1RMDA

Rag1 dimerization domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
NCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILNSLMVKCPAQDCNEEVSLEKYNHHVSSHKESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the RAG1 dimerization domain reveals multiple zinc-binding motifs including a novel zinc binuclear cluster.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords RAG1
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 1997-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
A PF10426 zf-RAG1 Recombination-activating protein 1 zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1rmdA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1rmdA02
3ZPV1 2CSYA 4R2AA 1A1LA 1ZBDB 2EGPA 1YUIA 1RMDA 2LGLA 4YC9A 2KGIA 4R2YA 2H0DA 1X4UA 2EQ1A 3HCUA 2DLQA 2YRKA 4LLBA 3HTKC 1LDJB 2EOQA 3SOWA 3U5PA 2I50A 2L5UA 3O36A 2EOIA 5G05B 2EM7A 3VK6A 2EM3A 2EL5A 2YTFA 4A4BA 2L75A 2KE1A 2M85A 2E6RA 1WEOA 3L1XA 4A0CD 2YTPA 2LXHC 2MDGA 2RPCA 1BBOA 4YATA 2WBTA 4YADA 3DPLR 2L43A 2YTDA 5AIUA 3L1ZB 4WZ2A 3U5NA 4YABA 5KL3A 5LKTA 4Q6FA 2EMXA 2YYRA 4FK5C 2FUIA 1BORA 2Y1MA 1WE9A 2EN7A 5JG6A 4AUQB 2ENHA 2EOFA 1ZAAC 4UP0A 1MM2A 2HDPA 2EPCA 1FP0A 5H1VA 2EL4A 2RSIA 2WBSA 4ZQLA 1UBDC 2KYUA 2MNYA 2KFTA 5TDWA 2MIQA 4YBSA 4R2CA 2KWOA 2VJEA 1JM7B 4LADB 2KIZA 4MSXA 5FERA 3UK3C 2KGGA 3LQJA 3N9PA 2EN3A 2LT7A 5H1UA 4N3WA 4XI1A 5TRBA 4UI9B 4PTBA 2YTOA 4S3OC 2ECWA 1A1IA 4WSGA 2MT5A 2JMJA 1WEEA 3EB5A 4I7CA 1T1HA 2DGCA 4N4FA 1ZR9A 2LVHA 3MHHC 3QZVA 2E72A 2YTNA 3ZVZB 3ZTGA 4R2PA 3FL2A 5FB1A 5B76A 2JP9A 3EPLA 2CKLB 2EOXA 4FK5A 2FSAA 2YTIA 2CKLA 5FEYA 2YTQA 1A1FA 4LK9A 2FUUA 2D8SA 5TBNA 2GHFA 5DKAA 1AAYA 4FIPA 4TKPB 2CSHA 3O37A 2EN1A 1E4UA 5KH7A 3GV4A 2L80A 5G04B 5C13A 2K17A 3ZNIA 2VRDA 4L7XA 3KV5A 1X4JA 2BB8A 2LRIC 2EMGA 3GL6A 2NABA 2IDAA 5H9MA 2EN2A 3C6WA 3N9LA 1JM7A 2EMZA 3RTRB 2EM6A 3ZVYA 2K16A 4GNDA 3HCTA 5LCWB 3PURA 3T7LA 2KREA 1Z6UA 2PUYA 4F6MA 5KH9A 2YURA 2ECNA 2EOSA 1B69A 2Y43A 2CSZA 5G0FA 5KL5A 2EM5A 4R2QA 5TABA 2MA5A 3M99A 3O35A 5LKXA 2EQ3A 2EPPA 2YTGA 3LRQA 2LQ6A 2VNFA 2VPDA 2ELYA 2G45A 1XWHA 3M62A 5B8DA 1F62A 2YSMA 3SOUA 5KH3A 1YUJA 2VPGA 2EPXA 2G6QA 4BBQA 2LGGA 2LO3A 5AITA 1WEVA 2EOZA 1WEQA 3KQIA 2DX8A 2K4DA 2YTJA 2R1FA 4FO9A 2EM2A 2UZGA 3HCSA 2LCEA 2EN6A 4IS1C 2YSJA 2EOEA 2ELZA 2YSOA 2VJFA 3U5MA 2H0DB 5KL2A 2ADRA 4AYCB 3I2DA 4A49A 2YHNA 1WENA 5DINA 2EM9A 2YREA 2YU5A 1VFYA 4GB0A 2DMIA 2MUMA 4CA1A 2YHOA 2PNXA 4W4UA 5D1MB 1F2IG 2Y1NA 3NG2A 2ECGA 3N9OA 1X6EA 2CT1A 2D9HA 2XEUA 4X3GA 1MM3A 2F6JA 1BB8A 1LDKC 2EMYA 1WEUA 3EPHA 2LXPC 1X6HA 2GLIA 2KU3A 3M63A 4AP4A 2YQLA 4X9JA 1DGCA 4FJCA 1IYMA 1Z2QA 5B78A 4GNEA 2L0BA 1U6GB 3ZYQA 3O34A 4S3OB 2M9AA 3N9QA 4R2RA 1DVPA 2VPEA 1WESA 4NN2A 5I3LA 4LKAA 1G2FC 2F6NA 2EN8A 2C2LA 2ECJA 1WILA 2ECTA 4P5OB 2MNZA 2DLKA 2EPRA 2MA6A 2EOMA 3EPKA 2A25A 2KR4A 1VYXA 1X6FA 2M6MA 4IJDA 5FB0A 1X5WA 2KWKA 5EYAF 1WEMA 1Z1BA 2E6SA 2CTDA 5KL6A 1K2FA 4GNGA 4WZ0A 3LQIA 1UN6B 2XB1A 1TN9A 2EORA 2AN6A 1WGMA 1V87A 3C5KA 2EPZA 2K1JA 1P47A 3N9MA 1WJPA 1CHCA 3MHSA 1VD4A 3O33A 5TDRA 2QIZA 2LV9A 4YBTA 2NAAA 3LQHA 1G25A 3T6RA 1N87A 2MD7B 4B7YC 3KNVA 5LKZA 2LV2A 2EOOA 4IC2A 2EMWA 3VHTB 4O64A 1ZU1A 4F52B 2LN0A 4R7EA 3RPGC 2MKDA 2YTEA 3MHHA 2WBUA 2EMAA 5KL7A 1X3CA 1TF3A 2M3HA 2EMKA 2EM0A 3ASLA 2ENCA 4R2DA 4F2JC 3L11A 4WA6A 4F6NA 2QJ0A 2ENAA 4V3LC 2RSDA 1JK2A 2MKNA 2EODA 2EMHA 2EM8A 4CCGX 2EM4A 4R2SA 4L58A 2EL6A 2EOJA 4B86C 2C2VS 2HYED 1A1HA 2BAYA 5B77A 4M9VC 3O7AA 2YRHA 1WFKA 2YUCA 4AYCA 4PPEA 2YSPA 1YSAC 1X4IA 5B79A 4R2EA 3U5OA 1A1KA 3KV6A 2EPAA 4GZNC 2EJ4A 1WEPA 1NCSA 2J7JA 2YT5A 4A4CA 2G43A 2JRJA 3PHDA 4WZ3B 2EMFA 1FBVA 1KJKA 2KWNA 2ZETC 2YRMA 4YAXA 4QF3A 2EMCA 2PRTA 4YBMA 2LGVA 4C9ZA 1A1JA 2YU4A 4UP5A 3IHPA 1A1GA 2LGKA 5B75A 4GNFA 1LLMC 2M1RA 4R8PK 2YW8A 4LJNA 2ECVA 5KL4A 2MD8C 5J3XA 2VJEB 2JMDA 2VP7A 3SHBA 3M99B 2EA6A 2HGHA 4V3KC 1TF6A 5D1KB 4ZDTA 2YU8A 3ZPVE 2EOYA 4QF2A 1WEWA 2DRPA 2EQ0A 4IC3A 2RI7A 3SOXA 3EPJA 4AVXA 2EE8A 5D1LB 4I7DA 1MEYC 2EMIA 2ECIA 3DQVR 2EMLA 3PUQA 3N9NA 2VJFB 2EOHA 2CT2A 1JOCA 3EB6A 1HYJA 5LKUA 2WCC3 2JPAA 4ZUXU 3V43A 2F42A 2EMBA 1Z60A 2EPUA 1G2DC 2VPBA 3O70A 2KWJA 2OXQC 2EN4A 1JK1A 2LDRA 1HYIA 3MHSC 2EP3A 2YQMA 2I13A 2JMIA 4BHWA 2QICA 3RPGB 4I7BA 5H1TA 4MVTA 5C11A 1WIMA
chains in the Genus database with same CATH superfamily
3ZPV1 2CSYA 4R2AA 1A1LA 1ZBDB 3HXLA 5TSEA 2EGPA 4X64E 1YUIA 1RMDA 2XP0A 2LGLA 2CRRA 4YC9A 2KGIA 4DMIA 4R2YA 2H0DA 1X4UA 2EQ1A 3HCUA 2DLQA 2YRKA 4LLBA 1DQ3A 2VF1A 3HTKC 5AC5A 2KOUA 2L92A 1X47A 5K3QA 4B3RE 1LDJB 3Q1DA 2EOQA 2MC6A 3SOWA 2L3CA 3U5PA 3J80C 3LDYA 2I50A 2L5UA 3O36A 2EOIA 5G05B 3IWBA 4NHRA 2EM7A 3VK6A 5FLXC 2EM3A 2EL5A 2YTFA 4DKKA 4A4BA 4L8NA 2L75A 5IV8B 5BR8E 1YFHA 1GTKA 2KE1A 2M85A 2E6RA 1WHNA 1WEOA 3L1XA 4A0CD 2YTPA 2LTRA 2LXHC 2MDGA 4OGCA 2RPCA 4KZSA 4YATA 1BBOA 2WBTA 4YADA 3DPLR 2L43A 2N8XA 2L33A 2M13A 2L2KB 2YTDA 5AIUA 3L1ZB 4WZ2A 3U5NA 4YABA 5KL3A 4LU9A 1ZBTA 4TUIA 5LKTA 2DB2A 4Q6FA 2EMXA 2YYRA 3F6GA 4FK5C 5IT9C 1YZ9A 4F54A 3IWDA 4BHBA 3THOB 2FUIA 3E2DA 4BBYA 1RC7A 1T4LB 1XNQE 4GKJE 2JOXA 1BORA 2Y1MA 4WPYA 1WE9A 2EN7A 5JG6A 2RS7A 5A6JA 4AUQB 2ENHA 2EOFA 3JU0A 1ZAAC 4UP0A 1MM2A 2HDPA 2EPCA 1FP0A 5H1VA 2EL4A 2RSIA 3MDBC 4ZQLA 2WBSA 1XMOE 2NUFA 1T38A 1UBDC 2KYUA 2MNYA 4M2ZA 2KFTA 5TDWA 1XNRE 2M7QA 2UXDE 2MIQA 1UHZA 4WXCA 3AUZA 4YBSA 2DSMA 4R2CA 2KWOA 2VJEA 1JM7B 3DDTA 2JR1A 4ZYDA 2JYAA 4LFAE 4LADB 2EPMX 2KIZA 4MSXA 5FERA 4B3TE 3UK3C 3ADIA 3DWDA 2KGGA 3LQJA 3N9PA 1X48A 2EN3A 2V89A 4JYAE 2LT7A 5H1UA 4N3WA 4XI1A 5TRBA 1IMUA 3C6KA 4R03A 5AE3A 4UI9B 4LF7E 4PTBA 2YTOA 5LMUE 4S3OC 2LUQA 1HNZE 2ECWA 2EPKX 1A1IA 4WSGA 2MT5A 4LF5E 4DR7E 2JMJA 1WEEA 3EQ1A 3EB5A 4I7CA 1T1HA 4RHBB 1YYWA 2NUEA 1EH7A 2DGCA 4N4FA 2EPOA 2G7HA 2FTXB 1ZR9A 2LVHA 3MHHC 4GKKE 3O47A 3QZVA 2E72A 2YTNA 3ZVZB 3ZTGA 4R2PA 2CRWA 3FL2A 4ZYEA 2B0OE 5FB1A 3K6QA 5B76A 4MLQA 2JP9A 3EPLA 5LL6R 2CKLB 2EOXA 4FK5A 2FSAA 2YTIA 3C4BA 2CKLA 5FEYA 4O4KA 2YTQA 1A1FA 4LK9A 3KZZA 1N36E 2DJAA 2D8SA 2FUUA 2L3JA 5TBNA 3KWRA 4WSPA 2GHFA 3JTZA 3C6MA 4JI5E 1HR0E 5DKAA 1AAYA 3VYYA 2UUBE 4FIPA 4TKPB 3VYXA 4LF4E 2CSHA 1O0WA 2LJHA 4Q28A 3O37A 4O5GA 2HC5A 3JAMC 2EN1A 5AE2A 1E4UA 5KH7A 3GV4A 2L80A 5G04B 2EGMA 2MKEA 2L2NA 1YYOA 4DR4E 5C13A 2K17A 3ZNIA 1HNXE 1RQ0A 2VRDA 4L7XA 2FFWA 3KV5A 4WYQB 1X4JA 2RR4A 2BB8A 2LRIC 2KONA 4DV4E 2EMGA 2MC5A 2N3HA 1T4NA 3GL6A 2NABA 2IDAA 2XOZA 5H9MA 3C6WA 3N9LA 1JM7A 2EN2A 2EMZA 3RTRB 2GPIA 5IWAE 2EM6A 2I9IA 3ZVYA 4DR3E 2K16A 5A2QC 4TUGA 4GNDA 4X66E 3HCTA 2JXPA 2ODRC 4JV5E 5LCWB 3PURA 1WXRA 3OTOE 3T7LA 2KREA 2ZM6E 1Z6UA 2PUYA 4F6MA 5KH9A 3FIGA 2YURA 2ECNA 2L6MA 2EOSA 1BBGA 1B69A 2Y43A 2CSZA 5G0FA 5KL5A 2EM5A 4R2QA 1IBLE 2ODRD 3LJUX 5TABA 2MA5A 3M99A 3O35A 5LKXA 2B7VA 2EQ3A 2EPPA 4AQYE 4B3SE 4M30A 2YTGA 3LRQA 2CSVA 2LQ6A 2VNFA 2VPDA 2V86A 5DNYA 2ELYA 2G45A 4RH8A 1MGTA 1XWHA 3M62A 5B8DA 2MDRA 3DF6A 1QU6A 5AASA 1WHQA 1F62A 5A6KA 1T39A 2RS6A 2YSMA 3SOUA 5KH3A 1YUJA 2VPGA 2EPXA 4DV2E 4H9DA 2G6QA 1IQSA 3T1HE 2LGGA 4BBQA 2LO3A 5A6BA 5AITA 2LJUA 2L8TA 2V85A 3BF2A 4BCAA 2FD4A 5AE1A 1WEVA 2E5LE 2EOZA 1WEQA 3KQIA 2DX8A 2K4DA 2YTJA 2R1FA 3TQMA 4DR5E 4FO9A 4P7DA 2EM2A 2LBSB 2UZGA 4ZYGA 5A6AA 3HCSA 3SUBA 2DSYA 2B3TB 2DIXA 2LTSA 4M0VA 2LCEA 2EN6A 3ZOQB 4IS1C 4NZVA 2Q8UA 2YSJA 1AH5A 2EOEA 3HPZA 2DMYA 2ELZA 2YSOA 2YT4A 4BHCA 4LF8E 2VJFA 3U5MA 2H0DB 5KL2A 2YZTA 2ADRA 4AYCB 4DV0E 2JOBA 3I2DA 4A49A 5ADZA 2YHNA 4KHPE 1WENA 4BMJA 1SR9A 5DINA 2EM9A 2UXCE 2YREA 2YU5A 1VFYA 4GB0A 2DMIA 2OWAA 2MUMA 4CA1A 2YHOA 5A69A 2PNXA 3FANA 3L00A 4W4UA 2V8QB 3OMLA 5D1MB 3RMPA 2Y1NA 3NG2A 3C4TA 4ZYHA 4DUZE 1F2IG 2ECGA 3N9OA 4WXDA 1X6EA 2CT1A 2D9HA 2XEUA 4X3GA 3ECRA 1MM3A 2F6JA 2YVRA 2NA2A 4LFBE 1BB8A 3LMLA 4X8WA 1LDKC 2EMYA 2L7PA 4F1PA 2B9DA 1WEUA 3EPHA 5F3WA 4BC9A 2LXPC 4JI3E 1X6HA 3LVRE 2B7TA 4LTYA 2KU3A 1IBKE 2GLIA 3JUEA 3H7HA 3M63A 4AP4A 2V87A 4X62E 4R8OA 4X65E 2JWOA 2YQLA 2VE7C 5LLQA 4X9JA 1DGCA 2VQFE 4FJCA 1IYMA 1Z2QA 5B78A 2K4VA 3KDEC 1ZBQA 2WZOA 4GNEA 4O43A 3HTXA 2RTXA 2L0BA 4JI0E 1U6GB 2LAUA 2EWLA 3ZYQA 4F9AB 3O34A 3ADLA 4S3OB 2M9AA 4B3ME 3N9QA 4R2RA 4DUYE 1DVPA 2VPEA 2UU9E 1WESA 1PKPA 2HHHE 4NN2A 5I3LA 4LKAA 1G2FC 2F6NA 4LF6E 2EN8A 2C2LA 2ECJA 1DCQA 1WILA 2ECTA 4P5OB 2MNZA 4DV3E 2DLKA 5SVIB 2EPRA 4JI4E 5SVXA 2MA6A 2EOMA 1X49A 2LMZA 2A25A 3EPKA 2KR4A 1IBME 1KYQA 1I94E 1VYXA 1X6FA 5LMNE 4WX9A 2M6MA 4IJDA 1PDAA 5FB0A 2NUGA 1X5WA 2KWKA 5EYAF 1WEMA 2IQJA 4OOGC 1Z1BA 2E6SA 2FGGA 2CTDA 5KL6A 2V83A 1K2FA 4GNGA 4WZ0A 3LQIA 4NXME 1UN6B 2XB1A 4MLVA 1TN9A 3FAOA 1SFEA 2EORA 3DJWA 2N3GA 2AN6A 1WGMA 4JI2E 4DR2E 1V87A 3C5KA 2EPZA 2F4VE 2K1JA 1P47A 2JUNA 2KKXA 3N9MA 1WJPA 1CHCA 3MHSA 1VD4A 2JVAA 3O33A 4DV1E 2EPLX 5TDRA 2QIZA 2UXBE 2LV9A 3THNA 4YBTA 2NAAA 5SVYA 2E1MA 3LQHA 3T1YE 3J7AG 1G25A 3T6RA 4DV7E 1N87A 3H09A 4BS9A 2MD7B 4B7YC 3KNVA 5LKZA 2LV2A 1EH8A 2EOOA 4IC2A 2EMWA 1MBMA 3VHTB 1YYKA 4O64A 1ZU1A 4F52B 1N32E 2LN0A 4R7EA 3RPGC 3ADJA 2MKDA 3T9KA 3MHHA 2YTEA 2WBUA 2LRSA 2EMAA 5KL7A 1X3CA 3LVQE 4O24A 1TF3A 2M3HA 2YWQA 4LF9E 2EMKA 2EM0A 2H36X 3J7Yp 4JI6E 4DR6E 3ASLA 2ENCA 4R2DA 1FKAE 2M4IA 2K7IA 4F2JC 3L11A 4WA6A 2LUPB 2UUCE 4Q35B 2QJ0A 2ENAA 4F6NA 3AV0A 4V3LC 2RSDA 1JK2A 2MKNA 2P57A 2EODA 1PJTA 2EMHA 4L5NC 4Z0OA 2EM8A 4CCGX 2EM4A 4R2SA 1N34E 1DI2A 2EPNA 3MSWA 2RSMA 4OX9E 4L58A 2EL6A 1QNTA 2EOJA 2R76A 3BGHA 4B86C 2FV4B 2RQLA 2C2VS 2HYED 2M1SA 3HQ1A 1A1HA 2BAYA 5B77A 4M9VC 3O7AA 5T6JA 1HNWE 2YRHA 1WFKA 4DR1E 2YUCA 4AYCA 4PPEA 2YSPA 1YSAC 2L2MA 1X4IA 3J81C 4NXNE 5B79A 4OGEA 1GQEA 2KHXA 4R2EA 4KWYA 3U5OA 1A1KA 3KV6A 2EPAA 4GZNC 2EJ4A 4K0KE 2BBGA 1WEPA 1NCSA 2J7JA 2YT5A 1WRJA 4A4CA 1T4OA 2G43A 5CFFE 2JRJA 3PHDA 4WZ3B 2EMFA 4O62A 3LLHA 1FBVA 1KJKA 2LE2A 2KWNA 2ZETC 2XOCA 2YRMA 2EXUA 1FJGE 4N4RB 4JI8E 4YAXA 4QF3A 2EMCA 4LFCE 5A6BD 2PRTA 4YBMA 1UILA 3F6HA 2IHR1 1L4SA 2LGVA 4I8OA 2D8UA 1J5EE 4C9ZA 4DV6E 3M7KA 4P78A 2V88A 2CPNA 2VQEE 1A1JA 2YU4A 4UP5A 1EH6A 1YPNA 3IHPA 1A1GA 3QG5C 2LGKA 5B75A 4GNFA 1N3GA 4JI7E 1LLMC 2M1RA 4R8PK 2CONA 2YW8A 4LJNA 2ECVA 5KL4A 2JM3A 2MD8C 3FM8C 5J3XA 4HTGA 1NEIA 2VJEB 2JMDA 2VP7A 3SHBA 3KZYA 2EA6A 3M99B 2HGHA 4V3KC 1TF6A 5SVIA 5D1KB 4ZDTA 2YU8A 1N33E 2HJJA 3ADGA 2JY9A 3BIDA 3ZPVE 2EOYA 2UUAE 4QF2A 1WEWA 3BBGA 4YHHE 2DRPA 1GZ6A 2EQ0A 2F8BA 1PJSA 4IC3A 4QQ4A 1PJQA 2RI7A 3SOXA 3P1XA 3EPJA 4AVXA 2EE8A 5D1LB 4I7DA 1MEYC 2EMIA 2ECIA 3DQVR 4Z0RA 4F9CB 2EMLA 3PUQA 1J26A 1STUA 3N9NA 2VJFB 2EOHA 2CT2A 3FJUB 1IQOA 1JOCA 3EB6A 1HYJA 3HPSA 5LKUA 2WCC3 2JPAA 4J8ZA 3PLWA 4DV5E 4ZUXU 3V43A 4YY3E 2F42A 3FEHA 4HEIA 2EMBA 1Z60A 2EZ6A 1EKZA 2EPUA 2XOYA 1G2DC 5IXMB 2VPBA 3O70A 5AC4A 2KWJA 2OXQC 2EN4A 4BC7A 1JK1A 4JI1E 2E61A 4GEQB 2LDRA 1HYIA 3MHSC 2EP3A 4F9BB 4WFTA 3IWCA 2YQMA 2KKYA 2JMIA 2I13A 4BHWA 2QICA 3RPGB 2YPNA 1XMQE 4I7BA 5H1TA 4MVTA 5C11A 1WIMA
chains in the Genus database with same CATH topology
3ZPV1 2CSYA 4R2AA 1A1LA 1ZBDB 2EGPA 1YUIA 1RMDA 2LGLA 4YC9A 2KGIA 4R2YA 2H0DA 1X4UA 2EQ1A 3HCUA 2DLQA 2YRKA 4LLBA 3HTKC 1LDJB 2EOQA 3SOWA 3U5PA 2I50A 2L5UA 3O36A 2EOIA 5G05B 2EM7A 3VK6A 2EM3A 2EL5A 2YTFA 4A4BA 2L75A 2KE1A 2M85A 2E6RA 1WEOA 3L1XA 4A0CD 2YTPA 2LXHC 2MDGA 2RPCA 1BBOA 4YATA 2WBTA 4YADA 3DPLR 2L43A 2YTDA 5AIUA 3L1ZB 4WZ2A 3U5NA 4YABA 5KL3A 5LKTA 4Q6FA 2EMXA 2YYRA 4FK5C 2FUIA 1BORA 2Y1MA 1WE9A 2EN7A 5JG6A 4AUQB 2ENHA 2EOFA 1ZAAC 4UP0A 1MM2A 2HDPA 2EPCA 1FP0A 5H1VA 2EL4A 2RSIA 2WBSA 4ZQLA 1UBDC 2KYUA 2MNYA 2KFTA 5TDWA 2MIQA 4YBSA 4R2CA 2KWOA 2VJEA 1JM7B 4LADB 2KIZA 4MSXA 5FERA 3UK3C 2KGGA 3LQJA 3N9PA 2EN3A 2LT7A 5H1UA 4N3WA 4XI1A 5TRBA 4UI9B 4PTBA 2YTOA 4S3OC 2ECWA 1A1IA 4WSGA 2MT5A 2JMJA 1WEEA 3EB5A 4I7CA 1T1HA 2DGCA 4N4FA 1ZR9A 2LVHA 3MHHC 3QZVA 2E72A 2YTNA 3ZVZB 3ZTGA 4R2PA 3FL2A 5FB1A 5B76A 2JP9A 3EPLA 2CKLB 2EOXA 4FK5A 2FSAA 2YTIA 2CKLA 5FEYA 2YTQA 1A1FA 4LK9A 2FUUA 2D8SA 5TBNA 2GHFA 5DKAA 1AAYA 4FIPA 4TKPB 2CSHA 3O37A 2EN1A 1E4UA 5KH7A 3GV4A 2L80A 5G04B 5C13A 2K17A 3ZNIA 2VRDA 4L7XA 3KV5A 1X4JA 2BB8A 2LRIC 2EMGA 3GL6A 2NABA 2IDAA 5H9MA 2EN2A 3C6WA 3N9LA 1JM7A 2EMZA 3RTRB 2EM6A 3ZVYA 2K16A 4GNDA 3HCTA 5LCWB 3PURA 3T7LA 2KREA 1Z6UA 2PUYA 4F6MA 5KH9A 2YURA 2ECNA 2EOSA 1B69A 2Y43A 2CSZA 5G0FA 5KL5A 2EM5A 4R2QA 5TABA 2MA5A 3M99A 3O35A 5LKXA 2EQ3A 2EPPA 2YTGA 3LRQA 2LQ6A 2VNFA 2VPDA 2ELYA 2G45A 1XWHA 3M62A 5B8DA 1F62A 2YSMA 3SOUA 5KH3A 1YUJA 2VPGA 2EPXA 2G6QA 4BBQA 2LGGA 2LO3A 5AITA 1WEVA 2EOZA 1WEQA 3KQIA 2DX8A 2K4DA 2YTJA 2R1FA 4FO9A 2EM2A 2UZGA 3HCSA 2LCEA 2EN6A 4IS1C 2YSJA 2EOEA 2ELZA 2YSOA 2VJFA 3U5MA 2H0DB 5KL2A 2ADRA 4AYCB 3I2DA 4A49A 2YHNA 1WENA 5DINA 2EM9A 2YREA 2YU5A 1VFYA 4GB0A 2DMIA 2MUMA 4CA1A 2YHOA 2PNXA 4W4UA 5D1MB 1F2IG 2Y1NA 3NG2A 2ECGA 3N9OA 1X6EA 2CT1A 2D9HA 2XEUA 4X3GA 1MM3A 2F6JA 1BB8A 1LDKC 2EMYA 1WEUA 3EPHA 2LXPC 1X6HA 2GLIA 2KU3A 3M63A 4AP4A 2YQLA 4X9JA 1DGCA 4FJCA 1IYMA 1Z2QA 5B78A 4GNEA 2L0BA 1U6GB 3ZYQA 3O34A 4S3OB 2M9AA 3N9QA 4R2RA 1DVPA 2VPEA 1WESA 4NN2A 5I3LA 4LKAA 1G2FC 2F6NA 2EN8A 2C2LA 2ECJA 1WILA 2ECTA 4P5OB 2MNZA 2DLKA 2EPRA 2MA6A 2EOMA 3EPKA 2A25A 2KR4A 1VYXA 1X6FA 2M6MA 4IJDA 5FB0A 1X5WA 2KWKA 5EYAF 1WEMA 1Z1BA 2E6SA 2CTDA 5KL6A 1K2FA 4GNGA 4WZ0A 3LQIA 1UN6B 2XB1A 1TN9A 2EORA 2AN6A 1WGMA 1V87A 3C5KA 2EPZA 2K1JA 1P47A 3N9MA 1WJPA 1CHCA 3MHSA 1VD4A 3O33A 5TDRA 2QIZA 2LV9A 4YBTA 2NAAA 3LQHA 1G25A 3T6RA 1N87A 2MD7B 4B7YC 3KNVA 5LKZA 2LV2A 2EOOA 4IC2A 2EMWA 3VHTB 4O64A 1ZU1A 4F52B 2LN0A 4R7EA 3RPGC 2MKDA 2YTEA 3MHHA 2WBUA 2EMAA 5KL7A 1X3CA 1TF3A 2M3HA 2EMKA 2EM0A 3ASLA 2ENCA 4R2DA 4F2JC 3L11A 4WA6A 4F6NA 2QJ0A 2ENAA 4V3LC 2RSDA 1JK2A 2MKNA 2EODA 2EMHA 2EM8A 4CCGX 2EM4A 4R2SA 4L58A 2EL6A 2EOJA 4B86C 2C2VS 2HYED 1A1HA 2BAYA 5B77A 4M9VC 3O7AA 2YRHA 1WFKA 2YUCA 4AYCA 4PPEA 2YSPA 1YSAC 1X4IA 5B79A 4R2EA 3U5OA 1A1KA 3KV6A 2EPAA 4GZNC 2EJ4A 1WEPA 1NCSA 2J7JA 2YT5A 4A4CA 2G43A 2JRJA 3PHDA 4WZ3B 2EMFA 1FBVA 1KJKA 2KWNA 2ZETC 2YRMA 4YAXA 4QF3A 2EMCA 2PRTA 4YBMA 2LGVA 4C9ZA 1A1JA 2YU4A 4UP5A 3IHPA 1A1GA 2LGKA 5B75A 4GNFA 1LLMC 2M1RA 4R8PK 2YW8A 4LJNA 2ECVA 5KL4A 2MD8C 5J3XA 2VJEB 2JMDA 2VP7A 3SHBA 3M99B 2EA6A 2HGHA 4V3KC 1TF6A 5D1KB 4ZDTA 2YU8A 3ZPVE 2EOYA 4QF2A 1WEWA 2DRPA 2EQ0A 4IC3A 2RI7A 3SOXA 3EPJA 4AVXA 2EE8A 5D1LB 4I7DA 1MEYC 2EMIA 2ECIA 3DQVR 2EMLA 3PUQA 3N9NA 2VJFB 2EOHA 2CT2A 1JOCA 3EB6A 1HYJA 5LKUA 2WCC3 2JPAA 4ZUXU 3V43A 2F42A 2EMBA 1Z60A 2EPUA 1G2DC 2VPBA 3O70A 2KWJA 2OXQC 2EN4A 1JK1A 2LDRA 1HYIA 3MHSC 2EP3A 2YQMA 2I13A 2JMIA 4BHWA 2QICA 3RPGB 4I7BA 5H1TA 4MVTA 5C11A 1WIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPV 1;  2CSY A;  4R2A A;  1A1L A;  1ZBD B;  2EGP A;  1YUI A;  1RMD A;  2LGL A;  4YC9 A;  2KGI A;  4R2Y A;  2H0D A;  1X4U A;  2EQ1 A;  3HCU A;  2DLQ A;  2YRK A;  4LLB A;  3HTK C;  1LDJ B;  2EOQ A;  3SOW A;  3U5P A;  2I50 A;  2L5U A;  3O36 A;  2EOI A;  5G05 B;  2EM7 A;  3VK6 A;  2EM3 A;  2EL5 A;  2YTF A;  4A4B A;  2L75 A;  2KE1 A;  2M85 A;  2E6R A;  1WEO A;  3L1X A;  4A0C D;  2YTP A;  2LXH C;  2MDG A;  2RPC A;  1BBO A;  4YAT A;  2WBT A;  4YAD A;  3DPL R;  2L43 A;  2YTD A;  5AIU A;  3L1Z B;  4WZ2 A;  3U5N A;  4YAB A;  5KL3 A;  5LKT A;  4Q6F A;  2EMX A;  2YYR A;  4FK5 C;  2FUI A;  1BOR A;  2Y1M A;  1WE9 A;  2EN7 A;  5JG6 A;  4AUQ B;  2ENH A;  2EOF A;  1ZAA C;  4UP0 A;  1MM2 A;  2HDP A;  2EPC A;  1FP0 A;  5H1V A;  2EL4 A;  2RSI A;  2WBS A;  4ZQL A;  1UBD C;  2KYU A;  2MNY A;  2KFT A;  5TDW A;  2MIQ A;  4YBS A;  4R2C A;  2KWO A;  2VJE A;  1JM7 B;  4LAD B;  2KIZ A;  4MSX A;  5FER A;  3UK3 C;  2KGG A;  3LQJ A;  3N9P A;  2EN3 A;  2LT7 A;  5H1U A;  4N3W A;  4XI1 A;  5TRB A;  4UI9 B;  4PTB A;  2YTO A;  4S3O C;  2ECW A;  1A1I A;  4WSG A;  2MT5 A;  2JMJ A;  1WEE A;  3EB5 A;  4I7C A;  1T1H A;  2DGC A;  4N4F A;  1ZR9 A;  2LVH A;  3MHH C;  3QZV A;  2E72 A;  2YTN A;  3ZVZ B;  3ZTG A;  4R2P A;  3FL2 A;  5FB1 A;  5B76 A;  2JP9 A;  3EPL A;  2CKL B;  2EOX A;  4FK5 A;  2FSA A;  2YTI A;  2CKL A;  5FEY A;  2YTQ A;  1A1F A;  4LK9 A;  2FUU A;  2D8S A;  5TBN A;  2GHF A;  5DKA A;  1AAY A;  4FIP A;  4TKP B;  2CSH A;  3O37 A;  2EN1 A;  1E4U A;  5KH7 A;  3GV4 A;  2L80 A;  5G04 B;  5C13 A;  2K17 A;  3ZNI A;  2VRD A;  4L7X A;  3KV5 A;  1X4J A;  2BB8 A;  2LRI C;  2EMG A;  3GL6 A;  2NAB A;  2IDA A;  5H9M A;  2EN2 A;  3C6W A;  3N9L A;  1JM7 A;  2EMZ A;  3RTR B;  2EM6 A;  3ZVY A;  2K16 A;  4GND A;  3HCT A;  5LCW B;  3PUR A;  3T7L A;  2KRE A;  1Z6U A;  2PUY A;  4F6M A;  5KH9 A;  2YUR A;  2ECN A;  2EOS A;  1B69 A;  2Y43 A;  2CSZ A;  5G0F A;  5KL5 A;  2EM5 A;  4R2Q A;  5TAB A;  2MA5 A;  3M99 A;  3O35 A;  5LKX A;  2EQ3 A;  2EPP A;  2YTG A;  3LRQ A;  2LQ6 A;  2VNF A;  2VPD A;  2ELY A;  2G45 A;  1XWH A;  3M62 A;  5B8D A;  1F62 A;  2YSM A;  3SOU A;  5KH3 A;  1YUJ A;  2VPG A;  2EPX A;  2G6Q A;  4BBQ A;  2LGG A;  2LO3 A;  5AIT A;  1WEV A;  2EOZ A;  1WEQ A;  3KQI A;  2DX8 A;  2K4D A;  2YTJ A;  2R1F A;  4FO9 A;  2EM2 A;  2UZG A;  3HCS A;  2LCE A;  2EN6 A;  4IS1 C;  2YSJ A;  2EOE A;  2ELZ A;  2YSO A;  2VJF A;  3U5M A;  2H0D B;  5KL2 A;  2ADR A;  4AYC B;  3I2D A;  4A49 A;  2YHN A;  1WEN A;  5DIN A;  2EM9 A;  2YRE A;  2YU5 A;  1VFY A;  4GB0 A;  2DMI A;  2MUM A;  4CA1 A;  2YHO A;  2PNX A;  4W4U A;  5D1M B;  1F2I G;  2Y1N A;  3NG2 A;  2ECG A;  3N9O A;  1X6E A;  2CT1 A;  2D9H A;  2XEU A;  4X3G A;  1MM3 A;  2F6J A;  1BB8 A;  1LDK C;  2EMY A;  1WEU A;  3EPH A;  2LXP C;  1X6H A;  2GLI A;  2KU3 A;  3M63 A;  4AP4 A;  2YQL A;  4X9J A;  1DGC A;  4FJC A;  1IYM A;  1Z2Q A;  5B78 A;  4GNE A;  2L0B A;  1U6G B;  3ZYQ A;  3O34 A;  4S3O B;  2M9A A;  3N9Q A;  4R2R A;  1DVP A;  2VPE A;  1WES A;  4NN2 A;  5I3L A;  4LKA A;  1G2F C;  2F6N A;  2EN8 A;  2C2L A;  2ECJ A;  1WIL A;  2ECT A;  4P5O B;  2MNZ A;  2DLK A;  2EPR A;  2MA6 A;  2EOM A;  3EPK A;  2A25 A;  2KR4 A;  1VYX A;  1X6F A;  2M6M A;  4IJD A;  5FB0 A;  1X5W A;  2KWK A;  5EYA F;  1WEM A;  1Z1B A;  2E6S A;  2CTD A;  5KL6 A;  1K2F A;  4GNG A;  4WZ0 A;  3LQI A;  1UN6 B;  2XB1 A;  1TN9 A;  2EOR A;  2AN6 A;  1WGM A;  1V87 A;  3C5K A;  2EPZ A;  2K1J A;  1P47 A;  3N9M A;  1WJP A;  1CHC A;  3MHS A;  1VD4 A;  3O33 A;  5TDR A;  2QIZ A;  2LV9 A;  4YBT A;  2NAA A;  3LQH A;  1G25 A;  3T6R A;  1N87 A;  2MD7 B;  4B7Y C;  3KNV A;  5LKZ A;  2LV2 A;  2EOO A;  4IC2 A;  2EMW A;  3VHT B;  4O64 A;  1ZU1 A;  4F52 B;  2LN0 A;  4R7E A;  3RPG C;  2MKD A;  2YTE A;  3MHH A;  2WBU A;  2EMA A;  5KL7 A;  1X3C A;  1TF3 A;  2M3H A;  2EMK A;  2EM0 A;  3ASL A;  2ENC A;  4R2D A;  4F2J C;  3L11 A;  4WA6 A;  4F6N A;  2QJ0 A;  2ENA A;  4V3L C;  2RSD A;  1JK2 A;  2MKN A;  2EOD A;  2EMH A;  2EM8 A;  4CCG X;  2EM4 A;  4R2S A;  4L58 A;  2EL6 A;  2EOJ A;  4B86 C;  2C2V S;  2HYE D;  1A1H A;  2BAY A;  5B77 A;  4M9V C;  3O7A A;  2YRH A;  1WFK A;  2YUC A;  4AYC A;  4PPE A;  2YSP A;  1YSA C;  1X4I A;  5B79 A;  4R2E A;  3U5O A;  1A1K A;  3KV6 A;  2EPA A;  4GZN C;  2EJ4 A;  1WEP A;  1NCS A;  2J7J A;  2YT5 A;  4A4C A;  2G43 A;  2JRJ A;  3PHD A;  4WZ3 B;  2EMF A;  1FBV A;  1KJK A;  2KWN A;  2ZET C;  2YRM A;  4YAX A;  4QF3 A;  2EMC A;  2PRT A;  4YBM A;  2LGV A;  4C9Z A;  1A1J A;  2YU4 A;  4UP5 A;  3IHP A;  1A1G A;  2LGK A;  5B75 A;  4GNF A;  1LLM C;  2M1R A;  4R8P K;  2YW8 A;  4LJN A;  2ECV A;  5KL4 A;  2MD8 C;  5J3X A;  2VJE B;  2JMD A;  2VP7 A;  3SHB A;  3M99 B;  2EA6 A;  2HGH A;  4V3K C;  1TF6 A;  5D1K B;  4ZDT A;  2YU8 A;  3ZPV E;  2EOY A;  4QF2 A;  1WEW A;  2DRP A;  2EQ0 A;  4IC3 A;  2RI7 A;  3SOX A;  3EPJ A;  4AVX A;  2EE8 A;  5D1L B;  4I7D A;  1MEY C;  2EMI A;  2ECI A;  3DQV R;  2EML A;  3PUQ A;  3N9N A;  2VJF B;  2EOH A;  2CT2 A;  1JOC A;  3EB6 A;  1HYJ A;  5LKU A;  2WCC 3;  2JPA A;  4ZUX U;  3V43 A;  2F42 A;  2EMB A;  1Z60 A;  2EPU A;  1G2D C;  2VPB A;  3O70 A;  2KWJ A;  2OXQ C;  2EN4 A;  1JK1 A;  2LDR A;  1HYI A;  3MHS C;  2EP3 A;  2YQM A;  2I13 A;  2JMI A;  4BHW A;  2QIC A;  3RPG B;  4I7B A;  5H1T A;  4MVT A;  5C11 A;  1WIM A; 
#chains in the Genus database with same CATH topology
 3ZPV 1;  2CSY A;  4R2A A;  1A1L A;  1ZBD B;  3HXL A;  5TSE A;  2EGP A;  4X64 E;  1YUI A;  1RMD A;  2XP0 A;  2LGL A;  2CRR A;  4YC9 A;  2KGI A;  4DMI A;  4R2Y A;  2H0D A;  1X4U A;  2EQ1 A;  3HCU A;  2DLQ A;  2YRK A;  4LLB A;  1DQ3 A;  2VF1 A;  3HTK C;  5AC5 A;  2KOU A;  2L92 A;  1X47 A;  5K3Q A;  4B3R E;  1LDJ B;  3Q1D A;  2EOQ A;  2MC6 A;  3SOW A;  2L3C A;  3U5P A;  3J80 C;  3LDY A;  2I50 A;  2L5U A;  3O36 A;  2EOI A;  5G05 B;  3IWB A;  4NHR A;  2EM7 A;  3VK6 A;  5FLX C;  2EM3 A;  2EL5 A;  2YTF A;  4DKK A;  4A4B A;  4L8N A;  2L75 A;  5IV8 B;  5BR8 E;  1YFH A;  1GTK A;  2KE1 A;  2M85 A;  2E6R A;  1WHN A;  1WEO A;  3L1X A;  4A0C D;  2YTP A;  2LTR A;  2LXH C;  2MDG A;  4OGC A;  2RPC A;  4KZS A;  4YAT A;  1BBO A;  2WBT A;  4YAD A;  3DPL R;  2L43 A;  2N8X A;  2L33 A;  2M13 A;  2L2K B;  2YTD A;  5AIU A;  3L1Z B;  4WZ2 A;  3U5N A;  4YAB A;  5KL3 A;  4LU9 A;  1ZBT A;  4TUI A;  5LKT A;  2DB2 A;  4Q6F A;  2EMX A;  2YYR A;  3F6G A;  4FK5 C;  5IT9 C;  1YZ9 A;  4F54 A;  3IWD A;  4BHB A;  3THO B;  2FUI A;  3E2D A;  4BBY A;  1RC7 A;  1T4L B;  1XNQ E;  4GKJ E;  2JOX A;  1BOR A;  2Y1M A;  4WPY A;  1WE9 A;  2EN7 A;  5JG6 A;  2RS7 A;  5A6J A;  4AUQ B;  2ENH A;  2EOF A;  3JU0 A;  1ZAA C;  4UP0 A;  1MM2 A;  2HDP A;  2EPC A;  1FP0 A;  5H1V A;  2EL4 A;  2RSI A;  3MDB C;  4ZQL A;  2WBS A;  1XMO E;  2NUF A;  1T38 A;  1UBD C;  2KYU A;  2MNY A;  4M2Z A;  2KFT A;  5TDW A;  1XNR E;  2M7Q A;  2UXD E;  2MIQ A;  1UHZ A;  4WXC A;  3AUZ A;  4YBS A;  2DSM A;  4R2C A;  2KWO A;  2VJE A;  1JM7 B;  3DDT A;  2JR1 A;  4ZYD A;  2JYA A;  4LFA E;  4LAD B;  2EPM X;  2KIZ A;  4MSX A;  5FER A;  4B3T E;  3UK3 C;  3ADI A;  3DWD A;  2KGG A;  3LQJ A;  3N9P A;  1X48 A;  2EN3 A;  2V89 A;  4JYA E;  2LT7 A;  5H1U A;  4N3W A;  4XI1 A;  5TRB A;  1IMU A;  3C6K A;  4R03 A;  5AE3 A;  4UI9 B;  4LF7 E;  4PTB A;  2YTO A;  5LMU E;  4S3O C;  2LUQ A;  1HNZ E;  2ECW A;  2EPK X;  1A1I A;  4WSG A;  2MT5 A;  4LF5 E;  4DR7 E;  2JMJ A;  1WEE A;  3EQ1 A;  3EB5 A;  4I7C A;  1T1H A;  4RHB B;  1YYW A;  2NUE A;  1EH7 A;  2DGC A;  4N4F A;  2EPO A;  2G7H A;  2FTX B;  1ZR9 A;  2LVH A;  3MHH C;  4GKK E;  3O47 A;  3QZV A;  2E72 A;  2YTN A;  3ZVZ B;  3ZTG A;  4R2P A;  2CRW A;  3FL2 A;  4ZYE A;  2B0O E;  5FB1 A;  3K6Q A;  5B76 A;  4MLQ A;  2JP9 A;  3EPL A;  5LL6 R;  2CKL B;  2EOX A;  4FK5 A;  2FSA A;  2YTI A;  3C4B A;  2CKL A;  5FEY A;  4O4K A;  2YTQ A;  1A1F A;  4LK9 A;  3KZZ A;  1N36 E;  2DJA A;  2D8S A;  2FUU A;  2L3J A;  5TBN A;  3KWR A;  4WSP A;  2GHF A;  3JTZ A;  3C6M A;  4JI5 E;  1HR0 E;  5DKA A;  1AAY A;  3VYY A;  2UUB E;  4FIP A;  4TKP B;  3VYX A;  4LF4 E;  2CSH A;  1O0W A;  2LJH A;  4Q28 A;  3O37 A;  4O5G A;  2HC5 A;  3JAM C;  2EN1 A;  5AE2 A;  1E4U A;  5KH7 A;  3GV4 A;  2L80 A;  5G04 B;  2EGM A;  2MKE A;  2L2N A;  1YYO A;  4DR4 E;  5C13 A;  2K17 A;  3ZNI A;  1HNX E;  1RQ0 A;  2VRD A;  4L7X A;  2FFW A;  3KV5 A;  4WYQ B;  1X4J A;  2RR4 A;  2BB8 A;  2LRI C;  2KON A;  4DV4 E;  2EMG A;  2MC5 A;  2N3H A;  1T4N A;  3GL6 A;  2NAB A;  2IDA A;  2XOZ A;  5H9M A;  3C6W A;  3N9L A;  1JM7 A;  2EN2 A;  2EMZ A;  3RTR B;  2GPI A;  5IWA E;  2EM6 A;  2I9I A;  3ZVY A;  4DR3 E;  2K16 A;  5A2Q C;  4TUG A;  4GND A;  4X66 E;  3HCT A;  2JXP A;  2ODR C;  4JV5 E;  5LCW B;  3PUR A;  1WXR A;  3OTO E;  3T7L A;  2KRE A;  2ZM6 E;  1Z6U A;  2PUY A;  4F6M A;  5KH9 A;  3FIG A;  2YUR A;  2ECN A;  2L6M A;  2EOS A;  1BBG A;  1B69 A;  2Y43 A;  2CSZ A;  5G0F A;  5KL5 A;  2EM5 A;  4R2Q A;  1IBL E;  2ODR D;  3LJU X;  5TAB A;  2MA5 A;  3M99 A;  3O35 A;  5LKX A;  2B7V A;  2EQ3 A;  2EPP A;  4AQY E;  4B3S E;  4M30 A;  2YTG A;  3LRQ A;  2CSV A;  2LQ6 A;  2VNF A;  2VPD A;  2V86 A;  5DNY A;  2ELY A;  2G45 A;  4RH8 A;  1MGT A;  1XWH A;  3M62 A;  5B8D A;  2MDR A;  3DF6 A;  1QU6 A;  5AAS A;  1WHQ A;  1F62 A;  5A6K A;  1T39 A;  2RS6 A;  2YSM A;  3SOU A;  5KH3 A;  1YUJ A;  2VPG A;  2EPX A;  4DV2 E;  4H9D A;  2G6Q A;  1IQS A;  3T1H E;  2LGG A;  4BBQ A;  2LO3 A;  5A6B A;  5AIT A;  2LJU A;  2L8T A;  2V85 A;  3BF2 A;  4BCA A;  2FD4 A;  5AE1 A;  1WEV A;  2E5L E;  2EOZ A;  1WEQ A;  3KQI A;  2DX8 A;  2K4D A;  2YTJ A;  2R1F A;  3TQM A;  4DR5 E;  4FO9 A;  4P7D A;  2EM2 A;  2LBS B;  2UZG A;  4ZYG A;  5A6A A;  3HCS A;  3SUB A;  2DSY A;  2B3T B;  2DIX A;  2LTS A;  4M0V A;  2LCE A;  2EN6 A;  3ZOQ B;  4IS1 C;  4NZV A;  2Q8U A;  2YSJ A;  1AH5 A;  2EOE A;  3HPZ A;  2DMY A;  2ELZ A;  2YSO A;  2YT4 A;  4BHC A;  4LF8 E;  2VJF A;  3U5M A;  2H0D B;  5KL2 A;  2YZT A;  2ADR A;  4AYC B;  4DV0 E;  2JOB A;  3I2D A;  4A49 A;  5ADZ A;  2YHN A;  4KHP E;  1WEN A;  4BMJ A;  1SR9 A;  5DIN A;  2EM9 A;  2UXC E;  2YRE A;  2YU5 A;  1VFY A;  4GB0 A;  2DMI A;  2OWA A;  2MUM A;  4CA1 A;  2YHO A;  5A69 A;  2PNX A;  3FAN A;  3L00 A;  4W4U A;  2V8Q B;  3OML A;  5D1M B;  3RMP A;  2Y1N A;  3NG2 A;  3C4T A;  4ZYH A;  4DUZ E;  1F2I G;  2ECG A;  3N9O A;  4WXD A;  1X6E A;  2CT1 A;  2D9H A;  2XEU A;  4X3G A;  3ECR A;  1MM3 A;  2F6J A;  2YVR A;  2NA2 A;  4LFB E;  1BB8 A;  3LML A;  4X8W A;  1LDK C;  2EMY A;  2L7P A;  4F1P A;  2B9D A;  1WEU A;  3EPH A;  5F3W A;  4BC9 A;  2LXP C;  4JI3 E;  1X6H A;  3LVR E;  2B7T A;  4LTY A;  2KU3 A;  1IBK E;  2GLI A;  3JUE A;  3H7H A;  3M63 A;  4AP4 A;  2V87 A;  4X62 E;  4R8O A;  4X65 E;  2JWO A;  2YQL A;  2VE7 C;  5LLQ A;  4X9J A;  1DGC A;  2VQF E;  4FJC A;  1IYM A;  1Z2Q A;  5B78 A;  2K4V A;  3KDE C;  1ZBQ A;  2WZO A;  4GNE A;  4O43 A;  3HTX A;  2RTX A;  2L0B A;  4JI0 E;  1U6G B;  2LAU A;  2EWL A;  3ZYQ A;  4F9A B;  3O34 A;  3ADL A;  4S3O B;  2M9A A;  4B3M E;  3N9Q A;  4R2R A;  4DUY E;  1DVP A;  2VPE A;  2UU9 E;  1WES A;  1PKP A;  2HHH E;  4NN2 A;  5I3L A;  4LKA A;  1G2F C;  2F6N A;  4LF6 E;  2EN8 A;  2C2L A;  2ECJ A;  1DCQ A;  1WIL A;  2ECT A;  4P5O B;  2MNZ A;  4DV3 E;  2DLK A;  5SVI B;  2EPR A;  4JI4 E;  5SVX A;  2MA6 A;  2EOM A;  1X49 A;  2LMZ A;  2A25 A;  3EPK A;  2KR4 A;  1IBM E;  1KYQ A;  1I94 E;  1VYX A;  1X6F A;  5LMN E;  4WX9 A;  2M6M A;  4IJD A;  1PDA A;  5FB0 A;  2NUG A;  1X5W A;  2KWK A;  5EYA F;  1WEM A;  2IQJ A;  4OOG C;  1Z1B A;  2E6S A;  2FGG A;  2CTD A;  5KL6 A;  2V83 A;  1K2F A;  4GNG A;  4WZ0 A;  3LQI A;  4NXM E;  1UN6 B;  2XB1 A;  4MLV A;  1TN9 A;  3FAO A;  1SFE A;  2EOR A;  3DJW A;  2N3G A;  2AN6 A;  1WGM A;  4JI2 E;  4DR2 E;  1V87 A;  3C5K A;  2EPZ A;  2F4V E;  2K1J A;  1P47 A;  2JUN A;  2KKX A;  3N9M A;  1WJP A;  1CHC A;  3MHS A;  1VD4 A;  2JVA A;  3O33 A;  4DV1 E;  2EPL X;  5TDR A;  2QIZ A;  2UXB E;  2LV9 A;  3THN A;  4YBT A;  2NAA A;  5SVY A;  2E1M A;  3LQH A;  3T1Y E;  3J7A G;  1G25 A;  3T6R A;  4DV7 E;  1N87 A;  3H09 A;  4BS9 A;  2MD7 B;  4B7Y C;  3KNV A;  5LKZ A;  2LV2 A;  1EH8 A;  2EOO A;  4IC2 A;  2EMW A;  1MBM A;  3VHT B;  1YYK A;  4O64 A;  1ZU1 A;  4F52 B;  1N32 E;  2LN0 A;  4R7E A;  3RPG C;  3ADJ A;  2MKD A;  3T9K A;  3MHH A;  2YTE A;  2WBU A;  2LRS A;  2EMA A;  5KL7 A;  1X3C A;  3LVQ E;  4O24 A;  1TF3 A;  2M3H A;  2YWQ A;  4LF9 E;  2EMK A;  2EM0 A;  2H36 X;  3J7Y p;  4JI6 E;  4DR6 E;  3ASL A;  2ENC A;  4R2D A;  1FKA E;  2M4I A;  2K7I A;  4F2J C;  3L11 A;  4WA6 A;  2LUP B;  2UUC E;  4Q35 B;  2QJ0 A;  2ENA A;  4F6N A;  3AV0 A;  4V3L C;  2RSD A;  1JK2 A;  2MKN A;  2P57 A;  2EOD A;  1PJT A;  2EMH A;  4L5N C;  4Z0O A;  2EM8 A;  4CCG X;  2EM4 A;  4R2S A;  1N34 E;  1DI2 A;  2EPN A;  3MSW A;  2RSM A;  4OX9 E;  4L58 A;  2EL6 A;  1QNT A;  2EOJ A;  2R76 A;  3BGH A;  4B86 C;  2FV4 B;  2RQL A;  2C2V S;  2HYE D;  2M1S A;  3HQ1 A;  1A1H A;  2BAY A;  5B77 A;  4M9V C;  3O7A A;  5T6J A;  1HNW E;  2YRH A;  1WFK A;  4DR1 E;  2YUC A;  4AYC A;  4PPE A;  2YSP A;  1YSA C;  2L2M A;  1X4I A;  3J81 C;  4NXN E;  5B79 A;  4OGE A;  1GQE A;  2KHX A;  4R2E A;  4KWY A;  3U5O A;  1A1K A;  3KV6 A;  2EPA A;  4GZN C;  2EJ4 A;  4K0K E;  2BBG A;  1WEP A;  1NCS A;  2J7J A;  2YT5 A;  1WRJ A;  4A4C A;  1T4O A;  2G43 A;  5CFF E;  2JRJ A;  3PHD A;  4WZ3 B;  2EMF A;  4O62 A;  3LLH A;  1FBV A;  1KJK A;  2LE2 A;  2KWN A;  2ZET C;  2XOC A;  2YRM A;  2EXU A;  1FJG E;  4N4R B;  4JI8 E;  4YAX A;  4QF3 A;  2EMC A;  4LFC E;  5A6B D;  2PRT A;  4YBM A;  1UIL A;  3F6H A;  2IHR 1;  1L4S A;  2LGV A;  4I8O A;  2D8U A;  1J5E E;  4C9Z A;  4DV6 E;  3M7K A;  4P78 A;  2V88 A;  2CPN A;  2VQE E;  1A1J A;  2YU4 A;  4UP5 A;  1EH6 A;  1YPN A;  3IHP A;  1A1G A;  3QG5 C;  2LGK A;  5B75 A;  4GNF A;  1N3G A;  4JI7 E;  1LLM C;  2M1R A;  4R8P K;  2CON A;  2YW8 A;  4LJN A;  2ECV A;  5KL4 A;  2JM3 A;  2MD8 C;  3FM8 C;  5J3X A;  4HTG A;  1NEI A;  2VJE B;  2JMD A;  2VP7 A;  3SHB A;  3KZY A;  2EA6 A;  3M99 B;  2HGH A;  4V3K C;  1TF6 A;  5SVI A;  5D1K B;  4ZDT A;  2YU8 A;  1N33 E;  2HJJ A;  3ADG A;  2JY9 A;  3BID A;  3ZPV E;  2EOY A;  2UUA E;  4QF2 A;  1WEW A;  3BBG A;  4YHH E;  2DRP A;  1GZ6 A;  2EQ0 A;  2F8B A;  1PJS A;  4IC3 A;  4QQ4 A;  1PJQ A;  2RI7 A;  3SOX A;  3P1X A;  3EPJ A;  4AVX A;  2EE8 A;  5D1L B;  4I7D A;  1MEY C;  2EMI A;  2ECI A;  3DQV R;  4Z0R A;  4F9C B;  2EML A;  3PUQ A;  1J26 A;  1STU A;  3N9N A;  2VJF B;  2EOH A;  2CT2 A;  3FJU B;  1IQO A;  1JOC A;  3EB6 A;  1HYJ A;  3HPS A;  5LKU A;  2WCC 3;  2JPA A;  4J8Z A;  3PLW A;  4DV5 E;  4ZUX U;  3V43 A;  4YY3 E;  2F42 A;  3FEH A;  4HEI A;  2EMB A;  1Z60 A;  2EZ6 A;  1EKZ A;  2EPU A;  2XOY A;  1G2D C;  5IXM B;  2VPB A;  3O70 A;  5AC4 A;  2KWJ A;  2OXQ C;  2EN4 A;  4BC7 A;  1JK1 A;  4JI1 E;  2E61 A;  4GEQ B;  2LDR A;  1HYI A;  3MHS C;  2EP3 A;  4F9B B;  4WFT A;  3IWC A;  2YQM A;  2KKY A;  2JMI A;  2I13 A;  4BHW A;  2QIC A;  3RPG B;  2YPN A;  1XMQ E;  4I7B A;  5H1T A;  4MVT A;  5C11 A;  1WIM A; 
#chains in the Genus database with same CATH homology
 3ZPV 1;  2CSY A;  4R2A A;  1A1L A;  1ZBD B;  2EGP A;  1YUI A;  1RMD A;  2LGL A;  4YC9 A;  2KGI A;  4R2Y A;  2H0D A;  1X4U A;  2EQ1 A;  3HCU A;  2DLQ A;  2YRK A;  4LLB A;  3HTK C;  1LDJ B;  2EOQ A;  3SOW A;  3U5P A;  2I50 A;  2L5U A;  3O36 A;  2EOI A;  5G05 B;  2EM7 A;  3VK6 A;  2EM3 A;  2EL5 A;  2YTF A;  4A4B A;  2L75 A;  2KE1 A;  2M85 A;  2E6R A;  1WEO A;  3L1X A;  4A0C D;  2YTP A;  2LXH C;  2MDG A;  2RPC A;  1BBO A;  4YAT A;  2WBT A;  4YAD A;  3DPL R;  2L43 A;  2YTD A;  5AIU A;  3L1Z B;  4WZ2 A;  3U5N A;  4YAB A;  5KL3 A;  5LKT A;  4Q6F A;  2EMX A;  2YYR A;  4FK5 C;  2FUI A;  1BOR A;  2Y1M A;  1WE9 A;  2EN7 A;  5JG6 A;  4AUQ B;  2ENH A;  2EOF A;  1ZAA C;  4UP0 A;  1MM2 A;  2HDP A;  2EPC A;  1FP0 A;  5H1V A;  2EL4 A;  2RSI A;  2WBS A;  4ZQL A;  1UBD C;  2KYU A;  2MNY A;  2KFT A;  5TDW A;  2MIQ A;  4YBS A;  4R2C A;  2KWO A;  2VJE A;  1JM7 B;  4LAD B;  2KIZ A;  4MSX A;  5FER A;  3UK3 C;  2KGG A;  3LQJ A;  3N9P A;  2EN3 A;  2LT7 A;  5H1U A;  4N3W A;  4XI1 A;  5TRB A;  4UI9 B;  4PTB A;  2YTO A;  4S3O C;  2ECW A;  1A1I A;  4WSG A;  2MT5 A;  2JMJ A;  1WEE A;  3EB5 A;  4I7C A;  1T1H A;  2DGC A;  4N4F A;  1ZR9 A;  2LVH A;  3MHH C;  3QZV A;  2E72 A;  2YTN A;  3ZVZ B;  3ZTG A;  4R2P A;  3FL2 A;  5FB1 A;  5B76 A;  2JP9 A;  3EPL A;  2CKL B;  2EOX A;  4FK5 A;  2FSA A;  2YTI A;  2CKL A;  5FEY A;  2YTQ A;  1A1F A;  4LK9 A;  2FUU A;  2D8S A;  5TBN A;  2GHF A;  5DKA A;  1AAY A;  4FIP A;  4TKP B;  2CSH A;  3O37 A;  2EN1 A;  1E4U A;  5KH7 A;  3GV4 A;  2L80 A;  5G04 B;  5C13 A;  2K17 A;  3ZNI A;  2VRD A;  4L7X A;  3KV5 A;  1X4J A;  2BB8 A;  2LRI C;  2EMG A;  3GL6 A;  2NAB A;  2IDA A;  5H9M A;  2EN2 A;  3C6W A;  3N9L A;  1JM7 A;  2EMZ A;  3RTR B;  2EM6 A;  3ZVY A;  2K16 A;  4GND A;  3HCT A;  5LCW B;  3PUR A;  3T7L A;  2KRE A;  1Z6U A;  2PUY A;  4F6M A;  5KH9 A;  2YUR A;  2ECN A;  2EOS A;  1B69 A;  2Y43 A;  2CSZ A;  5G0F A;  5KL5 A;  2EM5 A;  4R2Q A;  5TAB A;  2MA5 A;  3M99 A;  3O35 A;  5LKX A;  2EQ3 A;  2EPP A;  2YTG A;  3LRQ A;  2LQ6 A;  2VNF A;  2VPD A;  2ELY A;  2G45 A;  1XWH A;  3M62 A;  5B8D A;  1F62 A;  2YSM A;  3SOU A;  5KH3 A;  1YUJ A;  2VPG A;  2EPX A;  2G6Q A;  4BBQ A;  2LGG A;  2LO3 A;  5AIT A;  1WEV A;  2EOZ A;  1WEQ A;  3KQI A;  2DX8 A;  2K4D A;  2YTJ A;  2R1F A;  4FO9 A;  2EM2 A;  2UZG A;  3HCS A;  2LCE A;  2EN6 A;  4IS1 C;  2YSJ A;  2EOE A;  2ELZ A;  2YSO A;  2VJF A;  3U5M A;  2H0D B;  5KL2 A;  2ADR A;  4AYC B;  3I2D A;  4A49 A;  2YHN A;  1WEN A;  5DIN A;  2EM9 A;  2YRE A;  2YU5 A;  1VFY A;  4GB0 A;  2DMI A;  2MUM A;  4CA1 A;  2YHO A;  2PNX A;  4W4U A;  5D1M B;  1F2I G;  2Y1N A;  3NG2 A;  2ECG A;  3N9O A;  1X6E A;  2CT1 A;  2D9H A;  2XEU A;  4X3G A;  1MM3 A;  2F6J A;  1BB8 A;  1LDK C;  2EMY A;  1WEU A;  3EPH A;  2LXP C;  1X6H A;  2GLI A;  2KU3 A;  3M63 A;  4AP4 A;  2YQL A;  4X9J A;  1DGC A;  4FJC A;  1IYM A;  1Z2Q A;  5B78 A;  4GNE A;  2L0B A;  1U6G B;  3ZYQ A;  3O34 A;  4S3O B;  2M9A A;  3N9Q A;  4R2R A;  1DVP A;  2VPE A;  1WES A;  4NN2 A;  5I3L A;  4LKA A;  1G2F C;  2F6N A;  2EN8 A;  2C2L A;  2ECJ A;  1WIL A;  2ECT A;  4P5O B;  2MNZ A;  2DLK A;  2EPR A;  2MA6 A;  2EOM A;  3EPK A;  2A25 A;  2KR4 A;  1VYX A;  1X6F A;  2M6M A;  4IJD A;  5FB0 A;  1X5W A;  2KWK A;  5EYA F;  1WEM A;  1Z1B A;  2E6S A;  2CTD A;  5KL6 A;  1K2F A;  4GNG A;  4WZ0 A;  3LQI A;  1UN6 B;  2XB1 A;  1TN9 A;  2EOR A;  2AN6 A;  1WGM A;  1V87 A;  3C5K A;  2EPZ A;  2K1J A;  1P47 A;  3N9M A;  1WJP A;  1CHC A;  3MHS A;  1VD4 A;  3O33 A;  5TDR A;  2QIZ A;  2LV9 A;  4YBT A;  2NAA A;  3LQH A;  1G25 A;  3T6R A;  1N87 A;  2MD7 B;  4B7Y C;  3KNV A;  5LKZ A;  2LV2 A;  2EOO A;  4IC2 A;  2EMW A;  3VHT B;  4O64 A;  1ZU1 A;  4F52 B;  2LN0 A;  4R7E A;  3RPG C;  2MKD A;  2YTE A;  3MHH A;  2WBU A;  2EMA A;  5KL7 A;  1X3C A;  1TF3 A;  2M3H A;  2EMK A;  2EM0 A;  3ASL A;  2ENC A;  4R2D A;  4F2J C;  3L11 A;  4WA6 A;  4F6N A;  2QJ0 A;  2ENA A;  4V3L C;  2RSD A;  1JK2 A;  2MKN A;  2EOD A;  2EMH A;  2EM8 A;  4CCG X;  2EM4 A;  4R2S A;  4L58 A;  2EL6 A;  2EOJ A;  4B86 C;  2C2V S;  2HYE D;  1A1H A;  2BAY A;  5B77 A;  4M9V C;  3O7A A;  2YRH A;  1WFK A;  2YUC A;  4AYC A;  4PPE A;  2YSP A;  1YSA C;  1X4I A;  5B79 A;  4R2E A;  3U5O A;  1A1K A;  3KV6 A;  2EPA A;  4GZN C;  2EJ4 A;  1WEP A;  1NCS A;  2J7J A;  2YT5 A;  4A4C A;  2G43 A;  2JRJ A;  3PHD A;  4WZ3 B;  2EMF A;  1FBV A;  1KJK A;  2KWN A;  2ZET C;  2YRM A;  4YAX A;  4QF3 A;  2EMC A;  2PRT A;  4YBM A;  2LGV A;  4C9Z A;  1A1J A;  2YU4 A;  4UP5 A;  3IHP A;  1A1G A;  2LGK A;  5B75 A;  4GNF A;  1LLM C;  2M1R A;  4R8P K;  2YW8 A;  4LJN A;  2ECV A;  5KL4 A;  2MD8 C;  5J3X A;  2VJE B;  2JMD A;  2VP7 A;  3SHB A;  3M99 B;  2EA6 A;  2HGH A;  4V3K C;  1TF6 A;  5D1K B;  4ZDT A;  2YU8 A;  3ZPV E;  2EOY A;  4QF2 A;  1WEW A;  2DRP A;  2EQ0 A;  4IC3 A;  2RI7 A;  3SOX A;  3EPJ A;  4AVX A;  2EE8 A;  5D1L B;  4I7D A;  1MEY C;  2EMI A;  2ECI A;  3DQV R;  2EML A;  3PUQ A;  3N9N A;  2VJF B;  2EOH A;  2CT2 A;  1JOC A;  3EB6 A;  1HYJ A;  5LKU A;  2WCC 3;  2JPA A;  4ZUX U;  3V43 A;  2F42 A;  2EMB A;  1Z60 A;  2EPU A;  1G2D C;  2VPB A;  3O70 A;  2KWJ A;  2OXQ C;  2EN4 A;  1JK1 A;  2LDR A;  1HYI A;  3MHS C;  2EP3 A;  2YQM A;  2I13 A;  2JMI A;  4BHW A;  2QIC A;  3RPG B;  4I7B A;  5H1T A;  4MVT A;  5C11 A;  1WIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...