1RM8A

Crystal structure of the catalytic domain of mmp-16/mt3-mmp: characterization of mt-mmp specific features
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
169
Chain Sequence
GQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-16
publication title Crystal structure of the catalytic domain of MMP-16/MT3-MMP: characterization of MT-MMP specific features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 169
sequence length 169
ec nomenclature ec 3.4.24.-:
pdb deposition date 2003-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1rm8A00
4JP4A 1C8TA 3KMCA 3SHIA 1IAGA 4ILWD 1OS2A 4XM7A 2OW9A 3EHXA 4WKEA 2AYKA 3K7NA 3F18A 1QIAA 5I2ZA 5I12A 3V96B 5I0LA 3WV3A 4AIGA 2WO8A 3I7GA 1OMJA 2OW2A 3HB2P 1KUKA 456CA 1D8FA 3AIGA 1XFZA 1BQQM 1HTDA 3LKAA 1AYKA 1MMBA 3TVCA 2PJTA 966CA 4HMAA 3BA0A 1JH1A 1XFXA 2CKIA 4H2EA 2KRJA 2OW0A 2X7MA 1BUVM 1I73A 1XUCA 4WF6A 3I7IA 4HX3A 3LUMA 3WV2A 2D1OA 2MLRA 2JSDA 3LMCA 1D5JA 2EROA 2JT5A 2SRTA 3LIKA 1FM1A 4DF9A 3G5CA 1CGEA 2E2DA 1IABA 3F16A 5CZMA 4G9LA 2J83A 1JIZA 1B8YA 1OM6A 4WZVA 1ZS0A 1O0TA 5H8XA 4FVLA 3CKIA 3USNA 1GO8P 1HOVA 2MZHA 2Z2DA 3AYKA 1UMTA 4PKSA 1CK7A 1ZXVA 2X3CA 5I4OA 3N2VA 1IAEA 3LJTA 1KUHA 1QIBA 2RJPA 1K7QA 2JT6A 3DPEA 4PKWA 4QKZA 2YIGA 4DV8A 2K9CA 2W13A 4H82A 2USNA 4EFSA 4I03A 4Q1LA 1O0QA 1GKDA 5L79A 1SU3A 1BUDA 1BZSA 4JPAA 1D7XA 3VI1A 1HV5A 4GWMA 4WK7A 1ATLA 2TCLA 1G9KA 3KEKA 3L0TA 4H84A 1GKCA 3DNGA 1ND1A 1CXVA 2OW1A 4XCTA 5BPAA 1R1JA 1BIWA 2FV5A 2OXUA 1QJJA 1A86A 1HFSA 4GF1A 3LQBA 4H49A 4L63A 3E8RA 1SMPA 3F15A 3O2XA 4G0DA 3EDGA 1EUBA 1G12A 1DMTA 4FXQA 1PWUA 1QUAA 5LABA 1JIWP 1FBLA 4FXYP 1G05A 1OS9A 3LJGA 4GR3A 2WO9A 4I35A 3N2UA 4XM8A 2OXZA 2Y6DA 1SRPA 1ZVXA 4L19A 1Y8JA 1EB6A 3HBVP 4DPEA 3HY9A 3KRYA 1DTHA 3F1AA 1BKCI 1MMPA 2O36A 1KBCA 1WNIA 3KEJA 3GBOA 4PKUA 1I76A 2L0RA 2XS3A 4JQGA 1JAQA 3HDAP 4AYKA 1Q3AA 4A3WA 1YCMA 1AKLA 1GO7P 1R1HA 4L6TA 2W14A 4PKVA 1UTTA 5I43A 1G4KA 4JIJA 1I1IP 3LJZA 1IADA 1JKYA 4GWNA 1ASTA 3HDBA 1PWVA 3LGPA 3DPFA 3TT4A 1RM8A 2X3BA 2A8HA 3EHYA 1R54A 2Y6CA 5BOTA 3P1VA 1BM6A 3K7LA 3O64A 4IUWA 3G42A 4GR8A 3LIRA 4H1QA 2OXWA 1GE7A 1MMRA 2XS4A 1CQRA 3B8ZA 5L7FA 2QPJA 1BKCE 2DDFA 2O3EA 1RMZA 1KAPP 1BSWA 2OZRA 1QICA 1UMSA 5CUHA 4ON1A 2RJQA 5BOYA 4FU4A 1YOUA 2CLTA 1HFCA 3ZVSA 1QJIA 1USNA 1KUGA 3TSKA 1BKCA 3OHOA 3Q2GA 3LQ0A 4JA1A 4GR0A 1K7GA 3DL1A 2YB9A 1XUDA 3KWVC 3U1RA 2K2GA 3RTSA 4WKIA 2AIGP 1CIZA 2OVXA 1R1IA 2V4BA 2D1NA 2HU6A 1CGFA 1AF0A 1YQYA 3RTTA 1KUIA 1Z3JA 2E3XA 3F19A 2N8RA 5D3CA 2ERPA 1R55A 1ROSA 1Y0VA 2DW2A 4XBHA 1JANA 3EWJA 1OO9A 3WV1A 3EDIA 1C7KA 1XFVA 4CTHA 4H76A 3ELMA 4PKQA 5D1TA 5D2BA 2WOAA 4AXQA 1XFYA 4IJOA 2JIHA 1SATA 5D1SA 1GXDA 1MNCA 3F17A 2X3AA 3LK8A 3ZXHA 1K7IA 2POJA 3UVCA 4H3XA 1PWWA 4A7BA 1Y93A 2W15A 1JJ9A 2JNPA 3EDHA 3L0VA 3LEAA 1GE5A 2OVZA 3KECA 1ZXCA 4AUOA 5I3MA 1J7NA 3AYUA 1JAOA 3KMEA 1UEAA 2ERQA 2I47A 3LUNA 4GUYA 4J4MA 4XM6A 1IAAA 1GE6A 2DW1A 1FLSA 5B5PA 2OI0A 3TS4A 3DSLA 3MA2A 4R3VA 1YP1A 3EDZA 1G49A 3HYGA 3DWBA 4GQLA 5JMYA 1UTZA 5D1UA 1HY7A 1BQOA 1EAKA 2FV9A 5B5OA 1A85A 830CA 1XURA 1CAQA 2DW0A 2OY2A 2W12A 1KUFA 1PWPA 1L6JA 2W0DA 1D8MA 2OY4A 4IN9A 3KHIA 2MZIA 2MZEA 5CXAA 1SLMA 4DD8A 4ZR5A 3LILA 3P24A 1C3IA 1B3DA 1MMQA 2J0TA 3B2ZA 3NX7A 1CGLA 1ZTQA 1JK3A 4PKTA 3HBUP 3LE9A 1XFWA 1SLNA 2MLSA 1JAPA 3ZUKA 2DDYA 3B92A 1S4BP 3OHLA 3HY7A 4H30A 1OM7A 3VTGA 1OM8A 3Q2HA 1PWQA 1XFUA 5D7WA 4PKRA 1H71P 1IACA 1ZP5A
chains in the Genus database with same CATH superfamily
4JP4A 1C8TA 3KMCA 4L7AA 3SHIA 1IAGA 4ILWD 1OS2A 4XM7A 2OW9A 3EHXA 4WKEA 2AYKA 3K7NA 3F18A 1QIAA 5I2ZA 5I12A 3V96B 5I0LA 3WV3A 4AIGA 2WO8A 3I7GA 1OMJA 3DTIA 2OW2A 3HB2P 1KUKA 456CA 1D8FA 3AIGA 1XFZA 1BQQM 1HTDA 3LKAA 1AYKA 1MMBA 3TVCA 2PJTA 966CA 4HMAA 3BA0A 1JH1A 1XFXA 2CKIA 4H2EA 2KRJA 2OW0A 2X7MA 1BUVM 1I73A 1XUCA 4WF6A 3I7IA 4HX3A 3LUMA 3WV2A 2D1OA 2MLRA 2JSDA 3LMCA 1D5JA 2EROA 2JT5A 2SRTA 3LIKA 1FM1A 4DF9A 3G5CA 1XAXA 1CGEA 2E2DA 1IABA 3F16A 5CZMA 4G9LA 2J83A 1JIZA 1B8YA 1OM6A 4WZVA 1ZS0A 1O0TA 5H8XA 4FVLA 3CKIA 3USNA 1GO8P 1HOVA 2MZHA 2Z2DA 3AYKA 1UMTA 4PKSA 1CK7A 1ZXVA 2X3CA 5I4OA 3N2VA 1IAEA 3LJTA 1KUHA 1QIBA 2RJPA 1K7QA 2JT6A 3DPEA 4PKWA 4QKZA 2YIGA 4DV8A 2K9CA 2W13A 4H82A 2USNA 4EFSA 4I03A 4Q1LA 1O0QA 1GKDA 5L79A 1SU3A 1BUDA 1BZSA 4JPAA 1D7XA 3VI1A 1HV5A 4GWMA 4WK7A 1ATLA 2TCLA 1G9KA 3KEKA 3L0TA 4H84A 1GKCA 3DNGA 1ND1A 1CXVA 2OW1A 4XCTA 5BPAA 1R1JA 1BIWA 2FV5A 2OXUA 1QJJA 1A86A 1HFSA 4GF1A 3LQBA 4H49A 4L63A 3E8RA 1SMPA 3F15A 3O2XA 4G0DA 3EDGA 1EUBA 1G12A 1DMTA 4FXQA 1PWUA 1QUAA 5LABA 1JIWP 1FBLA 4FXYP 1G05A 1OS9A 3LJGA 4GR3A 2WO9A 4I35A 3N2UA 4XM8A 2OXZA 2Y6DA 1SRPA 1ZVXA 4L19A 1Y8JA 1EB6A 3HBVP 4DPEA 3HY9A 3KRYA 1DTHA 3F1AA 1BKCI 1MMPA 2O36A 1KBCA 1WNIA 3KEJA 3GBOA 4PKUA 1I76A 2L0RA 2XS3A 4JQGA 1JAQA 3HDAP 4AYKA 1Q3AA 4A3WA 1YCMA 1AKLA 1GO7P 1R1HA 4L6TA 2W14A 4PKVA 1UTTA 5I43A 1G4KA 4JIJA 1I1IP 3LJZA 1IADA 1JKYA 4GWNA 1ASTA 3HDBA 3LGPA 1PWVA 3DPFA 3TT4A 1RM8A 2X3BA 2A8HA 3EHYA 1R54A 2Y6CA 5BOTA 3P1VA 1BM6A 3K7LA 3O64A 4IUWA 3G42A 4GR8A 3LIRA 4H1QA 2OXWA 1GE7A 1MMRA 2XS4A 1CQRA 3B8ZA 5L7FA 2QPJA 1BKCE 2DDFA 2O3EA 1RMZA 1KAPP 1BSWA 2OZRA 1QICA 1UMSA 5CUHA 4ON1A 2RJQA 1TVIA 5BOYA 4FU4A 1YOUA 2CLTA 1HFCA 3ZVSA 1QJIA 1USNA 1KUGA 3TSKA 1BKCA 3OHOA 3Q2GA 3LQ0A 4JA1A 4GR0A 1K7GA 3DL1A 2YB9A 1XUDA 3KWVC 3U1RA 2K2GA 3RTSA 4WKIA 2AIGP 1CIZA 2OVXA 1R1IA 2V4BA 2D1NA 2HU6A 1CGFA 1AF0A 1YQYA 3RTTA 1KUIA 1Z3JA 2E3XA 3F19A 2N8RA 5D3CA 2ERPA 1XM5A 1R55A 1ROSA 1Y0VA 2DW2A 4XBHA 1JANA 3EWJA 1OO9A 3WV1A 3EDIA 1C7KA 1XFVA 4CTHA 4H76A 3ELMA 4PKQA 5D1TA 5D2BA 2WOAA 4AXQA 1XFYA 4IJOA 2JIHA 1SATA 5D1SA 1GXDA 1MNCA 3F17A 2YUFA 2X3AA 3LK8A 3ZXHA 1K7IA 2POJA 3UVCA 4H3XA 1PWWA 4A7BA 1Y93A 2W15A 1JJ9A 2JNPA 3EDHA 3L0VA 3LEAA 3DTKA 1GE5A 2OVZA 3KECA 1ZXCA 4AUOA 5I3MA 1J7NA 3AYUA 1JAOA 3KMEA 1UEAA 2ERQA 2I47A 3LUNA 4GUYA 4J4MA 4XM6A 1IAAA 1GE6A 2DW1A 1FLSA 5B5PA 2OI0A 3TS4A 3DSLA 3MA2A 4R3VA 1YP1A 3EDZA 1G49A 3HYGA 3DWBA 4GQLA 5JMYA 1UTZA 3DTEA 5D1UA 1HY7A 1BQOA 1EAKA 2FV9A 1OZ9A 5B5OA 1A85A 830CA 1XURA 1CAQA 2DW0A 2OY2A 2W12A 1KUFA 1PWPA 1L6JA 2W0DA 1D8MA 2OY4A 4IN9A 3KHIA 2MZIA 2MZEA 5CXAA 1SLMA 4DD8A 4ZR5A 3LILA 3P24A 1C3IA 1B3DA 1MMQA 2J0TA 3B2ZA 3NX7A 1CGLA 1ZTQA 1JK3A 4PKTA 3HBUP 3LE9A 1XFWA 1SLNA 2MLSA 1JAPA 3ZUKA 2DDYA 3B92A 1S4BP 3OHLA 3HY7A 4H30A 1OM7A 3VTGA 1OM8A 3Q2HA 1PWQA 1XFUA 5D7WA 4PKRA 1H71P 1IACA 1ZP5A
chains in the Genus database with same CATH topology
4JP4A 1C8TA 3KMCA 4L7AA 3SHIA 1IAGA 4ILWD 1OS2A 4XM7A 2OW9A 3EHXA 4WKEA 2AYKA 3K7NA 3F18A 1QIAA 5I2ZA 5I12A 3V96B 5I0LA 3WV3A 4AIGA 2WO8A 3I7GA 1OMJA 3DTIA 2OW2A 3HB2P 1KUKA 456CA 1D8FA 3AIGA 1XFZA 1BQQM 1HTDA 3LKAA 1AYKA 1MMBA 3TVCA 2PJTA 966CA 4HMAA 3BA0A 1JH1A 1XFXA 2CKIA 4H2EA 2KRJA 2OW0A 2X7MA 1BUVM 1I73A 1XUCA 4WF6A 3I7IA 4HX3A 3LUMA 3WV2A 2D1OA 2MLRA 2JSDA 3LMCA 1D5JA 2EROA 2JT5A 2SRTA 3LIKA 1FM1A 4DF9A 3G5CA 1CGEA 2E2DA 1IABA 3F16A 5CZMA 4G9LA 2J83A 1JIZA 1B8YA 1OM6A 4WZVA 1ZS0A 1O0TA 5H8XA 4FVLA 3CKIA 3USNA 1GO8P 1HOVA 2MZHA 2Z2DA 3AYKA 1UMTA 4PKSA 1CK7A 1ZXVA 2X3CA 5I4OA 3N2VA 1IAEA 3LJTA 1KUHA 1QIBA 2RJPA 1K7QA 2JT6A 3DPEA 4PKWA 4QKZA 2YIGA 4DV8A 2K9CA 2W13A 4H82A 2USNA 4EFSA 4I03A 4Q1LA 1O0QA 1GKDA 5L79A 1SU3A 1BUDA 1BZSA 4JPAA 1D7XA 3VI1A 1HV5A 4GWMA 4WK7A 1ATLA 2TCLA 1G9KA 3KEKA 3L0TA 4H84A 1GKCA 3DNGA 1ND1A 1CXVA 2OW1A 4XCTA 5BPAA 1R1JA 1BIWA 2FV5A 2OXUA 1QJJA 1A86A 1HFSA 4GF1A 3LQBA 4H49A 4L63A 3E8RA 1SMPA 3F15A 3O2XA 4G0DA 3EDGA 1EUBA 1G12A 1DMTA 4FXQA 1PWUA 1QUAA 5LABA 1JIWP 1FBLA 4FXYP 1G05A 1OS9A 3LJGA 4GR3A 2WO9A 4I35A 3N2UA 4XM8A 2OXZA 2Y6DA 1SRPA 1ZVXA 4L19A 1Y8JA 1EB6A 3HBVP 4DPEA 3HY9A 3KRYA 1DTHA 3F1AA 1BKCI 1MMPA 2O36A 1KBCA 1WNIA 3KEJA 3GBOA 4PKUA 1I76A 2L0RA 2XS3A 4JQGA 1JAQA 3HDAP 4AYKA 1Q3AA 4A3WA 1YCMA 1AKLA 1GO7P 1R1HA 4L6TA 2W14A 4PKVA 1UTTA 5I43A 1G4KA 4JIJA 1I1IP 3LJZA 1IADA 1JKYA 4GWNA 1ASTA 3HDBA 3LGPA 1PWVA 3DPFA 3TT4A 1RM8A 2X3BA 2A8HA 3EHYA 1R54A 2Y6CA 5BOTA 3P1VA 1BM6A 3K7LA 3O64A 4IUWA 3G42A 4GR8A 3LIRA 4H1QA 2OXWA 1GE7A 1MMRA 2XS4A 1CQRA 3B8ZA 5L7FA 2QPJA 1BKCE 2DDFA 2O3EA 1RMZA 1KAPP 1BSWA 2OZRA 1QICA 1UMSA 5CUHA 4ON1A 2RJQA 5BOYA 4FU4A 1YOUA 2CLTA 1HFCA 3ZVSA 1QJIA 1USNA 1KUGA 3TSKA 1BKCA 3OHOA 3Q2GA 3LQ0A 4JA1A 4GR0A 1K7GA 3DL1A 2YB9A 1XUDA 3KWVC 3U1RA 2K2GA 3RTSA 4WKIA 2AIGP 1CIZA 2OVXA 1R1IA 2V4BA 2D1NA 2HU6A 1CGFA 1AF0A 1YQYA 3RTTA 1KUIA 1Z3JA 2E3XA 3F19A 2N8RA 5D3CA 2ERPA 1R55A 1ROSA 1Y0VA 2DW2A 4XBHA 1JANA 3EWJA 1OO9A 3WV1A 3EDIA 1C7KA 1XFVA 4CTHA 4H76A 3ELMA 4PKQA 5D1TA 5D2BA 2WOAA 4AXQA 1XFYA 4IJOA 2JIHA 1SATA 5D1SA 1GXDA 1MNCA 3F17A 2YUFA 2X3AA 3LK8A 3ZXHA 1K7IA 2POJA 3UVCA 4H3XA 1PWWA 4A7BA 1Y93A 2W15A 1JJ9A 2JNPA 3EDHA 3L0VA 3LEAA 3DTKA 1GE5A 2OVZA 3KECA 1ZXCA 4AUOA 5I3MA 1J7NA 3AYUA 1JAOA 3KMEA 1UEAA 2ERQA 2I47A 3LUNA 4GUYA 4J4MA 4XM6A 1IAAA 1GE6A 2DW1A 1FLSA 5B5PA 2OI0A 3TS4A 3DSLA 3MA2A 4R3VA 1YP1A 3EDZA 1G49A 3HYGA 3DWBA 4GQLA 5JMYA 1UTZA 3DTEA 5D1UA 1HY7A 1BQOA 1EAKA 2FV9A 5B5OA 1A85A 830CA 1XURA 1CAQA 2DW0A 2OY2A 2W12A 1KUFA 1PWPA 1L6JA 2W0DA 1D8MA 2OY4A 4IN9A 3KHIA 2MZIA 2MZEA 5CXAA 1SLMA 4DD8A 4ZR5A 3LILA 3P24A 1C3IA 1B3DA 1MMQA 2J0TA 3B2ZA 3NX7A 1CGLA 1ZTQA 1JK3A 4PKTA 3HBUP 3LE9A 1XFWA 1SLNA 2MLSA 1JAPA 3ZUKA 2DDYA 3B92A 1S4BP 3OHLA 3HY7A 4H30A 1OM7A 3VTGA 1OM8A 3Q2HA 1PWQA 1XFUA 5D7WA 4PKRA 1H71P 1IACA 1ZP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JP4 A;  1C8T A;  3KMC A;  3SHI A;  1IAG A;  4ILW D;  1OS2 A;  4XM7 A;  2OW9 A;  3EHX A;  4WKE A;  2AYK A;  3K7N A;  3F18 A;  1QIA A;  5I2Z A;  5I12 A;  3V96 B;  5I0L A;  3WV3 A;  4AIG A;  2WO8 A;  3I7G A;  1OMJ A;  2OW2 A;  3HB2 P;  1KUK A;  456C A;  1D8F A;  3AIG A;  1XFZ A;  1BQQ M;  1HTD A;  3LKA A;  1AYK A;  1MMB A;  3TVC A;  2PJT A;  966C A;  4HMA A;  3BA0 A;  1JH1 A;  1XFX A;  2CKI A;  4H2E A;  2KRJ A;  2OW0 A;  2X7M A;  1BUV M;  1I73 A;  1XUC A;  4WF6 A;  3I7I A;  4HX3 A;  3LUM A;  3WV2 A;  2D1O A;  2MLR A;  2JSD A;  3LMC A;  1D5J A;  2ERO A;  2JT5 A;  2SRT A;  3LIK A;  1FM1 A;  4DF9 A;  3G5C A;  1CGE A;  2E2D A;  1IAB A;  3F16 A;  5CZM A;  4G9L A;  2J83 A;  1JIZ A;  1B8Y A;  1OM6 A;  4WZV A;  1ZS0 A;  1O0T A;  5H8X A;  4FVL A;  3CKI A;  3USN A;  1GO8 P;  1HOV A;  2MZH A;  2Z2D A;  3AYK A;  1UMT A;  4PKS A;  1CK7 A;  1ZXV A;  2X3C A;  5I4O A;  3N2V A;  1IAE A;  3LJT A;  1KUH A;  1QIB A;  2RJP A;  1K7Q A;  2JT6 A;  3DPE A;  4PKW A;  4QKZ A;  2YIG A;  4DV8 A;  2K9C A;  2W13 A;  4H82 A;  2USN A;  4EFS A;  4I03 A;  4Q1L A;  1O0Q A;  1GKD A;  5L79 A;  1SU3 A;  1BUD A;  1BZS A;  4JPA A;  1D7X A;  3VI1 A;  1HV5 A;  4GWM A;  4WK7 A;  1ATL A;  2TCL A;  1G9K A;  3KEK A;  3L0T A;  4H84 A;  1GKC A;  3DNG A;  1ND1 A;  1CXV A;  2OW1 A;  4XCT A;  5BPA A;  1R1J A;  1BIW A;  2FV5 A;  2OXU A;  1QJJ A;  1A86 A;  1HFS A;  4GF1 A;  3LQB A;  4H49 A;  4L63 A;  3E8R A;  1SMP A;  3F15 A;  3O2X A;  4G0D A;  3EDG A;  1EUB A;  1G12 A;  1DMT A;  4FXQ A;  1PWU A;  1QUA A;  5LAB A;  1JIW P;  1FBL A;  4FXY P;  1G05 A;  1OS9 A;  3LJG A;  4GR3 A;  2WO9 A;  4I35 A;  3N2U A;  4XM8 A;  2OXZ A;  2Y6D A;  1SRP A;  1ZVX A;  4L19 A;  1Y8J A;  1EB6 A;  3HBV P;  4DPE A;  3HY9 A;  3KRY A;  1DTH A;  3F1A A;  1BKC I;  1MMP A;  2O36 A;  1KBC A;  1WNI A;  3KEJ A;  3GBO A;  4PKU A;  1I76 A;  2L0R A;  2XS3 A;  4JQG A;  1JAQ A;  3HDA P;  4AYK A;  1Q3A A;  4A3W A;  1YCM A;  1AKL A;  1GO7 P;  1R1H A;  4L6T A;  2W14 A;  4PKV A;  1UTT A;  5I43 A;  1G4K A;  4JIJ A;  1I1I P;  3LJZ A;  1IAD A;  1JKY A;  4GWN A;  1AST A;  3HDB A;  1PWV A;  3LGP A;  3DPF A;  3TT4 A;  1RM8 A;  2X3B A;  2A8H A;  3EHY A;  1R54 A;  2Y6C A;  5BOT A;  3P1V A;  1BM6 A;  3K7L A;  3O64 A;  4IUW A;  3G42 A;  4GR8 A;  3LIR A;  4H1Q A;  2OXW A;  1GE7 A;  1MMR A;  2XS4 A;  1CQR A;  3B8Z A;  5L7F A;  2QPJ A;  1BKC E;  2DDF A;  2O3E A;  1RMZ A;  1KAP P;  1BSW A;  2OZR A;  1QIC A;  1UMS A;  5CUH A;  4ON1 A;  2RJQ A;  5BOY A;  4FU4 A;  1YOU A;  2CLT A;  1HFC A;  3ZVS A;  1QJI A;  1USN A;  1KUG A;  3TSK A;  1BKC A;  3OHO A;  3Q2G A;  3LQ0 A;  4JA1 A;  4GR0 A;  1K7G A;  3DL1 A;  2YB9 A;  1XUD A;  3KWV C;  3U1R A;  2K2G A;  3RTS A;  4WKI A;  2AIG P;  1CIZ A;  2OVX A;  1R1I A;  2V4B A;  2D1N A;  2HU6 A;  1CGF A;  1AF0 A;  1YQY A;  3RTT A;  1KUI A;  1Z3J A;  2E3X A;  3F19 A;  2N8R A;  5D3C A;  2ERP A;  1R55 A;  1ROS A;  1Y0V A;  2DW2 A;  4XBH A;  1JAN A;  3EWJ A;  1OO9 A;  3WV1 A;  3EDI A;  1C7K A;  1XFV A;  4CTH A;  4H76 A;  3ELM A;  4PKQ A;  5D1T A;  5D2B A;  2WOA A;  4AXQ A;  1XFY A;  4IJO A;  2JIH A;  1SAT A;  5D1S A;  1GXD A;  1MNC A;  3F17 A;  2X3A A;  3LK8 A;  3ZXH A;  1K7I A;  2POJ A;  3UVC A;  4H3X A;  1PWW A;  4A7B A;  1Y93 A;  2W15 A;  1JJ9 A;  2JNP A;  3EDH A;  3L0V A;  3LEA A;  1GE5 A;  2OVZ A;  3KEC A;  1ZXC A;  4AUO A;  5I3M A;  1J7N A;  3AYU A;  1JAO A;  3KME A;  1UEA A;  2ERQ A;  2I47 A;  3LUN A;  4GUY A;  4J4M A;  4XM6 A;  1IAA A;  1GE6 A;  2DW1 A;  1FLS A;  5B5P A;  2OI0 A;  3TS4 A;  3DSL A;  3MA2 A;  4R3V A;  1YP1 A;  3EDZ A;  1G49 A;  3HYG A;  3DWB A;  4GQL A;  5JMY A;  1UTZ A;  5D1U A;  1HY7 A;  1BQO A;  1EAK A;  2FV9 A;  5B5O A;  1A85 A;  830C A;  1XUR A;  1CAQ A;  2DW0 A;  2OY2 A;  2W12 A;  1KUF A;  1PWP A;  1L6J A;  2W0D A;  1D8M A;  2OY4 A;  4IN9 A;  3KHI A;  2MZI A;  2MZE A;  5CXA A;  1SLM A;  4DD8 A;  4ZR5 A;  3LIL A;  3P24 A;  1C3I A;  1B3D A;  1MMQ A;  2J0T A;  3B2Z A;  3NX7 A;  1CGL A;  1ZTQ A;  1JK3 A;  4PKT A;  3HBU P;  3LE9 A;  1XFW A;  1SLN A;  2MLS A;  1JAP A;  3ZUK A;  2DDY A;  3B92 A;  1S4B P;  3OHL A;  3HY7 A;  4H30 A;  1OM7 A;  3VTG A;  1OM8 A;  3Q2H A;  1PWQ A;  1XFU A;  5D7W A;  4PKR A;  1H71 P;  1IAC A;  1ZP5 A; 
#chains in the Genus database with same CATH topology
 4JP4 A;  1C8T A;  3KMC A;  4L7A A;  3SHI A;  1IAG A;  4ILW D;  1OS2 A;  4XM7 A;  2OW9 A;  3EHX A;  4WKE A;  2AYK A;  3K7N A;  3F18 A;  1QIA A;  5I2Z A;  5I12 A;  3V96 B;  5I0L A;  3WV3 A;  4AIG A;  2WO8 A;  3I7G A;  1OMJ A;  3DTI A;  2OW2 A;  3HB2 P;  1KUK A;  456C A;  1D8F A;  3AIG A;  1XFZ A;  1BQQ M;  1HTD A;  3LKA A;  1AYK A;  1MMB A;  3TVC A;  2PJT A;  966C A;  4HMA A;  3BA0 A;  1JH1 A;  1XFX A;  2CKI A;  4H2E A;  2KRJ A;  2OW0 A;  2X7M A;  1BUV M;  1I73 A;  1XUC A;  4WF6 A;  3I7I A;  4HX3 A;  3LUM A;  3WV2 A;  2D1O A;  2MLR A;  2JSD A;  3LMC A;  1D5J A;  2ERO A;  2JT5 A;  2SRT A;  3LIK A;  1FM1 A;  4DF9 A;  3G5C A;  1XAX A;  1CGE A;  2E2D A;  1IAB A;  3F16 A;  5CZM A;  4G9L A;  2J83 A;  1JIZ A;  1B8Y A;  1OM6 A;  4WZV A;  1ZS0 A;  1O0T A;  5H8X A;  4FVL A;  3CKI A;  3USN A;  1GO8 P;  1HOV A;  2MZH A;  2Z2D A;  3AYK A;  1UMT A;  4PKS A;  1CK7 A;  1ZXV A;  2X3C A;  5I4O A;  3N2V A;  1IAE A;  3LJT A;  1KUH A;  1QIB A;  2RJP A;  1K7Q A;  2JT6 A;  3DPE A;  4PKW A;  4QKZ A;  2YIG A;  4DV8 A;  2K9C A;  2W13 A;  4H82 A;  2USN A;  4EFS A;  4I03 A;  4Q1L A;  1O0Q A;  1GKD A;  5L79 A;  1SU3 A;  1BUD A;  1BZS A;  4JPA A;  1D7X A;  3VI1 A;  1HV5 A;  4GWM A;  4WK7 A;  1ATL A;  2TCL A;  1G9K A;  3KEK A;  3L0T A;  4H84 A;  1GKC A;  3DNG A;  1ND1 A;  1CXV A;  2OW1 A;  4XCT A;  5BPA A;  1R1J A;  1BIW A;  2FV5 A;  2OXU A;  1QJJ A;  1A86 A;  1HFS A;  4GF1 A;  3LQB A;  4H49 A;  4L63 A;  3E8R A;  1SMP A;  3F15 A;  3O2X A;  4G0D A;  3EDG A;  1EUB A;  1G12 A;  1DMT A;  4FXQ A;  1PWU A;  1QUA A;  5LAB A;  1JIW P;  1FBL A;  4FXY P;  1G05 A;  1OS9 A;  3LJG A;  4GR3 A;  2WO9 A;  4I35 A;  3N2U A;  4XM8 A;  2OXZ A;  2Y6D A;  1SRP A;  1ZVX A;  4L19 A;  1Y8J A;  1EB6 A;  3HBV P;  4DPE A;  3HY9 A;  3KRY A;  1DTH A;  3F1A A;  1BKC I;  1MMP A;  2O36 A;  1KBC A;  1WNI A;  3KEJ A;  3GBO A;  4PKU A;  1I76 A;  2L0R A;  2XS3 A;  4JQG A;  1JAQ A;  3HDA P;  4AYK A;  1Q3A A;  4A3W A;  1YCM A;  1AKL A;  1GO7 P;  1R1H A;  4L6T A;  2W14 A;  4PKV A;  1UTT A;  5I43 A;  1G4K A;  4JIJ A;  1I1I P;  3LJZ A;  1IAD A;  1JKY A;  4GWN A;  1AST A;  3HDB A;  3LGP A;  1PWV A;  3DPF A;  3TT4 A;  1RM8 A;  2X3B A;  2A8H A;  3EHY A;  1R54 A;  2Y6C A;  5BOT A;  3P1V A;  1BM6 A;  3K7L A;  3O64 A;  4IUW A;  3G42 A;  4GR8 A;  3LIR A;  4H1Q A;  2OXW A;  1GE7 A;  1MMR A;  2XS4 A;  1CQR A;  3B8Z A;  5L7F A;  2QPJ A;  1BKC E;  2DDF A;  2O3E A;  1RMZ A;  1KAP P;  1BSW A;  2OZR A;  1QIC A;  1UMS A;  5CUH A;  4ON1 A;  2RJQ A;  1TVI A;  5BOY A;  4FU4 A;  1YOU A;  2CLT A;  1HFC A;  3ZVS A;  1QJI A;  1USN A;  1KUG A;  3TSK A;  1BKC A;  3OHO A;  3Q2G A;  3LQ0 A;  4JA1 A;  4GR0 A;  1K7G A;  3DL1 A;  2YB9 A;  1XUD A;  3KWV C;  3U1R A;  2K2G A;  3RTS A;  4WKI A;  2AIG P;  1CIZ A;  2OVX A;  1R1I A;  2V4B A;  2D1N A;  2HU6 A;  1CGF A;  1AF0 A;  1YQY A;  3RTT A;  1KUI A;  1Z3J A;  2E3X A;  3F19 A;  2N8R A;  5D3C A;  2ERP A;  1XM5 A;  1R55 A;  1ROS A;  1Y0V A;  2DW2 A;  4XBH A;  1JAN A;  3EWJ A;  1OO9 A;  3WV1 A;  3EDI A;  1C7K A;  1XFV A;  4CTH A;  4H76 A;  3ELM A;  4PKQ A;  5D1T A;  5D2B A;  2WOA A;  4AXQ A;  1XFY A;  4IJO A;  2JIH A;  1SAT A;  5D1S A;  1GXD A;  1MNC A;  3F17 A;  2YUF A;  2X3A A;  3LK8 A;  3ZXH A;  1K7I A;  2POJ A;  3UVC A;  4H3X A;  1PWW A;  4A7B A;  1Y93 A;  2W15 A;  1JJ9 A;  2JNP A;  3EDH A;  3L0V A;  3LEA A;  3DTK A;  1GE5 A;  2OVZ A;  3KEC A;  1ZXC A;  4AUO A;  5I3M A;  1J7N A;  3AYU A;  1JAO A;  3KME A;  1UEA A;  2ERQ A;  2I47 A;  3LUN A;  4GUY A;  4J4M A;  4XM6 A;  1IAA A;  1GE6 A;  2DW1 A;  1FLS A;  5B5P A;  2OI0 A;  3TS4 A;  3DSL A;  3MA2 A;  4R3V A;  1YP1 A;  3EDZ A;  1G49 A;  3HYG A;  3DWB A;  4GQL A;  5JMY A;  1UTZ A;  3DTE A;  5D1U A;  1HY7 A;  1BQO A;  1EAK A;  2FV9 A;  1OZ9 A;  5B5O A;  1A85 A;  830C A;  1XUR A;  1CAQ A;  2DW0 A;  2OY2 A;  2W12 A;  1KUF A;  1PWP A;  1L6J A;  2W0D A;  1D8M A;  2OY4 A;  4IN9 A;  3KHI A;  2MZI A;  2MZE A;  5CXA A;  1SLM A;  4DD8 A;  4ZR5 A;  3LIL A;  3P24 A;  1C3I A;  1B3D A;  1MMQ A;  2J0T A;  3B2Z A;  3NX7 A;  1CGL A;  1ZTQ A;  1JK3 A;  4PKT A;  3HBU P;  3LE9 A;  1XFW A;  1SLN A;  2MLS A;  1JAP A;  3ZUK A;  2DDY A;  3B92 A;  1S4B P;  3OHL A;  3HY7 A;  4H30 A;  1OM7 A;  3VTG A;  1OM8 A;  3Q2H A;  1PWQ A;  1XFU A;  5D7W A;  4PKR A;  1H71 P;  1IAC A;  1ZP5 A; 
#chains in the Genus database with same CATH homology
 4JP4 A;  1C8T A;  3KMC A;  4L7A A;  3SHI A;  1IAG A;  4ILW D;  1OS2 A;  4XM7 A;  2OW9 A;  3EHX A;  4WKE A;  2AYK A;  3K7N A;  3F18 A;  1QIA A;  5I2Z A;  5I12 A;  3V96 B;  5I0L A;  3WV3 A;  4AIG A;  2WO8 A;  3I7G A;  1OMJ A;  3DTI A;  2OW2 A;  3HB2 P;  1KUK A;  456C A;  1D8F A;  3AIG A;  1XFZ A;  1BQQ M;  1HTD A;  3LKA A;  1AYK A;  1MMB A;  3TVC A;  2PJT A;  966C A;  4HMA A;  3BA0 A;  1JH1 A;  1XFX A;  2CKI A;  4H2E A;  2KRJ A;  2OW0 A;  2X7M A;  1BUV M;  1I73 A;  1XUC A;  4WF6 A;  3I7I A;  4HX3 A;  3LUM A;  3WV2 A;  2D1O A;  2MLR A;  2JSD A;  3LMC A;  1D5J A;  2ERO A;  2JT5 A;  2SRT A;  3LIK A;  1FM1 A;  4DF9 A;  3G5C A;  1CGE A;  2E2D A;  1IAB A;  3F16 A;  5CZM A;  4G9L A;  2J83 A;  1JIZ A;  1B8Y A;  1OM6 A;  4WZV A;  1ZS0 A;  1O0T A;  5H8X A;  4FVL A;  3CKI A;  3USN A;  1GO8 P;  1HOV A;  2MZH A;  2Z2D A;  3AYK A;  1UMT A;  4PKS A;  1CK7 A;  1ZXV A;  2X3C A;  5I4O A;  3N2V A;  1IAE A;  3LJT A;  1KUH A;  1QIB A;  2RJP A;  1K7Q A;  2JT6 A;  3DPE A;  4PKW A;  4QKZ A;  2YIG A;  4DV8 A;  2K9C A;  2W13 A;  4H82 A;  2USN A;  4EFS A;  4I03 A;  4Q1L A;  1O0Q A;  1GKD A;  5L79 A;  1SU3 A;  1BUD A;  1BZS A;  4JPA A;  1D7X A;  3VI1 A;  1HV5 A;  4GWM A;  4WK7 A;  1ATL A;  2TCL A;  1G9K A;  3KEK A;  3L0T A;  4H84 A;  1GKC A;  3DNG A;  1ND1 A;  1CXV A;  2OW1 A;  4XCT A;  5BPA A;  1R1J A;  1BIW A;  2FV5 A;  2OXU A;  1QJJ A;  1A86 A;  1HFS A;  4GF1 A;  3LQB A;  4H49 A;  4L63 A;  3E8R A;  1SMP A;  3F15 A;  3O2X A;  4G0D A;  3EDG A;  1EUB A;  1G12 A;  1DMT A;  4FXQ A;  1PWU A;  1QUA A;  5LAB A;  1JIW P;  1FBL A;  4FXY P;  1G05 A;  1OS9 A;  3LJG A;  4GR3 A;  2WO9 A;  4I35 A;  3N2U A;  4XM8 A;  2OXZ A;  2Y6D A;  1SRP A;  1ZVX A;  4L19 A;  1Y8J A;  1EB6 A;  3HBV P;  4DPE A;  3HY9 A;  3KRY A;  1DTH A;  3F1A A;  1BKC I;  1MMP A;  2O36 A;  1KBC A;  1WNI A;  3KEJ A;  3GBO A;  4PKU A;  1I76 A;  2L0R A;  2XS3 A;  4JQG A;  1JAQ A;  3HDA P;  4AYK A;  1Q3A A;  4A3W A;  1YCM A;  1AKL A;  1GO7 P;  1R1H A;  4L6T A;  2W14 A;  4PKV A;  1UTT A;  5I43 A;  1G4K A;  4JIJ A;  1I1I P;  3LJZ A;  1IAD A;  1JKY A;  4GWN A;  1AST A;  3HDB A;  3LGP A;  1PWV A;  3DPF A;  3TT4 A;  1RM8 A;  2X3B A;  2A8H A;  3EHY A;  1R54 A;  2Y6C A;  5BOT A;  3P1V A;  1BM6 A;  3K7L A;  3O64 A;  4IUW A;  3G42 A;  4GR8 A;  3LIR A;  4H1Q A;  2OXW A;  1GE7 A;  1MMR A;  2XS4 A;  1CQR A;  3B8Z A;  5L7F A;  2QPJ A;  1BKC E;  2DDF A;  2O3E A;  1RMZ A;  1KAP P;  1BSW A;  2OZR A;  1QIC A;  1UMS A;  5CUH A;  4ON1 A;  2RJQ A;  5BOY A;  4FU4 A;  1YOU A;  2CLT A;  1HFC A;  3ZVS A;  1QJI A;  1USN A;  1KUG A;  3TSK A;  1BKC A;  3OHO A;  3Q2G A;  3LQ0 A;  4JA1 A;  4GR0 A;  1K7G A;  3DL1 A;  2YB9 A;  1XUD A;  3KWV C;  3U1R A;  2K2G A;  3RTS A;  4WKI A;  2AIG P;  1CIZ A;  2OVX A;  1R1I A;  2V4B A;  2D1N A;  2HU6 A;  1CGF A;  1AF0 A;  1YQY A;  3RTT A;  1KUI A;  1Z3J A;  2E3X A;  3F19 A;  2N8R A;  5D3C A;  2ERP A;  1R55 A;  1ROS A;  1Y0V A;  2DW2 A;  4XBH A;  1JAN A;  3EWJ A;  1OO9 A;  3WV1 A;  3EDI A;  1C7K A;  1XFV A;  4CTH A;  4H76 A;  3ELM A;  4PKQ A;  5D1T A;  5D2B A;  2WOA A;  4AXQ A;  1XFY A;  4IJO A;  2JIH A;  1SAT A;  5D1S A;  1GXD A;  1MNC A;  3F17 A;  2YUF A;  2X3A A;  3LK8 A;  3ZXH A;  1K7I A;  2POJ A;  3UVC A;  4H3X A;  1PWW A;  4A7B A;  1Y93 A;  2W15 A;  1JJ9 A;  2JNP A;  3EDH A;  3L0V A;  3LEA A;  3DTK A;  1GE5 A;  2OVZ A;  3KEC A;  1ZXC A;  4AUO A;  5I3M A;  1J7N A;  3AYU A;  1JAO A;  3KME A;  1UEA A;  2ERQ A;  2I47 A;  3LUN A;  4GUY A;  4J4M A;  4XM6 A;  1IAA A;  1GE6 A;  2DW1 A;  1FLS A;  5B5P A;  2OI0 A;  3TS4 A;  3DSL A;  3MA2 A;  4R3V A;  1YP1 A;  3EDZ A;  1G49 A;  3HYG A;  3DWB A;  4GQL A;  5JMY A;  1UTZ A;  3DTE A;  5D1U A;  1HY7 A;  1BQO A;  1EAK A;  2FV9 A;  5B5O A;  1A85 A;  830C A;  1XUR A;  1CAQ A;  2DW0 A;  2OY2 A;  2W12 A;  1KUF A;  1PWP A;  1L6J A;  2W0D A;  1D8M A;  2OY4 A;  4IN9 A;  3KHI A;  2MZI A;  2MZE A;  5CXA A;  1SLM A;  4DD8 A;  4ZR5 A;  3LIL A;  3P24 A;  1C3I A;  1B3D A;  1MMQ A;  2J0T A;  3B2Z A;  3NX7 A;  1CGL A;  1ZTQ A;  1JK3 A;  4PKT A;  3HBU P;  3LE9 A;  1XFW A;  1SLN A;  2MLS A;  1JAP A;  3ZUK A;  2DDY A;  3B92 A;  1S4B P;  3OHL A;  3HY7 A;  4H30 A;  1OM7 A;  3VTG A;  1OM8 A;  3Q2H A;  1PWQ A;  1XFU A;  5D7W A;  4PKR A;  1H71 P;  1IAC A;  1ZP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...