBA 3E19A 1NBEB 2V8JA 2YRVA 4K11A 4BDYA 3VYGA 2YWWA 1Y96A 5LJ3d 2HKQB 3V8KA 1ZLMA 2YUOA 2PTKA 1VQLT 4F04B 3A98A 1PSFA 2YT6A 3VV0A 2CS7A 1YCSB 4ME7A 2KI7A 5KCOA 3M4YA 3QSUA 1VQLA 2WSFE 1MMAA 1RLPC 4JRIA 4M7AC 1NE8A 2LNHB 4F7UG 1G3WA 3QJ6A 2QYZA 1R77A 3GNFB 4FYYB 2CYZB 4EMKA 4M75B 5FWBA 5GJVB 5FRNA 1QMCA 3L2QA 3M58A 4C8QE 4JJNK 1NYFA 3JCMW 5CKEA 1XJWB 2LRQA 3CCVT 3HFNA 1SG5A 2V26A 4GY5A 2H8HA 1N9RA 3JCMP 1FWZA 3CCVA 2LVMA 4N0AC 3SEMA 4RG2A 1VQLQ 1OX8A 1TS9A 4JRPA 3V8JA 3JCMf 1E6HA 1I1JA 2DJZA 2RHUA 2EQJA 2HZYA 1D0XA 3MEVA 2EBPA 5LJ5f 4EPCA 3SWNB 1JJ2A 4M77G 2J7IA 2IIMA 3C12A 2QG9B 4II1A 1UFFA 2F1LA 1HYOA 2ROLA 3NTHA 4M7DC 1M3BA 2JT4A 3OYAA 3QKJA 4C92G 1TUCA 1SPKA 4AFSC 2DNUA 3TCJA 1K73R 1Q7YU 2QTVA 3H0FA 4X9DA 3DB3A 3CCVQ 3M54A 4XQ3A 4A4HA 5GAN6 1B3QA 3LWIA 2HSPA 5HKCA 3M53A 4M7AB 4XTUA 1KHCA 3MKDA 4J6YA 2B8AA 3X28B 2HD0A 2RK2A 1VQMT 1FMWA 2RQTA 5IHIA 3GNGA 3RDVA 2RA2A 1OZ3A 1QP2A 1VQMA 4IUTA 2F69A 1AWXA 4J9FA 3VYHB 2C06A 2LMJA 4KULA 2J6OA 2MWPA 1NYGA 4Z88A 1OQKA 1F1BB 2H3JA 5GANf 4BDZA 3GBQA 4BE2A 5KYUB 5HY6A 1TWBA 4Q5WA 1WJSA 3TEEA 4D8KA 5KYNA 2GQIA 4FYVB 2VB6A 4NL3A 1JRIA 2P0QA 5FRMA 3PNWC 2KT8A 1W2BA 4LD6A 1MV3A 1GBRA 4R0KA 1QWEA 5GMKi 1PRLC 1Y7XA 2X4YA 1VQMQ 1W6XA 4XU3A 1UGSB 1J3TA 1V1CA 1ZBJA 3M59A 4E7JA 5D6YA 3JB9F 1W70A 2FPDA 4M7DB 1Q86C 2JM8A 4OGCA 1OPKA 3KBGA 1UB4A 2CP0A 1AZGB 2XDDA 1FMVA 2Y4YA 1VYUA 5GMKj 1AWJA 5GAOn 2LJ1A 2KVQG 3E9FA 2DETA 2KMTA 2O01E 4JDSA 2DTOA 2A28A 2PZ1A 2MF2A 4FSXA 2KYBA 3OS1A 4OF1A 1I5LA 1HD3A 2RNAA 1PG5B 1JQQA 1IREB 1ZHIA 2XIDA 3JB9J 5IHKA 1YJNT 9ATCB 2OAWA 4QVDA 4CC3A 4LDXA 1M27C 4DQ2A 5D6XA 2DIGA 3CCSA 4O6JA 1RI0A 3M56A 3HPWA 4LDWA 3GOXA 5CKBA 3JCMh 2A0FB 4F16A 1TUGB 3CCRT 3CC2T 2OX7A 2RF0A 3X25B 2CUBA 5LJ5h 1G3TA 1V29B 4ZN1A 3CCRA 4LXCA 2RHXA 3VS2A 1PC0A 4FW2A 3A8MB 2DILA 1Z9ZA 3MEAA 4J7IA 4E6RA 2K3YA 1EFNA 2ZPHB 4AFZC 3FJPA 3RR6A 4C8QA 3M55A 4BB7A 2VKNA 3OMCA 4P5NA 1QW1A 4X34A 3CCSQ 3SDZA 4Y91A 2EVRA 4MDXA 1LVKA 1X2QA 5GAMd 4M78E 4PJOA 3EFOA 1T0HA 4XK8E 1M2VA 1SHGA 4PJMA 2K9GA 1B7TA 2RO0A 3FB9A 4TVRA 2X9HA 2XDPA 3CCRQ 1WFWA 4QKUA 4N4IA 2DBKA 5J26A 4PJNA 3UDCA 3VUZA 2DEUA 1NJIR 3I5RA 2COZA 2AZSA 1Q7YC 2PNIA 5GANh 2RQUA 3VS0A 2DZ9A 2EFIA 3HRSA 2VWFA 3PGGA 3L2UA 5L23A 2E5QA 1WHGA 2K3BA 4LUDA 2LT4A 3EFSA 1QWFA 4YTLA 3INZA 1PSEA 1VQ7T 1GFDA 2E6NA 1M1KR 2DTIA 2BE9B 4OMLA 1NLOC 1K73U 2CSQA 1VA7A 1ZSGA 4BY6C 3PMTA 2K7AA 3CPWP 2VGNA 1PNJA 2O4XB 4E7ZA 1QP3A 1K1ZA 4J9DA 1MMNA 1H641 1WXTA 4M75D 3EG3A 4M77C 4XU1A 4PJOF 1GBQA 3GPLA 2B86A 1G2BA 2XK0A 2ROTA 3HHTB 4C92C 3JCMX 5DM7R 3L1AA 2EW3A 3CMAT 3DLLA 2DERA 5GAN8 2EGAA 3CPFA 2EAYA 3CMAA 3TSZA 2LNVA 4PLLA 4EIKA 2E41A 1D3BA 4IUQA 2FYKA 3C4SA 4F7UB 2GBQA 3F70A 2BIVA 2DD5A 3OYLA 1SKUB 2Z0WA 3S3OA 2CP5A 5LJ3g 3OYJA 4XAXB 2ZPEB 2FRYA 3CC7A 2VVKA 2YLCA 4IUUA 3QUIA 2AKKA 1YBYA 2QQRA 2JOYA 2XD0A 3OYIA 1VQ4T 2LTOA 5KCHA 2MK5A 1X43A 1U8RA 1H3ZA 2CSIA 4EDUA 1I81A 1WIEA 3PIOA 4CC2A 1NPRA 2L3SA 3GLXA 1MHNA 4LDUA 1GCQC 2LQKA 4IURA 2HL3A 1YNZA 2M16A 2AT1B 2V1QA 3OW2A 1UGRB 1OOTA 2IPOB 2BKDN 3X20B 2OTLT 1ZX6A 1NPPA 5CCAA 4M7AD 4BY6B 3META 2OTLA 4QT7A 1JEGA 2KK4A 1QCOA 1ZSZC 2HKNA 1WX6A 2EGCA 4MZTA 1E7OA 5EG2A 1KFZA 3CC7Q 5C0MA 4M77B 2LT1A 2O9VA 2QGGA 4A4KA 2D0NA 1X6OA 2LQ8A 2RQVA 3OYCA 4C92B 1LJOA 2D6FA 1AD5A 4OP0A 1SRMA 3VS5A 4QQGA 2DXCA 4HT9A 2LZ6B 2KRSA 3JCMe 3E9GA 1XTDA 3J80E 2K3XA 4KT0E 2JS2A 4XU2A 2YDLA 4Z89A 2X4XA 2D8HA 4LDYA 2RPNA 1I5OB 1BI2A 3DB4A 2QI2A 1AWOA 2NUTA 4GLMA 2YLBA 4JRQA 3RUXA 2EYYA 1PCXA 3EAEA 4BI8B 2CREA 2E70A 4PL6A 3G7ZA 2X3WD 3HKSA 3VS3A 2KXDA 3EG9A 4HVUA 1YJWQ 4M7DD 2RJDA 2FZCB 2YRCA 4C5GA 4QW2A 2CZ6B 2QEXA 5HK3A 2WSCE 4XU0A 2JVVA 4M78A 2D1XA 1WXBA 1NLPC 4KGVB 1JJ2P 1YITT 4L59A 5CO7A 3QIIA 4RTYA 5FU6C 1IO6A 1UEBA 2HBPA 1V76A 1KJWA 4E47A 2KYMA 1RLQC 1ZSZB 1NJIU 1K73C 3FLGA 4AG1C 5HCKA 1Z9QA 3QWXX 4GLKA 3OS2A 1ZBXA 2KDSA 1U1TA 4HCZA 3BY7A 5GANe 2E4HA 2K79A 1OZ2A 3LGFA 3EG0A 3MEWA 3EGDA 2QEXQ 2F2WA 2V8KA 4DBHA 1WZOA 2FG0A 1W1FA 3H0HA 3VUBA 1M30A 1M3CA 1QQJA 2ESWA 4DBQA 1W4SA 5GAN7 4ZTFA 2A7YA 2KRMA 1UECA 3VU3C 3TQ7P 3NTKA 2COWA 1UUEA 5IXBA 2NUZA 1N8RR 3SWNC 1QVFP 2ED1A 1ZUUA 1UTIA 2VUBA 2QGFB 2M51A 2E6ZA 3MPUB 2RK1A 4C8QB 3X26B 3H9NA 2YXYA 2EWNA 1XNIA 2G6FX 3NHNA 1KC8U 2JZ2A 2M1HA 5FU6B 3QJYA 5LJ3j 3WVEB 1VQ9T 3RKWA 1K8AU 3G4SA 4A4EA 4J83A 2EJFA 1VQ5T 1VQ9A 3QZ5B 1UJYA 4CI0C 4AG2C 2K2MA 2K5LA 1VQ5A 4A4GA 1VYTA 5M9OA 3I56T 4ZGEB 3BDLA 1PKTA 2BZXA 4PLIA 2DIQA 2CH4A 4RTVA 2MPXC 3I56A 3HSBA 3EH1A 1YCYA 2AK5A 2AZVA 5KYWA 2AHJB 1M1FA 4FYXB 4PJOE 2LDMA 1M9SA 4ZN3A 4M4ZA 4ZTJA 2DL4A 3V7CA 1BU1A 5I2MA 3QO3A 5GAMg 3S3NA 3M57A 1QCNA 3G4SQ 3G1JA 1VQ9Q 2E3HA 3G71T 4X9CA 3I35A 1SSHA 2LX7A 4OMNA 5GAOm 2YRDA 1VQ5Q 3G71A 2KY9A 3C94A 1NG2A 2DD4A 3EHQA 1N27A 3JB9G 2QQAA 3AHUA 8AT1B 3I56Q 4DOVA 2JUFA 4XTYA 3CXCA 2QA4T 1SEMA 1K76A 5D6WA 3E2UA 4EMHA 4Z8AA 2QA4A 1D1BA 1YWPA 3PFSA 2OAUA 2R57A 1WPYA 1G3SA 1Q82U 3OSVA 2E3IA 1JO8A 2GQVA 2K6DA 1YFNA 4IIMA 5CIUA 1G8XA 1LPLA 4BE0A 5J39A 3FC3A 4RMOA 1KIKA 3G71Q 1WHJA 2HQEA 5FLXE 2CZ7B 1NJIC 1SHFA 2NWMA 2CT4A 2M0YA 3OY9A 2KSSA 1QVPA 3UATA 4FL6A 1YWOA 1H92A 4KUDK 2QA4Q 2RN8A 4AFQC 3PE0A 4RTTA 5GMKh 1RUWA 4M77D 4BE1A 5A0LA 1MNEA 2MIOA 5GJWB 1WGSA 1M1KC 2J6KA 3KUFA 4C92D 2A37A 2LQWA 4BD3A 4HXJA 3L42A 4XTXA 2XKOC 2P0PA 2FZKB 4DOWA 1Q95G 2DL5A 4FIBA 3UA7A 3CBMA 3UA6A 2KRNA 5CAIA 4OB1B 3L2RA 1KG1A 3U23A 4OB3B 4HVWA 4JZ3A 1GL5A 4M77F 3TVTA 2C0TA 4JJDA 2EGEA 3REAB 1U3OA 4Y28E 1B34A 2IVWA 1VQNT 4J9HA 2NUTB 1N8RU 3OYGA 3MCAB 4C92F 3CCST 1IXDA 1K8AC 1VQNA 2DAQA 1YHQA 2EKOA 3QBYA 2FEIA 2EYWA 2XICA 3QWYA 2EQMA 2CGHA 4VUBA 1BBZA 2E5KA 5A0GA 1X27A 3M0UA 3VJPA 4D6WA 1S72Q 2ZPBB 1KQSP 2HQHA 1RAEB 1OEBA 4C5IA 3J81E 3OS0A 2M0OA 4AMCA 4EMGA 1VQ8A 4M78B 1WYXA 4C8QG 2X4JA 1BI3A 4B9XA 3EGXB 1IGUA 1JU5C 2HBWA 3EHRA 3ME9A 3OW2P 2MI6A 3JCMV 4PJOG 2P0KA 3FIFA 5FROA 1TOVA 4F17A 2ZGWA 2DFUA 3G6EQ 1YIJT 2FO0A 1I07A 4IUVA 2MWOA 1VQNQ 2L3RA 1YHQQ 1RAAB 1YIJA 1WA7A 4EMKC 3M0RA 2BZYA 3OMGA 1UDLA 3OBWA 3M0SA 2NLUA 4C0GA 2EYZA 3CBPA 1D1CA 3VS1A 3MJXA 2GGRA 4B6MA 2X35A 2X51A 4R56A 1QVGP 1VQ8Q 1WNLA 5GAMj 1M8VA 1PWTA 2VXFA 2KNBB 3JCMd 4FT2A 1PM3A 3CCMT 2A08A 1UHCA 5LJ5d 3JCMQ 2O31A 2WSEE 3CCMA 3FDRA 4OMPA 2GNCA 3RBBB 5KYYA 2XI9A 5GAOq 4OB0B 4C8QD 4QQDA 3HP9A 1P92A 2EPDA 4KGXB 3RKYA 1Q82C 1WQ7A 2E65A 4RCCA 3CPWS 1YIJQ 3FRNA 2DK3A 2MOXA 2ZCFB 5I11A 4JUVA 4M75A 3IQLA 5GAN4 1KQ1A 1ZUKA 3QG1A 4OMMA 1WQWA 1Y96B 3CCQA 1WHKA 1K4US 3CCMQ 1NEGA 3ZFJA 1HSQA 1WDXA 2ED0A 2XG8D 2MMPA 2RJCA 1K9MU 2ECZA 3JCMJ 3V7SA 2RI5A 2FRWA 4EMKB 1R0BG 5GANd 3VS7A 2A36A 1EZZB 3L2WA 2PUKB 1OYXA 1KC8R 2KE9A 4J8OA 2DYIA 4PJJA 2DPPB 2JTFA 2L8DA 1UGVA 4MDWA 1Y0MA 5GMKe 4OB2B 3CC7T 3CCQQ 3T9NA 1K8AR 2QAZA 3RERA 3HL8A 5J3BA 1SSFA 2C0IA 1B07A 4DEYA 1OU9A 4FM4B 4M75F 5CQXA 1LNXA 2VV5A 1FMKA 3EG1A 2G3RA 1KHIA 2HDAA 1UJ0A 1U5SA 3R6OA 2ZPFB 1BB9A 4J7FA 1UE9A 4M7AA 2O9SA 5LJ3f 2HNIA 4MMKA 3RKXA 4DA4A 1GRIA 1N8RC 2CP2A 1EIFA 1OULA 1K0SA 2RHZA 1VIFA 4BI3A 3OA6A 1CSKA 3J7AF 1LCKA 3I5SA 3NPFA 3TU4K 3E1SA 3OBYA 1I0CA 3MHXA 1K0XA 3SFMA 3OYMA 4BUGA 1GCPA 2ATCB 2XU8A 2COYA 2FVUA 1AWWA 1EX4A 3H0IA 3BDUA 4JLIA 4HCCA 3OYKA 1RACB 1YJWT 2RI2A 2E64A 5KYUA 3S6WA 4FSSA 2SEMA 4NOYA 1OU8A 2DVEA 2GF7A 2RQRA 2CP6A 4J9IA 1YJWA 4N0AA 2CUDA 4HVVA 5KH6A 1QCFA 2YUPA 4IKFA 3GIBA 3FJ5A 4LE9A 2YUQA 5CKFA 2DM1A 1VQOA 4RTXA 1Q81R 4RKUE 3GF5A 3C95A 1QLYA 2W10A 3Q1JA 4CC4B 1RL2A 5FU7C 2EQKA 1UHFA 1UGPB 3M0TA 5IAYA 1RADB 2CZ1B 2ABLA 1AEYA 4M7DA 1WHLA 4M78G 1Q82R 4JPBW 4M7AF 2F5KA 1VIEA 1C0MA 4KH0B 2ZPGB 4ZGDB 2R5MA 1BCOA 1VQ6A 4OMFB 5CKDA 1WI7A 3KFVA 5GAN3 2QEXT 4RCBA 1G5VA 3CQTA 4OMQA 4C8QC 4FCYA 3NMZC 4M77E 3JV3A 2NUPA 1VQOQ 2DXBA 2KEAA 1CKBA 5A2QE 2CDTA 4NS5A 4PJOC 4RTZA 4C92E 1BI1A 3CXCP 2EJ9A 4JS5A 2LJ3A 3OYBA 2LQNA 3RMSA 1TU0B 3DKMA 1VUBA 2LCLA 3CCUA 3BW1A 3CPWA 2EYQA 4KBMB 2BE7D 2Y4XA 4QVCA 4E7KA 1VQ6Q 1X69A 2PQWA 2JXBA 2DX1A 1M5Q1 3AT1B 1OX9A 2E1HA 2RJFA 4E7SA 1KD1R 1JB0E 1IZ6A 2JS0A 2K4YA 4M78D 3LX7A 2DO3A 1X01A 1GFCA 3CMEQ 4M7DF 2EJGA 2L3QA 4CRIA 1DJ7B 5GMKl 4PJLA 2LP5A 1K9MC 1ZA1B 3I9QA 3JRZA 4OVAA 3PVLA 5FU7B 4J6XA 1QVFS 2FPFA 5LJ3h 3MO8A 3M0QA 1N9SA 2WACA 1M90R 3CCUQ 2JMAA 1AHJB 1BI0A 2RM4A 4RTUA 4ELZC 4FYWB 1OI1A 4E7HA 2KBTA 2L2PA 4GBQA 4E7LA 3ULRB 5C6SA 2K5FA 3LWHA 3RNJA 1W2BP 3V8LA 4UC4A 2PVDB 1RI9A 3OYDA 3URGA 3A8GB 5CKHA 5EC7A 3EG2A 1Q86U 5CQYA 4PJOB 3EFOB 3G4ST 2O88A 2JTMA 2RMOA 1RAGB 2I2LA 2CT3A 1M2VB 2GTJA 4A63B 1IHWA 1ABOA 3PVQA 2QTXA 5DLOA 3ASKA 5LL6S 3M0PA 1YI2T 1AVZC 5CK9A 2DZCA 3TSWA
chains in the Genus database with same CATH topology
4HXJA 1QWFA 1NEBA 1GFDA 1YN8A 2DRMA 2DYBA 4OMLA 1NLOC 4WCIA 2DBMA 2DL5A 1PRMC 3UA7A 2JW4A 3UA6A 2CSQA 2KRNA 3U23A 1VA7A 1ZSGA 1M8MA 2K7AA 1PNJA 1XOVA 4HVWA 1OPLA 1K1ZA 4JZ3A 4J9DA 1GL5A 1WXTA 3EG3A 3VRZA 3TVTA 2C0TA 4JJDA 2EGEA 1GBQA 2DL7A 2B86A 1G2BA 3UF4A 3REAB 2ROTA 1U3OA 2KT1A 1JXOA 4J9HA 2EW3A 2DVJA 2L3PA 2EGAA 2FEIA 2EYWA 5ECAA 3QWYA 2QDLA 1BBZA 2E5KA 1X27A 3M0UA 3TSZA 2BZ8A 1H8KA 4EIKA 1OEBA 4ORZA 2DA9A 2EKHA 1WYXA 2MCNA 2DMOA 1JU5C 2GBQA 2HBWA 1X6GA 3EHRA 2RQWA 4JZ4A 1U06A 2FRYA 2VVKA 4HCKA 2F2VA 2AKKA 1CKAA 2JTEA 4F17A 1T0JA 2XMFA 2OJ2A 2DRKA 4D8DA 1X43A 4ZNXA 2CSIA 2FO0A 2HEQA 3O5ZA 1I07A 1N5ZA 1WIEA 5IXFA 1SRLA 4CC2A 2L3SA 1GCQC 3ZL7C 4OMOA 1WA7A 1YNZA 2DLPA 3M0RA 2BZYA 2F2XA 2V1QA 1UDLA 3M0SA 1OOTA 2EYZA 4JJCA 3VS1A 2GGRA 1K9AA 1E6GA 1ZX6A 4LNPA 4QT7A 1JEGA 2J6FA 4LN2A 3NGPA 1PKSA 2OI3A 1PWTA 2KNBB 2DF6A 1WX6A 2EGCA 1E7OA 4X1VA 1KFZA 3VRYA 5IHNA 1Y57A 2A08A 1UHCA 2O31A 2O9VA 4OMPA 2GNCA 3LH5A 3RBBB 4JJBA 2D0NA 2RQVA 3THKA 2EPDA 1AD5A 4K11A 1SRMA 1FYNA 3VS5A 1WLPB 2LZ6B 1ZLMA 2KRSA 2MOXA 2YUOA 2PTKA 5I11A 1AZEA 3A98A 2YT6A 2DJQA 1YCSB 3IQLA 2JS2A 4J9BA 2YDLA 4Z89A 2D8HA 1ZUKA 4OMMA 2RPNA 1RLPC 2LNHB 1AWOA 4GLMA 3VS4A 2YUNA 1GCQA 2JM9A 2EYYA 2CREA 4CC7A 5FWBA 5GJVB 2X3WD 1G83A 1K4US 2SRCA 3VS3A 1NEGA 1HSQA 2KXDA 1WDXA 2ED0A 4HVUA 1NYFA 3REBB 2ECZA 2D1XA 4Y92A 1WXBA 1NLPC 2FRWA 4J9EA 2H8HA 4DEXA 3VS7A 2A36A 4J9CA 4RTYA 1IO6A 1KJWA 4AFUC 2KE9A 3SEMA 2LCSA 2KYMA 1UGVA 1Y0MA 5IH2A 2EYXA 1RLQC 1ZUYA 1E6HA 1BK2A 1I1JA 4J9GA 1JXMA 4AG1C 5HCKA 2EBPA 1Z9QA 3QWXX 1QKXA 1OV3A 2C0IA 1B07A 2J7IA 2IIMA 4DEYA 2K79A 1FMKA 1UFFA 3EG1A 2ROLA 3EG0A 1M3BA 2JT4A 2HDAA 1UJ0A 1U5SA 2F2WA 2V1RA 2FG0A 1BB9A 1SPKA 1TUCA 4AFSC 1UE9A 2DNUA 1W1FA 3H0HA 2O9SA 1M30A 3H0FA 2LJ0A 1GRIA 1M3CA 2ESWA 1K0SA 2JMCA 3EGUA 5FWCA 1B3QA 1NM7A 1CSKA 2HSPA 1LCKA 3I5SA 3NPFA 2KRMA 1I0CA 1UECA 2O2OA 1K0XA 2KGTA 4RTWA 1GCPA 2BTTA 1UUEA 2RQTA 1MV0B 5IXBA 1AWWA 1VYVA 2NUZA 5IHIA 3H0IA 2C0OA 4F14A 5FW9A 2ED1A 2X3XD 4FSSA 2SEMA 1ZUUA 1AWXA 2RQRA 4J9IA 4J9FA 1UTIA 2YSQA 2CUDA 3TSWA 2LMJA 1X2KA 2M51A 4HVVA 2J6OA 1QCFA 2DL3A 1NYGA 2YUPA 4Z88A 2G6FX 3FJ5A 3NHNA 4LE9A 2YUQA 2KR3A 2DM1A 2ENMA 4RTXA 1YP5A 3GBQA 1UG1A 1QLYA 2W10A 4CC4B 2DL8A 4D8KA 1UHFA 3M0TA 2GQIA 2KROA 2ABLA 1AEYA 4JPBW 2EQIA 1UJYA 2KT8A 1TUDA 1MV3A 1GBRA 4R0KA 1QWEA 4ESRA 1KSWA 1PRLC 4AG2C 2K2MA 1VYTA 1W6XA 1J3TA 1A0NB 1V1CA 1WI7A 1ZBJA 3KFVA 2FPEA 1PKTA 1M3AA 1W70A 2BZXA 2GTOA 4RTVA 2FPDA 2CH4A 2KXCA 2JM8A 3CQTA 1OPKA 4OMQA 1AZGB 2AK5A 2L0AA 2AZVA 4RUGA 3NMZC 3JV3A 1VYUA 1AWJA 2LJ1A 2KEAA 2J06A 4M4ZA 1CKBA 2DL4A 2CDTA 1BU1A 4RTZA 2A28A 2PZ1A 2KYBA 1PHTA 2LJ3A 2LQNA 1HD3A 2RNAA 1JQQA 1SSHA 2LX7A 3I35A 4OMNA 5IHKA 2OAWA 4CC3A 1M27C 1X69A 1NG2A 2JXBA 5I22A 2DX1A 3EHQA 4F16A 1X6BA 2JS0A 1ARKA 2AKLA 2RF0A 1SEMA 1GFCA 2CUBA 1K76A 2L3QA 4Z8AA 3VS2A 1YWPA 3SHWA 2I0NA 2LP5A 2DILA 1T3LA 1Z9ZA 3I9QA 4E6RA 3PVLA 1MUZA 2FPFA 1JO8A 3C0CA 2K6DA 1H3HA 1EFNA 4IIMA 3M0QA 4AFZC 2W0ZA 2JMAA 4RTUA 4IIOA 1KIKA 2VKNA 1TG0A 2KBTA 2L2PA 2P4RA 1SHFA 2EVRA 2NWMA 2CT4A 2M0YA 1X2QA 2J05A 4GBQA 1T0HA 3UATA 3ULRB 1HJDA 3H41A 1SHGA 2K9GA 3RNJA 1ABQA 1YWOA 4KRTA 1H92A 1S1NA 2CH4W 1WFWA 2RN8A 4AFQC 1RI9A 3PE0A 4RTTA 4LUEA 2DBKA 1RUWA 1WXUA 2HCKA 1T3SA 3EG2A 5EC7A 2D8JA 2MIOA 3I5RA 5GJWB 2O88A 2AZSA 2DE0X 2RMOA 2J6KA 2CT3A 2GTJA 4A63B 3R6NA 3VS6A 1ABOA 3PVQA 2PNIA 2RQUA 3VS0A 1QKWA 3M0PA 2VWFA 2A37A 2LQWA 1AVZC 5L23A 2K3BA 1AOJA 4LUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXJ A;  1QWF A;  1NEB A;  1GFD A;  1YN8 A;  2DRM A;  2DYB A;  4OML A;  1NLO C;  4WCI A;  2DBM A;  2DL5 A;  1PRM C;  3UA7 A;  2JW4 A;  3UA6 A;  2CSQ A;  2KRN A;  3U23 A;  1VA7 A;  1ZSG A;  1M8M A;  2K7A A;  1PNJ A;  1XOV A;  4HVW A;  1OPL A;  1K1Z A;  4JZ3 A;  4J9D A;  1GL5 A;  1WXT A;  3EG3 A;  3VRZ A;  3TVT A;  2C0T A;  4JJD A;  2EGE A;  1GBQ A;  2DL7 A;  2B86 A;  1G2B A;  3UF4 A;  3REA B;  2ROT A;  1U3O A;  2KT1 A;  1JXO A;  4J9H A;  2EW3 A;  2DVJ A;  2L3P A;  2EGA A;  2FEI A;  2EYW A;  5ECA A;  3QWY A;  2QDL A;  1BBZ A;  2E5K A;  1X27 A;  3M0U A;  3TSZ A;  2BZ8 A;  1H8K A;  4EIK A;  1OEB A;  4ORZ A;  2DA9 A;  2EKH A;  1WYX A;  2MCN A;  2DMO A;  1JU5 C;  2GBQ A;  2HBW A;  1X6G A;  3EHR A;  2RQW A;  4JZ4 A;  1U06 A;  2FRY A;  2VVK A;  4HCK A;  2F2V A;  2AKK A;  1CKA A;  2JTE A;  4F17 A;  1T0J A;  2XMF A;  2OJ2 A;  2DRK A;  4D8D A;  1X43 A;  4ZNX A;  2CSI A;  2FO0 A;  2HEQ A;  3O5Z A;  1I07 A;  1N5Z A;  1WIE A;  5IXF A;  1SRL A;  4CC2 A;  2L3S A;  1GCQ C;  3ZL7 C;  4OMO A;  1WA7 A;  1YNZ A;  2DLP A;  3M0R A;  2BZY A;  2F2X A;  2V1Q A;  1UDL A;  3M0S A;  1OOT A;  2EYZ A;  4JJC A;  3VS1 A;  2GGR A;  1K9A A;  1E6G A;  1ZX6 A;  4LNP A;  4QT7 A;  1JEG A;  2J6F A;  4LN2 A;  3NGP A;  1PKS A;  2OI3 A;  1PWT A;  2KNB B;  2DF6 A;  1WX6 A;  2EGC A;  1E7O A;  4X1V A;  1KFZ A;  3VRY A;  5IHN A;  1Y57 A;  2A08 A;  1UHC A;  2O31 A;  2O9V A;  4OMP A;  2GNC A;  3LH5 A;  3RBB B;  4JJB A;  2D0N A;  2RQV A;  3THK A;  2EPD A;  1AD5 A;  4K11 A;  1SRM A;  1FYN A;  3VS5 A;  1WLP B;  2LZ6 B;  1ZLM A;  2KRS A;  2MOX A;  2YUO A;  2PTK A;  5I11 A;  1AZE A;  3A98 A;  2YT6 A;  2DJQ A;  1YCS B;  3IQL A;  2JS2 A;  4J9B A;  2YDL A;  4Z89 A;  2D8H A;  1ZUK A;  4OMM A;  2RPN A;  1RLP C;  2LNH B;  1AWO A;  4GLM A;  3VS4 A;  2YUN A;  1GCQ A;  2JM9 A;  2EYY A;  2CRE A;  4CC7 A;  5FWB A;  5GJV B;  2X3W D;  1G83 A;  1K4U S;  2SRC A;  3VS3 A;  1NEG A;  1HSQ A;  2KXD A;  1WDX A;  2ED0 A;  4HVU A;  1NYF A;  3REB B;  2ECZ A;  2D1X A;  4Y92 A;  1WXB A;  1NLP C;  2FRW A;  4J9E A;  2H8H A;  4DEX A;  3VS7 A;  2A36 A;  4J9C A;  4RTY A;  1IO6 A;  1KJW A;  4AFU C;  2KE9 A;  3SEM A;  2LCS A;  2KYM A;  1UGV A;  1Y0M A;  5IH2 A;  2EYX A;  1RLQ C;  1ZUY A;  1E6H A;  1BK2 A;  1I1J A;  4J9G A;  1JXM A;  4AG1 C;  5HCK A;  2EBP A;  1Z9Q A;  3QWX X;  1QKX A;  1OV3 A;  2C0I A;  1B07 A;  2J7I A;  2IIM A;  4DEY A;  2K79 A;  1FMK A;  1UFF A;  3EG1 A;  2ROL A;  3EG0 A;  1M3B A;  2JT4 A;  2HDA A;  1UJ0 A;  1U5S A;  2F2W A;  2V1R A;  2FG0 A;  1BB9 A;  1SPK A;  1TUC A;  4AFS C;  1UE9 A;  2DNU A;  1W1F A;  3H0H A;  2O9S A;  1M30 A;  3H0F A;  2LJ0 A;  1GRI A;  1M3C A;  2ESW A;  1K0S A;  2JMC A;  3EGU A;  5FWC A;  1B3Q A;  1NM7 A;  1CSK A;  2HSP A;  1LCK A;  3I5S A;  3NPF A;  2KRM A;  1I0C A;  1UEC A;  2O2O A;  1K0X A;  2KGT A;  4RTW A;  1GCP A;  2BTT A;  1UUE A;  2RQT A;  1MV0 B;  5IXB A;  1AWW A;  1VYV A;  2NUZ A;  5IHI A;  3H0I A;  2C0O A;  4F14 A;  5FW9 A;  2ED1 A;  2X3X D;  4FSS A;  2SEM A;  1ZUU A;  1AWX A;  2RQR A;  4J9I A;  4J9F A;  1UTI A;  2YSQ A;  2CUD A;  3TSW A;  2LMJ A;  1X2K A;  2M51 A;  4HVV A;  2J6O A;  1QCF A;  2DL3 A;  1NYG A;  2YUP A;  4Z88 A;  2G6F X;  3FJ5 A;  3NHN A;  4LE9 A;  2YUQ A;  2KR3 A;  2DM1 A;  2ENM A;  4RTX A;  1YP5 A;  3GBQ A;  1UG1 A;  1QLY A;  2W10 A;  4CC4 B;  2DL8 A;  4D8K A;  1UHF A;  3M0T A;  2GQI A;  2KRO A;  2ABL A;  1AEY A;  4JPB W;  2EQI A;  1UJY A;  2KT8 A;  1TUD A;  1MV3 A;  1GBR A;  4R0K A;  1QWE A;  4ESR A;  1KSW A;  1PRL C;  4AG2 C;  2K2M A;  1VYT A;  1W6X A;  1J3T A;  1A0N B;  1V1C A;  1WI7 A;  1ZBJ A;  3KFV A;  2FPE A;  1PKT A;  1M3A A;  1W70 A;  2BZX A;  2GTO A;  4RTV A;  2FPD A;  2CH4 A;  2KXC A;  2JM8 A;  3CQT A;  1OPK A;  4OMQ A;  1AZG B;  2AK5 A;  2L0A A;  2AZV A;  4RUG A;  3NMZ C;  3JV3 A;  1VYU A;  1AWJ A;  2LJ1 A;  2KEA A;  2J06 A;  4M4Z A;  1CKB A;  2DL4 A;  2CDT A;  1BU1 A;  4RTZ A;  2A28 A;  2PZ1 A;  2KYB A;  1PHT A;  2LJ3 A;  2LQN A;  1HD3 A;  2RNA A;  1JQQ A;  1SSH A;  2LX7 A;  3I35 A;  4OMN A;  5IHK A;  2OAW A;  4CC3 A;  1M27 C;  1X69 A;  1NG2 A;  2JXB A;  5I22 A;  2DX1 A;  3EHQ A;  4F16 A;  1X6B A;  2JS0 A;  1ARK A;  2AKL A;  2RF0 A;  1SEM A;  1GFC A;  2CUB A;  1K76 A;  2L3Q A;  4Z8A A;  3VS2 A;  1YWP A;  3SHW A;  2I0N A;  2LP5 A;  2DIL A;  1T3L A;  1Z9Z A;  3I9Q A;  4E6R A;  3PVL A;  1MUZ A;  2FPF A;  1JO8 A;  3C0C A;  2K6D A;  1H3H A;  1EFN A;  4IIM A;  3M0Q A;  4AFZ C;  2W0Z A;  2JMA A;  4RTU A;  4IIO A;  1KIK A;  2VKN A;  1TG0 A;  2KBT A;  2L2P A;  2P4R A;  1SHF A;  2EVR A;  2NWM A;  2CT4 A;  2M0Y A;  1X2Q A;  2J05 A;  4GBQ A;  1T0H A;  3UAT A;  3ULR B;  1HJD A;  3H41 A;  1SHG A;  2K9G A;  3RNJ A;  1ABQ A;  1YWO A;  4KRT A;  1H92 A;  1S1N A;  2CH4 W;  1WFW A;  2RN8 A;  4AFQ C;  1RI9 A;  3PE0 A;  4RTT A;  4LUE A;  2DBK A;  1RUW A;  1WXU A;  2HCK A;  1T3S A;  3EG2 A;  5EC7 A;  2D8J A;  2MIO A;  3I5R A;  5GJW B;  2O88 A;  2AZS A;  2DE0 X;  2RMO A;  2J6K A;  2CT3 A;  2GTJ A;  4A63 B;  3R6N A;  3VS6 A;  1ABO A;  3PVQ A;  2PNI A;  2RQU A;  3VS0 A;  1QKW A;  3M0P A;  2VWF A;  2A37 A;  2LQW A;  1AVZ C;  5L23 A;  2K3B A;  1AOJ A;  4LUD A; 
#chains in the Genus database with same CATH topology
 3MP1 A;  1LOJ A;  4B9W A;  1NEB A;  2O4X A;  1YI2 A;  4DBF A;  1TTH B;  5KYY B;  1YN8 A;  2K2V A;  2XDB A;  2DYB A;  2KQW A;  3CCE T;  2EQU A;  2DBM A;  1PRM C;  3HRU A;  2CP7 A;  2VC8 A;  3CC4 Q;  2L5Q A;  3A5Z B;  1IHV A;  3CCE A;  5CR2 A;  1M8M A;  2P84 A;  3JB9 H;  1OPL A;  2R5A A;  4PNO A;  3A8L B;  2E12 A;  2QQS A;  2MAM A;  3VRZ A;  1IGQ A;  2DL7 A;  3N5B B;  2KT1 A;  1JXO A;  3QPH A;  4ATO A;  3CCJ T;  3D7S B;  4E2F B;  2VXE A;  2A3L A;  3ZEH A;  3JCM g;  4F7U A;  1YI2 Q;  4PFZ A;  3CCJ A;  2QQB A;  3L2V A;  5KYX A;  5LJ5 g;  3JCM c;  5GAM f;  2GFA A;  2R58 A;  4IUP A;  4ELY C;  2BZ8 A;  1H8K A;  3NFC A;  4ORZ A;  3CCE Q;  2H3E B;  1KQ2 A;  2PVG B;  2MCN A;  1Q81 U;  2DMO A;  1X6G A;  4M75 E;  4C5H A;  3QXE B;  2RQW A;  2QDY B;  2CZ0 B;  2OTJ T;  2F2V A;  1I4K 1;  1CKA A;  2Y90 A;  1D3B B;  3JSC A;  1MMD A;  2OJ2 A;  2OTJ A;  1X75 C;  2MYS A;  3MEU A;  1WJQ A;  4A4F A;  4A54 A;  5I2S A;  5IXF A;  1SRL A;  1M2O A;  3ZL7 C;  3NTI A;  3RES A;  4OMO A;  3CCJ Q;  5AYF A;  1TSF A;  2DLP A;  1ZA2 B;  1K9M R;  1RAH B;  4M77 A;  3X24 B;  4JJC A;  1K9A A;  1E6G A;  4BAC A;  4V2S A;  4AT1 B;  4LNP A;  4M78 C;  1VQK T;  3NGP A;  2LC4 A;  4C92 A;  4F7U F;  1Y07 A;  4PKC C;  1VQK A;  5GAN g;  3O8V A;  3JB9 D;  4PK4 A;  1RAI B;  3OYE A;  2ZPI B;  3QYH B;  3M5A A;  2OTJ Q;  4FW1 A;  3THK A;  1FYN A;  2CKK A;  3QHS A;  1XQH A;  2PVO B;  5IN1 A;  3OYH A;  5GAO r;  1S72 T;  1WLP B;  1KD1 U;  2DTH A;  1VOM A;  4O5V A;  1QVF A;  1AZE A;  4M7A E;  2DJQ A;  1S72 A;  4HCB A;  1G3Y A;  4J9B A;  3BE3 A;  1Y71 A;  4Z02 A;  3PT9 A;  2JJ9 A;  2RI3 A;  3KXT A;  3VS4 A;  2YUN A;  1VQK Q;  1GCQ A;  2JM9 A;  1FX7 A;  4CC7 A;  1SF9 A;  5LJ3 e;  1G83 A;  2ZZD A;  2SRC A;  4C5E A;  1M90 U;  3G6E T;  1BIA A;  2D0Q B;  1C6V X;  5CVI A;  1KC8 C;  2GCX A;  1KQS S;  2K5I A;  3G6E A;  3REB B;  1YHQ T;  1ACM B;  4Y92 A;  1HXD A;  1ZSZ A;  4J9E A;  2EIF A;  3CBO A;  4DEX A;  2QAS A;  5HK0 A;  4J6W A;  2CP3 A;  4J9C A;  3OW2 S;  3EG9 B;  8ATC B;  1VQ8 T;  3LH0 A;  2YHT A;  4AFU C;  2LCS A;  3TRE A;  3MP8 A;  5IH2 A;  3RMQ A;  2EYX A;  2NUP B;  1HK9 A;  1ZUY A;  1BK2 A;  5GAM h;  4J9G A;  1JXM A;  1AT1 B;  3FEO A;  2QQ9 A;  1QKX A;  1OV3 A;  4M7D E;  4LDV A;  2LCC A;  4C0D C;  1YJN A;  3UPU A;  4ANJ A;  4MML A;  3OB9 A;  1YJ9 T;  2V1R A;  1QVG S;  4BI4 A;  3CC2 A;  4FU6 A;  1YJ9 A;  2LJ0 A;  5GAO p;  2HMA A;  4MZM A;  4KUI A;  5GAN 5;  2VAS A;  3JCM b;  2JMC A;  2HL5 C;  3EGU A;  5FWC A;  1NM7 A;  2BUD A;  1IB8 A;  3EGD B;  3MP6 A;  4KH1 B;  4NL2 A;  5GAO l;  4ZGJ B;  3M4G A;  2O2O A;  2KGT A;  4RTW A;  1KK7 A;  2ZAE A;  2BTT A;  2K57 A;  1D0Y A;  1MV0 B;  1PD1 A;  1VYV A;  3P8D A;  2C0O A;  4F14 A;  4J5Y A;  1Q81 C;  1YJN Q;  4M75 G;  5FW9 A;  2JNG A;  2X3X D;  4N4G A;  2YSQ A;  3A8H B;  1X2K A;  5LJ5 j;  2DL3 A;  3OSS C;  1WHM A;  3PMI A;  3CC2 Q;  1YJ9 Q;  1PD0 A;  2KR3 A;  2ENM A;  3H8Z A;  1YP5 A;  1O9S A;  2HQX A;  1UG1 A;  4PJO D;  2DL8 A;  1M4Z A;  3CCQ T;  2KRO A;  4KGZ B;  2FL7 A;  2RHI A;  2EQI A;  3EH2 A;  1TUD A;  5KE3 A;  1BKB A;  4ESR A;  1KSW A;  2KAF A;  4C0D B;  1A0N B;  2DXT A;  1RAF B;  2FPE A;  1M3A A;  2GTO A;  4JRK A;  2KXC A;  1VQ7 A;  2LX9 A;  2PU9 B;  2L0A A;  4RUG A;  4C8Q F;  2X4W A;  4QQ6 A;  1U1S A;  1ZQ1 A;  4L5G A;  2J06 A;  4HKE A;  3JAM E;  1RAB B;  2IG0 A;  3SWN A;  5GMK m;  3L2Z A;  4RG8 A;  2E10 A;  4XTV A;  2RJE A;  3OQ5 A;  3V7R A;  1KD1 C;  1Q86 R;  2AIR B;  5GAN j;  1PHT A;  5KYW B;  4M7A G;  3VKI A;  3CD6 T;  4C0F A;  3HTR A;  3S3M A;  5I22 A;  3CD6 A;  2FZG B;  1NZ9 A;  1VQ7 Q;  3BFM A;  2VYT A;  1X6B A;  1ARK A;  2AKL A;  3SD4 A;  2DKG A;  3UT1 A;  2NYS A;  4WF2 A;  1M90 C;  5AT1 B;  2DXU A;  2VGM A;  3M9Q A;  5IT9 E;  2FHD A;  3SHW A;  5KYX B;  2I0N A;  3RIR A;  1T3L A;  1JBM A;  3UWN A;  3LGL A;  1MUZ A;  2QXF A;  5GAN 2;  1KQS A;  3C0C A;  4WTO B;  1H3H A;  4OGE A;  2XHC A;  3DLM A;  2W0Z A;  2DEQ A;  3GP8 A;  1VQ4 A;  5D7U A;  4IIO A;  2FB7 A;  4LD9 K;  1TG0 A;  2P4R A;  3CD6 Q;  3CMA Q;  3QZ9 B;  1MGQ A;  2QK0 A;  2J05 A;  3CCL T;  1HJD A;  5L8R E;  4F7U E;  4M7D G;  3H41 A;  1N6A A;  4XTW A;  3HFO A;  1VQO T;  1ABQ A;  2P4T A;  1BCM A;  4KRT A;  3WVD B;  3CCL A;  1S1N A;  1R0C B;  1BIB A;  2CH4 W;  4L6V 5;  3SB2 A;  1MMG A;  4E7I A;  4LUE A;  1WXU A;  6AT1 B;  2HCK A;  1T3S A;  4FT4 A;  3LW5 E;  3QDF A;  1VQP T;  2D8J A;  1BYM A;  2DE0 X;  2HAX A;  4DBR A;  1VQP A;  3R6N A;  3VS6 A;  3QYG B;  5GAM e;  1QKW A;  1VQ4 Q;  1QVG A;  1VQ6 T;  1AOJ A;  1JJ2 S;  1Q7Y R;  2DRM A;  1D09 B;  3H6Z A;  2RD1 A;  4WCI A;  3OYN A;  4PFP A;  3CME T;  5LJ5 e;  3OYF A;  4R55 A;  2JW4 A;  1I8F A;  3EFR A;  1WHH A;  2F5T X;  2OTL Q;  3CXC S;  3CME A;  3CCL Q;  5DY9 A;  1XOV A;  3P8H A;  4A53 A;  5A0D A;  4HT8 A;  5DLQ E;  1D0Z A;  1TXQ A;  1UGQ B;  2D9T A;  1GXI E;  1VQP Q;  3CEY A;  3UF4 A;  3WXM B;  3CCU T;  1R8O B;  4JS4 A;  4MZP A;  3LLR A;  3EGX A;  2DVJ A;  2L3P A;  3HRT A;  1TH7 A;  5ECA A;  3JB9 I;  2QDL A;  5KE2 A;  2RH2 A;  3A8O B;  2RB6 A;  3I55 T;  1D1A A;  1YIT A;  2JN0 A;  1B34 B;  2RHY A;  4JLG A;  4N4H A;  2M02 A;  2DA9 A;  2EKH A;  3I55 A;  2V8I A;  4HA8 A;  2L89 A;  1FXX A;  2HSE B;  4JZ4 A;  1U06 A;  4HCK A;  4M75 C;  2JTE A;  3OYY A;  1T0J A;  2XMF A;  3ER0 A;  2DRK A;  4D8D A;  1C1A A;  4ZNX A;  4QVZ A;  2HEQ A;  3O5Z A;  1N5Z A;  2GFU A;  3OS5 A;  4XTZ A;  1M1K U;  1W2B S;  7AT1 B;  4C0Z A;  2F2X A;  3CC4 T;  4PFO A;  1O75 A;  3PIP A;  2M9U A;  1YIT Q;  3A1P A;  3CC4 A;  1IRX A;  3I55 Q;  2J6F A;  4LN2 A;  1PKS A;  4M78 F;  2OI3 A;  2DF6 A;  2PUO B;  5I21 A;  1M1G A;  4X1V A;  3QDR B;  1WJR A;  3VRY A;  5IHN A;  3ZBD A;  1Y57 A;  3LYI A;  3PTA A;  1MND A;  3P8B B;  3LH5 A;  4JJB A;  3E19 A;  1NBE B;  2V8J A;  2YRV A;  4K11 A;  4BDY A;  3VYG A;  2YWW A;  1Y96 A;  5LJ3 d;  2HKQ B;  3V8K A;  1ZLM A;  2YUO A;  2PTK A;  1VQL T;  4F04 B;  3A98 A;  1PSF A;  2YT6 A;  3VV0 A;  2CS7 A;  1YCS B;  4ME7 A;  2KI7 A;  5KCO A;  3M4Y A;  3QSU A;  1VQL A;  2WSF E;  1MMA A;  1RLP C;  4JRI A;  4M7A C;  1NE8 A;  2LNH B;  4F7U G;  1G3W A;  3QJ6 A;  2QYZ A;  1R77 A;  3GNF B;  4FYY B;  2CYZ B;  4EMK A;  4M75 B;  5FWB A;  5GJV B;  5FRN A;  1QMC A;  3L2Q A;  3M58 A;  4C8Q E;  4JJN K;  1NYF A;  3JCM W;  5CKE A;  1XJW B;  2LRQ A;  3CCV T;  3HFN A;  1SG5 A;  2V26 A;  4GY5 A;  2H8H A;  1N9R A;  3JCM P;  1FWZ A;  3CCV A;  2LVM A;  4N0A C;  3SEM A;  4RG2 A;  1VQL Q;  1OX8 A;  1TS9 A;  4JRP A;  3V8J A;  3JCM f;  1E6H A;  1I1J A;  2DJZ A;  2RHU A;  2EQJ A;  2HZY A;  1D0X A;  3MEV A;  2EBP A;  5LJ5 f;  4EPC A;  3SWN B;  1JJ2 A;  4M77 G;  2J7I A;  2IIM A;  3C12 A;  2QG9 B;  4II1 A;  1UFF A;  2F1L A;  1HYO A;  2ROL A;  3NTH A;  4M7D C;  1M3B A;  2JT4 A;  3OYA A;  3QKJ A;  4C92 G;  1TUC A;  1SPK A;  4AFS C;  2DNU A;  3TCJ A;  1K73 R;  1Q7Y U;  2QTV A;  3H0F A;  4X9D A;  3DB3 A;  3CCV Q;  3M54 A;  4XQ3 A;  4A4H A;  5GAN 6;  1B3Q A;  3LWI A;  2HSP A;  5HKC A;  3M53 A;  4M7A B;  4XTU A;  1KHC A;  3MKD A;  4J6Y A;  2B8A A;  3X28 B;  2HD0 A;  2RK2 A;  1VQM T;  1FMW A;  2RQT A;  5IHI A;  3GNG A;  3RDV A;  2RA2 A;  1OZ3 A;  1QP2 A;  1VQM A;  4IUT A;  2F69 A;  1AWX A;  4J9F A;  3VYH B;  2C06 A;  2LMJ A;  4KUL A;  2J6O A;  2MWP A;  1NYG A;  4Z88 A;  1OQK A;  1F1B B;  2H3J A;  5GAN f;  4BDZ A;  3GBQ A;  4BE2 A;  5KYU B;  5HY6 A;  1TWB A;  4Q5W A;  1WJS A;  3TEE A;  4D8K A;  5KYN A;  2GQI A;  4FYV B;  2VB6 A;  4NL3 A;  1JRI A;  2P0Q A;  5FRM A;  3PNW C;  2KT8 A;  1W2B A;  4LD6 A;  1MV3 A;  1GBR A;  4R0K A;  1QWE A;  5GMK i;  1PRL C;  1Y7X A;  2X4Y A;  1VQM Q;  1W6X A;  4XU3 A;  1UGS B;  1J3T A;  1V1C A;  1ZBJ A;  3M59 A;  4E7J A;  5D6Y A;  3JB9 F;  1W70 A;  2FPD A;  4M7D B;  1Q86 C;  2JM8 A;  4OGC A;  1OPK A;  3KBG A;  1UB4 A;  2CP0 A;  1AZG B;  2XDD A;  1FMV A;  2Y4Y A;  1VYU A;  5GMK j;  1AWJ A;  5GAO n;  2LJ1 A;  2KVQ G;  3E9F A;  2DET A;  2KMT A;  2O01 E;  4JDS A;  2DTO A;  2A28 A;  2PZ1 A;  2MF2 A;  4FSX A;  2KYB A;  3OS1 A;  4OF1 A;  1I5L A;  1HD3 A;  2RNA A;  1PG5 B;  1JQQ A;  1IRE B;  1ZHI A;  2XID A;  3JB9 J;  5IHK A;  1YJN T;  9ATC B;  2OAW A;  4QVD A;  4CC3 A;  4LDX A;  1M27 C;  4DQ2 A;  5D6X A;  2DIG A;  3CCS A;  4O6J A;  1RI0 A;  3M56 A;  3HPW A;  4LDW A;  3GOX A;  5CKB A;  3JCM h;  2A0F B;  4F16 A;  1TUG B;  3CCR T;  3CC2 T;  2OX7 A;  2RF0 A;  3X25 B;  2CUB A;  5LJ5 h;  1G3T A;  1V29 B;  4ZN1 A;  3CCR A;  4LXC A;  2RHX A;  3VS2 A;  1PC0 A;  4FW2 A;  3A8M B;  2DIL A;  1Z9Z A;  3MEA A;  4J7I A;  4E6R A;  2K3Y A;  1EFN A;  2ZPH B;  4AFZ C;  3FJP A;  3RR6 A;  4C8Q A;  3M55 A;  4BB7 A;  2VKN A;  3OMC A;  4P5N A;  1QW1 A;  4X34 A;  3CCS Q;  3SDZ A;  4Y91 A;  2EVR A;  4MDX A;  1LVK A;  1X2Q A;  5GAM d;  4M78 E;  4PJO A;  3EFO A;  1T0H A;  4XK8 E;  1M2V A;  1SHG A;  4PJM A;  2K9G A;  1B7T A;  2RO0 A;  3FB9 A;  4TVR A;  2X9H A;  2XDP A;  3CCR Q;  1WFW A;  4QKU A;  4N4I A;  2DBK A;  5J26 A;  4PJN A;  3UDC A;  3VUZ A;  2DEU A;  1NJI R;  3I5R A;  2COZ A;  2AZS A;  1Q7Y C;  2PNI A;  5GAN h;  2RQU A;  3VS0 A;  2DZ9 A;  2EFI A;  3HRS A;  2VWF A;  3PGG A;  3L2U A;  5L23 A;  2E5Q A;  1WHG A;  2K3B A;  4LUD A;  2LT4 A;  3EFS A;  1QWF A;  4YTL A;  3INZ A;  1PSE A;  1VQ7 T;  1GFD A;  2E6N A;  1M1K R;  2DTI A;  2BE9 B;  4OML A;  1NLO C;  1K73 U;  2CSQ A;  1VA7 A;  1ZSG A;  4BY6 C;  3PMT A;  2K7A A;  3CPW P;  2VGN A;  1PNJ A;  2O4X B;  4E7Z A;  1QP3 A;  1K1Z A;  4J9D A;  1MMN A;  1H64 1;  1WXT A;  4M75 D;  3EG3 A;  4M77 C;  4XU1 A;  4PJO F;  1GBQ A;  3GPL A;  2B86 A;  1G2B A;  2XK0 A;  2ROT A;  3HHT B;  4C92 C;  3JCM X;  5DM7 R;  3L1A A;  2EW3 A;  3CMA T;  3DLL A;  2DER A;  5GAN 8;  2EGA A;  3CPF A;  2EAY A;  3CMA A;  3TSZ A;  2LNV A;  4PLL A;  4EIK A;  2E41 A;  1D3B A;  4IUQ A;  2FYK A;  3C4S A;  4F7U B;  2GBQ A;  3F70 A;  2BIV A;  2DD5 A;  3OYL A;  1SKU B;  2Z0W A;  3S3O A;  2CP5 A;  5LJ3 g;  3OYJ A;  4XAX B;  2ZPE B;  2FRY A;  3CC7 A;  2VVK A;  2YLC A;  4IUU A;  3QUI A;  2AKK A;  1YBY A;  2QQR A;  2JOY A;  2XD0 A;  3OYI A;  1VQ4 T;  2LTO A;  5KCH A;  2MK5 A;  1X43 A;  1U8R A;  1H3Z A;  2CSI A;  4EDU A;  1I81 A;  1WIE A;  3PIO A;  4CC2 A;  1NPR A;  2L3S A;  3GLX A;  1MHN A;  4LDU A;  1GCQ C;  2LQK A;  4IUR A;  2HL3 A;  1YNZ A;  2M16 A;  2AT1 B;  2V1Q A;  3OW2 A;  1UGR B;  1OOT A;  2IPO B;  2BKD N;  3X20 B;  2OTL T;  1ZX6 A;  1NPP A;  5CCA A;  4M7A D;  4BY6 B;  3MET A;  2OTL A;  4QT7 A;  1JEG A;  2KK4 A;  1QCO A;  1ZSZ C;  2HKN A;  1WX6 A;  2EGC A;  4MZT A;  1E7O A;  5EG2 A;  1KFZ A;  3CC7 Q;  5C0M A;  4M77 B;  2LT1 A;  2O9V A;  2QGG A;  4A4K A;  2D0N A;  1X6O A;  2LQ8 A;  2RQV A;  3OYC A;  4C92 B;  1LJO A;  2D6F A;  1AD5 A;  4OP0 A;  1SRM A;  3VS5 A;  4QQG A;  2DXC A;  4HT9 A;  2LZ6 B;  2KRS A;  3JCM e;  3E9G A;  1XTD A;  3J80 E;  2K3X A;  4KT0 E;  2JS2 A;  4XU2 A;  2YDL A;  4Z89 A;  2X4X A;  2D8H A;  4LDY A;  2RPN A;  1I5O B;  1BI2 A;  3DB4 A;  2QI2 A;  1AWO A;  2NUT A;  4GLM A;  2YLB A;  4JRQ A;  3RUX A;  2EYY A;  1PCX A;  3EAE A;  4BI8 B;  2CRE A;  2E70 A;  4PL6 A;  3G7Z A;  2X3W D;  3HKS A;  3VS3 A;  2KXD A;  3EG9 A;  4HVU A;  1YJW Q;  4M7D D;  2RJD A;  2FZC B;  2YRC A;  4C5G A;  4QW2 A;  2CZ6 B;  2QEX A;  5HK3 A;  2WSC E;  4XU0 A;  2JVV A;  4M78 A;  2D1X A;  1WXB A;  1NLP C;  4KGV B;  1JJ2 P;  1YIT T;  4L59 A;  5CO7 A;  3QII A;  4RTY A;  5FU6 C;  1IO6 A;  1UEB A;  2HBP A;  1V76 A;  1KJW A;  4E47 A;  2KYM A;  1RLQ C;  1ZSZ B;  1NJI U;  1K73 C;  3FLG A;  4AG1 C;  5HCK A;  1Z9Q A;  3QWX X;  4GLK A;  3OS2 A;  1ZBX A;  2KDS A;  1U1T A;  4HCZ A;  3BY7 A;  5GAN e;  2E4H A;  2K79 A;  1OZ2 A;  3LGF A;  3EG0 A;  3MEW A;  3EGD A;  2QEX Q;  2F2W A;  2V8K A;  4DBH A;  1WZO A;  2FG0 A;  1W1F A;  3H0H A;  3VUB A;  1M30 A;  1M3C A;  1QQJ A;  2ESW A;  4DBQ A;  1W4S A;  5GAN 7;  4ZTF A;  2A7Y A;  2KRM A;  1UEC A;  3VU3 C;  3TQ7 P;  3NTK A;  2COW A;  1UUE A;  5IXB A;  2NUZ A;  1N8R R;  3SWN C;  1QVF P;  2ED1 A;  1ZUU A;  1UTI A;  2VUB A;  2QGF B;  2M51 A;  2E6Z A;  3MPU B;  2RK1 A;  4C8Q B;  3X26 B;  3H9N A;  2YXY A;  2EWN A;  1XNI A;  2G6F X;  3NHN A;  1KC8 U;  2JZ2 A;  2M1H A;  5FU6 B;  3QJY A;  5LJ3 j;  3WVE B;  1VQ9 T;  3RKW A;  1K8A U;  3G4S A;  4A4E A;  4J83 A;  2EJF A;  1VQ5 T;  1VQ9 A;  3QZ5 B;  1UJY A;  4CI0 C;  4AG2 C;  2K2M A;  2K5L A;  1VQ5 A;  4A4G A;  1VYT A;  5M9O A;  3I56 T;  4ZGE B;  3BDL A;  1PKT A;  2BZX A;  4PLI A;  2DIQ A;  2CH4 A;  4RTV A;  2MPX C;  3I56 A;  3HSB A;  3EH1 A;  1YCY A;  2AK5 A;  2AZV A;  5KYW A;  2AHJ B;  1M1F A;  4FYX B;  4PJO E;  2LDM A;  1M9S A;  4ZN3 A;  4M4Z A;  4ZTJ A;  2DL4 A;  3V7C A;  1BU1 A;  5I2M A;  3QO3 A;  5GAM g;  3S3N A;  3M57 A;  1QCN A;  3G4S Q;  3G1J A;  1VQ9 Q;  2E3H A;  3G71 T;  4X9C A;  3I35 A;  1SSH A;  2LX7 A;  4OMN A;  5GAO m;  2YRD A;  1VQ5 Q;  3G71 A;  2KY9 A;  3C94 A;  1NG2 A;  2DD4 A;  3EHQ A;  1N27 A;  3JB9 G;  2QQA A;  3AHU A;  8AT1 B;  3I56 Q;  4DOV A;  2JUF A;  4XTY A;  3CXC A;  2QA4 T;  1SEM A;  1K76 A;  5D6W A;  3E2U A;  4EMH A;  4Z8A A;  2QA4 A;  1D1B A;  1YWP A;  3PFS A;  2OAU A;  2R57 A;  1WPY A;  1G3S A;  1Q82 U;  3OSV A;  2E3I A;  1JO8 A;  2GQV A;  2K6D A;  1YFN A;  4IIM A;  5CIU A;  1G8X A;  1LPL A;  4BE0 A;  5J39 A;  3FC3 A;  4RMO A;  1KIK A;  3G71 Q;  1WHJ A;  2HQE A;  5FLX E;  2CZ7 B;  1NJI C;  1SHF A;  2NWM A;  2CT4 A;  2M0Y A;  3OY9 A;  2KSS A;  1QVP A;  3UAT A;  4FL6 A;  1YWO A;  1H92 A;  4KUD K;  2QA4 Q;  2RN8 A;  4AFQ C;  3PE0 A;  4RTT A;  5GMK h;  1RUW A;  4M77 D;  4BE1 A;  5A0L A;  1MNE A;  2MIO A;  5GJW B;  1WGS A;  1M1K C;  2J6K A;  3KUF A;  4C92 D;  2A37 A;  2LQW A;  4BD3 A;  4HXJ A;  3L42 A;  4XTX A;  2XKO C;  2P0P A;  2FZK B;  4DOW A;  1Q95 G;  2DL5 A;  4FIB A;  3UA7 A;  3CBM A;  3UA6 A;  2KRN A;  5CAI A;  4OB1 B;  3L2R A;  1KG1 A;  3U23 A;  4OB3 B;  4HVW A;  4JZ3 A;  1GL5 A;  4M77 F;  3TVT A;  2C0T A;  4JJD A;  2EGE A;  3REA B;  1U3O A;  4Y28 E;  1B34 A;  2IVW A;  1VQN T;  4J9H A;  2NUT B;  1N8R U;  3OYG A;  3MCA B;  4C92 F;  3CCS T;  1IXD A;  1K8A C;  1VQN A;  2DAQ A;  1YHQ A;  2EKO A;  3QBY A;  2FEI A;  2EYW A;  2XIC A;  3QWY A;  2EQM A;  2CGH A;  4VUB A;  1BBZ A;  2E5K A;  5A0G A;  1X27 A;  3M0U A;  3VJP A;  4D6W A;  1S72 Q;  2ZPB B;  1KQS P;  2HQH A;  1RAE B;  1OEB A;  4C5I A;  3J81 E;  3OS0 A;  2M0O A;  4AMC A;  4EMG A;  1VQ8 A;  4M78 B;  1WYX A;  4C8Q G;  2X4J A;  1BI3 A;  4B9X A;  3EGX B;  1IGU A;  1JU5 C;  2HBW A;  3EHR A;  3ME9 A;  3OW2 P;  2MI6 A;  3JCM V;  4PJO G;  2P0K A;  3FIF A;  5FRO A;  1TOV A;  4F17 A;  2ZGW A;  2DFU A;  3G6E Q;  1YIJ T;  2FO0 A;  1I07 A;  4IUV A;  2MWO A;  1VQN Q;  2L3R A;  1YHQ Q;  1RAA B;  1YIJ A;  1WA7 A;  4EMK C;  3M0R A;  2BZY A;  3OMG A;  1UDL A;  3OBW A;  3M0S A;  2NLU A;  4C0G A;  2EYZ A;  3CBP A;  1D1C A;  3VS1 A;  3MJX A;  2GGR A;  4B6M A;  2X35 A;  2X51 A;  4R56 A;  1QVG P;  1VQ8 Q;  1WNL A;  5GAM j;  1M8V A;  1PWT A;  2VXF A;  2KNB B;  3JCM d;  4FT2 A;  1PM3 A;  3CCM T;  2A08 A;  1UHC A;  5LJ5 d;  3JCM Q;  2O31 A;  2WSE E;  3CCM A;  3FDR A;  4OMP A;  2GNC A;  3RBB B;  5KYY A;  2XI9 A;  5GAO q;  4OB0 B;  4C8Q D;  4QQD A;  3HP9 A;  1P92 A;  2EPD A;  4KGX B;  3RKY A;  1Q82 C;  1WQ7 A;  2E65 A;  4RCC A;  3CPW S;  1YIJ Q;  3FRN A;  2DK3 A;  2MOX A;  2ZCF B;  5I11 A;  4JUV A;  4M75 A;  3IQL A;  5GAN 4;  1KQ1 A;  1ZUK A;  3QG1 A;  4OMM A;  1WQW A;  1Y96 B;  3CCQ A;  1WHK A;  1K4U S;  3CCM Q;  1NEG A;  3ZFJ A;  1HSQ A;  1WDX A;  2ED0 A;  2XG8 D;  2MMP A;  2RJC A;  1K9M U;  2ECZ A;  3JCM J;  3V7S A;  2RI5 A;  2FRW A;  4EMK B;  1R0B G;  5GAN d;  3VS7 A;  2A36 A;  1EZZ B;  3L2W A;  2PUK B;  1OYX A;  1KC8 R;  2KE9 A;  4J8O A;  2DYI A;  4PJJ A;  2DPP B;  2JTF A;  2L8D A;  1UGV A;  4MDW A;  1Y0M A;  5GMK e;  4OB2 B;  3CC7 T;  3CCQ Q;  3T9N A;  1K8A R;  2QAZ A;  3RER A;  3HL8 A;  5J3B A;  1SSF A;  2C0I A;  1B07 A;  4DEY A;  1OU9 A;  4FM4 B;  4M75 F;  5CQX A;  1LNX A;  2VV5 A;  1FMK A;  3EG1 A;  2G3R A;  1KHI A;  2HDA A;  1UJ0 A;  1U5S A;  3R6O A;  2ZPF B;  1BB9 A;  4J7F A;  1UE9 A;  4M7A A;  2O9S A;  5LJ3 f;  2HNI A;  4MMK A;  3RKX A;  4DA4 A;  1GRI A;  1N8R C;  2CP2 A;  1EIF A;  1OUL A;  1K0S A;  2RHZ A;  1VIF A;  4BI3 A;  3OA6 A;  1CSK A;  3J7A F;  1LCK A;  3I5S A;  3NPF A;  3TU4 K;  3E1S A;  3OBY A;  1I0C A;  3MHX A;  1K0X A;  3SFM A;  3OYM A;  4BUG A;  1GCP A;  2ATC B;  2XU8 A;  2COY A;  2FVU A;  1AWW A;  1EX4 A;  3H0I A;  3BDU A;  4JLI A;  4HCC A;  3OYK A;  1RAC B;  1YJW T;  2RI2 A;  2E64 A;  5KYU A;  3S6W A;  4FSS A;  2SEM A;  4NOY A;  1OU8 A;  2DVE A;  2GF7 A;  2RQR A;  2CP6 A;  4J9I A;  1YJW A;  4N0A A;  2CUD A;  4HVV A;  5KH6 A;  1QCF A;  2YUP A;  4IKF A;  3GIB A;  3FJ5 A;  4LE9 A;  2YUQ A;  5CKF A;  2DM1 A;  1VQO A;  4RTX A;  1Q81 R;  4RKU E;  3GF5 A;  3C95 A;  1QLY A;  2W10 A;  3Q1J A;  4CC4 B;  1RL2 A;  5FU7 C;  2EQK A;  1UHF A;  1UGP B;  3M0T A;  5IAY A;  1RAD B;  2CZ1 B;  2ABL A;  1AEY A;  4M7D A;  1WHL A;  4M78 G;  1Q82 R;  4JPB W;  4M7A F;  2F5K A;  1VIE A;  1C0M A;  4KH0 B;  2ZPG B;  4ZGD B;  2R5M A;  1BCO A;  1VQ6 A;  4OMF B;  5CKD A;  1WI7 A;  3KFV A;  5GAN 3;  2QEX T;  4RCB A;  1G5V A;  3CQT A;  4OMQ A;  4C8Q C;  4FCY A;  3NMZ C;  4M77 E;  3JV3 A;  2NUP A;  1VQO Q;  2DXB A;  2KEA A;  1CKB A;  5A2Q E;  2CDT A;  4NS5 A;  4PJO C;  4RTZ A;  4C92 E;  1BI1 A;  3CXC P;  2EJ9 A;  4JS5 A;  2LJ3 A;  3OYB A;  2LQN A;  3RMS A;  1TU0 B;  3DKM A;  1VUB A;  2LCL A;  3CCU A;  3BW1 A;  3CPW A;  2EYQ A;  4KBM B;  2BE7 D;  2Y4X A;  4QVC A;  4E7K A;  1VQ6 Q;  1X69 A;  2PQW A;  2JXB A;  2DX1 A;  1M5Q 1;  3AT1 B;  1OX9 A;  2E1H A;  2RJF A;  4E7S A;  1KD1 R;  1JB0 E;  1IZ6 A;  2JS0 A;  2K4Y A;  4M78 D;  3LX7 A;  2DO3 A;  1X01 A;  1GFC A;  3CME Q;  4M7D F;  2EJG A;  2L3Q A;  4CRI A;  1DJ7 B;  5GMK l;  4PJL A;  2LP5 A;  1K9M C;  1ZA1 B;  3I9Q A;  3JRZ A;  4OVA A;  3PVL A;  5FU7 B;  4J6X A;  1QVF S;  2FPF A;  5LJ3 h;  3MO8 A;  3M0Q A;  1N9S A;  2WAC A;  1M90 R;  3CCU Q;  2JMA A;  1AHJ B;  1BI0 A;  2RM4 A;  4RTU A;  4ELZ C;  4FYW B;  1OI1 A;  4E7H A;  2KBT A;  2L2P A;  4GBQ A;  4E7L A;  3ULR B;  5C6S A;  2K5F A;  3LWH A;  3RNJ A;  1W2B P;  3V8L A;  4UC4 A;  2PVD B;  1RI9 A;  3OYD A;  3URG A;  3A8G B;  5CKH A;  5EC7 A;  3EG2 A;  1Q86 U;  5CQY A;  4PJO B;  3EFO B;  3G4S T;  2O88 A;  2JTM A;  2RMO A;  1RAG B;  2I2L A;  2CT3 A;  1M2V B;  2GTJ A;  4A63 B;  1IHW A;  1ABO A;  3PVQ A;  2QTX A;  5DLO A;  3ASK A;  5LL6 S;  3M0P A;  1YI2 T;  1AVZ C;  5CK9 A;  2DZC A;  3TSW A; 
#chains in the Genus database with same CATH homology
 4HXJ A;  1QWF A;  1NEB A;  1GFD A;  1YN8 A;  2DRM A;  2DYB A;  4OML A;  1NLO C;  4WCI A;  2DBM A;  2DL5 A;  1PRM C;  3UA7 A;  2JW4 A;  3UA6 A;  2CSQ A;  2KRN A;  3U23 A;  1VA7 A;  1ZSG A;  1M8M A;  2K7A A;  1PNJ A;  1XOV A;  4HVW A;  1OPL A;  1K1Z A;  4JZ3 A;  4J9D A;  1GL5 A;  1WXT A;  3EG3 A;  3VRZ A;  3TVT A;  2C0T A;  4JJD A;  2EGE A;  1GBQ A;  2DL7 A;  2B86 A;  1G2B A;  3UF4 A;  3REA B;  2ROT A;  1U3O A;  2KT1 A;  1JXO A;  4J9H A;  2EW3 A;  2DVJ A;  2L3P A;  2EGA A;  2FEI A;  2EYW A;  5ECA A;  3QWY A;  2QDL A;  1BBZ A;  2E5K A;  1X27 A;  3M0U A;  3TSZ A;  2BZ8 A;  1H8K A;  4EIK A;  1OEB A;  4ORZ A;  2DA9 A;  2EKH A;  1WYX A;  2MCN A;  2DMO A;  1JU5 C;  2GBQ A;  2HBW A;  1X6G A;  3EHR A;  2RQW A;  4JZ4 A;  1U06 A;  2FRY A;  2VVK A;  4HCK A;  2F2V A;  2AKK A;  1CKA A;  2JTE A;  4F17 A;  1T0J A;  2XMF A;  2OJ2 A;  2DRK A;  4D8D A;  1X43 A;  4ZNX A;  2CSI A;  2FO0 A;  2HEQ A;  3O5Z A;  1I07 A;  1N5Z A;  1WIE A;  5IXF A;  1SRL A;  4CC2 A;  2L3S A;  1GCQ C;  3ZL7 C;  4OMO A;  1WA7 A;  1YNZ A;  2DLP A;  3M0R A;  2BZY A;  2F2X A;  2V1Q A;  1UDL A;  3M0S A;  1OOT A;  2EYZ A;  4JJC A;  3VS1 A;  2GGR A;  1K9A A;  1E6G A;  1ZX6 A;  4LNP A;  4QT7 A;  1JEG A;  2J6F A;  4LN2 A;  3NGP A;  1PKS A;  2OI3 A;  1PWT A;  2KNB B;  2DF6 A;  1WX6 A;  2EGC A;  1E7O A;  4X1V A;  1KFZ A;  3VRY A;  5IHN A;  1Y57 A;  2A08 A;  1UHC A;  2O31 A;  2O9V A;  4OMP A;  2GNC A;  3LH5 A;  3RBB B;  4JJB A;  2D0N A;  2RQV A;  3THK A;  2EPD A;  1AD5 A;  4K11 A;  1SRM A;  1FYN A;  3VS5 A;  1WLP B;  2LZ6 B;  1ZLM A;  2KRS A;  2MOX A;  2YUO A;  2PTK A;  5I11 A;  1AZE A;  3A98 A;  2YT6 A;  2DJQ A;  1YCS B;  3IQL A;  2JS2 A;  4J9B A;  2YDL A;  4Z89 A;  2D8H A;  1ZUK A;  4OMM A;  2RPN A;  1RLP C;  2LNH B;  1AWO A;  4GLM A;  3VS4 A;  2YUN A;  1GCQ A;  2JM9 A;  2EYY A;  2CRE A;  4CC7 A;  5FWB A;  5GJV B;  2X3W D;  1G83 A;  1K4U S;  2SRC A;  3VS3 A;  1NEG A;  1HSQ A;  2KXD A;  1WDX A;  2ED0 A;  4HVU A;  1NYF A;  3REB B;  2ECZ A;  2D1X A;  4Y92 A;  1WXB A;  1NLP C;  2FRW A;  4J9E A;  2H8H A;  4DEX A;  3VS7 A;  2A36 A;  4J9C A;  4RTY A;  1IO6 A;  1KJW A;  4AFU C;  2KE9 A;  3SEM A;  2LCS A;  2KYM A;  1UGV A;  1Y0M A;  5IH2 A;  2EYX A;  1RLQ C;  1ZUY A;  1E6H A;  1BK2 A;  1I1J A;  4J9G A;  1JXM A;  4AG1 C;  5HCK A;  2EBP A;  1Z9Q A;  3QWX X;  1QKX A;  1OV3 A;  2C0I A;  1B07 A;  2J7I A;  2IIM A;  4DEY A;  2K79 A;  1FMK A;  1UFF A;  3EG1 A;  2ROL A;  3EG0 A;  1M3B A;  2JT4 A;  2HDA A;  1UJ0 A;  1U5S A;  2F2W A;  2V1R A;  2FG0 A;  1BB9 A;  1SPK A;  1TUC A;  4AFS C;  1UE9 A;  2DNU A;  1W1F A;  3H0H A;  2O9S A;  1M30 A;  3H0F A;  2LJ0 A;  1GRI A;  1M3C A;  2ESW A;  1K0S A;  2JMC A;  3EGU A;  5FWC A;  1B3Q A;  1NM7 A;  1CSK A;  2HSP A;  1LCK A;  3I5S A;  3NPF A;  2KRM A;  1I0C A;  1UEC A;  2O2O A;  1K0X A;  2KGT A;  4RTW A;  1GCP A;  2BTT A;  1UUE A;  2RQT A;  1MV0 B;  5IXB A;  1AWW A;  1VYV A;  2NUZ A;  5IHI A;  3H0I A;  2C0O A;  4F14 A;  5FW9 A;  2ED1 A;  2X3X D;  4FSS A;  2SEM A;  1ZUU A;  1AWX A;  2RQR A;  4J9I A;  4J9F A;  1UTI A;  2YSQ A;  2CUD A;  3TSW A;  2LMJ A;  1X2K A;  2M51 A;  4HVV A;  2J6O A;  1QCF A;  2DL3 A;  1NYG A;  2YUP A;  4Z88 A;  2G6F X;  3FJ5 A;  3NHN A;  4LE9 A;  2YUQ A;  2KR3 A;  2DM1 A;  2ENM A;  4RTX A;  1YP5 A;  3GBQ A;  1UG1 A;  1QLY A;  2W10 A;  4CC4 B;  2DL8 A;  4D8K A;  1UHF A;  3M0T A;  2GQI A;  2KRO A;  2ABL A;  1AEY A;  4JPB W;  2EQI A;  1UJY A;  2KT8 A;  1TUD A;  1MV3 A;  1GBR A;  4R0K A;  1QWE A;  4ESR A;  1KSW A;  1PRL C;  4AG2 C;  2K2M A;  1VYT A;  1W6X A;  1J3T A;  1A0N B;  1V1C A;  1WI7 A;  1ZBJ A;  3KFV A;  2FPE A;  1PKT A;  1M3A A;  1W70 A;  2BZX A;  2GTO A;  4RTV A;  2FPD A;  2CH4 A;  2KXC A;  2JM8 A;  3CQT A;  1OPK A;  4OMQ A;  1AZG B;  2AK5 A;  2L0A A;  2AZV A;  4RUG A;  3NMZ C;  3JV3 A;  1VYU A;  1AWJ A;  2LJ1 A;  2KEA A;  2J06 A;  4M4Z A;  1CKB A;  2DL4 A;  2CDT A;  1BU1 A;  4RTZ A;  2A28 A;  2PZ1 A;  2KYB A;  1PHT A;  2LJ3 A;  2LQN A;  1HD3 A;  2RNA A;  1JQQ A;  1SSH A;  2LX7 A;  3I35 A;  4OMN A;  5IHK A;  2OAW A;  4CC3 A;  1M27 C;  1X69 A;  1NG2 A;  2JXB A;  5I22 A;  2DX1 A;  3EHQ A;  4F16 A;  1X6B A;  2JS0 A;  1ARK A;  2AKL A;  2RF0 A;  1SEM A;  1GFC A;  2CUB A;  1K76 A;  2L3Q A;  4Z8A A;  3VS2 A;  1YWP A;  3SHW A;  2I0N A;  2LP5 A;  2DIL A;  1T3L A;  1Z9Z A;  3I9Q A;  4E6R A;  3PVL A;  1MUZ A;  2FPF A;  1JO8 A;  3C0C A;  2K6D A;  1H3H A;  1EFN A;  4IIM A;  3M0Q A;  4AFZ C;  2W0Z A;  2JMA A;  4RTU A;  4IIO A;  1KIK A;  2VKN A;  1TG0 A;  2KBT A;  2L2P A;  2P4R A;  1SHF A;  2EVR A;  2NWM A;  2CT4 A;  2M0Y A;  1X2Q A;  2J05 A;  4GBQ A;  1T0H A;  3UAT A;  3ULR B;  1HJD A;  3H41 A;  1SHG A;  2K9G A;  3RNJ A;  1ABQ A;  1YWO A;  4KRT A;  1H92 A;  1S1N A;  2CH4 W;  1WFW A;  2RN8 A;  4AFQ C;  1RI9 A;  3PE0 A;  4RTT A;  4LUE A;  2DBK A;  1RUW A;  1WXU A;  2HCK A;  1T3S A;  3EG2 A;  5EC7 A;  2D8J A;  2MIO A;  3I5R A;  5GJW B;  2O88 A;  2AZS A;  2DE0 X;  2RMO A;  2J6K A;  2CT3 A;  2GTJ A;  4A63 B;  3R6N A;  3VS6 A;  1ABO A;  3PVQ A;  2PNI A;  2RQU A;  3VS0 A;  1QKW A;  3M0P A;  2VWF A;  2A37 A;  2LQW A;  1AVZ C;  5L23 A;  2K3B A;  1AOJ A;  4LUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...