1RLPC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
molecule tags Complex (signal transduction/peptide)
source organism Gallus gallus
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1rlpC00
2W10A 2DM1A 2J6KA 4RTVA 1X69A 2C0IA 1X2QA 1VYVA 1ZSGA 2DBKA 4RTUA 2JW4A 1T3LA 3UF4A 2GQIA 2D8HA 4Z88A 4DEXA 2DL3A 4LN2A 2A36A 2DMOA 1M30A 1VA7A 1TG0A 3H0HA 2CUDA 2ROLA 4RTYA 1KJWA 1OPLA 1EFNA 2ABLA 3TSWA 1GBQA 4Z8AA 1U5SA 1T3SA 2RQRA 3IQLA 2YUPA 3CQTA 3VS6A 1WA7A 4JJBA 2YT6A 2SRCA 4J9DA 1X27A 1X6BA 2JS0A 2D8JA 2GTOA 1X2KA 2EVRA 2O31A 4K11A 1RUWA 1ABOA 2FEIA 4FSSA 2A08A 5I22A 5IHIA 4CC4B 1ZUKA 3QWXX 3H0FA 1T0HA 4HVWA 1MUZA 1FYNA 3EG3A 4JPBW 2DE0X 1YNZA 2HCKA 2L2PA 1K0SA 1GCQA 1AOJA 2XMFA 2KXCA 2RPNA 4R0KA 2LP5A 1W1FA 2L3PA 1YWOA 2KRMA 1CSKA 2JTEA 1BK2A 2EBPA 1A0NB 1WXBA 4RTZA 3UA7A 4M4ZA 1PRLC 2DILA 2DF6A 2VVKA 1QKXA 3H41A 2AKLA 2AZSA 1PRMC 1G2BA 1X43A 4Y92A 2LJ1A 2MIOA 4IIOA 2KT1A 1M3CA 1PNJA 2AKKA 2JT4A 2YUQA 2O88A 1OV3A 2QDLA 3JV3A 2DL4A 2KGTA 4Z89A 2PTKA 2MOXA 4OMOA 2C0OA 2EYXA 4AFUC 2C0TA 1HD3A 1G83A 2F2XA 4DEYA 2JXBA 2ENMA 2LZ6B 1AWWA 1HJDA 2HEQA 2KYMA 1AWJA 2SEMA 4QT7A 3NHNA 2FRYA 1ZLMA 3A98A 2FPEA 2J6FA 1MV3A 4GBQA 1ARKA 4AFZC 5EC7A 3SEMA 1WIEA 1ZBJA 2RN8A 2RQUA 1WYXA 2DL8A 5ECAA 3VRZA 4AFQC 2FPDA 2ECZA 1BB9A 2MCNA 4KRTA 5FW9A 1BU1A 2CSQA 3H0IA 3NGPA 2BZXA 4RTTA 1WI7A 1GCPA 2L0AA 4AFSC 1ZX6A 3NPFA 1I07A 2DJQA 2D1XA 3EGUA 1Y0MA 1W70A 1NYFA 1VYTA 2BZ8A 4JJDA 4OMPA 2JMCA 1SHGA 5FWCA 3I5RA 2O9VA 2E5KA 2LQNA 2KRNA 1H92A 2EGEA 1U06A 1Z9ZA 3EG1A 2K9GA 1QWEA 3I35A 3EG0A 2CH4W 1Y57A 3NMZC 4J9IA 3GBQA 1ABQA 1UTIA 2LQWA 2RQTA 1RLQC 2RMOA 1PWTA 2EKHA 3PVLA 3EHRA 1QCFA 1M27C 2A28A 2YSQA 1T0JA 1GL5A 4RTWA 1M3AA 1KSWA 2JM9A 1IO6A 2DVJA 2DLPA 2RF0A 1SPKA 1NEBA 1AEYA 3M0UA 3VS5A 3QWYA 4HVUA 4X1VA 2LMJA 2BTTA 2FG0A 4F14A 2M0YA 2PZ1A 1UHCA 1U3OA 4LNPA 2JM8A 1PKTA 3M0RA 4JZ4A 4OMMA 3KFVA 2CSIA 2CDTA 2RNAA 4J9GA 3REAB 4OMNA 2KXDA 5L23A 2L3QA 3TVTA 2ESWA 4J9CA 2DL5A 3UATA 1UJ0A 1QLYA 2EGCA 5HCKA 2EQIA 2K79A 2OJ2A 2EYZA 1WDXA 1AZEA 5FWBA 3RNJA 2F2VA 1E6HA 2GTJA 2F2WA 1Z9QA 4JJCA 2O2OA 3R6NA 1X6GA 2LJ0A 4HCKA 1PHTA 2LJ3A 2X3XD 3U23A 4J9HA 1YN8A 2CH4A 5GJVB 1RLPC 2PNIA 3VS2A 1SRLA 1BBZA 2VWFA 1ZUUA 3VS4A 1NM7A 1AD5A 4LUEA 2O9SA 3EHQA 4RTXA 4E6RA 2EGAA 4ESRA 2P4RA 1JO8A 2V1QA 2H8HA 4WCIA 1VYUA 1WLPB 1OPKA 1I1JA 3SHWA 2AZVA 1UUEA 2G6FX 1J3TA 4CC3A 2LCSA 3VS0A 1SSHA 1N5ZA 3VS3A 3VS1A 2CT3A 1M8MA 2KT8A 3EG2A 3I9QA 2RQWA 2X3WD 4LE9A 1V1CA 2AK5A 1UGVA 1FMKA 1GBRA 2B86A 2FRWA 2EPDA 1WXTA 1JXMA 1XOVA 2OAWA 2KR3A 2KBTA 1AZGB 1WFWA 4J9EA 2HBWA 4RUGA 2DBMA 1GFDA 1YP5A 2JMAA 3UA6A 1E6GA 1B07A 1AWXA 4CC7A 2K6DA 4HVVA 1CKAA 2FO0A 1JU5C 2YUOA 4F17A 1HSQA 1UJYA 1H3HA 1PKSA 1UE9A 4J9FA 4AG2C 2RQVA 5IHKA 1GRIA 1UHFA 2GBQA 1OEBA 1OOTA 1S1NA 1AWOA 1JEGA 1K0XA 5IHNA 1KFZA 1K4US 1LCKA 1UECA 1WX6A 1UFFA 2V1RA 3TSZA 2OI3A 1K9AA 2IIMA 3O5ZA 2JS2A 2D0NA 2ED1A 4IIMA 2ED0A 2L3SA 2J6OA 4LUDA 4D8DA 2KYBA 3PE0A 1K76A 4HXJA 1KIKA 2J7IA 1WXUA 3C0CA 2BZYA 1TUDA 5IXFA 4D8KA 1QKWA 3M0SA 1TUCA 3M0PA 1H8KA 2NWMA 1NEGA 2DA9A 2CT4A 1JQQA 2M51A 2GNCA 2ROTA 3VS7A 5IH2A 1SHFA 3ZL7C 2KEAA 4AG1C 4OMLA 3PVQA 2KNBB 2DRKA 1ZUYA 1SEMA 1GFCA 2EYWA 1SRMA 3I5SA 2DL7A 2DRMA 3LH5A 1NLOC 2GGRA 2LX7A 2YDLA 2CREA 1YCSB 4GLMA 2KE9A 2KROA 2HSPA 2K3BA 2YUNA 4ZNXA 1W6XA 5GJWB 1JXOA 4OMQA 4ORZA 1UG1A 3VRYA 5I11A 1K1ZA 2LNHB 4J9BA 5IXBA 1QWFA 2I0NA 2HDAA 1YWPA 1MV0B 3M0TA 1I0CA 3RBBB 1B3QA 2K2MA 1AVZC 2CUBA 2NUZA 1E7OA 1M3BA 4F16A 1NG2A 3M0QA 3THKA 1NLPC 2A37A 2KRSA 3FJ5A 2FPFA 2EYYA 1GCQC 3ULRB 2EW3A 1NYGA 4A63B 1UDLA 1RI9A 2DX1A 2J06A 2VKNA 2DNUA 4EIKA 4JZ3A 1CKBA 2DYBA 3REBB 2W0ZA 4CC2A 2K7AA 2J05A
chains in the Genus database with same CATH superfamily
2J6KA 2ZPHB 1LPLA 1X2QA 3JCMf 4C92B 4KGXB 2X4WA 3CCUT 2GQIA 3GNFB 4DEXA 5KE3A 3OYBA 2DL3A 1Q7YU 1VQNA 3KBGA 1VA7A 2YLCA 2RD1A 3DLMA 4M75A 2MI6A 1JJ2A 1Q95G 3OYIA 4M77B 4DBRA 3CMEQ 4Z8AA 3RDVA 1QP3A 1T3SA 2DXCA 4M7DD 1WA7A 4LDWA 4ZGDB 2CYZB 2Y4XA 1YITA 4J9DA 3S3NA 1X6BA 2JS0A 1Y71A 1X2KA 4DOWA 1RUWA 5CKDA 4CC4B 4IUPA 2DEUA 5KYXB 3DB3A 5GANg 4FW2A 1VQKT 4HVWA 3TU4K 1MUZA 3OW2S 4C8QA 2CP0A 4J83A 5GAMd 1NPPA 2I2LA 3DKMA 2HCKA 4M7AB 4M7DE 2XIDA 1AOJA 2XMFA 3C4SA 3VYHB 1Q82C 2RHXA 5GMKm 1CSKA 4PJJA 5KE2A 1IXDA 5CVIA 1VQ7T 1BK2A 2DIGA 1WXBA 4N4HA 3UA7A 5GAN7 1S72A 5CKHA 1Y96B 2AKLA 1G2BA 5AT1B 1X43A 4C92E 5LJ5j 2LJ1A 4IIOA 3H6ZA 1IZ6A 2AKKA 3FJPA 1OV3A 9ATCB 2QDLA 3JV3A 2DL4A 4Z89A 2PTKA 2HQHA 2RJEA 3EFSA 4A4EA 2FL7A 2JZ2A 5D6XA 4J7FA 3BDUA 1TSFA 2QK0A 2ENMA 3SDZA 4E7HA 2KYMA 4QT7A 2FRYA 3A98A 1HYOA 2RH2A 4GBQA 1LJOA 4NL2A 2RQUA 2EAYA 1WYXA 1RAHB 1Q7YR 3RUXA 3JB9H 3OB9A 1BB9A 3JCMg 3E2UA 4B9XA 4V2SA 1N6AA 3NGPA 3QJYA 3EGXB 1I07A 3M4GA 2COYA 4FL6A 4OGCA 1NYFA 3CCET 2DEQA 4PJNA 1R8OB 2QDYB 5FU6C 1SHGA 3OA6A 3L2QA 4JS5A 2E5KA 2EGEA 1VQ5Q 4M75C 1U06A 4FYWB 2KDSA 2K4YA 3EG1A 4OGEA 3I35A 5GAOm 3OYKA 3LWHA 4GY5A 1Q82R 4O6JA 1Y57A 3NMZC 1VIEA 4J9IA 1M90R 1FWZA 1RLQC 2RMOA 2XK0A 2L8DA 2CZ7B 3FIFA 4PJMA 5L8RE 4QVDA 2LX9A 3CC7Q 1GL5A 1QW1A 3G4SA 1Q86R 1M3AA 2A7YA 3MEWA 2RF0A 1PG5B 5LJ5d 1NEBA 2QTXA 1KG1A 3OYAA 3M0UA 3VS5A 3LX7A 4KBMB 1FXXA 1QVGA 1XQHA 2FYKA 2HAXA 1VQNQ 2O4XB 1R0CB 2L3RA 4WF2A 1NZ9A 3ZBDA 2HKQB 4F14A 2M0YA 3DB4A 2PZ1A 4A4KA 1U3OA 4XTYA 4LNPA 3MP6A 4DBHA 1VQPA 1WJSA 4JZ4A 3A8OB 2NUTA 2CDTA 1KQSS 2RNAA 3J7AF 5L23A 2M0OA 1Q81U 4QVCA 4M78A 1LOJA 1D3BA 3QYHB 2OJ2A 2K79A 3F70A 2F2VA 4J6WA 3RNJA 1VQOT 1V29B 3SWNB 4E7JA 2XDBA 2LJ0A 1PSEA 3EG9B 2OTJQ 2X3XD 2KSSA 1SRLA 3E9FA 2VWFA 2AT1B 3VS4A 3A8MB 1AD5A 3LYIA 4LUEA 4RTXA 5KYUB 1VQ9T 2EGAA 3VU3C 2V1QA 2GF7A 4MZPA 1VYUA 1WLPB 1OPKA 3JCMe 1I1JA 5CKEA 2NUPB 2H3EB 3HP9A 2G6FX 2PUOB 2ZPBB 3CPWP 2DPPB 1M8MA 2XI9A 1W2BP 3I9QA 5M9OA 3Q1JA 3P8HA 3E19A 1V1CA 3FLGA 3OBWA 2B86A 5KYWA 2RO0A 4L5GA 5FU6B 2KR3A 1H641 5EG2A 4RUGA 1W2BA 4HCBA 1YP5A 2K3YA 5FLXE 4QQGA 1E6GA 3CPWA 3L2UA 2K6DA 1CKAA 3OS2A 2ZGWA 4F17A 2P0QA 4LD6A 1FMVA 3I55Q 3X25B 2EQUA 2WACA 1JB0E 1R77A 5LL6S 2GBQA 5GAN5 2MK5A 1VQ7Q 5IHNA 3SB2A 5GAN8 2QTVA 5C0MA 1QCNA 2JOYA 2XKOC 1QQJA 3A1PA 2OI3A 2EJFA 1HXDA 3CMAQ 4M7DC 3O5ZA 2R5AA 4HA8A 3PNWC 3CCVT 2MMPA 3FDRA 1G3SA 2ZPGB 4HCCA 3V8JA 3TCJA 4N4IA 1P92A 1K9MR 4XTZA 3X20B 2F5TX 1WXUA 3C0CA 3JSCA 3HFNA 3ER0A 2EJGA 2VASA 2X4YA 3HKSA 2NWMA 5HK3A 3CCQQ 2EWNA 1JQQA 4C5GA 5IH2A 4OMLA 3VV0A 3CC7A 3EFOB 1OU8A 1VQ6A 2DRMA 5CCAA 2HL3A 2K3XA 3CCMA 1M1FA 3OMCA 5A0GA 4MZMA 4MDXA 1C0MA 4M78F 4EMHA 2EJ9A 3OYLA 1RAAB 1OI1A 2DZCA 1W6XA 1JXOA 4FM4B 3OS1A 3CCEQ 1M2VB 4HCZA 1YJWQ 4NOYA 5CK9A 1QVFS 3X26B 2DAQA 5IXBA 1QWFA 3X24B 2VUBA 2DYIA 1YWPA 4BI3A 1M1KC 1WJQA 2RI3A 1IHWA 1AVZC 2CUBA 2NUZA 1S72Q 3CBPA 3WXMB 3CC4T 4ZTFA 1KC8U 3M0QA 1H3ZA 3C94A 3QDFA 3FJ5A 3QBYA 2FPFA 3ULRB 1NYGA 2RJCA 1UDLA 4X9DA 2QQAA 1RL2A 4DQ2A 1MMAA 1QCOA 3L2WA 3JCMd 5CAIA 4CC2A 3MP8A 1I5OB 2KK4A 4ELZC 4M7DF 4RTVA 1OULA 5I2SA 4QW2A 3S3OA 3OS0A 3CC2T 4AT1B 1WQ7A 3HRTA 5HKCA 4LN2A 5GAOl 1PM3A 1I8FA 1M30A 1WPYA 2AIRB 3H0HA 2DD5A 2CGHA 4RTYA 5HY6A 1OPLA 1ZHIA 2ABLA 2RI5A 5CIUA 2RQRA 3IQLA 3EFRA 2YUPA 3VS6A 2YT6A 1KC8C 1YHQA 3CC2Q 1C1AA 4P5NA 2E10A 5GAN2 2D8JA 1D09B 2WSEE 4K11A 3OYNA 1N8RC 1ABOA 3A8GB 5I22A 2Z0WA 3UT1A 3AHUA 1FX7A 2LTOA 4JJNK 2DKGA 1SF9A 1T0HA 1RAEB 4MZTA 1V76A 3EG3A 4JPBW 3V7RA 1JRIA 1YHQT 4M77G 4L59A 4OMFB 1TUGB 3J81E 1X75C 4R0KA 5FROA 2XDDA 1WHMA 1VOMA 3DLLA 3G6EA 1SG5A 1A0NB 4MMKA 4J6YA 4C8QG 4J8OA 4XTVA 1BI1A 4CI0C 1Q81C 2PVGB 2VVKA 2QA4T 2V8KA 1VQLA 2D6FA 3NFCA 1UEBA 1MMGA 2E5QA 2MIOA 1X6OA 2WSCE 2JT4A 2L5QA 2HD0A 2QA4A 2O88A 1U1SA 5KH6A 2VYTA 3CCQA 3H8ZA 2X4JA 2MOXA 4OMOA 3G71Q 2EYXA 4AFUC 4C0FA 1HD3A 4F7UB 4C8QD 2LVMA 2P0PA 4XU2A 1K73C 1YJNT 2JXBA 4FYVB 3TQ7P 3QHSA 4M7AA 1HJDA 1ZSZB 2SEMA 4ZN3A 2FPEA 2J6FA 4FIBA 3RR6A 1MV3A 2QA4Q 1Q7YC 3QPHA 1VQ6T 2YWWA 4AFZC 3VKIA 3LGFA 1LVKA 1YHQQ 4XU1A 2DL8A 1YI2Q 1Y7XA 1YBYA 4IURA 2FPDA 2ECZA 4KRTA 4BI8B 4QKUA 4M75E 3CCMQ 1OZ3A 1BU1A 2E3IA 4C8QE 5GAMf 4JLGA 2CSQA 3H0IA 4RTTA 2BZXA 4N0AC 4AFSC 1ZX6A 3MO8A 1Y0MA 4FT4A 1W70A 3SFMA 4Y28E 2BZ8A 5GANd 4D6WA 2R58A 1PC0A 2JMCA 3M57A 4M7AC 2QXFA 4PJOB 4II1A 1KQSA 1N8RU 5D7UA 1VQNT 3ZEHA 3CC2A 2EKHA 1OX8A 3EHRA 1QCFA 2A28A 1TH7A 4C5EA 2YSQA 1T0JA 2ATCB 4E7IA 4LDYA 1IO6A 2DVJA 3I56A 2DLPA 4F04B 3CXCP 3CCMT 3QWYA 3EFOA 3META 1D1AA 1QP2A 1UHCA 4F7UA 2CP5A 2ZPIB 3S3MA 1VIFA 3CEYA 3KFVA 4XAXB 4C92D 2DL5A 2OTLA 4BDYA 1ZBXA 1VQMA 3QZ5B 3KUFA 3M56A 4HT9A 1PD0A 2EQIA 5KYYA 5KCHA 2OTLT 4XTXA 2EIFA 1G8XA 5CQYA 3PT9A 3WVDB 2HKNA 4JJCA 4QQDA 3R6NA 5CKBA 4HCKA 3SWNA 2NUTB 1YN8A 5GJVB 1TWBA 3G6EQ 3VS2A 1W2BS 1BBZA 2DETA 5CR2A 2O9SA 1GXIE 1TS9A 3CPWS 3GOXA 2LQKA 4ESRA 4JRQA 2JN0A 2P4RA 2HQEA 1JO8A 3OYDA 4WCIA 4M7AF 2EQMA 3SHWA 3M58A 4F7UG 1B34A 3MCAB 4CC3A 3OYFA 3VS0A 1SSHA 3VS3A 2KT8A 2E4HA 4LE9A 3X28B 1GBRA 4ELYC 2FRWA 2JTMA 1JXMA 3PFSA 3JB9F 4O5VA 1XOVA 1BIAA 2E41A 2KBTA 5DLQE 3FB9A 3V7SA 1WFWA 2HBWA 1YJWT 3UA6A 5LJ3j 4WTOB 4MMLA 2QGGA 1WJRA 2PVDB 4CC7A 1JU5C 4XK8E 2YUOA 2QQSA 1K73R 3OYHA 4PFOA 1RAGB 5IHKA 1IGQA 1GRIA 1YJ9T 1K8AR 4M78E 2VB6A 1OOTA 1AWOA 1VQPT 5LJ3e 2LDMA 1QVFA 3JB9I 4C5IA 1LCKA 1WX6A 3D7SB 2V1RA 4ATOA 3TSZA 3MHXA 2DJZA 2GCXA 2JS2A 4FYYB 2L3SA 2J6OA 4J6XA 3HFOA 2ZPEB 4B9WA 4LD9K 3PE0A 3RKXA 4AMCA 1WNLA 4BY6B 3I55A 2K5IA 4KUDK 3BY7A 2KAFA 3CPFA 5FU7B 1AHJB 3BW1A 5GAMe 2DA9A 2D9TA 2CZ6B 4C92G 2ROTA 3ZL7C 3GIBA 3M4YA 1SEMA 4F7UE 2DXUA 3I5SA 2DL7A 5GAOp 2LCLA 4BACA 1NLOC 2GGRA 4M75B 2YDLA 1YCSB 4PK4A 1U1TA 2HQXA 2QEXT 4GLMA 3H9NA 1YJNA 2KROA 2YUNA 4Z02A 3URGA 1UG1A 3CCQT 3LLRA 4OB1B 2LNHB 4VUBA 4J9BA 2LCCA 4M78B 2HDAA 3M0TA 2BUDA 3RBBB 2OTJA 1E7OA 3CCRA 1M4ZA 1YITQ 5GAOq 3OYCA 2KRSA 3RMQA 3MPUB 3QKJA 2G3RA 1ZSZA 2MYSA 1GCQC 3LGLA 3VUBA 2XDPA 1D3BB 4EPCA 2DNUA 2K57A 2L89A 2R57A 5GANh 3JRZA 3QYGB 4RKUE 3JAME 2J05A 2W10A 3UWNA 2DM1A 2JVVA 5LJ3d 3JCMW 2LRQA 1X69A 3OW2A 2C0IA 4RTUA 2JW4A 1T3LA 3UF4A 2M16A 4Z88A 5CO7A 2YXYA 4C0DB 1QVFP 1TG0A 2RA2A 2CUDA 4GLKA 1YFNA 4BDZA 3C12A 4C92F 3TSWA 2DIQA 3TEEA 3OY9A 1U5SA 4PJOF 4OF1A 1FMWA 2QQRA 2RB6A 1KHIA 2KQWA 5KYUA 2P84A 4PFPA 1M2OA 3CC4Q 3JCMP 2K5LA 1AT1B 1M2VA 1X27A 2VC8A 3G1JA 2GFUA 1WHLA 2O31A 1ZA1B 1YIJA 4RG8A 2FEIA 2E6NA 4PFZA 1SKUB 4EMKB 2MAMA 2Y90A 3QWXX 2RJFA 3H0FA 3P8BB 4IUUA 1FYNA 2DE0X 2LQ8A 2XICA 4DBQA 2M02A 4M75F 2BIVA 2K2VA 1K0SA 1BCOA 2M9UA 2KXCA 2RPNA 3SD4A 2LP5A 4UC4A 2COWA 1BKBA 2L3PA 3MKDA 4ZGEB 2KRMA 1Q86U 5KCOA 1PRLC 3RKYA 1M1KU 2DILA 1MMDA 3UDCA 1UGSB 2V26A 3CCST 2AZSA 1PRMC 8AT1B 4Y92A 1KQ2A 4M77D 2Y4YA 1M3CA 2YUQA 4MDWA 1IHVA 3EAEA 4A4GA 1JJ2S 4DA4A 5IN1A 4PNOA 3BDLA 2C0TA 1G83A 2F2XA 1TTHB 3V8KA 1G3WA 5D6WA 2LZ6B 1AWWA 5GMKl 1VQPQ 4OP0A 3HL8A 1ZLMA 5GMKh 4RG2A 3LH0A 3OQ5A 3RIRA 4N0AA 3INZA 4B6MA 3CD6A 3OYYA 3SEMA 3CXCA 5ECAA 2X9HA 3L1AA 3VRZA 5A2QE 4OB3B 5DLOA 4PJOC 2YRVA 4F7UF 2F1LA 1ACMB 2PUKB 4FCYA 2E3HA 3RESA 1WI7A 2L0AA 3NPFA 2YRDA 2X35A 5IAYA 4JJDA 4X9CA 4M7AD 3MEAA 1WHHA 5DY9A 3LWIA 3EH1A 3I5RA 1IB8A 1KQ1A 1VQOA 2O9VA 2LQNA 2KRNA 4LDXA 1H92A 1KD1C 8ATCB 1NJIU 3C95A 3VUZA 5GAMj 2MWOA 5CQXA 1I5LA 3CCUA 4M78D 1ABQA 1UTIA 2LQWA 2RQTA 2ZPFB 3NTIA 3QDRB 1M27C 3M53A 1YIJQ 1KD1R 4TVRA 1M1GA 5LJ3h 1B7TA 4RTWA 2YRCA 4M7AE 1MNDA 2OX7A 2DTOA 2V8IA 1SPKA 3R6OA 4C5HA 4XU0A 1UGPB 3CCUQ 2H3JA 3TREA 4HVUA 1NE8A 3HPWA 2LMJA 5IT9E 2KI7A 3RMSA 2XD0A 2XG8D 3G6ET 1OYXA 4BE1A 2CS7A 2B8AA 1PKTA 3M0RA 2CSIA 4M77C 2EKOA 3EGXA 4KH1B 4OMNA 2V8JA 5LJ5h 3JCMc 5LJ5f 4PJOE 2ESWA 4J9CA 3UATA 5GAOn 1UJ0A 1QLYA 5HCKA 3CCRT 1VQMT 4BUGA 2EYZA 1WDXA 5FWBA 2IG0A 4C8QC 2GTJA 4A54A 1M5Q1 2QAZA 4M77A 1QVGS 1YJ9Q 2RHZA 2CH4A 2PNIA 4RMOA 1VQKQ 1XTDA 1ZUUA 2XHCA 1NM7A 4CRIA 2JNGA 4E7ZA 2EFIA 1R0BG 4BE0A 1LNXA 2XU8A 4BD3A 4PJOD 1UUEA 1N8RR 1J3TA 4A4FA 2QG9B 3CD6Q 1OX9A 3SWNC 3VS1A 2CT3A 4JUVA 5FU7C 2OTLQ 2FB7A 4M78C 1WHJA 3CCLT 1UGVA 1HK9A 2X4XA 1RABB 3QZ9B 4BY6C 2PU9B 2OAWA 2X51A 2PQWA 3OYEA 5GMKj 2DBMA 5GANf 4LXCA 1GFDA 2E6ZA 3JCMV 1VQLT 3QUIA 3M5AA 1I81A 1WHKA 3G4ST 3G71T 3JCMJ 1HSQA 1UJYA 2CP2A 4L6V5 1PKSA 2HZYA 4J9FA 1TXQA 1O9SA 4AG2C 3E1SA 4FYXB 1JBMA 2JJ9A 3OYJA 1D1CA 2CZ0B 1OEBA 2RK2A 1Y07A 1K0XA 1KFZA 3VYGA 1G3YA 1XJWB 1K4US 1UECA 1RI0A 3OSSC 3UPUA 1UFFA 1BYMA 1VQ9A 4PL6A 4BI4A 2NUPA 5LJ3f 4IUVA 2FHDA 1TOVA 5CKFA 2D0NA 4IIMA 2K5FA 1WGSA 4DOVA 2DTIA 4LUDA 4D8DA 2KYBA 1VQOQ 2RI2A 1VQ8A 1G3TA 3HHTB 1BI3A 1K76A 3CC4A 4C8QF 1S72T 1M8VA 4N4GA 1KIKA 1D0ZA 2HL5C 3PIPA 3NTHA 1TUDA 3WVEB 3N5BB 4D8KA 1O75A 1QKWA 3M0SA 3M55A 4XU3A 5C6SA 5FRNA 4LDUA 2D0QB 3NTKA 5D6YA 4OB0B 5KYWB 2AHJB 2GNCA 5GAN6 3VS7A 5LJ5g 1SHFA 2KEAA 4AG1C 3G7ZA 3PVQA 5J39A 3G4SQ 2KNBB 2DRKA 1VQ8Q 1ZUYA 3PMIA 3LH5A 2LX7A 3JCMQ 4A4HA 1SSFA 4KT0E 2BKDN 1NPRA 2CP6A 3BE3A 5GMKe 2VXFA 3CCJT 1W4SA 2QGFB 2HSPA 2K3BA 1RACB 2JUFA 5GJWB 2O01E 3CMAA 1KD1U 4OMQA 4R56A 2QQ9A 4M77E 1K1ZA 2E65A 4X34A 2ZZDA 1YCYA 2I0NA 2HSEB 3AT1B 1I4K1 1MV0B 4PJOG 3I55T 4J7IA 3GNGA 2DXBA 3I56Q 3G71A 3BFMA 3THKA 2A37A 3M9QA 2VGNA 4OVAA 4RCBA 3ASKA 4A63B 1VQ7A 3S6WA 3OBYA 4KGZB 3CCVA 2J06A 4NL3A 5A0DA 2VKNA 1OZ2A 4EIKA 4JZ3A 2DYBA 3REBB 2W0ZA 3QO3A 3E9GA 1VUBA 2QASA 1YJWA 5DM7R 2LC4A 1C6VX 1D1BA 1VYVA 1ZSGA 2DBKA 3QJ6A 2D8HA 3I56T 1YJNQ 2YHTA 3RERA 2A36A 2DMOA 1KC8R 4FW1A 1N9RA 2ROLA 1ZA2B 5J26A 3QXEB 1KJWA 4E7SA 1Q86C 4M7AG 1EFNA 5KYXA 3EGDB 3MEUA 1GBQA 1OQKA 6AT1B 4M7DB 2KMTA 4Q5WA 2CZ1B 3PTAA 3CQTA 4JS4A 4JJBA 1YI2A 4C8QB 2SRCA 1YITT 3A8LB 4FU6A 2GTOA 1WZOA 4M78G 2EVRA 3CCJA 2CP7A 1M9SA 4FSSA 2A08A 5FRMA 1K8AU 5IHIA 2DTHA 1YJ9A 1ZUKA 3A5ZB 2HNIA 3EG9A 2ZCFB 3MP1A 3FEOA 1YNZA 2L2PA 1IREB 1PD1A 1GCQA 3V7CA 1W1FA 1YWOA 4EMKA 2JTEA 1MNEA 2EBPA 2DO3A 4RTZA 2QI2A 4M4ZA 5I2MA 2KVQG 3OYMA 1MGQA 2DF6A 1K9MU 1QKXA 4C92C 3H41A 3EH2A 3CMET 4DBFA 2CP3A 1VQ6Q 4FSXA 2E12A 2KT1A 1PNJA 1XNIA 3CCSA 1K8AC 4JRPA 3GLXA 2KGTA 2FVUA 2C0OA 2KY9A 2EQKA 1PSFA 4DEYA 2FZGB 2HEQA 3M54A 1AWJA 3NHNA 4LDVA 2WSFE 3CCSQ 1YIJT 4Y91A 1ARKA 2EYQA 3HTRA 5EC7A 4BE2A 4JLIA 1WIEA 1VQ5A 1ZBJA 2RN8A 4AFQC 2MCNA 3OW2P 4OB2B 5FW9A 2LT4A 3ME9A 3HRSA 4JDSA 3OMGA 3QIIA 5GAMh 1K9MC 1GCPA 2RJDA 2DJQA 2P0KA 2D1XA 3EGUA 4C0DC 1N9SA 4PKCC 3L2RA 4IUTA 1VYTA 2PVOB 1QVPA 1RAIB 4OMPA 3MJXA 2LNVA 3MEVA 4KUIA 4M77F 5FWCA 5HK0A 4J5YA 4EDUA 1QMCA 4M7DG 1VQ8T 2DD4A 4ZN1A 4M75D 4JRIA 2QQBA 1Z9ZA 2K9GA 2DFUA 1VQMQ 5GAOr 1QWEA 3EG0A 2IVWA 3QSUA 3GF5A 2NLUA 2CH4W 2M1HA 4QVZA 3CCLQ 5I21A 3GBQA 4E47A 1PWTA 2O4XA 1KHCA 3PVLA 2QEXQ 2E70A 3KXTA 1BIBA 2COZA 3O8VA 2HBPA 3A8HB 1D0YA 3VJPA 1VQ9Q 2JTFA 4M75G 3FRNA 1KSWA 2JM9A 3T9NA 2VV5A 1AEYA 2RM4A 1PCXA 1ZQ1A 3OYGA 1U8RA 2E1HA 4X1VA 2BTTA 1BCMA 2FG0A 2P4TA 5GANe 2OTJT 3JCMb 4JRKA 1MMNA 4M7DA 3CCLA 3JB9J 4KULA 3JCMh 1M90U 3CBOA 2JM8A 4OMMA 2QEXA 2IPOB 3QG1A 2DXTA 4EMKC 4E7KA 2FZKB 4J9GA 3REAB 3CMAT 2KXDA 2L3QA 2A3LA 3TVTA 1QVGP 1NBEB 3CCEA 2EGCA 1DJ7B 2F69A 1AZEA 1WHGA 1E6HA 3L42A 3JCMX 3OSVA 2F2WA 1Z9QA 2O2OA 3JB9G 1X6GA 4PJOA 1PHTA 2LJ3A 3U23A 4J9HA 2NYSA 1RAFB 1RLPC 3RKWA 3J80E 5A0LA 4ANJA 4KGVB 1KK7A 3EHQA 4E6RA 1UGRB 2OAUA 1G5VA 2H8HA 1VQLQ 5GANj 2GFAA 4XTUA 4YTLA 4FT2A 1ZSZC 2AZVA 4HKEA 2LCSA 1UGQB 1M90C 1N5ZA 4IUQA 2F5KA 2LT1A 3EG2A 5LJ5e 2HMAA 2RQWA 2X3WD 2AK5A 4RCCA 1FMKA 4QQ6A 2EPDA 1WXTA 4NS5A 3CCJQ 5J3BA 1K73U 1AZGB 2BE9B 4J9EA 5LJ3g 1Q82U 1EX4A 4E7LA 5GAN3 2QYZA 2JMAA 1IRXA 1Q81R 1B07A 1IGUA 1AWXA 3CCRQ 4HVVA 2FO0A 5AYFA 2RK1A 1H3HA 1UE9A 2MWPA 1BI0A 2RQVA 3M59A 4KH0B 1UHFA 1JJ2P 3FC3A 1S1NA 1JEGA 2BE7D 2MPXC 7AT1B 1M1KR 2C06A 3L2ZA 4PJLA 1K9AA 2IIMA 2RHUA 4R55A 3PGGA 1UB4A 2ED1A 2ED0A 1WQWA 1RADB 3P8DA 3OS5A 1VQKA 1VQ4Q 4HXJA 1B34B 3HSBA 2EQJA 2J7IA 5GMKi 3HRUA 1NJIC 2BZYA 5GAN4 5IXFA 1TU0B 3GPLA 1TUCA 2MF2A 2GQVA 3M0PA 1H8KA 1NEGA 2CT4A 3LW5E 2M51A 4C0ZA 4EMGA 2VGMA 2R5MA 3V8LA 1YI2T 1VQ5T 4PLIA 1NJIR 1GFCA 3CD6T 2EYWA 1SRMA 2A0FB 1EIFA 1VQ4A 1X01A 2CREA 4PLLA 2VXEA 5GAMg 1VQ4T 1D0XA 3EGDA 3JB9D 4A53A 2KE9A 5KYNA 4ZTJA 1F1BB 3CC7T 4ZNXA 4XQ3A 3ZFJA 4IKFA 2FZCB 4E2FB 4ORZA 3VRYA 3L2VA 2ZAEA 5I11A 3CCVQ 4XTWA 2CKKA 3CBMA 4ME7A 1KQSP 5KYYB 4ZGJB 1I0CA 1B3QA 2DZ9A 2K2MA 1Y96A 2DK3A 4HT8A 1MHNA 1M3BA 4C92A 4F16A 1NG2A 1NLPC 1BI2A 2DVEA 1EZZB 1OU9A 2EYYA 2EW3A 2YLBA 1RI9A 1N27A 2RHYA 4C0GA 2DX1A 3CMEA 4BB7A 2DERA 3PIOA 3PMTA 3CXCS 2E64A 1CKBA 2RHIA 3GP8A 2K7AA
chains in the Genus database with same CATH topology
2W10A 2DM1A 2J6KA 4RTVA 1X69A 2C0IA 1X2QA 1VYVA 1ZSGA 2DBKA 4RTUA 2JW4A 1T3LA 3UF4A 2GQIA 2D8HA 4Z88A 4DEXA 2DL3A 4LN2A 2A36A 2DMOA 1M30A 1VA7A 1TG0A 3H0HA 2CUDA 2ROLA 4RTYA 1KJWA 1OPLA 1EFNA 2ABLA 3TSWA 1GBQA 4Z8AA 1U5SA 1T3SA 2RQRA 3IQLA 2YUPA 3CQTA 3VS6A 1WA7A 4JJBA 2YT6A 2SRCA 4J9DA 1X27A 1X6BA 2JS0A 2D8JA 2GTOA 1X2KA 2EVRA 2O31A 4K11A 1RUWA 1ABOA 2FEIA 4FSSA 2A08A 5I22A 5IHIA 4CC4B 1ZUKA 3QWXX 3H0FA 1T0HA 4HVWA 1MUZA 1FYNA 3EG3A 4JPBW 2DE0X 1YNZA 2HCKA 2L2PA 1K0SA 1GCQA 1AOJA 2XMFA 2KXCA 2RPNA 4R0KA 2LP5A 1W1FA 2L3PA 1YWOA 2KRMA 1CSKA 2JTEA 1BK2A 2EBPA 1A0NB 1WXBA 4RTZA 3UA7A 4M4ZA 1PRLC 2DILA 2DF6A 2VVKA 1QKXA 3H41A 2AKLA 2AZSA 1PRMC 1G2BA 1X43A 4Y92A 2LJ1A 2MIOA 4IIOA 2KT1A 1M3CA 1PNJA 2AKKA 2JT4A 2YUQA 2O88A 1OV3A 2QDLA 3JV3A 2DL4A 2KGTA 4Z89A 2PTKA 2MOXA 4OMOA 2C0OA 2EYXA 4AFUC 2C0TA 1HD3A 1G83A 2F2XA 4DEYA 2JXBA 2ENMA 2LZ6B 1AWWA 1HJDA 2HEQA 2KYMA 1AWJA 2SEMA 4QT7A 3NHNA 2FRYA 1ZLMA 3A98A 2FPEA 2J6FA 1MV3A 4GBQA 1ARKA 4AFZC 5EC7A 3SEMA 1WIEA 1ZBJA 2RN8A 2RQUA 1WYXA 2DL8A 5ECAA 3VRZA 4AFQC 2FPDA 2ECZA 1BB9A 2MCNA 4KRTA 5FW9A 1BU1A 2CSQA 3H0IA 3NGPA 2BZXA 4RTTA 1WI7A 1GCPA 2L0AA 4AFSC 1ZX6A 3NPFA 1I07A 2DJQA 2D1XA 3EGUA 1Y0MA 1W70A 1NYFA 1VYTA 2BZ8A 4JJDA 4OMPA 2JMCA 1SHGA 5FWCA 3I5RA 2O9VA 2E5KA 2LQNA 2KRNA 1H92A 2EGEA 1U06A 1Z9ZA 3EG1A 2K9GA 1QWEA 3I35A 3EG0A 2CH4W 1Y57A 3NMZC 4J9IA 3GBQA 1ABQA 1UTIA 2LQWA 2RQTA 1RLQC 2RMOA 1PWTA 2EKHA 3PVLA 3EHRA 1QCFA 1M27C 2A28A 2YSQA 1T0JA 1GL5A 4RTWA 1M3AA 1KSWA 2JM9A 1IO6A 2DVJA 2DLPA 2RF0A 1SPKA 1NEBA 1AEYA 3M0UA 3VS5A 3QWYA 4HVUA 4X1VA 2LMJA 2BTTA 2FG0A 4F14A 2M0YA 2PZ1A 1UHCA 1U3OA 4LNPA 2JM8A 1PKTA 3M0RA 4JZ4A 4OMMA 3KFVA 2CSIA 2CDTA 2RNAA 4J9GA 3REAB 4OMNA 2KXDA 5L23A 2L3QA 3TVTA 2ESWA 4J9CA 2DL5A 3UATA 1UJ0A 1QLYA 2EGCA 5HCKA 2EQIA 2K79A 2OJ2A 2EYZA 1WDXA 1AZEA 5FWBA 3RNJA 2F2VA 1E6HA 2GTJA 2F2WA 1Z9QA 4JJCA 2O2OA 3R6NA 1X6GA 2LJ0A 4HCKA 1PHTA 2LJ3A 2X3XD 3U23A 4J9HA 1YN8A 2CH4A 5GJVB 1RLPC 2PNIA 3VS2A 1SRLA 1BBZA 2VWFA 1ZUUA 3VS4A 1NM7A 1AD5A 4LUEA 2O9SA 3EHQA 4RTXA 4E6RA 2EGAA 4ESRA 2P4RA 1JO8A 2V1QA 2H8HA 4WCIA 1VYUA 1WLPB 1OPKA 1I1JA 3SHWA 2AZVA 1UUEA 2G6FX 1J3TA 4CC3A 2LCSA 3VS0A 1SSHA 1N5ZA 3VS3A 3VS1A 2CT3A 1M8MA 2KT8A 3EG2A 3I9QA 2RQWA 2X3WD 4LE9A 1V1CA 2AK5A 1UGVA 1FMKA 1GBRA 2B86A 2FRWA 2EPDA 1WXTA 1JXMA 1XOVA 2OAWA 2KR3A 2KBTA 1AZGB 1WFWA 4J9EA 2HBWA 4RUGA 2DBMA 1GFDA 1YP5A 2JMAA 3UA6A 1E6GA 1B07A 1AWXA 4CC7A 2K6DA 4HVVA 1CKAA 2FO0A 1JU5C 2YUOA 4F17A 1HSQA 1UJYA 1H3HA 1PKSA 1UE9A 4J9FA 4AG2C 2RQVA 5IHKA 1GRIA 1UHFA 2GBQA 1OEBA 1OOTA 1S1NA 1AWOA 1JEGA 1K0XA 5IHNA 1KFZA 1K4US 1LCKA 1UECA 1WX6A 1UFFA 2V1RA 3TSZA 2OI3A 1K9AA 2IIMA 3O5ZA 2JS2A 2D0NA 2ED1A 4IIMA 2ED0A 2L3SA 2J6OA 4LUDA 4D8DA 2KYBA 3PE0A 1K76A 4HXJA 1KIKA 2J7IA 1WXUA 3C0CA 2BZYA 1TUDA 5IXFA 4D8KA 1QKWA 3M0SA 1TUCA 3M0PA 1H8KA 2NWMA 1NEGA 2DA9A 2CT4A 1JQQA 2M51A 2GNCA 2ROTA 3VS7A 5IH2A 1SHFA 3ZL7C 2KEAA 4AG1C 4OMLA 3PVQA 2KNBB 2DRKA 1ZUYA 1SEMA 1GFCA 2EYWA 1SRMA 3I5SA 2DL7A 2DRMA 3LH5A 1NLOC 2GGRA 2LX7A 2YDLA 2CREA 1YCSB 4GLMA 2KE9A 2KROA 2HSPA 2K3BA 2YUNA 4ZNXA 1W6XA 5GJWB 1JXOA 4OMQA 4ORZA 1UG1A 3VRYA 5I11A 1K1ZA 2LNHB 4J9BA 5IXBA 1QWFA 2I0NA 2HDAA 1YWPA 1MV0B 3M0TA 1I0CA 3RBBB 1B3QA 2K2MA 1AVZC 2CUBA 2NUZA 1E7OA 1M3BA 4F16A 1NG2A 3M0QA 3THKA 1NLPC 2A37A 2KRSA 3FJ5A 2FPFA 2EYYA 1GCQC 3ULRB 2EW3A 1NYGA 4A63B 1UDLA 1RI9A 2DX1A 2J06A 2VKNA 2DNUA 4EIKA 4JZ3A 1CKBA 2DYBA 3REBB 2W0ZA 4CC2A 2K7AA 2J05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W10 A;  2DM1 A;  2J6K A;  4RTV A;  1X69 A;  2C0I A;  1X2Q A;  1VYV A;  1ZSG A;  2DBK A;  4RTU A;  2JW4 A;  1T3L A;  3UF4 A;  2GQI A;  2D8H A;  4Z88 A;  4DEX A;  2DL3 A;  4LN2 A;  2A36 A;  2DMO A;  1M30 A;  1VA7 A;  1TG0 A;  3H0H A;  2CUD A;  2ROL A;  4RTY A;  1KJW A;  1OPL A;  1EFN A;  2ABL A;  3TSW A;  1GBQ A;  4Z8A A;  1U5S A;  1T3S A;  2RQR A;  3IQL A;  2YUP A;  3CQT A;  3VS6 A;  1WA7 A;  4JJB A;  2YT6 A;  2SRC A;  4J9D A;  1X27 A;  1X6B A;  2JS0 A;  2D8J A;  2GTO A;  1X2K A;  2EVR A;  2O31 A;  4K11 A;  1RUW A;  1ABO A;  2FEI A;  4FSS A;  2A08 A;  5I22 A;  5IHI A;  4CC4 B;  1ZUK A;  3QWX X;  3H0F A;  1T0H A;  4HVW A;  1MUZ A;  1FYN A;  3EG3 A;  4JPB W;  2DE0 X;  1YNZ A;  2HCK A;  2L2P A;  1K0S A;  1GCQ A;  1AOJ A;  2XMF A;  2KXC A;  2RPN A;  4R0K A;  2LP5 A;  1W1F A;  2L3P A;  1YWO A;  2KRM A;  1CSK A;  2JTE A;  1BK2 A;  2EBP A;  1A0N B;  1WXB A;  4RTZ A;  3UA7 A;  4M4Z A;  1PRL C;  2DIL A;  2DF6 A;  2VVK A;  1QKX A;  3H41 A;  2AKL A;  2AZS A;  1PRM C;  1G2B A;  1X43 A;  4Y92 A;  2LJ1 A;  2MIO A;  4IIO A;  2KT1 A;  1M3C A;  1PNJ A;  2AKK A;  2JT4 A;  2YUQ A;  2O88 A;  1OV3 A;  2QDL A;  3JV3 A;  2DL4 A;  2KGT A;  4Z89 A;  2PTK A;  2MOX A;  4OMO A;  2C0O A;  2EYX A;  4AFU C;  2C0T A;  1HD3 A;  1G83 A;  2F2X A;  4DEY A;  2JXB A;  2ENM A;  2LZ6 B;  1AWW A;  1HJD A;  2HEQ A;  2KYM A;  1AWJ A;  2SEM A;  4QT7 A;  3NHN A;  2FRY A;  1ZLM A;  3A98 A;  2FPE A;  2J6F A;  1MV3 A;  4GBQ A;  1ARK A;  4AFZ C;  5EC7 A;  3SEM A;  1WIE A;  1ZBJ A;  2RN8 A;  2RQU A;  1WYX A;  2DL8 A;  5ECA A;  3VRZ A;  4AFQ C;  2FPD A;  2ECZ A;  1BB9 A;  2MCN A;  4KRT A;  5FW9 A;  1BU1 A;  2CSQ A;  3H0I A;  3NGP A;  2BZX A;  4RTT A;  1WI7 A;  1GCP A;  2L0A A;  4AFS C;  1ZX6 A;  3NPF A;  1I07 A;  2DJQ A;  2D1X A;  3EGU A;  1Y0M A;  1W70 A;  1NYF A;  1VYT A;  2BZ8 A;  4JJD A;  4OMP A;  2JMC A;  1SHG A;  5FWC A;  3I5R A;  2O9V A;  2E5K A;  2LQN A;  2KRN A;  1H92 A;  2EGE A;  1U06 A;  1Z9Z A;  3EG1 A;  2K9G A;  1QWE A;  3I35 A;  3EG0 A;  2CH4 W;  1Y57 A;  3NMZ C;  4J9I A;  3GBQ A;  1ABQ A;  1UTI A;  2LQW A;  2RQT A;  1RLQ C;  2RMO A;  1PWT A;  2EKH A;  3PVL A;  3EHR A;  1QCF A;  1M27 C;  2A28 A;  2YSQ A;  1T0J A;  1GL5 A;  4RTW A;  1M3A A;  1KSW A;  2JM9 A;  1IO6 A;  2DVJ A;  2DLP A;  2RF0 A;  1SPK A;  1NEB A;  1AEY A;  3M0U A;  3VS5 A;  3QWY A;  4HVU A;  4X1V A;  2LMJ A;  2BTT A;  2FG0 A;  4F14 A;  2M0Y A;  2PZ1 A;  1UHC A;  1U3O A;  4LNP A;  2JM8 A;  1PKT A;  3M0R A;  4JZ4 A;  4OMM A;  3KFV A;  2CSI A;  2CDT A;  2RNA A;  4J9G A;  3REA B;  4OMN A;  2KXD A;  5L23 A;  2L3Q A;  3TVT A;  2ESW A;  4J9C A;  2DL5 A;  3UAT A;  1UJ0 A;  1QLY A;  2EGC A;  5HCK A;  2EQI A;  2K79 A;  2OJ2 A;  2EYZ A;  1WDX A;  1AZE A;  5FWB A;  3RNJ A;  2F2V A;  1E6H A;  2GTJ A;  2F2W A;  1Z9Q A;  4JJC A;  2O2O A;  3R6N A;  1X6G A;  2LJ0 A;  4HCK A;  1PHT A;  2LJ3 A;  2X3X D;  3U23 A;  4J9H A;  1YN8 A;  2CH4 A;  5GJV B;  1RLP C;  2PNI A;  3VS2 A;  1SRL A;  1BBZ A;  2VWF A;  1ZUU A;  3VS4 A;  1NM7 A;  1AD5 A;  4LUE A;  2O9S A;  3EHQ A;  4RTX A;  4E6R A;  2EGA A;  4ESR A;  2P4R A;  1JO8 A;  2V1Q A;  2H8H A;  4WCI A;  1VYU A;  1WLP B;  1OPK A;  1I1J A;  3SHW A;  2AZV A;  1UUE A;  2G6F X;  1J3T A;  4CC3 A;  2LCS A;  3VS0 A;  1SSH A;  1N5Z A;  3VS3 A;  3VS1 A;  2CT3 A;  1M8M A;  2KT8 A;  3EG2 A;  3I9Q A;  2RQW A;  2X3W D;  4LE9 A;  1V1C A;  2AK5 A;  1UGV A;  1FMK A;  1GBR A;  2B86 A;  2FRW A;  2EPD A;  1WXT A;  1JXM A;  1XOV A;  2OAW A;  2KR3 A;  2KBT A;  1AZG B;  1WFW A;  4J9E A;  2HBW A;  4RUG A;  2DBM A;  1GFD A;  1YP5 A;  2JMA A;  3UA6 A;  1E6G A;  1B07 A;  1AWX A;  4CC7 A;  2K6D A;  4HVV A;  1CKA A;  2FO0 A;  1JU5 C;  2YUO A;  4F17 A;  1HSQ A;  1UJY A;  1H3H A;  1PKS A;  1UE9 A;  4J9F A;  4AG2 C;  2RQV A;  5IHK A;  1GRI A;  1UHF A;  2GBQ A;  1OEB A;  1OOT A;  1S1N A;  1AWO A;  1JEG A;  1K0X A;  5IHN A;  1KFZ A;  1K4U S;  1LCK A;  1UEC A;  1WX6 A;  1UFF A;  2V1R A;  3TSZ A;  2OI3 A;  1K9A A;  2IIM A;  3O5Z A;  2JS2 A;  2D0N A;  2ED1 A;  4IIM A;  2ED0 A;  2L3S A;  2J6O A;  4LUD A;  4D8D A;  2KYB A;  3PE0 A;  1K76 A;  4HXJ A;  1KIK A;  2J7I A;  1WXU A;  3C0C A;  2BZY A;  1TUD A;  5IXF A;  4D8K A;  1QKW A;  3M0S A;  1TUC A;  3M0P A;  1H8K A;  2NWM A;  1NEG A;  2DA9 A;  2CT4 A;  1JQQ A;  2M51 A;  2GNC A;  2ROT A;  3VS7 A;  5IH2 A;  1SHF A;  3ZL7 C;  2KEA A;  4AG1 C;  4OML A;  3PVQ A;  2KNB B;  2DRK A;  1ZUY A;  1SEM A;  1GFC A;  2EYW A;  1SRM A;  3I5S A;  2DL7 A;  2DRM A;  3LH5 A;  1NLO C;  2GGR A;  2LX7 A;  2YDL A;  2CRE A;  1YCS B;  4GLM A;  2KE9 A;  2KRO A;  2HSP A;  2K3B A;  2YUN A;  4ZNX A;  1W6X A;  5GJW B;  1JXO A;  4OMQ A;  4ORZ A;  1UG1 A;  3VRY A;  5I11 A;  1K1Z A;  2LNH B;  4J9B A;  5IXB A;  1QWF A;  2I0N A;  2HDA A;  1YWP A;  1MV0 B;  3M0T A;  1I0C A;  3RBB B;  1B3Q A;  2K2M A;  1AVZ C;  2CUB A;  2NUZ A;  1E7O A;  1M3B A;  4F16 A;  1NG2 A;  3M0Q A;  3THK A;  1NLP C;  2A37 A;  2KRS A;  3FJ5 A;  2FPF A;  2EYY A;  1GCQ C;  3ULR B;  2EW3 A;  1NYG A;  4A63 B;  1UDL A;  1RI9 A;  2DX1 A;  2J06 A;  2VKN A;  2DNU A;  4EIK A;  4JZ3 A;  1CKB A;  2DYB A;  3REB B;  2W0Z A;  4CC2 A;  2K7A A;  2J05 A; 
#chains in the Genus database with same CATH topology
 2J6K A;  2ZPH B;  1LPL A;  1X2Q A;  3JCM f;  4C92 B;  4KGX B;  2X4W A;  3CCU T;  2GQI A;  3GNF B;  4DEX A;  5KE3 A;  3OYB A;  2DL3 A;  1Q7Y U;  1VQN A;  3KBG A;  1VA7 A;  2YLC A;  2RD1 A;  3DLM A;  4M75 A;  2MI6 A;  1JJ2 A;  1Q95 G;  3OYI A;  4M77 B;  4DBR A;  3CME Q;  4Z8A A;  3RDV A;  1QP3 A;  1T3S A;  2DXC A;  4M7D D;  1WA7 A;  4LDW A;  4ZGD B;  2CYZ B;  2Y4X A;  1YIT A;  4J9D A;  3S3N A;  1X6B A;  2JS0 A;  1Y71 A;  1X2K A;  4DOW A;  1RUW A;  5CKD A;  4CC4 B;  4IUP A;  2DEU A;  5KYX B;  3DB3 A;  5GAN g;  4FW2 A;  1VQK T;  4HVW A;  3TU4 K;  1MUZ A;  3OW2 S;  4C8Q A;  2CP0 A;  4J83 A;  5GAM d;  1NPP A;  2I2L A;  3DKM A;  2HCK A;  4M7A B;  4M7D E;  2XID A;  1AOJ A;  2XMF A;  3C4S A;  3VYH B;  1Q82 C;  2RHX A;  5GMK m;  1CSK A;  4PJJ A;  5KE2 A;  1IXD A;  5CVI A;  1VQ7 T;  1BK2 A;  2DIG A;  1WXB A;  4N4H A;  3UA7 A;  5GAN 7;  1S72 A;  5CKH A;  1Y96 B;  2AKL A;  1G2B A;  5AT1 B;  1X43 A;  4C92 E;  5LJ5 j;  2LJ1 A;  4IIO A;  3H6Z A;  1IZ6 A;  2AKK A;  3FJP A;  1OV3 A;  9ATC B;  2QDL A;  3JV3 A;  2DL4 A;  4Z89 A;  2PTK A;  2HQH A;  2RJE A;  3EFS A;  4A4E A;  2FL7 A;  2JZ2 A;  5D6X A;  4J7F A;  3BDU A;  1TSF A;  2QK0 A;  2ENM A;  3SDZ A;  4E7H A;  2KYM A;  4QT7 A;  2FRY A;  3A98 A;  1HYO A;  2RH2 A;  4GBQ A;  1LJO A;  4NL2 A;  2RQU A;  2EAY A;  1WYX A;  1RAH B;  1Q7Y R;  3RUX A;  3JB9 H;  3OB9 A;  1BB9 A;  3JCM g;  3E2U A;  4B9X A;  4V2S A;  1N6A A;  3NGP A;  3QJY A;  3EGX B;  1I07 A;  3M4G A;  2COY A;  4FL6 A;  4OGC A;  1NYF A;  3CCE T;  2DEQ A;  4PJN A;  1R8O B;  2QDY B;  5FU6 C;  1SHG A;  3OA6 A;  3L2Q A;  4JS5 A;  2E5K A;  2EGE A;  1VQ5 Q;  4M75 C;  1U06 A;  4FYW B;  2KDS A;  2K4Y A;  3EG1 A;  4OGE A;  3I35 A;  5GAO m;  3OYK A;  3LWH A;  4GY5 A;  1Q82 R;  4O6J A;  1Y57 A;  3NMZ C;  1VIE A;  4J9I A;  1M90 R;  1FWZ A;  1RLQ C;  2RMO A;  2XK0 A;  2L8D A;  2CZ7 B;  3FIF A;  4PJM A;  5L8R E;  4QVD A;  2LX9 A;  3CC7 Q;  1GL5 A;  1QW1 A;  3G4S A;  1Q86 R;  1M3A A;  2A7Y A;  3MEW A;  2RF0 A;  1PG5 B;  5LJ5 d;  1NEB A;  2QTX A;  1KG1 A;  3OYA A;  3M0U A;  3VS5 A;  3LX7 A;  4KBM B;  1FXX A;  1QVG A;  1XQH A;  2FYK A;  2HAX A;  1VQN Q;  2O4X B;  1R0C B;  2L3R A;  4WF2 A;  1NZ9 A;  3ZBD A;  2HKQ B;  4F14 A;  2M0Y A;  3DB4 A;  2PZ1 A;  4A4K A;  1U3O A;  4XTY A;  4LNP A;  3MP6 A;  4DBH A;  1VQP A;  1WJS A;  4JZ4 A;  3A8O B;  2NUT A;  2CDT A;  1KQS S;  2RNA A;  3J7A F;  5L23 A;  2M0O A;  1Q81 U;  4QVC A;  4M78 A;  1LOJ A;  1D3B A;  3QYH B;  2OJ2 A;  2K79 A;  3F70 A;  2F2V A;  4J6W A;  3RNJ A;  1VQO T;  1V29 B;  3SWN B;  4E7J A;  2XDB A;  2LJ0 A;  1PSE A;  3EG9 B;  2OTJ Q;  2X3X D;  2KSS A;  1SRL A;  3E9F A;  2VWF A;  2AT1 B;  3VS4 A;  3A8M B;  1AD5 A;  3LYI A;  4LUE A;  4RTX A;  5KYU B;  1VQ9 T;  2EGA A;  3VU3 C;  2V1Q A;  2GF7 A;  4MZP A;  1VYU A;  1WLP B;  1OPK A;  3JCM e;  1I1J A;  5CKE A;  2NUP B;  2H3E B;  3HP9 A;  2G6F X;  2PUO B;  2ZPB B;  3CPW P;  2DPP B;  1M8M A;  2XI9 A;  1W2B P;  3I9Q A;  5M9O A;  3Q1J A;  3P8H A;  3E19 A;  1V1C A;  3FLG A;  3OBW A;  2B86 A;  5KYW A;  2RO0 A;  4L5G A;  5FU6 B;  2KR3 A;  1H64 1;  5EG2 A;  4RUG A;  1W2B A;  4HCB A;  1YP5 A;  2K3Y A;  5FLX E;  4QQG A;  1E6G A;  3CPW A;  3L2U A;  2K6D A;  1CKA A;  3OS2 A;  2ZGW A;  4F17 A;  2P0Q A;  4LD6 A;  1FMV A;  3I55 Q;  3X25 B;  2EQU A;  2WAC A;  1JB0 E;  1R77 A;  5LL6 S;  2GBQ A;  5GAN 5;  2MK5 A;  1VQ7 Q;  5IHN A;  3SB2 A;  5GAN 8;  2QTV A;  5C0M A;  1QCN A;  2JOY A;  2XKO C;  1QQJ A;  3A1P A;  2OI3 A;  2EJF A;  1HXD A;  3CMA Q;  4M7D C;  3O5Z A;  2R5A A;  4HA8 A;  3PNW C;  3CCV T;  2MMP A;  3FDR A;  1G3S A;  2ZPG B;  4HCC A;  3V8J A;  3TCJ A;  4N4I A;  1P92 A;  1K9M R;  4XTZ A;  3X20 B;  2F5T X;  1WXU A;  3C0C A;  3JSC A;  3HFN A;  3ER0 A;  2EJG A;  2VAS A;  2X4Y A;  3HKS A;  2NWM A;  5HK3 A;  3CCQ Q;  2EWN A;  1JQQ A;  4C5G A;  5IH2 A;  4OML A;  3VV0 A;  3CC7 A;  3EFO B;  1OU8 A;  1VQ6 A;  2DRM A;  5CCA A;  2HL3 A;  2K3X A;  3CCM A;  1M1F A;  3OMC A;  5A0G A;  4MZM A;  4MDX A;  1C0M A;  4M78 F;  4EMH A;  2EJ9 A;  3OYL A;  1RAA B;  1OI1 A;  2DZC A;  1W6X A;  1JXO A;  4FM4 B;  3OS1 A;  3CCE Q;  1M2V B;  4HCZ A;  1YJW Q;  4NOY A;  5CK9 A;  1QVF S;  3X26 B;  2DAQ A;  5IXB A;  1QWF A;  3X24 B;  2VUB A;  2DYI A;  1YWP A;  4BI3 A;  1M1K C;  1WJQ A;  2RI3 A;  1IHW A;  1AVZ C;  2CUB A;  2NUZ A;  1S72 Q;  3CBP A;  3WXM B;  3CC4 T;  4ZTF A;  1KC8 U;  3M0Q A;  1H3Z A;  3C94 A;  3QDF A;  3FJ5 A;  3QBY A;  2FPF A;  3ULR B;  1NYG A;  2RJC A;  1UDL A;  4X9D A;  2QQA A;  1RL2 A;  4DQ2 A;  1MMA A;  1QCO A;  3L2W A;  3JCM d;  5CAI A;  4CC2 A;  3MP8 A;  1I5O B;  2KK4 A;  4ELZ C;  4M7D F;  4RTV A;  1OUL A;  5I2S A;  4QW2 A;  3S3O A;  3OS0 A;  3CC2 T;  4AT1 B;  1WQ7 A;  3HRT A;  5HKC A;  4LN2 A;  5GAO l;  1PM3 A;  1I8F A;  1M30 A;  1WPY A;  2AIR B;  3H0H A;  2DD5 A;  2CGH A;  4RTY A;  5HY6 A;  1OPL A;  1ZHI A;  2ABL A;  2RI5 A;  5CIU A;  2RQR A;  3IQL A;  3EFR A;  2YUP A;  3VS6 A;  2YT6 A;  1KC8 C;  1YHQ A;  3CC2 Q;  1C1A A;  4P5N A;  2E10 A;  5GAN 2;  2D8J A;  1D09 B;  2WSE E;  4K11 A;  3OYN A;  1N8R C;  1ABO A;  3A8G B;  5I22 A;  2Z0W A;  3UT1 A;  3AHU A;  1FX7 A;  2LTO A;  4JJN K;  2DKG A;  1SF9 A;  1T0H A;  1RAE B;  4MZT A;  1V76 A;  3EG3 A;  4JPB W;  3V7R A;  1JRI A;  1YHQ T;  4M77 G;  4L59 A;  4OMF B;  1TUG B;  3J81 E;  1X75 C;  4R0K A;  5FRO A;  2XDD A;  1WHM A;  1VOM A;  3DLL A;  3G6E A;  1SG5 A;  1A0N B;  4MMK A;  4J6Y A;  4C8Q G;  4J8O A;  4XTV A;  1BI1 A;  4CI0 C;  1Q81 C;  2PVG B;  2VVK A;  2QA4 T;  2V8K A;  1VQL A;  2D6F A;  3NFC A;  1UEB A;  1MMG A;  2E5Q A;  2MIO A;  1X6O A;  2WSC E;  2JT4 A;  2L5Q A;  2HD0 A;  2QA4 A;  2O88 A;  1U1S A;  5KH6 A;  2VYT A;  3CCQ A;  3H8Z A;  2X4J A;  2MOX A;  4OMO A;  3G71 Q;  2EYX A;  4AFU C;  4C0F A;  1HD3 A;  4F7U B;  4C8Q D;  2LVM A;  2P0P A;  4XU2 A;  1K73 C;  1YJN T;  2JXB A;  4FYV B;  3TQ7 P;  3QHS A;  4M7A A;  1HJD A;  1ZSZ B;  2SEM A;  4ZN3 A;  2FPE A;  2J6F A;  4FIB A;  3RR6 A;  1MV3 A;  2QA4 Q;  1Q7Y C;  3QPH A;  1VQ6 T;  2YWW A;  4AFZ C;  3VKI A;  3LGF A;  1LVK A;  1YHQ Q;  4XU1 A;  2DL8 A;  1YI2 Q;  1Y7X A;  1YBY A;  4IUR A;  2FPD A;  2ECZ A;  4KRT A;  4BI8 B;  4QKU A;  4M75 E;  3CCM Q;  1OZ3 A;  1BU1 A;  2E3I A;  4C8Q E;  5GAM f;  4JLG A;  2CSQ A;  3H0I A;  4RTT A;  2BZX A;  4N0A C;  4AFS C;  1ZX6 A;  3MO8 A;  1Y0M A;  4FT4 A;  1W70 A;  3SFM A;  4Y28 E;  2BZ8 A;  5GAN d;  4D6W A;  2R58 A;  1PC0 A;  2JMC A;  3M57 A;  4M7A C;  2QXF A;  4PJO B;  4II1 A;  1KQS A;  1N8R U;  5D7U A;  1VQN T;  3ZEH A;  3CC2 A;  2EKH A;  1OX8 A;  3EHR A;  1QCF A;  2A28 A;  1TH7 A;  4C5E A;  2YSQ A;  1T0J A;  2ATC B;  4E7I A;  4LDY A;  1IO6 A;  2DVJ A;  3I56 A;  2DLP A;  4F04 B;  3CXC P;  3CCM T;  3QWY A;  3EFO A;  3MET A;  1D1A A;  1QP2 A;  1UHC A;  4F7U A;  2CP5 A;  2ZPI B;  3S3M A;  1VIF A;  3CEY A;  3KFV A;  4XAX B;  4C92 D;  2DL5 A;  2OTL A;  4BDY A;  1ZBX A;  1VQM A;  3QZ5 B;  3KUF A;  3M56 A;  4HT9 A;  1PD0 A;  2EQI A;  5KYY A;  5KCH A;  2OTL T;  4XTX A;  2EIF A;  1G8X A;  5CQY A;  3PT9 A;  3WVD B;  2HKN A;  4JJC A;  4QQD A;  3R6N A;  5CKB A;  4HCK A;  3SWN A;  2NUT B;  1YN8 A;  5GJV B;  1TWB A;  3G6E Q;  3VS2 A;  1W2B S;  1BBZ A;  2DET A;  5CR2 A;  2O9S A;  1GXI E;  1TS9 A;  3CPW S;  3GOX A;  2LQK A;  4ESR A;  4JRQ A;  2JN0 A;  2P4R A;  2HQE A;  1JO8 A;  3OYD A;  4WCI A;  4M7A F;  2EQM A;  3SHW A;  3M58 A;  4F7U G;  1B34 A;  3MCA B;  4CC3 A;  3OYF A;  3VS0 A;  1SSH A;  3VS3 A;  2KT8 A;  2E4H A;  4LE9 A;  3X28 B;  1GBR A;  4ELY C;  2FRW A;  2JTM A;  1JXM A;  3PFS A;  3JB9 F;  4O5V A;  1XOV A;  1BIA A;  2E41 A;  2KBT A;  5DLQ E;  3FB9 A;  3V7S A;  1WFW A;  2HBW A;  1YJW T;  3UA6 A;  5LJ3 j;  4WTO B;  4MML A;  2QGG A;  1WJR A;  2PVD B;  4CC7 A;  1JU5 C;  4XK8 E;  2YUO A;  2QQS A;  1K73 R;  3OYH A;  4PFO A;  1RAG B;  5IHK A;  1IGQ A;  1GRI A;  1YJ9 T;  1K8A R;  4M78 E;  2VB6 A;  1OOT A;  1AWO A;  1VQP T;  5LJ3 e;  2LDM A;  1QVF A;  3JB9 I;  4C5I A;  1LCK A;  1WX6 A;  3D7S B;  2V1R A;  4ATO A;  3TSZ A;  3MHX A;  2DJZ A;  2GCX A;  2JS2 A;  4FYY B;  2L3S A;  2J6O A;  4J6X A;  3HFO A;  2ZPE B;  4B9W A;  4LD9 K;  3PE0 A;  3RKX A;  4AMC A;  1WNL A;  4BY6 B;  3I55 A;  2K5I A;  4KUD K;  3BY7 A;  2KAF A;  3CPF A;  5FU7 B;  1AHJ B;  3BW1 A;  5GAM e;  2DA9 A;  2D9T A;  2CZ6 B;  4C92 G;  2ROT A;  3ZL7 C;  3GIB A;  3M4Y A;  1SEM A;  4F7U E;  2DXU A;  3I5S A;  2DL7 A;  5GAO p;  2LCL A;  4BAC A;  1NLO C;  2GGR A;  4M75 B;  2YDL A;  1YCS B;  4PK4 A;  1U1T A;  2HQX A;  2QEX T;  4GLM A;  3H9N A;  1YJN A;  2KRO A;  2YUN A;  4Z02 A;  3URG A;  1UG1 A;  3CCQ T;  3LLR A;  4OB1 B;  2LNH B;  4VUB A;  4J9B A;  2LCC A;  4M78 B;  2HDA A;  3M0T A;  2BUD A;  3RBB B;  2OTJ A;  1E7O A;  3CCR A;  1M4Z A;  1YIT Q;  5GAO q;  3OYC A;  2KRS A;  3RMQ A;  3MPU B;  3QKJ A;  2G3R A;  1ZSZ A;  2MYS A;  1GCQ C;  3LGL A;  3VUB A;  2XDP A;  1D3B B;  4EPC A;  2DNU A;  2K57 A;  2L89 A;  2R57 A;  5GAN h;  3JRZ A;  3QYG B;  4RKU E;  3JAM E;  2J05 A;  2W10 A;  3UWN A;  2DM1 A;  2JVV A;  5LJ3 d;  3JCM W;  2LRQ A;  1X69 A;  3OW2 A;  2C0I A;  4RTU A;  2JW4 A;  1T3L A;  3UF4 A;  2M16 A;  4Z88 A;  5CO7 A;  2YXY A;  4C0D B;  1QVF P;  1TG0 A;  2RA2 A;  2CUD A;  4GLK A;  1YFN A;  4BDZ A;  3C12 A;  4C92 F;  3TSW A;  2DIQ A;  3TEE A;  3OY9 A;  1U5S A;  4PJO F;  4OF1 A;  1FMW A;  2QQR A;  2RB6 A;  1KHI A;  2KQW A;  5KYU A;  2P84 A;  4PFP A;  1M2O A;  3CC4 Q;  3JCM P;  2K5L A;  1AT1 B;  1M2V A;  1X27 A;  2VC8 A;  3G1J A;  2GFU A;  1WHL A;  2O31 A;  1ZA1 B;  1YIJ A;  4RG8 A;  2FEI A;  2E6N A;  4PFZ A;  1SKU B;  4EMK B;  2MAM A;  2Y90 A;  3QWX X;  2RJF A;  3H0F A;  3P8B B;  4IUU A;  1FYN A;  2DE0 X;  2LQ8 A;  2XIC A;  4DBQ A;  2M02 A;  4M75 F;  2BIV A;  2K2V A;  1K0S A;  1BCO A;  2M9U A;  2KXC A;  2RPN A;  3SD4 A;  2LP5 A;  4UC4 A;  2COW A;  1BKB A;  2L3P A;  3MKD A;  4ZGE B;  2KRM A;  1Q86 U;  5KCO A;  1PRL C;  3RKY A;  1M1K U;  2DIL A;  1MMD A;  3UDC A;  1UGS B;  2V26 A;  3CCS T;  2AZS A;  1PRM C;  8AT1 B;  4Y92 A;  1KQ2 A;  4M77 D;  2Y4Y A;  1M3C A;  2YUQ A;  4MDW A;  1IHV A;  3EAE A;  4A4G A;  1JJ2 S;  4DA4 A;  5IN1 A;  4PNO A;  3BDL A;  2C0T A;  1G83 A;  2F2X A;  1TTH B;  3V8K A;  1G3W A;  5D6W A;  2LZ6 B;  1AWW A;  5GMK l;  1VQP Q;  4OP0 A;  3HL8 A;  1ZLM A;  5GMK h;  4RG2 A;  3LH0 A;  3OQ5 A;  3RIR A;  4N0A A;  3INZ A;  4B6M A;  3CD6 A;  3OYY A;  3SEM A;  3CXC A;  5ECA A;  2X9H A;  3L1A A;  3VRZ A;  5A2Q E;  4OB3 B;  5DLO A;  4PJO C;  2YRV A;  4F7U F;  2F1L A;  1ACM B;  2PUK B;  4FCY A;  2E3H A;  3RES A;  1WI7 A;  2L0A A;  3NPF A;  2YRD A;  2X35 A;  5IAY A;  4JJD A;  4X9C A;  4M7A D;  3MEA A;  1WHH A;  5DY9 A;  3LWI A;  3EH1 A;  3I5R A;  1IB8 A;  1KQ1 A;  1VQO A;  2O9V A;  2LQN A;  2KRN A;  4LDX A;  1H92 A;  1KD1 C;  8ATC B;  1NJI U;  3C95 A;  3VUZ A;  5GAM j;  2MWO A;  5CQX A;  1I5L A;  3CCU A;  4M78 D;  1ABQ A;  1UTI A;  2LQW A;  2RQT A;  2ZPF B;  3NTI A;  3QDR B;  1M27 C;  3M53 A;  1YIJ Q;  1KD1 R;  4TVR A;  1M1G A;  5LJ3 h;  1B7T A;  4RTW A;  2YRC A;  4M7A E;  1MND A;  2OX7 A;  2DTO A;  2V8I A;  1SPK A;  3R6O A;  4C5H A;  4XU0 A;  1UGP B;  3CCU Q;  2H3J A;  3TRE A;  4HVU A;  1NE8 A;  3HPW A;  2LMJ A;  5IT9 E;  2KI7 A;  3RMS A;  2XD0 A;  2XG8 D;  3G6E T;  1OYX A;  4BE1 A;  2CS7 A;  2B8A A;  1PKT A;  3M0R A;  2CSI A;  4M77 C;  2EKO A;  3EGX A;  4KH1 B;  4OMN A;  2V8J A;  5LJ5 h;  3JCM c;  5LJ5 f;  4PJO E;  2ESW A;  4J9C A;  3UAT A;  5GAO n;  1UJ0 A;  1QLY A;  5HCK A;  3CCR T;  1VQM T;  4BUG A;  2EYZ A;  1WDX A;  5FWB A;  2IG0 A;  4C8Q C;  2GTJ A;  4A54 A;  1M5Q 1;  2QAZ A;  4M77 A;  1QVG S;  1YJ9 Q;  2RHZ A;  2CH4 A;  2PNI A;  4RMO A;  1VQK Q;  1XTD A;  1ZUU A;  2XHC A;  1NM7 A;  4CRI A;  2JNG A;  4E7Z A;  2EFI A;  1R0B G;  4BE0 A;  1LNX A;  2XU8 A;  4BD3 A;  4PJO D;  1UUE A;  1N8R R;  1J3T A;  4A4F A;  2QG9 B;  3CD6 Q;  1OX9 A;  3SWN C;  3VS1 A;  2CT3 A;  4JUV A;  5FU7 C;  2OTL Q;  2FB7 A;  4M78 C;  1WHJ A;  3CCL T;  1UGV A;  1HK9 A;  2X4X A;  1RAB B;  3QZ9 B;  4BY6 C;  2PU9 B;  2OAW A;  2X51 A;  2PQW A;  3OYE A;  5GMK j;  2DBM A;  5GAN f;  4LXC A;  1GFD A;  2E6Z A;  3JCM V;  1VQL T;  3QUI A;  3M5A A;  1I81 A;  1WHK A;  3G4S T;  3G71 T;  3JCM J;  1HSQ A;  1UJY A;  2CP2 A;  4L6V 5;  1PKS A;  2HZY A;  4J9F A;  1TXQ A;  1O9S A;  4AG2 C;  3E1S A;  4FYX B;  1JBM A;  2JJ9 A;  3OYJ A;  1D1C A;  2CZ0 B;  1OEB A;  2RK2 A;  1Y07 A;  1K0X A;  1KFZ A;  3VYG A;  1G3Y A;  1XJW B;  1K4U S;  1UEC A;  1RI0 A;  3OSS C;  3UPU A;  1UFF A;  1BYM A;  1VQ9 A;  4PL6 A;  4BI4 A;  2NUP A;  5LJ3 f;  4IUV A;  2FHD A;  1TOV A;  5CKF A;  2D0N A;  4IIM A;  2K5F A;  1WGS A;  4DOV A;  2DTI A;  4LUD A;  4D8D A;  2KYB A;  1VQO Q;  2RI2 A;  1VQ8 A;  1G3T A;  3HHT B;  1BI3 A;  1K76 A;  3CC4 A;  4C8Q F;  1S72 T;  1M8V A;  4N4G A;  1KIK A;  1D0Z A;  2HL5 C;  3PIP A;  3NTH A;  1TUD A;  3WVE B;  3N5B B;  4D8K A;  1O75 A;  1QKW A;  3M0S A;  3M55 A;  4XU3 A;  5C6S A;  5FRN A;  4LDU A;  2D0Q B;  3NTK A;  5D6Y A;  4OB0 B;  5KYW B;  2AHJ B;  2GNC A;  5GAN 6;  3VS7 A;  5LJ5 g;  1SHF A;  2KEA A;  4AG1 C;  3G7Z A;  3PVQ A;  5J39 A;  3G4S Q;  2KNB B;  2DRK A;  1VQ8 Q;  1ZUY A;  3PMI A;  3LH5 A;  2LX7 A;  3JCM Q;  4A4H A;  1SSF A;  4KT0 E;  2BKD N;  1NPR A;  2CP6 A;  3BE3 A;  5GMK e;  2VXF A;  3CCJ T;  1W4S A;  2QGF B;  2HSP A;  2K3B A;  1RAC B;  2JUF A;  5GJW B;  2O01 E;  3CMA A;  1KD1 U;  4OMQ A;  4R56 A;  2QQ9 A;  4M77 E;  1K1Z A;  2E65 A;  4X34 A;  2ZZD A;  1YCY A;  2I0N A;  2HSE B;  3AT1 B;  1I4K 1;  1MV0 B;  4PJO G;  3I55 T;  4J7I A;  3GNG A;  2DXB A;  3I56 Q;  3G71 A;  3BFM A;  3THK A;  2A37 A;  3M9Q A;  2VGN A;  4OVA A;  4RCB A;  3ASK A;  4A63 B;  1VQ7 A;  3S6W A;  3OBY A;  4KGZ B;  3CCV A;  2J06 A;  4NL3 A;  5A0D A;  2VKN A;  1OZ2 A;  4EIK A;  4JZ3 A;  2DYB A;  3REB B;  2W0Z A;  3QO3 A;  3E9G A;  1VUB A;  2QAS A;  1YJW A;  5DM7 R;  2LC4 A;  1C6V X;  1D1B A;  1VYV A;  1ZSG A;  2DBK A;  3QJ6 A;  2D8H A;  3I56 T;  1YJN Q;  2YHT A;  3RER A;  2A36 A;  2DMO A;  1KC8 R;  4FW1 A;  1N9R A;  2ROL A;  1ZA2 B;  5J26 A;  3QXE B;  1KJW A;  4E7S A;  1Q86 C;  4M7A G;  1EFN A;  5KYX A;  3EGD B;  3MEU A;  1GBQ A;  1OQK A;  6AT1 B;  4M7D B;  2KMT A;  4Q5W A;  2CZ1 B;  3PTA A;  3CQT A;  4JS4 A;  4JJB A;  1YI2 A;  4C8Q B;  2SRC A;  1YIT T;  3A8L B;  4FU6 A;  2GTO A;  1WZO A;  4M78 G;  2EVR A;  3CCJ A;  2CP7 A;  1M9S A;  4FSS A;  2A08 A;  5FRM A;  1K8A U;  5IHI A;  2DTH A;  1YJ9 A;  1ZUK A;  3A5Z B;  2HNI A;  3EG9 A;  2ZCF B;  3MP1 A;  3FEO A;  1YNZ A;  2L2P A;  1IRE B;  1PD1 A;  1GCQ A;  3V7C A;  1W1F A;  1YWO A;  4EMK A;  2JTE A;  1MNE A;  2EBP A;  2DO3 A;  4RTZ A;  2QI2 A;  4M4Z A;  5I2M A;  2KVQ G;  3OYM A;  1MGQ A;  2DF6 A;  1K9M U;  1QKX A;  4C92 C;  3H41 A;  3EH2 A;  3CME T;  4DBF A;  2CP3 A;  1VQ6 Q;  4FSX A;  2E12 A;  2KT1 A;  1PNJ A;  1XNI A;  3CCS A;  1K8A C;  4JRP A;  3GLX A;  2KGT A;  2FVU A;  2C0O A;  2KY9 A;  2EQK A;  1PSF A;  4DEY A;  2FZG B;  2HEQ A;  3M54 A;  1AWJ A;  3NHN A;  4LDV A;  2WSF E;  3CCS Q;  1YIJ T;  4Y91 A;  1ARK A;  2EYQ A;  3HTR A;  5EC7 A;  4BE2 A;  4JLI A;  1WIE A;  1VQ5 A;  1ZBJ A;  2RN8 A;  4AFQ C;  2MCN A;  3OW2 P;  4OB2 B;  5FW9 A;  2LT4 A;  3ME9 A;  3HRS A;  4JDS A;  3OMG A;  3QII A;  5GAM h;  1K9M C;  1GCP A;  2RJD A;  2DJQ A;  2P0K A;  2D1X A;  3EGU A;  4C0D C;  1N9S A;  4PKC C;  3L2R A;  4IUT A;  1VYT A;  2PVO B;  1QVP A;  1RAI B;  4OMP A;  3MJX A;  2LNV A;  3MEV A;  4KUI A;  4M77 F;  5FWC A;  5HK0 A;  4J5Y A;  4EDU A;  1QMC A;  4M7D G;  1VQ8 T;  2DD4 A;  4ZN1 A;  4M75 D;  4JRI A;  2QQB A;  1Z9Z A;  2K9G A;  2DFU A;  1VQM Q;  5GAO r;  1QWE A;  3EG0 A;  2IVW A;  3QSU A;  3GF5 A;  2NLU A;  2CH4 W;  2M1H A;  4QVZ A;  3CCL Q;  5I21 A;  3GBQ A;  4E47 A;  1PWT A;  2O4X A;  1KHC A;  3PVL A;  2QEX Q;  2E70 A;  3KXT A;  1BIB A;  2COZ A;  3O8V A;  2HBP A;  3A8H B;  1D0Y A;  3VJP A;  1VQ9 Q;  2JTF A;  4M75 G;  3FRN A;  1KSW A;  2JM9 A;  3T9N A;  2VV5 A;  1AEY A;  2RM4 A;  1PCX A;  1ZQ1 A;  3OYG A;  1U8R A;  2E1H A;  4X1V A;  2BTT A;  1BCM A;  2FG0 A;  2P4T A;  5GAN e;  2OTJ T;  3JCM b;  4JRK A;  1MMN A;  4M7D A;  3CCL A;  3JB9 J;  4KUL A;  3JCM h;  1M90 U;  3CBO A;  2JM8 A;  4OMM A;  2QEX A;  2IPO B;  3QG1 A;  2DXT A;  4EMK C;  4E7K A;  2FZK B;  4J9G A;  3REA B;  3CMA T;  2KXD A;  2L3Q A;  2A3L A;  3TVT A;  1QVG P;  1NBE B;  3CCE A;  2EGC A;  1DJ7 B;  2F69 A;  1AZE A;  1WHG A;  1E6H A;  3L42 A;  3JCM X;  3OSV A;  2F2W A;  1Z9Q A;  2O2O A;  3JB9 G;  1X6G A;  4PJO A;  1PHT A;  2LJ3 A;  3U23 A;  4J9H A;  2NYS A;  1RAF B;  1RLP C;  3RKW A;  3J80 E;  5A0L A;  4ANJ A;  4KGV B;  1KK7 A;  3EHQ A;  4E6R A;  1UGR B;  2OAU A;  1G5V A;  2H8H A;  1VQL Q;  5GAN j;  2GFA A;  4XTU A;  4YTL A;  4FT2 A;  1ZSZ C;  2AZV A;  4HKE A;  2LCS A;  1UGQ B;  1M90 C;  1N5Z A;  4IUQ A;  2F5K A;  2LT1 A;  3EG2 A;  5LJ5 e;  2HMA A;  2RQW A;  2X3W D;  2AK5 A;  4RCC A;  1FMK A;  4QQ6 A;  2EPD A;  1WXT A;  4NS5 A;  3CCJ Q;  5J3B A;  1K73 U;  1AZG B;  2BE9 B;  4J9E A;  5LJ3 g;  1Q82 U;  1EX4 A;  4E7L A;  5GAN 3;  2QYZ A;  2JMA A;  1IRX A;  1Q81 R;  1B07 A;  1IGU A;  1AWX A;  3CCR Q;  4HVV A;  2FO0 A;  5AYF A;  2RK1 A;  1H3H A;  1UE9 A;  2MWP A;  1BI0 A;  2RQV A;  3M59 A;  4KH0 B;  1UHF A;  1JJ2 P;  3FC3 A;  1S1N A;  1JEG A;  2BE7 D;  2MPX C;  7AT1 B;  1M1K R;  2C06 A;  3L2Z A;  4PJL A;  1K9A A;  2IIM A;  2RHU A;  4R55 A;  3PGG A;  1UB4 A;  2ED1 A;  2ED0 A;  1WQW A;  1RAD B;  3P8D A;  3OS5 A;  1VQK A;  1VQ4 Q;  4HXJ A;  1B34 B;  3HSB A;  2EQJ A;  2J7I A;  5GMK i;  3HRU A;  1NJI C;  2BZY A;  5GAN 4;  5IXF A;  1TU0 B;  3GPL A;  1TUC A;  2MF2 A;  2GQV A;  3M0P A;  1H8K A;  1NEG A;  2CT4 A;  3LW5 E;  2M51 A;  4C0Z A;  4EMG A;  2VGM A;  2R5M A;  3V8L A;  1YI2 T;  1VQ5 T;  4PLI A;  1NJI R;  1GFC A;  3CD6 T;  2EYW A;  1SRM A;  2A0F B;  1EIF A;  1VQ4 A;  1X01 A;  2CRE A;  4PLL A;  2VXE A;  5GAM g;  1VQ4 T;  1D0X A;  3EGD A;  3JB9 D;  4A53 A;  2KE9 A;  5KYN A;  4ZTJ A;  1F1B B;  3CC7 T;  4ZNX A;  4XQ3 A;  3ZFJ A;  4IKF A;  2FZC B;  4E2F B;  4ORZ A;  3VRY A;  3L2V A;  2ZAE A;  5I11 A;  3CCV Q;  4XTW A;  2CKK A;  3CBM A;  4ME7 A;  1KQS P;  5KYY B;  4ZGJ B;  1I0C A;  1B3Q A;  2DZ9 A;  2K2M A;  1Y96 A;  2DK3 A;  4HT8 A;  1MHN A;  1M3B A;  4C92 A;  4F16 A;  1NG2 A;  1NLP C;  1BI2 A;  2DVE A;  1EZZ B;  1OU9 A;  2EYY A;  2EW3 A;  2YLB A;  1RI9 A;  1N27 A;  2RHY A;  4C0G A;  2DX1 A;  3CME A;  4BB7 A;  2DER A;  3PIO A;  3PMT A;  3CXC S;  2E64 A;  1CKB A;  2RHI A;  3GP8 A;  2K7A A; 
#chains in the Genus database with same CATH homology
 2W10 A;  2DM1 A;  2J6K A;  4RTV A;  1X69 A;  2C0I A;  1X2Q A;  1VYV A;  1ZSG A;  2DBK A;  4RTU A;  2JW4 A;  1T3L A;  3UF4 A;  2GQI A;  2D8H A;  4Z88 A;  4DEX A;  2DL3 A;  4LN2 A;  2A36 A;  2DMO A;  1M30 A;  1VA7 A;  1TG0 A;  3H0H A;  2CUD A;  2ROL A;  4RTY A;  1KJW A;  1OPL A;  1EFN A;  2ABL A;  3TSW A;  1GBQ A;  4Z8A A;  1U5S A;  1T3S A;  2RQR A;  3IQL A;  2YUP A;  3CQT A;  3VS6 A;  1WA7 A;  4JJB A;  2YT6 A;  2SRC A;  4J9D A;  1X27 A;  1X6B A;  2JS0 A;  2D8J A;  2GTO A;  1X2K A;  2EVR A;  2O31 A;  4K11 A;  1RUW A;  1ABO A;  2FEI A;  4FSS A;  2A08 A;  5I22 A;  5IHI A;  4CC4 B;  1ZUK A;  3QWX X;  3H0F A;  1T0H A;  4HVW A;  1MUZ A;  1FYN A;  3EG3 A;  4JPB W;  2DE0 X;  1YNZ A;  2HCK A;  2L2P A;  1K0S A;  1GCQ A;  1AOJ A;  2XMF A;  2KXC A;  2RPN A;  4R0K A;  2LP5 A;  1W1F A;  2L3P A;  1YWO A;  2KRM A;  1CSK A;  2JTE A;  1BK2 A;  2EBP A;  1A0N B;  1WXB A;  4RTZ A;  3UA7 A;  4M4Z A;  1PRL C;  2DIL A;  2DF6 A;  2VVK A;  1QKX A;  3H41 A;  2AKL A;  2AZS A;  1PRM C;  1G2B A;  1X43 A;  4Y92 A;  2LJ1 A;  2MIO A;  4IIO A;  2KT1 A;  1M3C A;  1PNJ A;  2AKK A;  2JT4 A;  2YUQ A;  2O88 A;  1OV3 A;  2QDL A;  3JV3 A;  2DL4 A;  2KGT A;  4Z89 A;  2PTK A;  2MOX A;  4OMO A;  2C0O A;  2EYX A;  4AFU C;  2C0T A;  1HD3 A;  1G83 A;  2F2X A;  4DEY A;  2JXB A;  2ENM A;  2LZ6 B;  1AWW A;  1HJD A;  2HEQ A;  2KYM A;  1AWJ A;  2SEM A;  4QT7 A;  3NHN A;  2FRY A;  1ZLM A;  3A98 A;  2FPE A;  2J6F A;  1MV3 A;  4GBQ A;  1ARK A;  4AFZ C;  5EC7 A;  3SEM A;  1WIE A;  1ZBJ A;  2RN8 A;  2RQU A;  1WYX A;  2DL8 A;  5ECA A;  3VRZ A;  4AFQ C;  2FPD A;  2ECZ A;  1BB9 A;  2MCN A;  4KRT A;  5FW9 A;  1BU1 A;  2CSQ A;  3H0I A;  3NGP A;  2BZX A;  4RTT A;  1WI7 A;  1GCP A;  2L0A A;  4AFS C;  1ZX6 A;  3NPF A;  1I07 A;  2DJQ A;  2D1X A;  3EGU A;  1Y0M A;  1W70 A;  1NYF A;  1VYT A;  2BZ8 A;  4JJD A;  4OMP A;  2JMC A;  1SHG A;  5FWC A;  3I5R A;  2O9V A;  2E5K A;  2LQN A;  2KRN A;  1H92 A;  2EGE A;  1U06 A;  1Z9Z A;  3EG1 A;  2K9G A;  1QWE A;  3I35 A;  3EG0 A;  2CH4 W;  1Y57 A;  3NMZ C;  4J9I A;  3GBQ A;  1ABQ A;  1UTI A;  2LQW A;  2RQT A;  1RLQ C;  2RMO A;  1PWT A;  2EKH A;  3PVL A;  3EHR A;  1QCF A;  1M27 C;  2A28 A;  2YSQ A;  1T0J A;  1GL5 A;  4RTW A;  1M3A A;  1KSW A;  2JM9 A;  1IO6 A;  2DVJ A;  2DLP A;  2RF0 A;  1SPK A;  1NEB A;  1AEY A;  3M0U A;  3VS5 A;  3QWY A;  4HVU A;  4X1V A;  2LMJ A;  2BTT A;  2FG0 A;  4F14 A;  2M0Y A;  2PZ1 A;  1UHC A;  1U3O A;  4LNP A;  2JM8 A;  1PKT A;  3M0R A;  4JZ4 A;  4OMM A;  3KFV A;  2CSI A;  2CDT A;  2RNA A;  4J9G A;  3REA B;  4OMN A;  2KXD A;  5L23 A;  2L3Q A;  3TVT A;  2ESW A;  4J9C A;  2DL5 A;  3UAT A;  1UJ0 A;  1QLY A;  2EGC A;  5HCK A;  2EQI A;  2K79 A;  2OJ2 A;  2EYZ A;  1WDX A;  1AZE A;  5FWB A;  3RNJ A;  2F2V A;  1E6H A;  2GTJ A;  2F2W A;  1Z9Q A;  4JJC A;  2O2O A;  3R6N A;  1X6G A;  2LJ0 A;  4HCK A;  1PHT A;  2LJ3 A;  2X3X D;  3U23 A;  4J9H A;  1YN8 A;  2CH4 A;  5GJV B;  1RLP C;  2PNI A;  3VS2 A;  1SRL A;  1BBZ A;  2VWF A;  1ZUU A;  3VS4 A;  1NM7 A;  1AD5 A;  4LUE A;  2O9S A;  3EHQ A;  4RTX A;  4E6R A;  2EGA A;  4ESR A;  2P4R A;  1JO8 A;  2V1Q A;  2H8H A;  4WCI A;  1VYU A;  1WLP B;  1OPK A;  1I1J A;  3SHW A;  2AZV A;  1UUE A;  2G6F X;  1J3T A;  4CC3 A;  2LCS A;  3VS0 A;  1SSH A;  1N5Z A;  3VS3 A;  3VS1 A;  2CT3 A;  1M8M A;  2KT8 A;  3EG2 A;  3I9Q A;  2RQW A;  2X3W D;  4LE9 A;  1V1C A;  2AK5 A;  1UGV A;  1FMK A;  1GBR A;  2B86 A;  2FRW A;  2EPD A;  1WXT A;  1JXM A;  1XOV A;  2OAW A;  2KR3 A;  2KBT A;  1AZG B;  1WFW A;  4J9E A;  2HBW A;  4RUG A;  2DBM A;  1GFD A;  1YP5 A;  2JMA A;  3UA6 A;  1E6G A;  1B07 A;  1AWX A;  4CC7 A;  2K6D A;  4HVV A;  1CKA A;  2FO0 A;  1JU5 C;  2YUO A;  4F17 A;  1HSQ A;  1UJY A;  1H3H A;  1PKS A;  1UE9 A;  4J9F A;  4AG2 C;  2RQV A;  5IHK A;  1GRI A;  1UHF A;  2GBQ A;  1OEB A;  1OOT A;  1S1N A;  1AWO A;  1JEG A;  1K0X A;  5IHN A;  1KFZ A;  1K4U S;  1LCK A;  1UEC A;  1WX6 A;  1UFF A;  2V1R A;  3TSZ A;  2OI3 A;  1K9A A;  2IIM A;  3O5Z A;  2JS2 A;  2D0N A;  2ED1 A;  4IIM A;  2ED0 A;  2L3S A;  2J6O A;  4LUD A;  4D8D A;  2KYB A;  3PE0 A;  1K76 A;  4HXJ A;  1KIK A;  2J7I A;  1WXU A;  3C0C A;  2BZY A;  1TUD A;  5IXF A;  4D8K A;  1QKW A;  3M0S A;  1TUC A;  3M0P A;  1H8K A;  2NWM A;  1NEG A;  2DA9 A;  2CT4 A;  1JQQ A;  2M51 A;  2GNC A;  2ROT A;  3VS7 A;  5IH2 A;  1SHF A;  3ZL7 C;  2KEA A;  4AG1 C;  4OML A;  3PVQ A;  2KNB B;  2DRK A;  1ZUY A;  1SEM A;  1GFC A;  2EYW A;  1SRM A;  3I5S A;  2DL7 A;  2DRM A;  3LH5 A;  1NLO C;  2GGR A;  2LX7 A;  2YDL A;  2CRE A;  1YCS B;  4GLM A;  2KE9 A;  2KRO A;  2HSP A;  2K3B A;  2YUN A;  4ZNX A;  1W6X A;  5GJW B;  1JXO A;  4OMQ A;  4ORZ A;  1UG1 A;  3VRY A;  5I11 A;  1K1Z A;  2LNH B;  4J9B A;  5IXB A;  1QWF A;  2I0N A;  2HDA A;  1YWP A;  1MV0 B;  3M0T A;  1I0C A;  3RBB B;  1B3Q A;  2K2M A;  1AVZ C;  2CUB A;  2NUZ A;  1E7O A;  1M3B A;  4F16 A;  1NG2 A;  3M0Q A;  3THK A;  1NLP C;  2A37 A;  2KRS A;  3FJ5 A;  2FPF A;  2EYY A;  1GCQ C;  3ULR B;  2EW3 A;  1NYG A;  4A63 B;  1UDL A;  1RI9 A;  2DX1 A;  2J06 A;  2VKN A;  2DNU A;  4EIK A;  4JZ3 A;  1CKB A;  2DYB A;  3REB B;  2W0Z A;  4CC2 A;  2K7A A;  2J05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...