1RMDA

Rag1 dimerization domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
NCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILNSLMVKCPAQDCNEEVSLEKYNHHVSSHKESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the RAG1 dimerization domain reveals multiple zinc-binding motifs including a novel zinc binuclear cluster.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords RAG1
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 1997-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
A PF10426 zf-RAG1 Recombination-activating protein 1 zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1rmdA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1rmdA02
3MHSA 2K16A 4AVXA 2CT2A 2VPEA 2I50A 1VFYA 2EOJA 3U5PA 2EM4A 2ECJA 4GB0A 2EMAA 1IYMA 5LKXA 2EN3A 2VNFA 4S3OC 3EB5A 2JRJA 5LKUA 3NG2A 2EOMA 2L5UA 3SOWA 1WEWA 5C11A 4LLBA 2HDPA 1MM2A 2R1FA 3EB6A 2E6SA 1DVPA 5DINA 2YTGA 2KR4A 4YBTA 2YTPA 5TABA 2JMIA 4IC3A 4X9JA 1UN6B 2BAYA 2QJ0A 2VJFB 2CSHA 3ZVZB 4GNFA 2FSAA 2BB8A 2XEUA 1G25A 5B8DA 2LVHA 2EOOA 2EMWA 5D1MB 2VJEB 1MEYC 2F6NA 3LQIA 3FL2A 4BHWA 2EMCA 4L7XA 5J3XA 2Y1MA 3QZVA 3MHHC 2JMDA 1BB8A 3ZPVE 1WFKA 1X6FA 2DMIA 2EOEA 3V43A 2DLKA 5KL2A 4YABA 2EN8A 2LGVA 4R2CA 3M99B 2JPAA 2OXQC 4F6NA 2EMFA 2EPPA 2KWNA 3EPHA 2EOSA 3RPGB 2EOZA 4YBSA 2EM9A 5KL3A 2EOQA 3O35A 3MHHA 2EN2A 1KJKA 2M85A 3KNVA 2EE8A 2WBUA 2EQ3A 1UBDC 4GNEA 2LGLA 2YTJA 1WENA 4AUQB 4ZDTA 3HCSA 4O64A 2E6RA 1A1IA 1TF3A 2EODA 1ZU1A 1X6HA 2LGGA 2ENCA 4M9VC 2MD7B 5DKAA 2YSJA 2MA5A 5FERA 4A0CD 4LJNA 3U5NA 2D8SA 2EGPA 4CCGX 3O37A 2EMXA 2EM2A 2EM8A 4IJDA 2CKLB 2K4DA 3ZNIA 1NCSA 1JOCA 2KU3A 1JK2A 2DRPA 1WESA 3PHDA 2CT1A 3MHSC 2YQMA 1LDKC 1F62A 2LN0A 4X3GA 3L1ZB 4A49A 2EMHA 1RMDA 2NABA 2YU4A 1E4UA 1Z1BA 2ENAA 5KH3A 4A4CA 2YTOA 4I7CA 4AYCB 2RI7A 2LCEA 1WEEA 2YW8A 2YREA 2YRHA 3ZPV1 1JM7A 1TN9A 2C2VS 2K1JA 2PUYA 2YTFA 3DPLR 4IC2A 1WEPA 2YRKA 2E72A 2RSDA 1ZAAC 2ADRA 2KWJA 4XI1A 3O36A 2A25A 2EMYA 4IS1C 4WZ0A 2EOXA 2WCC3 1Z6UA 2D9HA 5G05B 2EMBA 4N4FA 3N9LA 1X6EA 4PTBA 2FUUA 2EOFA 2EQ0A 4Q6FA 2H0DA 4R2PA 3L11A 2CSZA 1WIMA 1WJPA 5KL6A 2KREA 3KV6A 5FEYA 2LRIC 5D1KB 1YSAC 4FK5C 2MIQA 2ELZA 2LO3A 2MDGA 1MM3A 3U5MA 2GHFA 4WZ2A 2KE1A 2VPBA 5G04B 4R2RA 4FJCA 2G45A 1F2IG 2LXPC 3SOXA 5KL4A 2F42A 1G2FC 4C9ZA 4I7DA 2DX8A 2YHOA 2AN6A 2EOHA 4A4BA 2EMLA 2EN4A 2PNXA 3PURA 3M62A 1TF6A 1WE9A 2MD8C 4UP0A 4F52B 2G43A 1A1FA 2ECVA 3EPLA 2Y43A 2LV2A 2EJ4A 2KGIA 2NAAA 3EPKA 2YSMA 1WEOA 5KH9A 1BBOA 3C6WA 1B69A 5FB1A 2KYUA 5EYAF 2L43A 2LV9A 2J7JA 2PRTA 5LKTA 2MA6A 2VJFA 3L1XA 5KL5A 2EL6A 2YURA 3N9NA 2YT5A 4YADA 4WA6A 2ELYA 1G2DC 1T1HA 3T6RA 3N9OA 3RTRB 5H9MA 3I2DA 2RPCA 2VJEA 3RPGC 2YUCA 2EN7A 1A1KA 2JP9A 2ENHA 2KIZA 4I7BA 2Y1NA 5B77A 5B75A 2EA6A 2EMZA 2L0BA 2KFTA 4R2DA 4R2YA 5B76A 1WEMA 5TDWA 3N9MA 5TRBA 2M1RA 4AP4A 2ZETC 4ZQLA 2ECIA 4YAXA 2LXHC 5LKZA 1A1GA 5AITA 5LCWB 2LT7A 4QF2A 4YATA 2RSIA 2VP7A 1VYXA 4NN2A 3KV5A 3SOUA 3DQVR 2YU8A 2HYED 4V3KC 1K2FA 2EMGA 4W4UA 2HGHA 2MKDA 3EPJA 4LADB 2M6MA 2UZGA 1X4UA 2YSPA 2YRMA 1A1HA 2MT5A 4FK5A 2EPXA 2EOIA 3IHPA 4WZ3B 2EPCA 2GLIA 4L58A 2EPZA 1X5WA 4P5OB 4PPEA 4R2QA 2EM7A 3UK3C 4YC9A 4B7YC 3PUQA 3N9QA 2CKLA 1CHCA 1X4IA 2VPGA 2VRDA 3O7AA 1V87A 2F6JA 3ZTGA 1XWHA 4R8PK 4B86C 3VHTB 1A1JA 2EPAA 4YBMA 2EM0A 4CA1A 4ZUXU 1X4JA 2KWOA 3U5OA 4S3OB 5B79A 4FIPA 1WEUA 1ZR9A 2I13A 2L80A 2ECNA 2EMIA 2EP3A 3ZYQA 3O70A 1HYJA 2G6QA 4WSGA 3M99A 4UI9B 2QICA 2ECWA 5FB0A 5I3LA 2ECTA 2EN6A 3O33A 4GNDA 1VD4A 4MVTA 2EPRA 4GNGA 3LQHA 1YUJA 2EORA 4N3WA 3SHBA 3ZVYA 2FUIA 3ASLA 1WILA 5AIUA 2YTIA 2ECGA 3O34A 5TBNA 4R2AA 2LGKA 3HCUA 1WEQA 1U6GB 2XB1A 1YUIA 2YTDA 3KQIA 2YU5A 2K17A 2MUMA 2EOYA 2WBTA 2YTQA 4GZNC 2DGCA 2VPDA 4LK9A 2MNZA 3N9PA 5H1TA 2EQ1A 1A1LA 2EMKA 1X3CA 1WGMA 1ZBDB 5G0FA 1JK1A 1FBVA 4R2EA 2IDAA 3GV4A 1Z60A 1BORA 3T7LA 5C13A 1Z2QA 1HYIA 4MSXA 2EPUA 2CTDA 4TKPB 5KL7A 2L75A 3LQJA 2KGGA 2YHNA 4FO9A 3GL6A 2QIZA 4AYCA 2CSYA 4BBQA 2EL4A 4QF3A 2EL5A 3M63A 2EN1A 2C2LA 2EM5A 2YTEA 1WEVA 5TDRA 1JM7B 5JG6A 5H1UA 3LRQA 4UP5A 2JMJA 2YTNA 2KWKA 1P47A 3HCTA 2WBSA 1FP0A 5KH7A 1AAYA 3VK6A 2MKNA 3HTKC 2M3HA 1N87A 3C5KA 5H1VA 1LLMC 5D1LB 4R7EA 4F6MA 4R2SA 4V3LC 2EM6A 5B78A 2DLQA 2EM3A 4F2JC 2LDRA 2LQ6A 2H0DB 2YQLA 1DGCA 2YSOA 2YYRA 2M9AA 4LKAA 2MNYA 1LDJB
chains in the Genus database with same CATH superfamily
3MHSA 4MLQA 5LLQA 2K16A 2XOZA 4AVXA 1XNQE 2CT2A 2VPEA 1FKAE 4M2ZA 1HNXE 2I50A 3HTXA 1VFYA 1FJGE 2EOJA 3U5PA 2EM4A 2XOYA 2ECJA 4GB0A 2EMAA 1IYMA 5LKXA 3DJWA 2EN3A 2VNFA 2EPNA 4S3OC 4OGCA 3EB5A 4LFCE 2JRJA 5LKUA 3NG2A 3M7KA 2EOMA 2CRRA 2L5UA 3SOWA 1WEWA 5C11A 4DV1E 4O5GA 4LLBA 2HDPA 1MM2A 4DKKA 2R1FA 3EB6A 2E6SA 1DVPA 3BGHA 4AQYE 5A6AA 5DINA 2YTGA 2KR4A 4YBTA 2YTPA 2E5LE 5IXMB 2UXCE 4LF5E 2DSYA 5TABA 1PKPA 2JMIA 3THOB 4X64E 4IC3A 4X9JA 4HEIA 2H36X 4BC7A 1UN6B 4OOGC 2BAYA 2QJ0A 2VJFB 2CSHA 2FD4A 4F9CB 1UILA 3ZVZB 4GNFA 2FSAA 5FLXC 3J7Yp 2BB8A 2XEUA 3HPSA 4Q35B 1G25A 5LL6R 5B8DA 2LVHA 1IBME 3HXLA 2EOOA 2RQLA 2EMWA 4WX9A 5D1MB 2HC5A 4O24A 2VJEB 1MEYC 2F6NA 3LQIA 3FL2A 4X8WA 1SR9A 4BHWA 2EMCA 1WXRA 4L7XA 1WHQA 3VYXA 5J3XA 2Y1MA 1GQEA 3BF2A 3QZVA 2BBGA 3MHHC 3C4BA 2VQFE 5AE2A 2JMDA 4O43A 1BB8A 3LMLA 1X47A 4WXDA 3ZPVE 1WFKA 3LDYA 1X6FA 3J7AG 2UXBE 2DMIA 2EZ6A 2EOEA 3V43A 3MSWA 3IWDA 4L5NC 2DLKA 4NHRA 5KL2A 3LJUX 4YABA 5IT9C 3L00A 2EN8A 2LGVA 3SUBA 3ADGA 4DR6E 4P7DA 2L2NA 4R2CA 3M99B 2JPAA 2R76A 2OXQC 2B7TA 4F6NA 2EMFA 1QU6A 2MC5A 2EPPA 2KWNA 1XMOE 5A6BA 3EPHA 2EOSA 3LLHA 3RPGB 2EOZA 4YBSA 2LE2A 3DWDA 2EM9A 5KL3A 2F4VE 2EOQA 2K4VA 3O35A 3MHHA 2EN2A 2RSMA 4JI4E 1KJKA 4JI1E 2M85A 3KNVA 2EE8A 4YHHE 2EQ3A 2WBUA 4GNEA 2LGLA 1UBDC 2YTJA 1WENA 4AUQB 4ZDTA 2L3JA 3HCSA 4O64A 5SVIB 3AUZA 3H7HA 2E6RA 2ODRC 1HNWE 2JR1A 1A1IA 3LVQE 1TF3A 2EODA 1ZU1A 2GPIA 1X6HA 2LGGA 2ENCA 1IBKE 2L7PA 1NEIA 2L2KB 4M9VC 2MD7B 5DKAA 2OWAA 4ZYHA 1T4LB 2DMYA 2YSJA 2MA5A 5FERA 4A0CD 4LJNA 3U5NA 2M4IA 5AE3A 4QQ4A 4LU9A 2D8SA 2EGPA 3FIGA 4CCGX 3FEHA 3O37A 2EMXA 4J8ZA 4X65E 2KOUA 2UUCE 2EM2A 2N3HA 1T39A 4LF4E 1YYKA 4GKJE 2EM8A 4IJDA 2CKLB 3F6GA 2K4DA 3ZNIA 2JM3A 1NCSA 1YPNA 1JOCA 2MKEA 2KU3A 1JK2A 2DRPA 1WESA 5BR8E 3PHDA 1SFEA 2CT1A 3MHSC 2YQMA 1LDKC 1F62A 2LN0A 4X3GA 3L1ZB 4A49A 2EMHA 1RMDA 2KKYA 3MDBC 1ZBTA 2NABA 2YU4A 4H9DA 1E4UA 2KHXA 3IWCA 2DB2A 5KH3A 2ENAA 3ECRA 1Z1BA 4A4CA 2JY9A 4OX9E 2YTOA 4I7CA 4BHCA 2LTRA 3FM8C 4AYCB 2RI7A 2LCEA 2UUAE 2NA2A 1WEEA 3KZYA 4TUGA 2YW8A 2YREA 2YRHA 3ADJA 4Z0OA 3ZPV1 1JM7A 1X49A 1TN9A 2C2VS 2K1JA 2PUYA 4X66E 2YTFA 3DPLR 4RH8A 3H09A 2YWQA 2ODRD 1YYOA 4IC2A 1WEPA 2YRKA 2E72A 1IQOA 2RSDA 1UHZA 1ZAAC 2RS6A 2ADRA 2RR4A 2JUNA 2KWJA 4XI1A 3O36A 4O4KA 2A25A 2EMYA 1RQ0A 4F1PA 4DR5E 4IS1C 4WZ0A 5SVYA 2EOXA 4JI3E 2WCC3 1Z6UA 2P57A 2E1MA 2D9HA 4DV7E 3T1HE 5G05B 2EMBA 4N4FA 1XNRE 3N9LA 2V88A 1X6EA 4PTBA 2FUUA 2EOFA 2EQ0A 4Q6FA 3C6KA 2H0DA 1STUA 2VF1A 4R2PA 3L11A 5K3QA 2CSZA 1WIMA 1WJPA 2YZTA 4ZYEA 5KL6A 5LMNE 4GKKE 4LF8E 3E2DA 2KREA 3KV6A 5FEYA 1PJQA 2LRIC 5D1KB 1GZ6A 3C6MA 4FK5C 2MIQA 4L8NA 2IQJA 4WXCA 1IQSA 1YSAC 2CPNA 2ELZA 1O0WA 2LO3A 2KONA 1MM3A 3U5MA 2GHFA 2MDGA 5AC4A 4WZ2A 3FJUB 4M0VA 2KE1A 2VPBA 5G04B 4R2RA 4FJCA 1YZ9A 2G45A 3AV0A 2RTXA 1YYWA 1F2IG 4JI2E 2LXPC 3SOXA 5KL4A 2F42A 4I8OA 1G2FC 4GEQB 4C9ZA 4WPYA 4I7DA 2DX8A 2YHOA 2AN6A 2EOHA 2DJAA 4Q28A 4A4BA 2EMLA 2EN4A 2MC6A 2PNXA 2V8QB 5IV8B 2VQEE 4B3RE 3PURA 3M62A 2EPOA 3O47A 2EGMA 4JI6E 4ZYGA 1TF6A 1WE9A 2MD8C 2V86A 4UP0A 4DUYE 3T9KA 4F52B 2F8BA 2G43A 1ZBQA 4BMJA 1A1FA 2L6MA 2I9IA 3F6HA 4LFAE 5TSEA 4B3SE 2ECVA 3EPLA 2Y43A 2LV2A 1HNZE 2V89A 2EJ4A 2KGIA 4JI7E 4JI5E 2M7QA 2NAAA 4WSPA 3EPKA 2YSMA 4NZVA 1WEOA 5KH9A 3VYYA 4BCAA 2IHR1 1BBOA 3C6WA 1B69A 5FB1A 2KYUA 5EYAF 3JUEA 3BBGA 2L43A 2LV9A 2FV4B 2J7JA 2PRTA 3PLWA 5LKTA 2V87A 3Q1DA 1DQ3A 2MA6A 2VE7C 1MBMA 2VJFA 3TQMA 3L1XA 5KL5A 2EL6A 2YURA 4TUIA 4B3TE 2E61A 3N9NA 2YT5A 4YADA 4WA6A 2ELYA 2JWOA 1G2DC 1DI2A 1BBGA 1T1HA 3T6RA 3N9OA 3RTRB 5IWAE 1KYQA 5H9MA 3I2DA 4LF7E 4X62E 3THNA 2UUBE 1WHNA 2RPCA 2VJEA 3ZOQB 4LFBE 3RPGC 2YUCA 3BIDA 1IMUA 2EN7A 1A1KA 2JP9A 2WZOA 1DCQA 2ENHA 2KIZA 4HTGA 4I7BA 2Y1NA 2JVAA 5B77A 5B75A 2EA6A 2EMZA 2L0BA 1PJSA 4WFTA 2KFTA 4R2DA 4R2YA 1PJTA 5B76A 1WEMA 5TDWA 3N9MA 2EXUA 5TRBA 2LAUA 4P78A 2M1RA 4AP4A 4ZQLA 2ZETC 2LRSA 4M30A 2ECIA 4YAXA 5CFFE 2LXHC 4KHPE 5LKZA 1A1GA 4OGEA 5AITA 3FAOA 5LCWB 2LT7A 2YVRA 4QF2A 4YATA 2RSIA 2VP7A 4BBYA 1VYXA 4NN2A 3KV5A 4ZYDA 1EH8A 2YT4A 3SOUA 3DQVR 5SVXA 2LJHA 2M1SA 4DUZE 1HR0E 2YU8A 3IWBA 2HYED 4V3KC 1K2FA 4LF6E 2EMGA 4W4UA 4F54A 2HGHA 2MKDA 2Q8UA 3EPJA 1N36E 4LADB 5A2QC 1N34E 3HPZA 2M6MA 2UZGA 5LMUE 1X4UA 2YSPA 2YRMA 1A1HA 2MT5A 2EPMX 4FK5A 5A6JA 3JTZA 2MDRA 4DV4E 4BC9A 2EPXA 2LTSA 4F9AB 2V85A 1WRJA 4DR2E 2EOIA 3IHPA 4WZ3B 2EPCA 2XP0A 5T6JA 2GLIA 1XMQE 4DR1E 4L58A 2EPZA 2UU9E 1X5WA 3OTOE 2KKXA 1N32E 4P5OB 4PPEA 4R2QA 1N3GA 3ADLA 1EH7A 2LMZA 2CRWA 5DNYA 2JOBA 2EM7A 3UK3C 4YC9A 4B7YC 2LUPB 3PUQA 1T4OA 3N9QA 2CKLA 2FFWA 1CHCA 3HQ1A 1X4IA 3C4TA 2VPGA 2VRDA 3O7AA 1V87A 4DV0E 2F6JA 4DR3E 5F3WA 3ZTGA 2L3CA 1XWHA 4R8PK 4B86C 3VHTB 1A1JA 2EPAA 4Z0RA 5A69A 3K6QA 4DR4E 4YBMA 2EM0A 4CA1A 2YPNA 4ZUXU 1X4JA 2KWOA 2N8XA 3U5OA 4S3OB 3EQ1A 4F9BB 5B79A 2D8UA 1WEUA 4FIPA 1ZR9A 4KWYA 2K7IA 2I13A 1MGTA 2L80A 3DDTA 2ECNA 2EMIA 2EP3A 3ZYQA 3O70A 2ZM6E 3T1YE 1X48A 4LF9E 1HYJA 2G6QA 4WSGA 1GTKA 1EKZA 3ADIA 2RS7A 1L4SA 3M99A 2JYAA 3LVRE 4O62A 2QICA 4UI9B 2ECWA 5FB0A 5I3LA 2ECTA 2EN6A 3DF6A 3O33A 4GNDA 1VD4A 4MVTA 4JYAE 2G7HA 2EPRA 4DV5E 3FANA 4GNGA 2NUGA 1J5EE 2M13A 3LQHA 4JV5E 1YUJA 2EORA 4N3WA 3SHBA 3ZVYA 2FUIA 4DMIA 3ASLA 1WILA 5AIUA 1EH6A 5ADZA 2YTIA 2ECGA 3O34A 2NUEA 5TBNA 4RHBB 5SVIA 4R2AA 2LGKA 2L2MA 3HCUA 1WEQA 1U6GB 2XB1A 2JOXA 1YUIA 4DV6E 2B7VA 2YTDA 3KQIA 2YU5A 2K17A 1T4NA 1J26A 2EWLA 4YY3E 1N33E 4KZSA 2MUMA 2EOYA 2WBTA 2YTQA 3JU0A 4GZNC 2FGGA 2DGCA 2VPDA 4LK9A 2B9DA 2CSVA 3J80C 2MNZA 1RC7A 3N9PA 5H1TA 2EQ1A 1A1LA 2JXPA 1IBLE 2EMKA 1T38A 1X3CA 1WGMA 2LUQA 2XOCA 1ZBDB 2N3GA 5G0FA 1JK1A 4B3ME 1FBVA 4R2EA 2IDAA 3GV4A 1Z60A 1BORA 3T7LA 5C13A 2HJJA 1Z2QA 3QG5C 1HYIA 4MSXA 2EPUA 2CTDA 2UXDE 3KWRA 4TKPB 5KL7A 2L75A 3LQJA 2KGGA 2YHNA 4FO9A 3GL6A 2DSMA 2QIZA 4AYCA 4LTYA 3J81C 2CSYA 2NUFA 2LJUA 4BBQA 2EL4A 5AC5A 4NXNE 4QF3A 2EL5A 3M63A 2EN1A 5AASA 4DV2E 2CONA 2B0OE 2C2LA 2EM5A 2EPKX 1WEVA 5TDRA 1JM7B 2L92A 2YTEA 4WYQB 4JI0E 5JG6A 5H1UA 3LRQA 4UP5A 3OMLA 5A6KA 3RMPA 2JMJA 1I94E 4R8OA 2YTNA 2FTXB 4R03A 5AE1A 2KWKA 3KZZA 3HCTA 1P47A 2WBSA 1FP0A 5KH7A 2B3TB 1AAYA 4DV3E 3VK6A 2MKNA 3HTKC 3KDEC 2M3HA 3JAMC 1N87A 3C5KA 5H1VA 1LLMC 5D1LB 2EPLX 4R7EA 1YFHA 2L8TA 2L33A 4F6MA 4BHBA 4R2SA 4BS9A 4NXME 4V3LC 2EM6A 5B78A 2DLQA 4K0KE 4JI8E 2EM3A 4F2JC 2LDRA 2LQ6A 1QNTA 2DIXA 4DR7E 3P1XA 2H0DB 2YQLA 1PDAA 5A6BD 1DGCA 2YSOA 2V83A 2YYRA 2HHHE 2M9AA 4LKAA 2MNYA 2LBSB 1LDJB 1AH5A 4MLVA 4N4RB
chains in the Genus database with same CATH topology
3MHSA 2K16A 4AVXA 2CT2A 2VPEA 2I50A 1VFYA 2EOJA 3U5PA 2EM4A 2ECJA 4GB0A 2EMAA 1IYMA 5LKXA 2EN3A 2VNFA 4S3OC 3EB5A 2JRJA 5LKUA 3NG2A 2EOMA 2L5UA 3SOWA 1WEWA 5C11A 4LLBA 2HDPA 1MM2A 2R1FA 3EB6A 2E6SA 1DVPA 5DINA 2YTGA 2KR4A 4YBTA 2YTPA 5TABA 2JMIA 4IC3A 4X9JA 1UN6B 2BAYA 2QJ0A 2VJFB 2CSHA 3ZVZB 4GNFA 2FSAA 2BB8A 2XEUA 1G25A 5B8DA 2LVHA 2EOOA 2EMWA 5D1MB 2VJEB 1MEYC 2F6NA 3LQIA 3FL2A 4BHWA 2EMCA 4L7XA 5J3XA 2Y1MA 3QZVA 3MHHC 2JMDA 1BB8A 3ZPVE 1WFKA 1X6FA 2DMIA 2EOEA 3V43A 2DLKA 5KL2A 4YABA 2EN8A 2LGVA 4R2CA 3M99B 2JPAA 2OXQC 4F6NA 2EMFA 2EPPA 2KWNA 3EPHA 2EOSA 3RPGB 2EOZA 4YBSA 2EM9A 5KL3A 2EOQA 3O35A 3MHHA 2EN2A 1KJKA 2M85A 3KNVA 2EE8A 2WBUA 2EQ3A 1UBDC 4GNEA 2LGLA 2YTJA 1WENA 4AUQB 4ZDTA 3HCSA 4O64A 2E6RA 1A1IA 1TF3A 2EODA 1ZU1A 1X6HA 2LGGA 2ENCA 4M9VC 2MD7B 5DKAA 2YSJA 2MA5A 5FERA 4A0CD 4LJNA 3U5NA 2D8SA 2EGPA 4CCGX 3O37A 2EMXA 2EM2A 2EM8A 4IJDA 2CKLB 2K4DA 3ZNIA 1NCSA 1JOCA 2KU3A 1JK2A 2DRPA 1WESA 3PHDA 2CT1A 3MHSC 2YQMA 1LDKC 1F62A 2LN0A 4X3GA 3L1ZB 4A49A 2EMHA 1RMDA 2NABA 2YU4A 1E4UA 1Z1BA 2ENAA 5KH3A 4A4CA 2YTOA 4I7CA 4AYCB 2RI7A 2LCEA 1WEEA 2YW8A 2YREA 2YRHA 3ZPV1 1JM7A 1TN9A 2C2VS 2K1JA 2PUYA 2YTFA 3DPLR 4IC2A 1WEPA 2YRKA 2E72A 2RSDA 1ZAAC 2ADRA 2KWJA 4XI1A 3O36A 2A25A 2EMYA 4IS1C 4WZ0A 2EOXA 2WCC3 1Z6UA 2D9HA 5G05B 2EMBA 4N4FA 3N9LA 1X6EA 4PTBA 2FUUA 2EOFA 2EQ0A 4Q6FA 2H0DA 4R2PA 3L11A 2CSZA 1WIMA 1WJPA 5KL6A 2KREA 3KV6A 5FEYA 2LRIC 5D1KB 1YSAC 4FK5C 2MIQA 2ELZA 2LO3A 2MDGA 1MM3A 3U5MA 2GHFA 4WZ2A 2KE1A 2VPBA 5G04B 4R2RA 4FJCA 2G45A 1F2IG 2LXPC 3SOXA 5KL4A 2F42A 1G2FC 4C9ZA 4I7DA 2DX8A 2YHOA 2AN6A 2EOHA 4A4BA 2EMLA 2EN4A 2PNXA 3PURA 3M62A 1TF6A 1WE9A 2MD8C 4UP0A 4F52B 2G43A 1A1FA 2ECVA 3EPLA 2Y43A 2LV2A 2EJ4A 2KGIA 2NAAA 3EPKA 2YSMA 1WEOA 5KH9A 1BBOA 3C6WA 1B69A 5FB1A 2KYUA 5EYAF 2L43A 2LV9A 2J7JA 2PRTA 5LKTA 2MA6A 2VJFA 3L1XA 5KL5A 2EL6A 2YURA 3N9NA 2YT5A 4YADA 4WA6A 2ELYA 1G2DC 1T1HA 3T6RA 3N9OA 3RTRB 5H9MA 3I2DA 2RPCA 2VJEA 3RPGC 2YUCA 2EN7A 1A1KA 2JP9A 2ENHA 2KIZA 4I7BA 2Y1NA 5B77A 5B75A 2EA6A 2EMZA 2L0BA 2KFTA 4R2DA 4R2YA 5B76A 1WEMA 5TDWA 3N9MA 5TRBA 2M1RA 4AP4A 2ZETC 4ZQLA 2ECIA 4YAXA 2LXHC 5LKZA 1A1GA 5AITA 5LCWB 2LT7A 4QF2A 4YATA 2RSIA 2VP7A 1VYXA 4NN2A 3KV5A 3SOUA 3DQVR 2YU8A 2HYED 4V3KC 1K2FA 2EMGA 4W4UA 2HGHA 2MKDA 3EPJA 4LADB 2M6MA 2UZGA 1X4UA 2YSPA 2YRMA 1A1HA 2MT5A 4FK5A 2EPXA 2EOIA 3IHPA 4WZ3B 2EPCA 2GLIA 4L58A 2EPZA 1X5WA 4P5OB 4PPEA 4R2QA 2EM7A 3UK3C 4YC9A 4B7YC 3PUQA 3N9QA 2CKLA 1CHCA 1X4IA 2VPGA 2VRDA 3O7AA 1V87A 2F6JA 3ZTGA 1XWHA 4R8PK 4B86C 3VHTB 1A1JA 2EPAA 4YBMA 2EM0A 4CA1A 4ZUXU 1X4JA 2KWOA 3U5OA 4S3OB 5B79A 4FIPA 1WEUA 1ZR9A 2I13A 2L80A 2ECNA 2EMIA 2EP3A 3ZYQA 3O70A 1HYJA 2G6QA 4WSGA 3M99A 4UI9B 2QICA 2ECWA 5FB0A 5I3LA 2ECTA 2EN6A 3O33A 4GNDA 1VD4A 4MVTA 2EPRA 4GNGA 3LQHA 1YUJA 2EORA 4N3WA 3SHBA 3ZVYA 2FUIA 3ASLA 1WILA 5AIUA 2YTIA 2ECGA 3O34A 5TBNA 4R2AA 2LGKA 3HCUA 1WEQA 1U6GB 2XB1A 1YUIA 2YTDA 3KQIA 2YU5A 2K17A 2MUMA 2EOYA 2WBTA 2YTQA 4GZNC 2DGCA 2VPDA 4LK9A 2MNZA 3N9PA 5H1TA 2EQ1A 1A1LA 2EMKA 1X3CA 1WGMA 1ZBDB 5G0FA 1JK1A 1FBVA 4R2EA 2IDAA 3GV4A 1Z60A 1BORA 3T7LA 5C13A 1Z2QA 1HYIA 4MSXA 2EPUA 2CTDA 4TKPB 5KL7A 2L75A 3LQJA 2KGGA 2YHNA 4FO9A 3GL6A 2QIZA 4AYCA 2CSYA 4BBQA 2EL4A 4QF3A 2EL5A 3M63A 2EN1A 2C2LA 2EM5A 2YTEA 1WEVA 5TDRA 1JM7B 5JG6A 5H1UA 3LRQA 4UP5A 2JMJA 2YTNA 2KWKA 1P47A 3HCTA 2WBSA 1FP0A 5KH7A 1AAYA 3VK6A 2MKNA 3HTKC 2M3HA 1N87A 3C5KA 5H1VA 1LLMC 5D1LB 4R7EA 4F6MA 4R2SA 4V3LC 2EM6A 5B78A 2DLQA 2EM3A 4F2JC 2LDRA 2LQ6A 2H0DB 2YQLA 1DGCA 2YSOA 2YYRA 2M9AA 4LKAA 2MNYA 1LDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS A;  2K16 A;  4AVX A;  2CT2 A;  2VPE A;  2I50 A;  1VFY A;  2EOJ A;  3U5P A;  2EM4 A;  2ECJ A;  4GB0 A;  2EMA A;  1IYM A;  5LKX A;  2EN3 A;  2VNF A;  4S3O C;  3EB5 A;  2JRJ A;  5LKU A;  3NG2 A;  2EOM A;  2L5U A;  3SOW A;  1WEW A;  5C11 A;  4LLB A;  2HDP A;  1MM2 A;  2R1F A;  3EB6 A;  2E6S A;  1DVP A;  5DIN A;  2YTG A;  2KR4 A;  4YBT A;  2YTP A;  5TAB A;  2JMI A;  4IC3 A;  4X9J A;  1UN6 B;  2BAY A;  2QJ0 A;  2VJF B;  2CSH A;  3ZVZ B;  4GNF A;  2FSA A;  2BB8 A;  2XEU A;  1G25 A;  5B8D A;  2LVH A;  2EOO A;  2EMW A;  5D1M B;  2VJE B;  1MEY C;  2F6N A;  3LQI A;  3FL2 A;  4BHW A;  2EMC A;  4L7X A;  5J3X A;  2Y1M A;  3QZV A;  3MHH C;  2JMD A;  1BB8 A;  3ZPV E;  1WFK A;  1X6F A;  2DMI A;  2EOE A;  3V43 A;  2DLK A;  5KL2 A;  4YAB A;  2EN8 A;  2LGV A;  4R2C A;  3M99 B;  2JPA A;  2OXQ C;  4F6N A;  2EMF A;  2EPP A;  2KWN A;  3EPH A;  2EOS A;  3RPG B;  2EOZ A;  4YBS A;  2EM9 A;  5KL3 A;  2EOQ A;  3O35 A;  3MHH A;  2EN2 A;  1KJK A;  2M85 A;  3KNV A;  2EE8 A;  2WBU A;  2EQ3 A;  1UBD C;  4GNE A;  2LGL A;  2YTJ A;  1WEN A;  4AUQ B;  4ZDT A;  3HCS A;  4O64 A;  2E6R A;  1A1I A;  1TF3 A;  2EOD A;  1ZU1 A;  1X6H A;  2LGG A;  2ENC A;  4M9V C;  2MD7 B;  5DKA A;  2YSJ A;  2MA5 A;  5FER A;  4A0C D;  4LJN A;  3U5N A;  2D8S A;  2EGP A;  4CCG X;  3O37 A;  2EMX A;  2EM2 A;  2EM8 A;  4IJD A;  2CKL B;  2K4D A;  3ZNI A;  1NCS A;  1JOC A;  2KU3 A;  1JK2 A;  2DRP A;  1WES A;  3PHD A;  2CT1 A;  3MHS C;  2YQM A;  1LDK C;  1F62 A;  2LN0 A;  4X3G A;  3L1Z B;  4A49 A;  2EMH A;  1RMD A;  2NAB A;  2YU4 A;  1E4U A;  1Z1B A;  2ENA A;  5KH3 A;  4A4C A;  2YTO A;  4I7C A;  4AYC B;  2RI7 A;  2LCE A;  1WEE A;  2YW8 A;  2YRE A;  2YRH A;  3ZPV 1;  1JM7 A;  1TN9 A;  2C2V S;  2K1J A;  2PUY A;  2YTF A;  3DPL R;  4IC2 A;  1WEP A;  2YRK A;  2E72 A;  2RSD A;  1ZAA C;  2ADR A;  2KWJ A;  4XI1 A;  3O36 A;  2A25 A;  2EMY A;  4IS1 C;  4WZ0 A;  2EOX A;  2WCC 3;  1Z6U A;  2D9H A;  5G05 B;  2EMB A;  4N4F A;  3N9L A;  1X6E A;  4PTB A;  2FUU A;  2EOF A;  2EQ0 A;  4Q6F A;  2H0D A;  4R2P A;  3L11 A;  2CSZ A;  1WIM A;  1WJP A;  5KL6 A;  2KRE A;  3KV6 A;  5FEY A;  2LRI C;  5D1K B;  1YSA C;  4FK5 C;  2MIQ A;  2ELZ A;  2LO3 A;  2MDG A;  1MM3 A;  3U5M A;  2GHF A;  4WZ2 A;  2KE1 A;  2VPB A;  5G04 B;  4R2R A;  4FJC A;  2G45 A;  1F2I G;  2LXP C;  3SOX A;  5KL4 A;  2F42 A;  1G2F C;  4C9Z A;  4I7D A;  2DX8 A;  2YHO A;  2AN6 A;  2EOH A;  4A4B A;  2EML A;  2EN4 A;  2PNX A;  3PUR A;  3M62 A;  1TF6 A;  1WE9 A;  2MD8 C;  4UP0 A;  4F52 B;  2G43 A;  1A1F A;  2ECV A;  3EPL A;  2Y43 A;  2LV2 A;  2EJ4 A;  2KGI A;  2NAA A;  3EPK A;  2YSM A;  1WEO A;  5KH9 A;  1BBO A;  3C6W A;  1B69 A;  5FB1 A;  2KYU A;  5EYA F;  2L43 A;  2LV9 A;  2J7J A;  2PRT A;  5LKT A;  2MA6 A;  2VJF A;  3L1X A;  5KL5 A;  2EL6 A;  2YUR A;  3N9N A;  2YT5 A;  4YAD A;  4WA6 A;  2ELY A;  1G2D C;  1T1H A;  3T6R A;  3N9O A;  3RTR B;  5H9M A;  3I2D A;  2RPC A;  2VJE A;  3RPG C;  2YUC A;  2EN7 A;  1A1K A;  2JP9 A;  2ENH A;  2KIZ A;  4I7B A;  2Y1N A;  5B77 A;  5B75 A;  2EA6 A;  2EMZ A;  2L0B A;  2KFT A;  4R2D A;  4R2Y A;  5B76 A;  1WEM A;  5TDW A;  3N9M A;  5TRB A;  2M1R A;  4AP4 A;  2ZET C;  4ZQL A;  2ECI A;  4YAX A;  2LXH C;  5LKZ A;  1A1G A;  5AIT A;  5LCW B;  2LT7 A;  4QF2 A;  4YAT A;  2RSI A;  2VP7 A;  1VYX A;  4NN2 A;  3KV5 A;  3SOU A;  3DQV R;  2YU8 A;  2HYE D;  4V3K C;  1K2F A;  2EMG A;  4W4U A;  2HGH A;  2MKD A;  3EPJ A;  4LAD B;  2M6M A;  2UZG A;  1X4U A;  2YSP A;  2YRM A;  1A1H A;  2MT5 A;  4FK5 A;  2EPX A;  2EOI A;  3IHP A;  4WZ3 B;  2EPC A;  2GLI A;  4L58 A;  2EPZ A;  1X5W A;  4P5O B;  4PPE A;  4R2Q A;  2EM7 A;  3UK3 C;  4YC9 A;  4B7Y C;  3PUQ A;  3N9Q A;  2CKL A;  1CHC A;  1X4I A;  2VPG A;  2VRD A;  3O7A A;  1V87 A;  2F6J A;  3ZTG A;  1XWH A;  4R8P K;  4B86 C;  3VHT B;  1A1J A;  2EPA A;  4YBM A;  2EM0 A;  4CA1 A;  4ZUX U;  1X4J A;  2KWO A;  3U5O A;  4S3O B;  5B79 A;  4FIP A;  1WEU A;  1ZR9 A;  2I13 A;  2L80 A;  2ECN A;  2EMI A;  2EP3 A;  3ZYQ A;  3O70 A;  1HYJ A;  2G6Q A;  4WSG A;  3M99 A;  4UI9 B;  2QIC A;  2ECW A;  5FB0 A;  5I3L A;  2ECT A;  2EN6 A;  3O33 A;  4GND A;  1VD4 A;  4MVT A;  2EPR A;  4GNG A;  3LQH A;  1YUJ A;  2EOR A;  4N3W A;  3SHB A;  3ZVY A;  2FUI A;  3ASL A;  1WIL A;  5AIU A;  2YTI A;  2ECG A;  3O34 A;  5TBN A;  4R2A A;  2LGK A;  3HCU A;  1WEQ A;  1U6G B;  2XB1 A;  1YUI A;  2YTD A;  3KQI A;  2YU5 A;  2K17 A;  2MUM A;  2EOY A;  2WBT A;  2YTQ A;  4GZN C;  2DGC A;  2VPD A;  4LK9 A;  2MNZ A;  3N9P A;  5H1T A;  2EQ1 A;  1A1L A;  2EMK A;  1X3C A;  1WGM A;  1ZBD B;  5G0F A;  1JK1 A;  1FBV A;  4R2E A;  2IDA A;  3GV4 A;  1Z60 A;  1BOR A;  3T7L A;  5C13 A;  1Z2Q A;  1HYI A;  4MSX A;  2EPU A;  2CTD A;  4TKP B;  5KL7 A;  2L75 A;  3LQJ A;  2KGG A;  2YHN A;  4FO9 A;  3GL6 A;  2QIZ A;  4AYC A;  2CSY A;  4BBQ A;  2EL4 A;  4QF3 A;  2EL5 A;  3M63 A;  2EN1 A;  2C2L A;  2EM5 A;  2YTE A;  1WEV A;  5TDR A;  1JM7 B;  5JG6 A;  5H1U A;  3LRQ A;  4UP5 A;  2JMJ A;  2YTN A;  2KWK A;  1P47 A;  3HCT A;  2WBS A;  1FP0 A;  5KH7 A;  1AAY A;  3VK6 A;  2MKN A;  3HTK C;  2M3H A;  1N87 A;  3C5K A;  5H1V A;  1LLM C;  5D1L B;  4R7E A;  4F6M A;  4R2S A;  4V3L C;  2EM6 A;  5B78 A;  2DLQ A;  2EM3 A;  4F2J C;  2LDR A;  2LQ6 A;  2H0D B;  2YQL A;  1DGC A;  2YSO A;  2YYR A;  2M9A A;  4LKA A;  2MNY A;  1LDJ B; 
#chains in the Genus database with same CATH topology
 3MHS A;  4MLQ A;  5LLQ A;  2K16 A;  2XOZ A;  4AVX A;  1XNQ E;  2CT2 A;  2VPE A;  1FKA E;  4M2Z A;  1HNX E;  2I50 A;  3HTX A;  1VFY A;  1FJG E;  2EOJ A;  3U5P A;  2EM4 A;  2XOY A;  2ECJ A;  4GB0 A;  2EMA A;  1IYM A;  5LKX A;  3DJW A;  2EN3 A;  2VNF A;  2EPN A;  4S3O C;  4OGC A;  3EB5 A;  4LFC E;  2JRJ A;  5LKU A;  3NG2 A;  3M7K A;  2EOM A;  2CRR A;  2L5U A;  3SOW A;  1WEW A;  5C11 A;  4DV1 E;  4O5G A;  4LLB A;  2HDP A;  1MM2 A;  4DKK A;  2R1F A;  3EB6 A;  2E6S A;  1DVP A;  3BGH A;  4AQY E;  5A6A A;  5DIN A;  2YTG A;  2KR4 A;  4YBT A;  2YTP A;  2E5L E;  5IXM B;  2UXC E;  4LF5 E;  2DSY A;  5TAB A;  1PKP A;  2JMI A;  3THO B;  4X64 E;  4IC3 A;  4X9J A;  4HEI A;  2H36 X;  4BC7 A;  1UN6 B;  4OOG C;  2BAY A;  2QJ0 A;  2VJF B;  2CSH A;  2FD4 A;  4F9C B;  1UIL A;  3ZVZ B;  4GNF A;  2FSA A;  5FLX C;  3J7Y p;  2BB8 A;  2XEU A;  3HPS A;  4Q35 B;  1G25 A;  5LL6 R;  5B8D A;  2LVH A;  1IBM E;  3HXL A;  2EOO A;  2RQL A;  2EMW A;  4WX9 A;  5D1M B;  2HC5 A;  4O24 A;  2VJE B;  1MEY C;  2F6N A;  3LQI A;  3FL2 A;  4X8W A;  1SR9 A;  4BHW A;  2EMC A;  1WXR A;  4L7X A;  1WHQ A;  3VYX A;  5J3X A;  2Y1M A;  1GQE A;  3BF2 A;  3QZV A;  2BBG A;  3MHH C;  3C4B A;  2VQF E;  5AE2 A;  2JMD A;  4O43 A;  1BB8 A;  3LML A;  1X47 A;  4WXD A;  3ZPV E;  1WFK A;  3LDY A;  1X6F A;  3J7A G;  2UXB E;  2DMI A;  2EZ6 A;  2EOE A;  3V43 A;  3MSW A;  3IWD A;  4L5N C;  2DLK A;  4NHR A;  5KL2 A;  3LJU X;  4YAB A;  5IT9 C;  3L00 A;  2EN8 A;  2LGV A;  3SUB A;  3ADG A;  4DR6 E;  4P7D A;  2L2N A;  4R2C A;  3M99 B;  2JPA A;  2R76 A;  2OXQ C;  2B7T A;  4F6N A;  2EMF A;  1QU6 A;  2MC5 A;  2EPP A;  2KWN A;  1XMO E;  5A6B A;  3EPH A;  2EOS A;  3LLH A;  3RPG B;  2EOZ A;  4YBS A;  2LE2 A;  3DWD A;  2EM9 A;  5KL3 A;  2F4V E;  2EOQ A;  2K4V A;  3O35 A;  3MHH A;  2EN2 A;  2RSM A;  4JI4 E;  1KJK A;  4JI1 E;  2M85 A;  3KNV A;  2EE8 A;  4YHH E;  2EQ3 A;  2WBU A;  4GNE A;  2LGL A;  1UBD C;  2YTJ A;  1WEN A;  4AUQ B;  4ZDT A;  2L3J A;  3HCS A;  4O64 A;  5SVI B;  3AUZ A;  3H7H A;  2E6R A;  2ODR C;  1HNW E;  2JR1 A;  1A1I A;  3LVQ E;  1TF3 A;  2EOD A;  1ZU1 A;  2GPI A;  1X6H A;  2LGG A;  2ENC A;  1IBK E;  2L7P A;  1NEI A;  2L2K B;  4M9V C;  2MD7 B;  5DKA A;  2OWA A;  4ZYH A;  1T4L B;  2DMY A;  2YSJ A;  2MA5 A;  5FER A;  4A0C D;  4LJN A;  3U5N A;  2M4I A;  5AE3 A;  4QQ4 A;  4LU9 A;  2D8S A;  2EGP A;  3FIG A;  4CCG X;  3FEH A;  3O37 A;  2EMX A;  4J8Z A;  4X65 E;  2KOU A;  2UUC E;  2EM2 A;  2N3H A;  1T39 A;  4LF4 E;  1YYK A;  4GKJ E;  2EM8 A;  4IJD A;  2CKL B;  3F6G A;  2K4D A;  3ZNI A;  2JM3 A;  1NCS A;  1YPN A;  1JOC A;  2MKE A;  2KU3 A;  1JK2 A;  2DRP A;  1WES A;  5BR8 E;  3PHD A;  1SFE A;  2CT1 A;  3MHS C;  2YQM A;  1LDK C;  1F62 A;  2LN0 A;  4X3G A;  3L1Z B;  4A49 A;  2EMH A;  1RMD A;  2KKY A;  3MDB C;  1ZBT A;  2NAB A;  2YU4 A;  4H9D A;  1E4U A;  2KHX A;  3IWC A;  2DB2 A;  5KH3 A;  2ENA A;  3ECR A;  1Z1B A;  4A4C A;  2JY9 A;  4OX9 E;  2YTO A;  4I7C A;  4BHC A;  2LTR A;  3FM8 C;  4AYC B;  2RI7 A;  2LCE A;  2UUA E;  2NA2 A;  1WEE A;  3KZY A;  4TUG A;  2YW8 A;  2YRE A;  2YRH A;  3ADJ A;  4Z0O A;  3ZPV 1;  1JM7 A;  1X49 A;  1TN9 A;  2C2V S;  2K1J A;  2PUY A;  4X66 E;  2YTF A;  3DPL R;  4RH8 A;  3H09 A;  2YWQ A;  2ODR D;  1YYO A;  4IC2 A;  1WEP A;  2YRK A;  2E72 A;  1IQO A;  2RSD A;  1UHZ A;  1ZAA C;  2RS6 A;  2ADR A;  2RR4 A;  2JUN A;  2KWJ A;  4XI1 A;  3O36 A;  4O4K A;  2A25 A;  2EMY A;  1RQ0 A;  4F1P A;  4DR5 E;  4IS1 C;  4WZ0 A;  5SVY A;  2EOX A;  4JI3 E;  2WCC 3;  1Z6U A;  2P57 A;  2E1M A;  2D9H A;  4DV7 E;  3T1H E;  5G05 B;  2EMB A;  4N4F A;  1XNR E;  3N9L A;  2V88 A;  1X6E A;  4PTB A;  2FUU A;  2EOF A;  2EQ0 A;  4Q6F A;  3C6K A;  2H0D A;  1STU A;  2VF1 A;  4R2P A;  3L11 A;  5K3Q A;  2CSZ A;  1WIM A;  1WJP A;  2YZT A;  4ZYE A;  5KL6 A;  5LMN E;  4GKK E;  4LF8 E;  3E2D A;  2KRE A;  3KV6 A;  5FEY A;  1PJQ A;  2LRI C;  5D1K B;  1GZ6 A;  3C6M A;  4FK5 C;  2MIQ A;  4L8N A;  2IQJ A;  4WXC A;  1IQS A;  1YSA C;  2CPN A;  2ELZ A;  1O0W A;  2LO3 A;  2KON A;  1MM3 A;  3U5M A;  2GHF A;  2MDG A;  5AC4 A;  4WZ2 A;  3FJU B;  4M0V A;  2KE1 A;  2VPB A;  5G04 B;  4R2R A;  4FJC A;  1YZ9 A;  2G45 A;  3AV0 A;  2RTX A;  1YYW A;  1F2I G;  4JI2 E;  2LXP C;  3SOX A;  5KL4 A;  2F42 A;  4I8O A;  1G2F C;  4GEQ B;  4C9Z A;  4WPY A;  4I7D A;  2DX8 A;  2YHO A;  2AN6 A;  2EOH A;  2DJA A;  4Q28 A;  4A4B A;  2EML A;  2EN4 A;  2MC6 A;  2PNX A;  2V8Q B;  5IV8 B;  2VQE E;  4B3R E;  3PUR A;  3M62 A;  2EPO A;  3O47 A;  2EGM A;  4JI6 E;  4ZYG A;  1TF6 A;  1WE9 A;  2MD8 C;  2V86 A;  4UP0 A;  4DUY E;  3T9K A;  4F52 B;  2F8B A;  2G43 A;  1ZBQ A;  4BMJ A;  1A1F A;  2L6M A;  2I9I A;  3F6H A;  4LFA E;  5TSE A;  4B3S E;  2ECV A;  3EPL A;  2Y43 A;  2LV2 A;  1HNZ E;  2V89 A;  2EJ4 A;  2KGI A;  4JI7 E;  4JI5 E;  2M7Q A;  2NAA A;  4WSP A;  3EPK A;  2YSM A;  4NZV A;  1WEO A;  5KH9 A;  3VYY A;  4BCA A;  2IHR 1;  1BBO A;  3C6W A;  1B69 A;  5FB1 A;  2KYU A;  5EYA F;  3JUE A;  3BBG A;  2L43 A;  2LV9 A;  2FV4 B;  2J7J A;  2PRT A;  3PLW A;  5LKT A;  2V87 A;  3Q1D A;  1DQ3 A;  2MA6 A;  2VE7 C;  1MBM A;  2VJF A;  3TQM A;  3L1X A;  5KL5 A;  2EL6 A;  2YUR A;  4TUI A;  4B3T E;  2E61 A;  3N9N A;  2YT5 A;  4YAD A;  4WA6 A;  2ELY A;  2JWO A;  1G2D C;  1DI2 A;  1BBG A;  1T1H A;  3T6R A;  3N9O A;  3RTR B;  5IWA E;  1KYQ A;  5H9M A;  3I2D A;  4LF7 E;  4X62 E;  3THN A;  2UUB E;  1WHN A;  2RPC A;  2VJE A;  3ZOQ B;  4LFB E;  3RPG C;  2YUC A;  3BID A;  1IMU A;  2EN7 A;  1A1K A;  2JP9 A;  2WZO A;  1DCQ A;  2ENH A;  2KIZ A;  4HTG A;  4I7B A;  2Y1N A;  2JVA A;  5B77 A;  5B75 A;  2EA6 A;  2EMZ A;  2L0B A;  1PJS A;  4WFT A;  2KFT A;  4R2D A;  4R2Y A;  1PJT A;  5B76 A;  1WEM A;  5TDW A;  3N9M A;  2EXU A;  5TRB A;  2LAU A;  4P78 A;  2M1R A;  4AP4 A;  4ZQL A;  2ZET C;  2LRS A;  4M30 A;  2ECI A;  4YAX A;  5CFF E;  2LXH C;  4KHP E;  5LKZ A;  1A1G A;  4OGE A;  5AIT A;  3FAO A;  5LCW B;  2LT7 A;  2YVR A;  4QF2 A;  4YAT A;  2RSI A;  2VP7 A;  4BBY A;  1VYX A;  4NN2 A;  3KV5 A;  4ZYD A;  1EH8 A;  2YT4 A;  3SOU A;  3DQV R;  5SVX A;  2LJH A;  2M1S A;  4DUZ E;  1HR0 E;  2YU8 A;  3IWB A;  2HYE D;  4V3K C;  1K2F A;  4LF6 E;  2EMG A;  4W4U A;  4F54 A;  2HGH A;  2MKD A;  2Q8U A;  3EPJ A;  1N36 E;  4LAD B;  5A2Q C;  1N34 E;  3HPZ A;  2M6M A;  2UZG A;  5LMU E;  1X4U A;  2YSP A;  2YRM A;  1A1H A;  2MT5 A;  2EPM X;  4FK5 A;  5A6J A;  3JTZ A;  2MDR A;  4DV4 E;  4BC9 A;  2EPX A;  2LTS A;  4F9A B;  2V85 A;  1WRJ A;  4DR2 E;  2EOI A;  3IHP A;  4WZ3 B;  2EPC A;  2XP0 A;  5T6J A;  2GLI A;  1XMQ E;  4DR1 E;  4L58 A;  2EPZ A;  2UU9 E;  1X5W A;  3OTO E;  2KKX A;  1N32 E;  4P5O B;  4PPE A;  4R2Q A;  1N3G A;  3ADL A;  1EH7 A;  2LMZ A;  2CRW A;  5DNY A;  2JOB A;  2EM7 A;  3UK3 C;  4YC9 A;  4B7Y C;  2LUP B;  3PUQ A;  1T4O A;  3N9Q A;  2CKL A;  2FFW A;  1CHC A;  3HQ1 A;  1X4I A;  3C4T A;  2VPG A;  2VRD A;  3O7A A;  1V87 A;  4DV0 E;  2F6J A;  4DR3 E;  5F3W A;  3ZTG A;  2L3C A;  1XWH A;  4R8P K;  4B86 C;  3VHT B;  1A1J A;  2EPA A;  4Z0R A;  5A69 A;  3K6Q A;  4DR4 E;  4YBM A;  2EM0 A;  4CA1 A;  2YPN A;  4ZUX U;  1X4J A;  2KWO A;  2N8X A;  3U5O A;  4S3O B;  3EQ1 A;  4F9B B;  5B79 A;  2D8U A;  1WEU A;  4FIP A;  1ZR9 A;  4KWY A;  2K7I A;  2I13 A;  1MGT A;  2L80 A;  3DDT A;  2ECN A;  2EMI A;  2EP3 A;  3ZYQ A;  3O70 A;  2ZM6 E;  3T1Y E;  1X48 A;  4LF9 E;  1HYJ A;  2G6Q A;  4WSG A;  1GTK A;  1EKZ A;  3ADI A;  2RS7 A;  1L4S A;  3M99 A;  2JYA A;  3LVR E;  4O62 A;  2QIC A;  4UI9 B;  2ECW A;  5FB0 A;  5I3L A;  2ECT A;  2EN6 A;  3DF6 A;  3O33 A;  4GND A;  1VD4 A;  4MVT A;  4JYA E;  2G7H A;  2EPR A;  4DV5 E;  3FAN A;  4GNG A;  2NUG A;  1J5E E;  2M13 A;  3LQH A;  4JV5 E;  1YUJ A;  2EOR A;  4N3W A;  3SHB A;  3ZVY A;  2FUI A;  4DMI A;  3ASL A;  1WIL A;  5AIU A;  1EH6 A;  5ADZ A;  2YTI A;  2ECG A;  3O34 A;  2NUE A;  5TBN A;  4RHB B;  5SVI A;  4R2A A;  2LGK A;  2L2M A;  3HCU A;  1WEQ A;  1U6G B;  2XB1 A;  2JOX A;  1YUI A;  4DV6 E;  2B7V A;  2YTD A;  3KQI A;  2YU5 A;  2K17 A;  1T4N A;  1J26 A;  2EWL A;  4YY3 E;  1N33 E;  4KZS A;  2MUM A;  2EOY A;  2WBT A;  2YTQ A;  3JU0 A;  4GZN C;  2FGG A;  2DGC A;  2VPD A;  4LK9 A;  2B9D A;  2CSV A;  3J80 C;  2MNZ A;  1RC7 A;  3N9P A;  5H1T A;  2EQ1 A;  1A1L A;  2JXP A;  1IBL E;  2EMK A;  1T38 A;  1X3C A;  1WGM A;  2LUQ A;  2XOC A;  1ZBD B;  2N3G A;  5G0F A;  1JK1 A;  4B3M E;  1FBV A;  4R2E A;  2IDA A;  3GV4 A;  1Z60 A;  1BOR A;  3T7L A;  5C13 A;  2HJJ A;  1Z2Q A;  3QG5 C;  1HYI A;  4MSX A;  2EPU A;  2CTD A;  2UXD E;  3KWR A;  4TKP B;  5KL7 A;  2L75 A;  3LQJ A;  2KGG A;  2YHN A;  4FO9 A;  3GL6 A;  2DSM A;  2QIZ A;  4AYC A;  4LTY A;  3J81 C;  2CSY A;  2NUF A;  2LJU A;  4BBQ A;  2EL4 A;  5AC5 A;  4NXN E;  4QF3 A;  2EL5 A;  3M63 A;  2EN1 A;  5AAS A;  4DV2 E;  2CON A;  2B0O E;  2C2L A;  2EM5 A;  2EPK X;  1WEV A;  5TDR A;  1JM7 B;  2L92 A;  2YTE A;  4WYQ B;  4JI0 E;  5JG6 A;  5H1U A;  3LRQ A;  4UP5 A;  3OML A;  5A6K A;  3RMP A;  2JMJ A;  1I94 E;  4R8O A;  2YTN A;  2FTX B;  4R03 A;  5AE1 A;  2KWK A;  3KZZ A;  3HCT A;  1P47 A;  2WBS A;  1FP0 A;  5KH7 A;  2B3T B;  1AAY A;  4DV3 E;  3VK6 A;  2MKN A;  3HTK C;  3KDE C;  2M3H A;  3JAM C;  1N87 A;  3C5K A;  5H1V A;  1LLM C;  5D1L B;  2EPL X;  4R7E A;  1YFH A;  2L8T A;  2L33 A;  4F6M A;  4BHB A;  4R2S A;  4BS9 A;  4NXM E;  4V3L C;  2EM6 A;  5B78 A;  2DLQ A;  4K0K E;  4JI8 E;  2EM3 A;  4F2J C;  2LDR A;  2LQ6 A;  1QNT A;  2DIX A;  4DR7 E;  3P1X A;  2H0D B;  2YQL A;  1PDA A;  5A6B D;  1DGC A;  2YSO A;  2V83 A;  2YYR A;  2HHH E;  2M9A A;  4LKA A;  2MNY A;  2LBS B;  1LDJ B;  1AH5 A;  4MLV A;  4N4R B; 
#chains in the Genus database with same CATH homology
 3MHS A;  2K16 A;  4AVX A;  2CT2 A;  2VPE A;  2I50 A;  1VFY A;  2EOJ A;  3U5P A;  2EM4 A;  2ECJ A;  4GB0 A;  2EMA A;  1IYM A;  5LKX A;  2EN3 A;  2VNF A;  4S3O C;  3EB5 A;  2JRJ A;  5LKU A;  3NG2 A;  2EOM A;  2L5U A;  3SOW A;  1WEW A;  5C11 A;  4LLB A;  2HDP A;  1MM2 A;  2R1F A;  3EB6 A;  2E6S A;  1DVP A;  5DIN A;  2YTG A;  2KR4 A;  4YBT A;  2YTP A;  5TAB A;  2JMI A;  4IC3 A;  4X9J A;  1UN6 B;  2BAY A;  2QJ0 A;  2VJF B;  2CSH A;  3ZVZ B;  4GNF A;  2FSA A;  2BB8 A;  2XEU A;  1G25 A;  5B8D A;  2LVH A;  2EOO A;  2EMW A;  5D1M B;  2VJE B;  1MEY C;  2F6N A;  3LQI A;  3FL2 A;  4BHW A;  2EMC A;  4L7X A;  5J3X A;  2Y1M A;  3QZV A;  3MHH C;  2JMD A;  1BB8 A;  3ZPV E;  1WFK A;  1X6F A;  2DMI A;  2EOE A;  3V43 A;  2DLK A;  5KL2 A;  4YAB A;  2EN8 A;  2LGV A;  4R2C A;  3M99 B;  2JPA A;  2OXQ C;  4F6N A;  2EMF A;  2EPP A;  2KWN A;  3EPH A;  2EOS A;  3RPG B;  2EOZ A;  4YBS A;  2EM9 A;  5KL3 A;  2EOQ A;  3O35 A;  3MHH A;  2EN2 A;  1KJK A;  2M85 A;  3KNV A;  2EE8 A;  2WBU A;  2EQ3 A;  1UBD C;  4GNE A;  2LGL A;  2YTJ A;  1WEN A;  4AUQ B;  4ZDT A;  3HCS A;  4O64 A;  2E6R A;  1A1I A;  1TF3 A;  2EOD A;  1ZU1 A;  1X6H A;  2LGG A;  2ENC A;  4M9V C;  2MD7 B;  5DKA A;  2YSJ A;  2MA5 A;  5FER A;  4A0C D;  4LJN A;  3U5N A;  2D8S A;  2EGP A;  4CCG X;  3O37 A;  2EMX A;  2EM2 A;  2EM8 A;  4IJD A;  2CKL B;  2K4D A;  3ZNI A;  1NCS A;  1JOC A;  2KU3 A;  1JK2 A;  2DRP A;  1WES A;  3PHD A;  2CT1 A;  3MHS C;  2YQM A;  1LDK C;  1F62 A;  2LN0 A;  4X3G A;  3L1Z B;  4A49 A;  2EMH A;  1RMD A;  2NAB A;  2YU4 A;  1E4U A;  1Z1B A;  2ENA A;  5KH3 A;  4A4C A;  2YTO A;  4I7C A;  4AYC B;  2RI7 A;  2LCE A;  1WEE A;  2YW8 A;  2YRE A;  2YRH A;  3ZPV 1;  1JM7 A;  1TN9 A;  2C2V S;  2K1J A;  2PUY A;  2YTF A;  3DPL R;  4IC2 A;  1WEP A;  2YRK A;  2E72 A;  2RSD A;  1ZAA C;  2ADR A;  2KWJ A;  4XI1 A;  3O36 A;  2A25 A;  2EMY A;  4IS1 C;  4WZ0 A;  2EOX A;  2WCC 3;  1Z6U A;  2D9H A;  5G05 B;  2EMB A;  4N4F A;  3N9L A;  1X6E A;  4PTB A;  2FUU A;  2EOF A;  2EQ0 A;  4Q6F A;  2H0D A;  4R2P A;  3L11 A;  2CSZ A;  1WIM A;  1WJP A;  5KL6 A;  2KRE A;  3KV6 A;  5FEY A;  2LRI C;  5D1K B;  1YSA C;  4FK5 C;  2MIQ A;  2ELZ A;  2LO3 A;  2MDG A;  1MM3 A;  3U5M A;  2GHF A;  4WZ2 A;  2KE1 A;  2VPB A;  5G04 B;  4R2R A;  4FJC A;  2G45 A;  1F2I G;  2LXP C;  3SOX A;  5KL4 A;  2F42 A;  1G2F C;  4C9Z A;  4I7D A;  2DX8 A;  2YHO A;  2AN6 A;  2EOH A;  4A4B A;  2EML A;  2EN4 A;  2PNX A;  3PUR A;  3M62 A;  1TF6 A;  1WE9 A;  2MD8 C;  4UP0 A;  4F52 B;  2G43 A;  1A1F A;  2ECV A;  3EPL A;  2Y43 A;  2LV2 A;  2EJ4 A;  2KGI A;  2NAA A;  3EPK A;  2YSM A;  1WEO A;  5KH9 A;  1BBO A;  3C6W A;  1B69 A;  5FB1 A;  2KYU A;  5EYA F;  2L43 A;  2LV9 A;  2J7J A;  2PRT A;  5LKT A;  2MA6 A;  2VJF A;  3L1X A;  5KL5 A;  2EL6 A;  2YUR A;  3N9N A;  2YT5 A;  4YAD A;  4WA6 A;  2ELY A;  1G2D C;  1T1H A;  3T6R A;  3N9O A;  3RTR B;  5H9M A;  3I2D A;  2RPC A;  2VJE A;  3RPG C;  2YUC A;  2EN7 A;  1A1K A;  2JP9 A;  2ENH A;  2KIZ A;  4I7B A;  2Y1N A;  5B77 A;  5B75 A;  2EA6 A;  2EMZ A;  2L0B A;  2KFT A;  4R2D A;  4R2Y A;  5B76 A;  1WEM A;  5TDW A;  3N9M A;  5TRB A;  2M1R A;  4AP4 A;  2ZET C;  4ZQL A;  2ECI A;  4YAX A;  2LXH C;  5LKZ A;  1A1G A;  5AIT A;  5LCW B;  2LT7 A;  4QF2 A;  4YAT A;  2RSI A;  2VP7 A;  1VYX A;  4NN2 A;  3KV5 A;  3SOU A;  3DQV R;  2YU8 A;  2HYE D;  4V3K C;  1K2F A;  2EMG A;  4W4U A;  2HGH A;  2MKD A;  3EPJ A;  4LAD B;  2M6M A;  2UZG A;  1X4U A;  2YSP A;  2YRM A;  1A1H A;  2MT5 A;  4FK5 A;  2EPX A;  2EOI A;  3IHP A;  4WZ3 B;  2EPC A;  2GLI A;  4L58 A;  2EPZ A;  1X5W A;  4P5O B;  4PPE A;  4R2Q A;  2EM7 A;  3UK3 C;  4YC9 A;  4B7Y C;  3PUQ A;  3N9Q A;  2CKL A;  1CHC A;  1X4I A;  2VPG A;  2VRD A;  3O7A A;  1V87 A;  2F6J A;  3ZTG A;  1XWH A;  4R8P K;  4B86 C;  3VHT B;  1A1J A;  2EPA A;  4YBM A;  2EM0 A;  4CA1 A;  4ZUX U;  1X4J A;  2KWO A;  3U5O A;  4S3O B;  5B79 A;  4FIP A;  1WEU A;  1ZR9 A;  2I13 A;  2L80 A;  2ECN A;  2EMI A;  2EP3 A;  3ZYQ A;  3O70 A;  1HYJ A;  2G6Q A;  4WSG A;  3M99 A;  4UI9 B;  2QIC A;  2ECW A;  5FB0 A;  5I3L A;  2ECT A;  2EN6 A;  3O33 A;  4GND A;  1VD4 A;  4MVT A;  2EPR A;  4GNG A;  3LQH A;  1YUJ A;  2EOR A;  4N3W A;  3SHB A;  3ZVY A;  2FUI A;  3ASL A;  1WIL A;  5AIU A;  2YTI A;  2ECG A;  3O34 A;  5TBN A;  4R2A A;  2LGK A;  3HCU A;  1WEQ A;  1U6G B;  2XB1 A;  1YUI A;  2YTD A;  3KQI A;  2YU5 A;  2K17 A;  2MUM A;  2EOY A;  2WBT A;  2YTQ A;  4GZN C;  2DGC A;  2VPD A;  4LK9 A;  2MNZ A;  3N9P A;  5H1T A;  2EQ1 A;  1A1L A;  2EMK A;  1X3C A;  1WGM A;  1ZBD B;  5G0F A;  1JK1 A;  1FBV A;  4R2E A;  2IDA A;  3GV4 A;  1Z60 A;  1BOR A;  3T7L A;  5C13 A;  1Z2Q A;  1HYI A;  4MSX A;  2EPU A;  2CTD A;  4TKP B;  5KL7 A;  2L75 A;  3LQJ A;  2KGG A;  2YHN A;  4FO9 A;  3GL6 A;  2QIZ A;  4AYC A;  2CSY A;  4BBQ A;  2EL4 A;  4QF3 A;  2EL5 A;  3M63 A;  2EN1 A;  2C2L A;  2EM5 A;  2YTE A;  1WEV A;  5TDR A;  1JM7 B;  5JG6 A;  5H1U A;  3LRQ A;  4UP5 A;  2JMJ A;  2YTN A;  2KWK A;  1P47 A;  3HCT A;  2WBS A;  1FP0 A;  5KH7 A;  1AAY A;  3VK6 A;  2MKN A;  3HTK C;  2M3H A;  1N87 A;  3C5K A;  5H1V A;  1LLM C;  5D1L B;  4R7E A;  4F6M A;  4R2S A;  4V3L C;  2EM6 A;  5B78 A;  2DLQ A;  2EM3 A;  4F2J C;  2LDR A;  2LQ6 A;  2H0D B;  2YQL A;  1DGC A;  2YSO A;  2YYR A;  2M9A A;  4LKA A;  2MNY A;  1LDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...