1RMDA

Rag1 dimerization domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
NCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILNSLMVKCPAQDCNEEVSLEKYNHHVSSHKESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAG1
publication title Crystal structure of the RAG1 dimerization domain reveals multiple zinc-binding motifs including a novel zinc binuclear cluster.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 1997-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
A PF10426 zf-RAG1 Recombination-activating protein 1 zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1rmdA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1rmdA02
1A1KA 2GHFA 5LKUA 2EODA 2ZETC 1WFKA 4YBTA 2EMCA 3O35A 5KL7A 2E72A 1TN9A 5FEYA 2YHOA 5TDWA 2HYED 2EMHA 1LDKC 3ZVYA 1U6GB 1IYMA 2YTJA 5G04B 1ZU1A 2MNYA 2ECTA 5TABA 5H9MA 3ZVZB 2K4DA 2CSZA 2Y1MA 5TBNA 1YSAC 3MHHC 2K17A 5B79A 2EM8A 3N9QA 2EOEA 3DQVR 2KFTA 5C13A 2ECWA 2YTGA 2CKLA 2L0BA 1Z2QA 1X4UA 2JMDA 2EMXA 3FL2A 3LQJA 2EMLA 4R2YA 5I3LA 5B78A 5B76A 5KH9A 2KGGA 2YURA 2CT1A 3UK3C 2EMIA 2YTOA 4O64A 2LVHA 4V3LC 4YC9A 3KV6A 2ECGA 4IC2A 2MKNA 2EE8A 2FUIA 2YQLA 2EP3A 5LCWB 4UP5A 2DRPA 4AUQB 2DX8A 4GNGA 1UN6B 4R8PK 1B69A 2E6RA 1DGCA 5G0FA 2D9HA 3N9LA 5AIUA 3EPKA 2KREA 3RPGC 4WZ2A 3ZTGA 2EOXA 3N9MA 3HCUA 1JM7B 2A25A 2LQ6A 1JK1A 2EN4A 2EN7A 4UP0A 1Z1BA 2L43A 2EL6A 1YUJA 4S3OC 2LO3A 5D1LB 3MHHA 3M62A 2EN1A 3GV4A 2EM6A 2YTQA 2EA6A 2YSOA 2EM2A 2AN6A 5KL5A 2VJEB 2J7JA 2VPEA 4FIPA 4PTBA 5FB0A 4X3GA 3ZPVE 2YT5A 4S3OB 5AITA 5EYAF 1TF3A 2MA5A 3U5NA 2YRMA 4N3WA 4B7YC 2RSDA 1FBVA 3LQHA 2EQ3A 4IC3A 2YTFA 2EL5A 2YTPA 1WEOA 2YHNA 2YU4A 1HYJA 2JPAA 3SHBA 2DMIA 5KH3A 2OXQC 1LLMC 2K1JA 4R2PA 3PUQA 3HCTA 2YQMA 4R7EA 3KV5A 2EN6A 1BB8A 2QJ0A 4FJCA 2ENAA 4YATA 3U5MA 2I13A 3VHTB 1JM7A 2YTDA 4A4CA 3T7LA 2KWOA 3KQIA 1E4UA 1ZBDB 4YADA 2EM5A 2KWNA 4F6MA 2VJEA 2JMJA 4LKAA 5D1MB 4MVTA 3QZVA 2KE1A 4X9JA 1WEUA 3PURA 1X4JA 3MHSA 2M6MA 2QICA 5B77A 2NABA 2EMAA 1X6HA 2ELZA 1A1IA 3I2DA 4LJNA 4A4BA 2YTEA 2H0DB 2VP7A 4LK9A 2EL4A 4WA6A 3O33A 4W4UA 2EQ0A 4ZUXU 1G2FC 2D8SA 3N9OA 4TKPB 4I7BA 2WBUA 2YRHA 3N9NA 2LN0A 2YU8A 1T1HA 2MD7B 1LDJB 1Z6UA 2EPPA 1WILA 1K2FA 5TDRA 1MEYC 2VPGA 2WBTA 2F42A 2MKDA 4V3KC 2MDGA 2GLIA 2EOIA 2C2VS 3EPHA 2FSAA 2EOZA 2EMBA 4MSXA 2G6QA 4L58A 2JRJA 4Q6FA 4FO9A 2JMIA 3SOXA 5H1TA 2G43A 2EOMA 5G05B 2YTIA 1WEVA 2VNFA 1VD4A 4AYCB 2ELYA 2H0DA 1WEQA 3MHSC 1A1JA 3LQIA 2C2LA 2HGHA 2EGPA 3ZNIA 4GB0A 2EPZA 2EOFA 3SOUA 3V43A 2RI7A 3ZYQA 4YBSA 2LGGA 2HDPA 2KWKA 4FK5A 4XI1A 4AP4A 1G2DC 1X6FA 2EOHA 3C6WA 1A1GA 4GNFA 1WIMA 1KJKA 2YSMA 1F2IG 3VK6A 1Z60A 2KU3A 2K16A 2L80A 2ECVA 2XB1A 4R2DA 4R2AA 4M9VC 4ZDTA 2YREA 3L1ZB 5LKTA 5FERA 4ZQLA 4QF2A 5KL6A 4R2QA 2NAAA 3NG2A 2CSYA 3N9PA 2DGCA 4F6NA 1WEMA 3EPJA 2MIQA 2KGIA 3KNVA 2CTDA 4A0CD 1RMDA 2EM9A 3EB6A 2IDAA 4AYCA 4F52B 3HTKC 2FUUA 2YUCA 1JK2A 1VYXA 2PNXA 1MM3A 2PUYA 2EMFA 2QIZA 2EN3A 3O36A 2EM4A 4B86C 4BHWA 2EOQA 1A1FA 1HYIA 2YRKA 4GNEA 2EM0A 2M3HA 1XWHA 2DLKA 2EOYA 2YTNA 1BORA 4GNDA 3EB5A 5KL3A 4IJDA 2DLQA 5B8DA 2M85A 2VRDA 2LGKA 5DINA 5KL4A 2R1FA 4FK5C 2YSPA 2CSHA 4NN2A 2KWJA 2YW8A 3U5OA 1AAYA 2G45A 2LXPC 4GZNC 1YUIA 4R2SA 4CA1A 4P5OB 2EOSA 2WCC3 2WBSA 4BBQA 2MNZA 5KL2A 2EMZA 1CHCA 4R2RA 2LV9A 2F6NA 1MM2A 2YYRA 2ECIA 2I50A 2RSIA 1X3CA 5LKXA 1X5WA 2BAYA 1ZAAC 2EORA 4YABA 2L75A 3HCSA 3SOWA 1WEPA 2Y1NA 4I7DA 4WZ3B 4A49A 2ENHA 2LRIC 4YBMA 2M9AA 3O7AA 2EPRA 5J3XA 5FB1A 2LV2A 2EOOA 3M63A 2YU5A 1VFYA 2YSJA 2LGLA 5H1UA 4C9ZA 1NCSA 2EN2A 1X4IA 2KIZA 1JOCA 2VJFB 1WENA 3O37A 5D1KB 4CCGX 2KYUA 1V87A 2UZGA 1ZR9A 2LT7A 4I7CA 1TF6A 2LCEA 2E6SA 3U5PA 1UBDC 2LDRA 3RTRB 4F2JC 4WSGA 1WESA 2EM7A 4L7XA 2LGVA 2EPCA 2EPAA 2EPXA 3L1XA 5KH7A 2F6JA 2EM3A 1WEWA 3DPLR 4WZ0A 2EOJA 3M99B 2MA6A 4YAXA 5C11A 2PRTA 5LKZA 3T6RA 3IHPA 2EN8A 2L5UA 5DKAA 4IS1C 1FP0A 2ECJA 1X6EA 5TRBA 2CT2A 3O70A 1WGMA 1G25A 3C5KA 2EMKA 1N87A 5JG6A 2MD8C 2LXHC 1P47A 2EMGA 2RPCA 2EQ1A 4R2EA 1DVPA 2KR4A 3ZPV1 3RPGB 1WEEA 3GL6A 5H1VA 4N4FA 4PPEA 4QF3A 2BB8A 2M1RA 1A1LA 4LADB 2MT5A 2VJFA 2ADRA 1WE9A 4R2CA 2CKLB 3LRQA 4AVXA 2XEUA 2EPUA 4LLBA 4UI9B 2ECNA 3PHDA 5B75A 1BBOA 1A1HA 3O34A 2MUMA 3ASLA 1WJPA 2EJ4A 2JP9A 2VPDA 3L11A 2ENCA 2VPBA 2Y43A 3M99A 2EMWA 1F62A 3EPLA 2EMYA
chains in the Genus database with same CATH superfamily
2LTRA 4DV3E 1A1KA 3KZYA 1HNWE 2GHFA 4DV6E 5LKUA 2EODA 2ZETC 4OGEA 2EPKX 1WFKA 4YBTA 2EMCA 3O35A 5KL7A 2E72A 3FM8C 1TN9A 5FEYA 2YHOA 5TDWA 2HYED 2EMHA 1LDKC 3ZVYA 1U6GB 1IYMA 2N3GA 2EPMX 5G04B 2YTJA 1ZU1A 4JI5E 2MNYA 2DSYA 2ECTA 5TABA 5H9MA 4J8ZA 3ZVZB 2K4DA 2CSZA 4JI0E 2Y1MA 4LF8E 3JU0A 2FV4B 5AE1A 1T4OA 5TBNA 2F4VE 4X66E 1YSAC 3MHHC 2K17A 3RMPA 1I94E 5B79A 2LTSA 2EM8A 3N9QA 2EOEA 3DQVR 4JI3E 2KFTA 4DV1E 5A69A 5C13A 4WXCA 2EPOA 1N32E 4Q35B 2ECWA 2DMYA 2YTGA 1IBME 2CKLA 1IMUA 4M2ZA 2L0BA 1Z2QA 1X4UA 2JMDA 1EH8A 3FL2A 2EMXA 1N34E 2RTXA 3LQJA 4F9CB 4WXDA 1IBKE 2EMLA 4R2YA 2B0OE 3LJUX 5B78A 5B76A 5I3LA 4NZVA 4WFTA 5KH9A 2KGGA 2YURA 2CT1A 3UK3C 2M13A 2V86A 2EMIA 3HQ1A 2YTOA 4O64A 2JWOA 2LVHA 3THOB 4V3LC 5AC5A 1T4LB 4NHRA 4YC9A 4X65E 4ZYGA 4DV2E 2EPLX 3KV6A 4BBYA 2ECGA 4IC2A 5K3QA 2JR1A 2MKNA 2EE8A 2FUIA 2L3JA 4LF4E 2YQLA 1IQOA 2EP3A 4R03A 5LCWB 4JYAE 4UP5A 2DRPA 2LJUA 4AUQB 2DX8A 4GNGA 1UN6B 4R8PK 3H7HA 1B69A 4N4RB 4LTYA 3ADLA 2E6RA 1DGCA 5G0FA 4B3SE 2RQLA 3AV0A 2ODRC 2D9HA 3N9LA 5AIUA 1WHQA 2WZOA 3EPKA 3OMLA 2KREA 5A6BA 5F3WA 3RPGC 1YYWA 4WZ2A 3ZTGA 2EOXA 2KKXA 3N9MA 3HCUA 1JM7B 2NUGA 2A25A 2LQ6A 1JK1A 4BHBA 2EN4A 4GEQB 3MSWA 2EN7A 4OX9E 1STUA 2XP0A 4UP0A 3IWCA 1Z1BA 2L43A 2EL6A 1YUJA 4S3OC 2CRRA 2LO3A 2V8QB 2LRSA 5D1LB 1XMOE 5BR8E 4DR6E 3MHHA 3M62A 2MDRA 4B3ME 2EN1A 3GV4A 2EM6A 2YTQA 2LUPB 2YZTA 2EA6A 2YSOA 2EM2A 2AN6A 5KL5A 2L33A 3L00A 5IXMB 2VJEB 2KKYA 1GQEA 2J7JA 2VPEA 4M0VA 1WXRA 4DV0E 1YZ9A 4KHPE 2NA2A 4FIPA 4BS9A 2OWAA 4PTBA 2D8UA 1RQ0A 5FB0A 4X3GA 3ZPVE 2YT5A 3BIDA 4DMIA 1IBLE 4S3OB 5AITA 4BHCA 3JUEA 4DR4E 5EYAF 3TQMA 1TF3A 4YHHE 1L4SA 1N36E 4Z0OA 2MA5A 3U5NA 2LJHA 2YRMA 1HR0E 4N3WA 4B7YC 2RSDA 1FBVA 3LQHA 2EQ3A 4IC3A 1GTKA 2YTFA 2EL5A 1EH6A 2YTPA 1WEOA 2YHNA 2YU4A 1HYJA 2JPAA 2YVRA 2LE2A 4LF7E 1QNTA 3SHBA 2DMIA 5KH3A 2OXQC 1WRJA 5LMUE 1DQ3A 1LLMC 2K1JA 4R2PA 3PUQA 2JOXA 5DNYA 3HCTA 2YQMA 2L6MA 4R7EA 3KV5A 2EN6A 5FLXC 4BMJA 1YFHA 3IWBA 1BB8A 1T39A 2QJ0A 4FJCA 1X47A 2ENAA 4YATA 3U5MA 1PKPA 3KWRA 2I13A 3VHTB 1JM7A 2YTDA 1J5EE 2B3TB 2R76A 4A4CA 3T7LA 2K7IA 3T9KA 2RS6A 2UXBE 1DI2A 2KWOA 3KQIA 1E4UA 3LVQE 3ECRA 1ZBDB 4YADA 2EM5A 1SFEA 1X49A 2BBGA 1KYQA 2V85A 2M7QA 5LMNE 2YT4A 2KWNA 2RS7A 3IWDA 4F6MA 2VJEA 3C4BA 2JMJA 2LUQA 1BBGA 2EXUA 4LKAA 5D1MB 4MVTA 2KHXA 3QZVA 2KE1A 3FANA 4X9JA 1WEUA 4YY3E 4LFAE 4JI1E 3PURA 4H9DA 1X4JA 3MHSA 3C6MA 5TSEA 2M6MA 2QICA 3LLHA 5B77A 2ODRD 2NABA 5AE2A 4DR3E 2EMAA 1X6HA 2ELZA 4O4KA 4JI8E 3I2DA 4LJNA 1A1IA 4A4BA 2YTEA 2H0DB 2VP7A 4LK9A 2EL4A 3VYYA 4WA6A 2VQEE 4DR1E 3O33A 4W4UA 2EQ0A 4ZUXU 5A6KA 1G2FC 3JTZA 2D8SA 3N9OA 4TKPB 4I7BA 3BBGA 2L2NA 2RSMA 4RH8A 2WBUA 2B9DA 2YRHA 3N9NA 4O5GA 4X62E 1MGTA 2LN0A 3VYXA 2LBSB 2YU8A 3QG5C 1T1HA 2MD7B 1LDJB 4Q28A 2ZM6E 5LLQA 2VE7C 4M30A 3PLWA 2IQJA 1Z6UA 2L2MA 2EPPA 1WILA 1K2FA 5TDRA 2F8BA 2VPGA 2WBTA 3BGHA 2MC6A 3LMLA 1YYOA 1MEYC 2XOCA 2F42A 2MKDA 4V3KC 2MDGA 2GLIA 4HTGA 4NXNE 5A2QC 2EOIA 5AASA 4KZSA 2C2VS 3EPHA 2FSAA 3HTXA 2EOZA 2EMBA 4ZYEA 1PJSA 2V87A 5IWAE 4MSXA 2G6QA 4L58A 3M7KA 2JRJA 4Q6FA 4R8OA 4FO9A 2JMIA 5T6JA 3SOXA 5H1TA 2G43A 2EOMA 2FD4A 5G05B 4L5NC 3FJUB 2UUAE 2YTIA 3C6KA 1WEVA 2MKEA 2VNFA 2HHHE 1VD4A 2E61A 4AYCB 3HPSA 2CPNA 2ELYA 2H0DA 1WEQA 2CRWA 3MHSC 1A1JA 3LQIA 2C2LA 4ZYHA 2CSVA 2HGHA 4B3TE 2M4IA 2EGPA 3ZNIA 4GB0A 2EPZA 1HNZE 2EOFA 5A6BD 3SOUA 3V43A 3FIGA 2RI7A 3ZYQA 4YBSA 2LGGA 2HDPA 2KWKA 4FK5A 4XI1A 4AP4A 3EQ1A 1X6FA 4DR2E 4L8NA 1EKZA 3DWDA 2EOHA 1G2DC 1N33E 3C6WA 4F9AB 1NEIA 1A1GA 4LF6E 4GNFA 1WIMA 2JYAA 2YSMA 1KJKA 3ADIA 1F2IG 3VK6A 1Z60A 2DJAA 2P57A 2UU9E 1XNRE 2KU3A 4DUZE 2K16A 2L80A 2ECVA 2XB1A 4R2DA 2UUBE 3T1YE 4R2AA 4M9VC 4O24A 2DB2A 2YPNA 4ZDTA 2YREA 3L1ZB 3SUBA 5LKTA 5FERA 4ZQLA 4QF2A 5KL6A 4R2QA 2NAAA 4I8OA 3NG2A 2CSYA 2L8TA 3DF6A 2FGGA 3N9PA 2DGCA 4F6NA 1WEMA 4WPYA 2JUNA 2N8XA 3EPJA 4Z0RA 5SVIB 2MIQA 4O43A 4BC7A 2KGIA 3KNVA 2CTDA 4NXME 2EGMA 4A0CD 1RMDA 4OGCA 2EM9A 3EB6A 2E1MA 3J7Yp 4BCAA 2IDAA 4AYCA 4F52B 4MLVA 3HTKC 2NUEA 2FUUA 2YUCA 2UUCE 1O0WA 1JK2A 1VYXA 2PNXA 1MM3A 2PUYA 2EMFA 2QIZA 2EN3A 3J7AG 3O36A 2EM4A 4B86C 4BHWA 2JM3A 2EOQA 2L92A 4JI2E 1A1FA 1HYIA 2YRKA 2XOYA 4GNEA 2EM0A 2M1SA 2L2KB 2M3HA 1XWHA 2DLKA 2EOYA 2YTNA 1BORA 4GNDA 3EB5A 2G7HA 4P78A 4DR5E 5IV8B 5KL3A 2EZ6A 3Q1DA 2E5LE 4IJDA 1SR9A 4B3RE 2DLQA 5B8DA 2M85A 2VRDA 2B7TA 2LGKA 5DINA 2K4VA 4KWYA 2R1FA 3AUZA 4FK5C 5KL4A 4LF5E 2YSPA 2CSHA 1YYKA 3H09A 4RHBB 1PJTA 4NN2A 2KWJA 2YW8A 3U5OA 1AAYA 1PDAA 1N3GA 2G45A 2LXPC 2KOUA 4GKKE 4GZNC 4LU9A 2DSMA 2GPIA 2JOBA 4WSPA 4WYQB 4AQYE 3MDBC 4WX9A 3ZOQB 4R2SA 1YUIA 4CA1A 4LFBE 4P5OB 2EOSA 2WCC3 2WBSA 4BBQA 2MNZA 5KL2A 2I9IA 2JY9A 2EMZA 1CHCA 5ADZA 5SVIA 3J81C 2LV9A 4R2RA 2F6NA 4P7DA 1MM2A 2YYRA 2ECIA 1FKAE 3HXLA 3THNA 2I50A 2RSIA 1X3CA 2UXDE 3O47A 3KZZA 1AH5A 5LKXA 1X5WA 3T1HE 2BAYA 3OTOE 1ZAAC 2YWQA 2EORA 4YABA 2H36X 2L75A 3HCSA 3SOWA 3F6GA 1WEPA 2Y1NA 4I7DA 4OOGC 1ZBQA 4WZ3B 4A49A 4F1PA 2ENHA 3C4TA 2LRIC 4YBMA 2M9AA 1HNXE 3JAMC 3O7AA 2FFWA 5J3XA 5FB1A 5SVYA 5SVXA 2EOOA 2EPRA 3M63A 2LV2A 2V83A 2YU5A 3BF2A 1VFYA 2YSJA 2LGLA 1MBMA 2XOZA 5H1UA 4TUIA 4C9ZA 1NCSA 1X48A 2EN2A 1X4IA 4DUYE 2KIZA 1JOCA 2VJFB 4BC9A 3K6QA 5A6JA 4LF9E 2Q8UA 1WENA 3O37A 5D1KB 4O62A 2KYUA 4CCGX 2VQFE 1V87A 5AC4A 2UZGA 1ZR9A 2LT7A 4I7CA 2HJJA 1TF6A 2UXCE 2LCEA 2E6SA 2VF1A 3U5PA 1XMQE 1UBDC 2LDRA 3RTRB 5LL6R 4F2JC 3HPZA 1WESA 4WSGA 4DV4E 2EM7A 3J80C 3FEHA 1ZBTA 4L7XA 2LGVA 2EPCA 2NUFA 4LFCE 2EPAA 3ADJA 2KONA 4JV5E 4DKKA 2EPXA 3L1XA 4HEIA 5KH7A 2F6JA 2EM3A 1WEWA 3DPLR 4WZ0A 2EOJA 3M99B 4K0KE 1PJQA 2MA6A 4YAXA 3DDTA 5C11A 1T4NA 2V89A 5LKZA 4F54A 3T6RA 2PRTA 3IHPA 2EN8A 4JI4E 2L5UA 5CFFE 5DKAA 4IS1C 1FP0A 2ECJA 1X6EA 5AE3A 5TRBA 2CT2A 4DV5E 1UILA 4X8WA 3O70A 1WGMA 4DV7E 2LMZA 1G25A 3C5KA 4ZYDA 1J26A 2EMKA 1N87A 5JG6A 2MD8C 1FJGE 3F6HA 2RR4A 2LXHC 1P47A 2EWLA 2B7VA 3LDYA 2EMGA 2RPCA 2EQ1A 2CONA 4R2EA 1WHNA 1DVPA 2KR4A 3ZPV1 2DIXA 2L3CA 3RPGB 1WEEA 3GL6A 5H1VA 4N4FA 1IQSA 1EH7A 1GZ6A 4PPEA 4QF3A 2BB8A 2N3HA 3DJWA 2M1RA 1A1LA 4LADB 3P1XA 2JXPA 1QU6A 4JI6E 2MT5A 1T38A 2VJFA 1UHZA 5IT9C 2ADRA 4JI7E 1WE9A 4R2CA 2CKLB 3LRQA 4AVXA 3FAOA 2JVAA 4MLQA 2L7PA 4DR7E 4X64E 2XEUA 2EPUA 4LLBA 2V88A 4UI9B 2ECNA 2MC5A 3PHDA 5B75A 4TUGA 1YPNA 3E2DA 3LVRE 2EPNA 2FTXB 1A1HA 1BBOA 3O34A 2MUMA 3ASLA 1WJPA 2HC5A 4F9BB 3KDEC 5A6AA 2EJ4A 2JP9A 2VPDA 3L11A 2ENCA 1XNQE 2VPBA 2Y43A 2LAUA 3M99A 2EMWA 3ADGA 1DCQA 4QQ4A 1RC7A 2IHR1 4GKJE 1F62A 3EPLA 2EMYA
chains in the Genus database with same CATH topology
1A1KA 2GHFA 5LKUA 2EODA 2ZETC 1WFKA 4YBTA 2EMCA 3O35A 5KL7A 2E72A 1TN9A 5FEYA 2YHOA 5TDWA 2HYED 2EMHA 1LDKC 3ZVYA 1U6GB 1IYMA 2YTJA 5G04B 1ZU1A 2MNYA 2ECTA 5TABA 5H9MA 3ZVZB 2K4DA 2CSZA 2Y1MA 5TBNA 1YSAC 3MHHC 2K17A 5B79A 2EM8A 3N9QA 2EOEA 3DQVR 2KFTA 5C13A 2ECWA 2YTGA 2CKLA 2L0BA 1Z2QA 1X4UA 2JMDA 2EMXA 3FL2A 3LQJA 2EMLA 4R2YA 5I3LA 5B78A 5B76A 5KH9A 2KGGA 2YURA 2CT1A 3UK3C 2EMIA 2YTOA 4O64A 2LVHA 4V3LC 4YC9A 3KV6A 2ECGA 4IC2A 2MKNA 2EE8A 2FUIA 2YQLA 2EP3A 5LCWB 4UP5A 2DRPA 4AUQB 2DX8A 4GNGA 1UN6B 4R8PK 1B69A 2E6RA 1DGCA 5G0FA 2D9HA 3N9LA 5AIUA 3EPKA 2KREA 3RPGC 4WZ2A 3ZTGA 2EOXA 3N9MA 3HCUA 1JM7B 2A25A 2LQ6A 1JK1A 2EN4A 2EN7A 4UP0A 1Z1BA 2L43A 2EL6A 1YUJA 4S3OC 2LO3A 5D1LB 3MHHA 3M62A 2EN1A 3GV4A 2EM6A 2YTQA 2EA6A 2YSOA 2EM2A 2AN6A 5KL5A 2VJEB 2J7JA 2VPEA 4FIPA 4PTBA 5FB0A 4X3GA 3ZPVE 2YT5A 4S3OB 5AITA 5EYAF 1TF3A 2MA5A 3U5NA 2YRMA 4N3WA 4B7YC 2RSDA 1FBVA 3LQHA 2EQ3A 4IC3A 2YTFA 2EL5A 2YTPA 1WEOA 2YHNA 2YU4A 1HYJA 2JPAA 3SHBA 2DMIA 5KH3A 2OXQC 1LLMC 2K1JA 4R2PA 3PUQA 3HCTA 2YQMA 4R7EA 3KV5A 2EN6A 1BB8A 2QJ0A 4FJCA 2ENAA 4YATA 3U5MA 2I13A 3VHTB 1JM7A 2YTDA 4A4CA 3T7LA 2KWOA 3KQIA 1E4UA 1ZBDB 4YADA 2EM5A 2KWNA 4F6MA 2VJEA 2JMJA 4LKAA 5D1MB 4MVTA 3QZVA 2KE1A 4X9JA 1WEUA 3PURA 1X4JA 3MHSA 2M6MA 2QICA 5B77A 2NABA 2EMAA 1X6HA 2ELZA 1A1IA 3I2DA 4LJNA 4A4BA 2YTEA 2H0DB 2VP7A 4LK9A 2EL4A 4WA6A 3O33A 4W4UA 2EQ0A 4ZUXU 1G2FC 2D8SA 3N9OA 4TKPB 4I7BA 2WBUA 2YRHA 3N9NA 2LN0A 2YU8A 1T1HA 2MD7B 1LDJB 1Z6UA 2EPPA 1WILA 1K2FA 5TDRA 1MEYC 2VPGA 2WBTA 2F42A 2MKDA 4V3KC 2MDGA 2GLIA 2EOIA 2C2VS 3EPHA 2FSAA 2EOZA 2EMBA 4MSXA 2G6QA 4L58A 2JRJA 4Q6FA 4FO9A 2JMIA 3SOXA 5H1TA 2G43A 2EOMA 5G05B 2YTIA 1WEVA 2VNFA 1VD4A 4AYCB 2ELYA 2H0DA 1WEQA 3MHSC 1A1JA 3LQIA 2C2LA 2HGHA 2EGPA 3ZNIA 4GB0A 2EPZA 2EOFA 3SOUA 3V43A 2RI7A 3ZYQA 4YBSA 2LGGA 2HDPA 2KWKA 4FK5A 4XI1A 4AP4A 1G2DC 1X6FA 2EOHA 3C6WA 1A1GA 4GNFA 1WIMA 1KJKA 2YSMA 1F2IG 3VK6A 1Z60A 2KU3A 2K16A 2L80A 2ECVA 2XB1A 4R2DA 4R2AA 4M9VC 4ZDTA 2YREA 3L1ZB 5LKTA 5FERA 4ZQLA 4QF2A 5KL6A 4R2QA 2NAAA 3NG2A 2CSYA 3N9PA 2DGCA 4F6NA 1WEMA 3EPJA 2MIQA 2KGIA 3KNVA 2CTDA 4A0CD 1RMDA 2EM9A 3EB6A 2IDAA 4AYCA 4F52B 3HTKC 2FUUA 2YUCA 1JK2A 1VYXA 2PNXA 1MM3A 2PUYA 2EMFA 2QIZA 2EN3A 3O36A 2EM4A 4B86C 4BHWA 2EOQA 1A1FA 1HYIA 2YRKA 4GNEA 2EM0A 2M3HA 1XWHA 2DLKA 2EOYA 2YTNA 1BORA 4GNDA 3EB5A 5KL3A 4IJDA 2DLQA 5B8DA 2M85A 2VRDA 2LGKA 5DINA 5KL4A 2R1FA 4FK5C 2YSPA 2CSHA 4NN2A 2KWJA 2YW8A 3U5OA 1AAYA 2G45A 2LXPC 4GZNC 1YUIA 4R2SA 4CA1A 4P5OB 2EOSA 2WCC3 2WBSA 4BBQA 2MNZA 5KL2A 2EMZA 1CHCA 4R2RA 2LV9A 2F6NA 1MM2A 2YYRA 2ECIA 2I50A 2RSIA 1X3CA 5LKXA 1X5WA 2BAYA 1ZAAC 2EORA 4YABA 2L75A 3HCSA 3SOWA 1WEPA 2Y1NA 4I7DA 4WZ3B 4A49A 2ENHA 2LRIC 4YBMA 2M9AA 3O7AA 2EPRA 5J3XA 5FB1A 2LV2A 2EOOA 3M63A 2YU5A 1VFYA 2YSJA 2LGLA 5H1UA 4C9ZA 1NCSA 2EN2A 1X4IA 2KIZA 1JOCA 2VJFB 1WENA 3O37A 5D1KB 4CCGX 2KYUA 1V87A 2UZGA 1ZR9A 2LT7A 4I7CA 1TF6A 2LCEA 2E6SA 3U5PA 1UBDC 2LDRA 3RTRB 4F2JC 4WSGA 1WESA 2EM7A 4L7XA 2LGVA 2EPCA 2EPAA 2EPXA 3L1XA 5KH7A 2F6JA 2EM3A 1WEWA 3DPLR 4WZ0A 2EOJA 3M99B 2MA6A 4YAXA 5C11A 2PRTA 5LKZA 3T6RA 3IHPA 2EN8A 2L5UA 5DKAA 4IS1C 1FP0A 2ECJA 1X6EA 5TRBA 2CT2A 3O70A 1WGMA 1G25A 3C5KA 2EMKA 1N87A 5JG6A 2MD8C 2LXHC 1P47A 2EMGA 2RPCA 2EQ1A 4R2EA 1DVPA 2KR4A 3ZPV1 3RPGB 1WEEA 3GL6A 5H1VA 4N4FA 4PPEA 4QF3A 2BB8A 2M1RA 1A1LA 4LADB 2MT5A 2VJFA 2ADRA 1WE9A 4R2CA 2CKLB 3LRQA 4AVXA 2XEUA 2EPUA 4LLBA 4UI9B 2ECNA 3PHDA 5B75A 1BBOA 1A1HA 3O34A 2MUMA 3ASLA 1WJPA 2EJ4A 2JP9A 2VPDA 3L11A 2ENCA 2VPBA 2Y43A 3M99A 2EMWA 1F62A 3EPLA 2EMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1K A;  2GHF A;  5LKU A;  2EOD A;  2ZET C;  1WFK A;  4YBT A;  2EMC A;  3O35 A;  5KL7 A;  2E72 A;  1TN9 A;  5FEY A;  2YHO A;  5TDW A;  2HYE D;  2EMH A;  1LDK C;  3ZVY A;  1U6G B;  1IYM A;  2YTJ A;  5G04 B;  1ZU1 A;  2MNY A;  2ECT A;  5TAB A;  5H9M A;  3ZVZ B;  2K4D A;  2CSZ A;  2Y1M A;  5TBN A;  1YSA C;  3MHH C;  2K17 A;  5B79 A;  2EM8 A;  3N9Q A;  2EOE A;  3DQV R;  2KFT A;  5C13 A;  2ECW A;  2YTG A;  2CKL A;  2L0B A;  1Z2Q A;  1X4U A;  2JMD A;  2EMX A;  3FL2 A;  3LQJ A;  2EML A;  4R2Y A;  5I3L A;  5B78 A;  5B76 A;  5KH9 A;  2KGG A;  2YUR A;  2CT1 A;  3UK3 C;  2EMI A;  2YTO A;  4O64 A;  2LVH A;  4V3L C;  4YC9 A;  3KV6 A;  2ECG A;  4IC2 A;  2MKN A;  2EE8 A;  2FUI A;  2YQL A;  2EP3 A;  5LCW B;  4UP5 A;  2DRP A;  4AUQ B;  2DX8 A;  4GNG A;  1UN6 B;  4R8P K;  1B69 A;  2E6R A;  1DGC A;  5G0F A;  2D9H A;  3N9L A;  5AIU A;  3EPK A;  2KRE A;  3RPG C;  4WZ2 A;  3ZTG A;  2EOX A;  3N9M A;  3HCU A;  1JM7 B;  2A25 A;  2LQ6 A;  1JK1 A;  2EN4 A;  2EN7 A;  4UP0 A;  1Z1B A;  2L43 A;  2EL6 A;  1YUJ A;  4S3O C;  2LO3 A;  5D1L B;  3MHH A;  3M62 A;  2EN1 A;  3GV4 A;  2EM6 A;  2YTQ A;  2EA6 A;  2YSO A;  2EM2 A;  2AN6 A;  5KL5 A;  2VJE B;  2J7J A;  2VPE A;  4FIP A;  4PTB A;  5FB0 A;  4X3G A;  3ZPV E;  2YT5 A;  4S3O B;  5AIT A;  5EYA F;  1TF3 A;  2MA5 A;  3U5N A;  2YRM A;  4N3W A;  4B7Y C;  2RSD A;  1FBV A;  3LQH A;  2EQ3 A;  4IC3 A;  2YTF A;  2EL5 A;  2YTP A;  1WEO A;  2YHN A;  2YU4 A;  1HYJ A;  2JPA A;  3SHB A;  2DMI A;  5KH3 A;  2OXQ C;  1LLM C;  2K1J A;  4R2P A;  3PUQ A;  3HCT A;  2YQM A;  4R7E A;  3KV5 A;  2EN6 A;  1BB8 A;  2QJ0 A;  4FJC A;  2ENA A;  4YAT A;  3U5M A;  2I13 A;  3VHT B;  1JM7 A;  2YTD A;  4A4C A;  3T7L A;  2KWO A;  3KQI A;  1E4U A;  1ZBD B;  4YAD A;  2EM5 A;  2KWN A;  4F6M A;  2VJE A;  2JMJ A;  4LKA A;  5D1M B;  4MVT A;  3QZV A;  2KE1 A;  4X9J A;  1WEU A;  3PUR A;  1X4J A;  3MHS A;  2M6M A;  2QIC A;  5B77 A;  2NAB A;  2EMA A;  1X6H A;  2ELZ A;  1A1I A;  3I2D A;  4LJN A;  4A4B A;  2YTE A;  2H0D B;  2VP7 A;  4LK9 A;  2EL4 A;  4WA6 A;  3O33 A;  4W4U A;  2EQ0 A;  4ZUX U;  1G2F C;  2D8S A;  3N9O A;  4TKP B;  4I7B A;  2WBU A;  2YRH A;  3N9N A;  2LN0 A;  2YU8 A;  1T1H A;  2MD7 B;  1LDJ B;  1Z6U A;  2EPP A;  1WIL A;  1K2F A;  5TDR A;  1MEY C;  2VPG A;  2WBT A;  2F42 A;  2MKD A;  4V3K C;  2MDG A;  2GLI A;  2EOI A;  2C2V S;  3EPH A;  2FSA A;  2EOZ A;  2EMB A;  4MSX A;  2G6Q A;  4L58 A;  2JRJ A;  4Q6F A;  4FO9 A;  2JMI A;  3SOX A;  5H1T A;  2G43 A;  2EOM A;  5G05 B;  2YTI A;  1WEV A;  2VNF A;  1VD4 A;  4AYC B;  2ELY A;  2H0D A;  1WEQ A;  3MHS C;  1A1J A;  3LQI A;  2C2L A;  2HGH A;  2EGP A;  3ZNI A;  4GB0 A;  2EPZ A;  2EOF A;  3SOU A;  3V43 A;  2RI7 A;  3ZYQ A;  4YBS A;  2LGG A;  2HDP A;  2KWK A;  4FK5 A;  4XI1 A;  4AP4 A;  1G2D C;  1X6F A;  2EOH A;  3C6W A;  1A1G A;  4GNF A;  1WIM A;  1KJK A;  2YSM A;  1F2I G;  3VK6 A;  1Z60 A;  2KU3 A;  2K16 A;  2L80 A;  2ECV A;  2XB1 A;  4R2D A;  4R2A A;  4M9V C;  4ZDT A;  2YRE A;  3L1Z B;  5LKT A;  5FER A;  4ZQL A;  4QF2 A;  5KL6 A;  4R2Q A;  2NAA A;  3NG2 A;  2CSY A;  3N9P A;  2DGC A;  4F6N A;  1WEM A;  3EPJ A;  2MIQ A;  2KGI A;  3KNV A;  2CTD A;  4A0C D;  1RMD A;  2EM9 A;  3EB6 A;  2IDA A;  4AYC A;  4F52 B;  3HTK C;  2FUU A;  2YUC A;  1JK2 A;  1VYX A;  2PNX A;  1MM3 A;  2PUY A;  2EMF A;  2QIZ A;  2EN3 A;  3O36 A;  2EM4 A;  4B86 C;  4BHW A;  2EOQ A;  1A1F A;  1HYI A;  2YRK A;  4GNE A;  2EM0 A;  2M3H A;  1XWH A;  2DLK A;  2EOY A;  2YTN A;  1BOR A;  4GND A;  3EB5 A;  5KL3 A;  4IJD A;  2DLQ A;  5B8D A;  2M85 A;  2VRD A;  2LGK A;  5DIN A;  5KL4 A;  2R1F A;  4FK5 C;  2YSP A;  2CSH A;  4NN2 A;  2KWJ A;  2YW8 A;  3U5O A;  1AAY A;  2G45 A;  2LXP C;  4GZN C;  1YUI A;  4R2S A;  4CA1 A;  4P5O B;  2EOS A;  2WCC 3;  2WBS A;  4BBQ A;  2MNZ A;  5KL2 A;  2EMZ A;  1CHC A;  4R2R A;  2LV9 A;  2F6N A;  1MM2 A;  2YYR A;  2ECI A;  2I50 A;  2RSI A;  1X3C A;  5LKX A;  1X5W A;  2BAY A;  1ZAA C;  2EOR A;  4YAB A;  2L75 A;  3HCS A;  3SOW A;  1WEP A;  2Y1N A;  4I7D A;  4WZ3 B;  4A49 A;  2ENH A;  2LRI C;  4YBM A;  2M9A A;  3O7A A;  2EPR A;  5J3X A;  5FB1 A;  2LV2 A;  2EOO A;  3M63 A;  2YU5 A;  1VFY A;  2YSJ A;  2LGL A;  5H1U A;  4C9Z A;  1NCS A;  2EN2 A;  1X4I A;  2KIZ A;  1JOC A;  2VJF B;  1WEN A;  3O37 A;  5D1K B;  4CCG X;  2KYU A;  1V87 A;  2UZG A;  1ZR9 A;  2LT7 A;  4I7C A;  1TF6 A;  2LCE A;  2E6S A;  3U5P A;  1UBD C;  2LDR A;  3RTR B;  4F2J C;  4WSG A;  1WES A;  2EM7 A;  4L7X A;  2LGV A;  2EPC A;  2EPA A;  2EPX A;  3L1X A;  5KH7 A;  2F6J A;  2EM3 A;  1WEW A;  3DPL R;  4WZ0 A;  2EOJ A;  3M99 B;  2MA6 A;  4YAX A;  5C11 A;  2PRT A;  5LKZ A;  3T6R A;  3IHP A;  2EN8 A;  2L5U A;  5DKA A;  4IS1 C;  1FP0 A;  2ECJ A;  1X6E A;  5TRB A;  2CT2 A;  3O70 A;  1WGM A;  1G25 A;  3C5K A;  2EMK A;  1N87 A;  5JG6 A;  2MD8 C;  2LXH C;  1P47 A;  2EMG A;  2RPC A;  2EQ1 A;  4R2E A;  1DVP A;  2KR4 A;  3ZPV 1;  3RPG B;  1WEE A;  3GL6 A;  5H1V A;  4N4F A;  4PPE A;  4QF3 A;  2BB8 A;  2M1R A;  1A1L A;  4LAD B;  2MT5 A;  2VJF A;  2ADR A;  1WE9 A;  4R2C A;  2CKL B;  3LRQ A;  4AVX A;  2XEU A;  2EPU A;  4LLB A;  4UI9 B;  2ECN A;  3PHD A;  5B75 A;  1BBO A;  1A1H A;  3O34 A;  2MUM A;  3ASL A;  1WJP A;  2EJ4 A;  2JP9 A;  2VPD A;  3L11 A;  2ENC A;  2VPB A;  2Y43 A;  3M99 A;  2EMW A;  1F62 A;  3EPL A;  2EMY A; 
#chains in the Genus database with same CATH topology
 2LTR A;  4DV3 E;  1A1K A;  3KZY A;  1HNW E;  2GHF A;  4DV6 E;  5LKU A;  2EOD A;  2ZET C;  4OGE A;  2EPK X;  1WFK A;  4YBT A;  2EMC A;  3O35 A;  5KL7 A;  2E72 A;  3FM8 C;  1TN9 A;  5FEY A;  2YHO A;  5TDW A;  2HYE D;  2EMH A;  1LDK C;  3ZVY A;  1U6G B;  1IYM A;  2N3G A;  2EPM X;  5G04 B;  2YTJ A;  1ZU1 A;  4JI5 E;  2MNY A;  2DSY A;  2ECT A;  5TAB A;  5H9M A;  4J8Z A;  3ZVZ B;  2K4D A;  2CSZ A;  4JI0 E;  2Y1M A;  4LF8 E;  3JU0 A;  2FV4 B;  5AE1 A;  1T4O A;  5TBN A;  2F4V E;  4X66 E;  1YSA C;  3MHH C;  2K17 A;  3RMP A;  1I94 E;  5B79 A;  2LTS A;  2EM8 A;  3N9Q A;  2EOE A;  3DQV R;  4JI3 E;  2KFT A;  4DV1 E;  5A69 A;  5C13 A;  4WXC A;  2EPO A;  1N32 E;  4Q35 B;  2ECW A;  2DMY A;  2YTG A;  1IBM E;  2CKL A;  1IMU A;  4M2Z A;  2L0B A;  1Z2Q A;  1X4U A;  2JMD A;  1EH8 A;  3FL2 A;  2EMX A;  1N34 E;  2RTX A;  3LQJ A;  4F9C B;  4WXD A;  1IBK E;  2EML A;  4R2Y A;  2B0O E;  3LJU X;  5B78 A;  5B76 A;  5I3L A;  4NZV A;  4WFT A;  5KH9 A;  2KGG A;  2YUR A;  2CT1 A;  3UK3 C;  2M13 A;  2V86 A;  2EMI A;  3HQ1 A;  2YTO A;  4O64 A;  2JWO A;  2LVH A;  3THO B;  4V3L C;  5AC5 A;  1T4L B;  4NHR A;  4YC9 A;  4X65 E;  4ZYG A;  4DV2 E;  2EPL X;  3KV6 A;  4BBY A;  2ECG A;  4IC2 A;  5K3Q A;  2JR1 A;  2MKN A;  2EE8 A;  2FUI A;  2L3J A;  4LF4 E;  2YQL A;  1IQO A;  2EP3 A;  4R03 A;  5LCW B;  4JYA E;  4UP5 A;  2DRP A;  2LJU A;  4AUQ B;  2DX8 A;  4GNG A;  1UN6 B;  4R8P K;  3H7H A;  1B69 A;  4N4R B;  4LTY A;  3ADL A;  2E6R A;  1DGC A;  5G0F A;  4B3S E;  2RQL A;  3AV0 A;  2ODR C;  2D9H A;  3N9L A;  5AIU A;  1WHQ A;  2WZO A;  3EPK A;  3OML A;  2KRE A;  5A6B A;  5F3W A;  3RPG C;  1YYW A;  4WZ2 A;  3ZTG A;  2EOX A;  2KKX A;  3N9M A;  3HCU A;  1JM7 B;  2NUG A;  2A25 A;  2LQ6 A;  1JK1 A;  4BHB A;  2EN4 A;  4GEQ B;  3MSW A;  2EN7 A;  4OX9 E;  1STU A;  2XP0 A;  4UP0 A;  3IWC A;  1Z1B A;  2L43 A;  2EL6 A;  1YUJ A;  4S3O C;  2CRR A;  2LO3 A;  2V8Q B;  2LRS A;  5D1L B;  1XMO E;  5BR8 E;  4DR6 E;  3MHH A;  3M62 A;  2MDR A;  4B3M E;  2EN1 A;  3GV4 A;  2EM6 A;  2YTQ A;  2LUP B;  2YZT A;  2EA6 A;  2YSO A;  2EM2 A;  2AN6 A;  5KL5 A;  2L33 A;  3L00 A;  5IXM B;  2VJE B;  2KKY A;  1GQE A;  2J7J A;  2VPE A;  4M0V A;  1WXR A;  4DV0 E;  1YZ9 A;  4KHP E;  2NA2 A;  4FIP A;  4BS9 A;  2OWA A;  4PTB A;  2D8U A;  1RQ0 A;  5FB0 A;  4X3G A;  3ZPV E;  2YT5 A;  3BID A;  4DMI A;  1IBL E;  4S3O B;  5AIT A;  4BHC A;  3JUE A;  4DR4 E;  5EYA F;  3TQM A;  1TF3 A;  4YHH E;  1L4S A;  1N36 E;  4Z0O A;  2MA5 A;  3U5N A;  2LJH A;  2YRM A;  1HR0 E;  4N3W A;  4B7Y C;  2RSD A;  1FBV A;  3LQH A;  2EQ3 A;  4IC3 A;  1GTK A;  2YTF A;  2EL5 A;  1EH6 A;  2YTP A;  1WEO A;  2YHN A;  2YU4 A;  1HYJ A;  2JPA A;  2YVR A;  2LE2 A;  4LF7 E;  1QNT A;  3SHB A;  2DMI A;  5KH3 A;  2OXQ C;  1WRJ A;  5LMU E;  1DQ3 A;  1LLM C;  2K1J A;  4R2P A;  3PUQ A;  2JOX A;  5DNY A;  3HCT A;  2YQM A;  2L6M A;  4R7E A;  3KV5 A;  2EN6 A;  5FLX C;  4BMJ A;  1YFH A;  3IWB A;  1BB8 A;  1T39 A;  2QJ0 A;  4FJC A;  1X47 A;  2ENA A;  4YAT A;  3U5M A;  1PKP A;  3KWR A;  2I13 A;  3VHT B;  1JM7 A;  2YTD A;  1J5E E;  2B3T B;  2R76 A;  4A4C A;  3T7L A;  2K7I A;  3T9K A;  2RS6 A;  2UXB E;  1DI2 A;  2KWO A;  3KQI A;  1E4U A;  3LVQ E;  3ECR A;  1ZBD B;  4YAD A;  2EM5 A;  1SFE A;  1X49 A;  2BBG A;  1KYQ A;  2V85 A;  2M7Q A;  5LMN E;  2YT4 A;  2KWN A;  2RS7 A;  3IWD A;  4F6M A;  2VJE A;  3C4B A;  2JMJ A;  2LUQ A;  1BBG A;  2EXU A;  4LKA A;  5D1M B;  4MVT A;  2KHX A;  3QZV A;  2KE1 A;  3FAN A;  4X9J A;  1WEU A;  4YY3 E;  4LFA E;  4JI1 E;  3PUR A;  4H9D A;  1X4J A;  3MHS A;  3C6M A;  5TSE A;  2M6M A;  2QIC A;  3LLH A;  5B77 A;  2ODR D;  2NAB A;  5AE2 A;  4DR3 E;  2EMA A;  1X6H A;  2ELZ A;  4O4K A;  4JI8 E;  3I2D A;  4LJN A;  1A1I A;  4A4B A;  2YTE A;  2H0D B;  2VP7 A;  4LK9 A;  2EL4 A;  3VYY A;  4WA6 A;  2VQE E;  4DR1 E;  3O33 A;  4W4U A;  2EQ0 A;  4ZUX U;  5A6K A;  1G2F C;  3JTZ A;  2D8S A;  3N9O A;  4TKP B;  4I7B A;  3BBG A;  2L2N A;  2RSM A;  4RH8 A;  2WBU A;  2B9D A;  2YRH A;  3N9N A;  4O5G A;  4X62 E;  1MGT A;  2LN0 A;  3VYX A;  2LBS B;  2YU8 A;  3QG5 C;  1T1H A;  2MD7 B;  1LDJ B;  4Q28 A;  2ZM6 E;  5LLQ A;  2VE7 C;  4M30 A;  3PLW A;  2IQJ A;  1Z6U A;  2L2M A;  2EPP A;  1WIL A;  1K2F A;  5TDR A;  2F8B A;  2VPG A;  2WBT A;  3BGH A;  2MC6 A;  3LML A;  1YYO A;  1MEY C;  2XOC A;  2F42 A;  2MKD A;  4V3K C;  2MDG A;  2GLI A;  4HTG A;  4NXN E;  5A2Q C;  2EOI A;  5AAS A;  4KZS A;  2C2V S;  3EPH A;  2FSA A;  3HTX A;  2EOZ A;  2EMB A;  4ZYE A;  1PJS A;  2V87 A;  5IWA E;  4MSX A;  2G6Q A;  4L58 A;  3M7K A;  2JRJ A;  4Q6F A;  4R8O A;  4FO9 A;  2JMI A;  5T6J A;  3SOX A;  5H1T A;  2G43 A;  2EOM A;  2FD4 A;  5G05 B;  4L5N C;  3FJU B;  2UUA E;  2YTI A;  3C6K A;  1WEV A;  2MKE A;  2VNF A;  2HHH E;  1VD4 A;  2E61 A;  4AYC B;  3HPS A;  2CPN A;  2ELY A;  2H0D A;  1WEQ A;  2CRW A;  3MHS C;  1A1J A;  3LQI A;  2C2L A;  4ZYH A;  2CSV A;  2HGH A;  4B3T E;  2M4I A;  2EGP A;  3ZNI A;  4GB0 A;  2EPZ A;  1HNZ E;  2EOF A;  5A6B D;  3SOU A;  3V43 A;  3FIG A;  2RI7 A;  3ZYQ A;  4YBS A;  2LGG A;  2HDP A;  2KWK A;  4FK5 A;  4XI1 A;  4AP4 A;  3EQ1 A;  1X6F A;  4DR2 E;  4L8N A;  1EKZ A;  3DWD A;  2EOH A;  1G2D C;  1N33 E;  3C6W A;  4F9A B;  1NEI A;  1A1G A;  4LF6 E;  4GNF A;  1WIM A;  2JYA A;  2YSM A;  1KJK A;  3ADI A;  1F2I G;  3VK6 A;  1Z60 A;  2DJA A;  2P57 A;  2UU9 E;  1XNR E;  2KU3 A;  4DUZ E;  2K16 A;  2L80 A;  2ECV A;  2XB1 A;  4R2D A;  2UUB E;  3T1Y E;  4R2A A;  4M9V C;  4O24 A;  2DB2 A;  2YPN A;  4ZDT A;  2YRE A;  3L1Z B;  3SUB A;  5LKT A;  5FER A;  4ZQL A;  4QF2 A;  5KL6 A;  4R2Q A;  2NAA A;  4I8O A;  3NG2 A;  2CSY A;  2L8T A;  3DF6 A;  2FGG A;  3N9P A;  2DGC A;  4F6N A;  1WEM A;  4WPY A;  2JUN A;  2N8X A;  3EPJ A;  4Z0R A;  5SVI B;  2MIQ A;  4O43 A;  4BC7 A;  2KGI A;  3KNV A;  2CTD A;  4NXM E;  2EGM A;  4A0C D;  1RMD A;  4OGC A;  2EM9 A;  3EB6 A;  2E1M A;  3J7Y p;  4BCA A;  2IDA A;  4AYC A;  4F52 B;  4MLV A;  3HTK C;  2NUE A;  2FUU A;  2YUC A;  2UUC E;  1O0W A;  1JK2 A;  1VYX A;  2PNX A;  1MM3 A;  2PUY A;  2EMF A;  2QIZ A;  2EN3 A;  3J7A G;  3O36 A;  2EM4 A;  4B86 C;  4BHW A;  2JM3 A;  2EOQ A;  2L92 A;  4JI2 E;  1A1F A;  1HYI A;  2YRK A;  2XOY A;  4GNE A;  2EM0 A;  2M1S A;  2L2K B;  2M3H A;  1XWH A;  2DLK A;  2EOY A;  2YTN A;  1BOR A;  4GND A;  3EB5 A;  2G7H A;  4P78 A;  4DR5 E;  5IV8 B;  5KL3 A;  2EZ6 A;  3Q1D A;  2E5L E;  4IJD A;  1SR9 A;  4B3R E;  2DLQ A;  5B8D A;  2M85 A;  2VRD A;  2B7T A;  2LGK A;  5DIN A;  2K4V A;  4KWY A;  2R1F A;  3AUZ A;  4FK5 C;  5KL4 A;  4LF5 E;  2YSP A;  2CSH A;  1YYK A;  3H09 A;  4RHB B;  1PJT A;  4NN2 A;  2KWJ A;  2YW8 A;  3U5O A;  1AAY A;  1PDA A;  1N3G A;  2G45 A;  2LXP C;  2KOU A;  4GKK E;  4GZN C;  4LU9 A;  2DSM A;  2GPI A;  2JOB A;  4WSP A;  4WYQ B;  4AQY E;  3MDB C;  4WX9 A;  3ZOQ B;  4R2S A;  1YUI A;  4CA1 A;  4LFB E;  4P5O B;  2EOS A;  2WCC 3;  2WBS A;  4BBQ A;  2MNZ A;  5KL2 A;  2I9I A;  2JY9 A;  2EMZ A;  1CHC A;  5ADZ A;  5SVI A;  3J81 C;  2LV9 A;  4R2R A;  2F6N A;  4P7D A;  1MM2 A;  2YYR A;  2ECI A;  1FKA E;  3HXL A;  3THN A;  2I50 A;  2RSI A;  1X3C A;  2UXD E;  3O47 A;  3KZZ A;  1AH5 A;  5LKX A;  1X5W A;  3T1H E;  2BAY A;  3OTO E;  1ZAA C;  2YWQ A;  2EOR A;  4YAB A;  2H36 X;  2L75 A;  3HCS A;  3SOW A;  3F6G A;  1WEP A;  2Y1N A;  4I7D A;  4OOG C;  1ZBQ A;  4WZ3 B;  4A49 A;  4F1P A;  2ENH A;  3C4T A;  2LRI C;  4YBM A;  2M9A A;  1HNX E;  3JAM C;  3O7A A;  2FFW A;  5J3X A;  5FB1 A;  5SVY A;  5SVX A;  2EOO A;  2EPR A;  3M63 A;  2LV2 A;  2V83 A;  2YU5 A;  3BF2 A;  1VFY A;  2YSJ A;  2LGL A;  1MBM A;  2XOZ A;  5H1U A;  4TUI A;  4C9Z A;  1NCS A;  1X48 A;  2EN2 A;  1X4I A;  4DUY E;  2KIZ A;  1JOC A;  2VJF B;  4BC9 A;  3K6Q A;  5A6J A;  4LF9 E;  2Q8U A;  1WEN A;  3O37 A;  5D1K B;  4O62 A;  2KYU A;  4CCG X;  2VQF E;  1V87 A;  5AC4 A;  2UZG A;  1ZR9 A;  2LT7 A;  4I7C A;  2HJJ A;  1TF6 A;  2UXC E;  2LCE A;  2E6S A;  2VF1 A;  3U5P A;  1XMQ E;  1UBD C;  2LDR A;  3RTR B;  5LL6 R;  4F2J C;  3HPZ A;  1WES A;  4WSG A;  4DV4 E;  2EM7 A;  3J80 C;  3FEH A;  1ZBT A;  4L7X A;  2LGV A;  2EPC A;  2NUF A;  4LFC E;  2EPA A;  3ADJ A;  2KON A;  4JV5 E;  4DKK A;  2EPX A;  3L1X A;  4HEI A;  5KH7 A;  2F6J A;  2EM3 A;  1WEW A;  3DPL R;  4WZ0 A;  2EOJ A;  3M99 B;  4K0K E;  1PJQ A;  2MA6 A;  4YAX A;  3DDT A;  5C11 A;  1T4N A;  2V89 A;  5LKZ A;  4F54 A;  3T6R A;  2PRT A;  3IHP A;  2EN8 A;  4JI4 E;  2L5U A;  5CFF E;  5DKA A;  4IS1 C;  1FP0 A;  2ECJ A;  1X6E A;  5AE3 A;  5TRB A;  2CT2 A;  4DV5 E;  1UIL A;  4X8W A;  3O70 A;  1WGM A;  4DV7 E;  2LMZ A;  1G25 A;  3C5K A;  4ZYD A;  1J26 A;  2EMK A;  1N87 A;  5JG6 A;  2MD8 C;  1FJG E;  3F6H A;  2RR4 A;  2LXH C;  1P47 A;  2EWL A;  2B7V A;  3LDY A;  2EMG A;  2RPC A;  2EQ1 A;  2CON A;  4R2E A;  1WHN A;  1DVP A;  2KR4 A;  3ZPV 1;  2DIX A;  2L3C A;  3RPG B;  1WEE A;  3GL6 A;  5H1V A;  4N4F A;  1IQS A;  1EH7 A;  1GZ6 A;  4PPE A;  4QF3 A;  2BB8 A;  2N3H A;  3DJW A;  2M1R A;  1A1L A;  4LAD B;  3P1X A;  2JXP A;  1QU6 A;  4JI6 E;  2MT5 A;  1T38 A;  2VJF A;  1UHZ A;  5IT9 C;  2ADR A;  4JI7 E;  1WE9 A;  4R2C A;  2CKL B;  3LRQ A;  4AVX A;  3FAO A;  2JVA A;  4MLQ A;  2L7P A;  4DR7 E;  4X64 E;  2XEU A;  2EPU A;  4LLB A;  2V88 A;  4UI9 B;  2ECN A;  2MC5 A;  3PHD A;  5B75 A;  4TUG A;  1YPN A;  3E2D A;  3LVR E;  2EPN A;  2FTX B;  1A1H A;  1BBO A;  3O34 A;  2MUM A;  3ASL A;  1WJP A;  2HC5 A;  4F9B B;  3KDE C;  5A6A A;  2EJ4 A;  2JP9 A;  2VPD A;  3L11 A;  2ENC A;  1XNQ E;  2VPB A;  2Y43 A;  2LAU A;  3M99 A;  2EMW A;  3ADG A;  1DCQ A;  4QQ4 A;  1RC7 A;  2IHR 1;  4GKJ E;  1F62 A;  3EPL A;  2EMY A; 
#chains in the Genus database with same CATH homology
 1A1K A;  2GHF A;  5LKU A;  2EOD A;  2ZET C;  1WFK A;  4YBT A;  2EMC A;  3O35 A;  5KL7 A;  2E72 A;  1TN9 A;  5FEY A;  2YHO A;  5TDW A;  2HYE D;  2EMH A;  1LDK C;  3ZVY A;  1U6G B;  1IYM A;  2YTJ A;  5G04 B;  1ZU1 A;  2MNY A;  2ECT A;  5TAB A;  5H9M A;  3ZVZ B;  2K4D A;  2CSZ A;  2Y1M A;  5TBN A;  1YSA C;  3MHH C;  2K17 A;  5B79 A;  2EM8 A;  3N9Q A;  2EOE A;  3DQV R;  2KFT A;  5C13 A;  2ECW A;  2YTG A;  2CKL A;  2L0B A;  1Z2Q A;  1X4U A;  2JMD A;  2EMX A;  3FL2 A;  3LQJ A;  2EML A;  4R2Y A;  5I3L A;  5B78 A;  5B76 A;  5KH9 A;  2KGG A;  2YUR A;  2CT1 A;  3UK3 C;  2EMI A;  2YTO A;  4O64 A;  2LVH A;  4V3L C;  4YC9 A;  3KV6 A;  2ECG A;  4IC2 A;  2MKN A;  2EE8 A;  2FUI A;  2YQL A;  2EP3 A;  5LCW B;  4UP5 A;  2DRP A;  4AUQ B;  2DX8 A;  4GNG A;  1UN6 B;  4R8P K;  1B69 A;  2E6R A;  1DGC A;  5G0F A;  2D9H A;  3N9L A;  5AIU A;  3EPK A;  2KRE A;  3RPG C;  4WZ2 A;  3ZTG A;  2EOX A;  3N9M A;  3HCU A;  1JM7 B;  2A25 A;  2LQ6 A;  1JK1 A;  2EN4 A;  2EN7 A;  4UP0 A;  1Z1B A;  2L43 A;  2EL6 A;  1YUJ A;  4S3O C;  2LO3 A;  5D1L B;  3MHH A;  3M62 A;  2EN1 A;  3GV4 A;  2EM6 A;  2YTQ A;  2EA6 A;  2YSO A;  2EM2 A;  2AN6 A;  5KL5 A;  2VJE B;  2J7J A;  2VPE A;  4FIP A;  4PTB A;  5FB0 A;  4X3G A;  3ZPV E;  2YT5 A;  4S3O B;  5AIT A;  5EYA F;  1TF3 A;  2MA5 A;  3U5N A;  2YRM A;  4N3W A;  4B7Y C;  2RSD A;  1FBV A;  3LQH A;  2EQ3 A;  4IC3 A;  2YTF A;  2EL5 A;  2YTP A;  1WEO A;  2YHN A;  2YU4 A;  1HYJ A;  2JPA A;  3SHB A;  2DMI A;  5KH3 A;  2OXQ C;  1LLM C;  2K1J A;  4R2P A;  3PUQ A;  3HCT A;  2YQM A;  4R7E A;  3KV5 A;  2EN6 A;  1BB8 A;  2QJ0 A;  4FJC A;  2ENA A;  4YAT A;  3U5M A;  2I13 A;  3VHT B;  1JM7 A;  2YTD A;  4A4C A;  3T7L A;  2KWO A;  3KQI A;  1E4U A;  1ZBD B;  4YAD A;  2EM5 A;  2KWN A;  4F6M A;  2VJE A;  2JMJ A;  4LKA A;  5D1M B;  4MVT A;  3QZV A;  2KE1 A;  4X9J A;  1WEU A;  3PUR A;  1X4J A;  3MHS A;  2M6M A;  2QIC A;  5B77 A;  2NAB A;  2EMA A;  1X6H A;  2ELZ A;  1A1I A;  3I2D A;  4LJN A;  4A4B A;  2YTE A;  2H0D B;  2VP7 A;  4LK9 A;  2EL4 A;  4WA6 A;  3O33 A;  4W4U A;  2EQ0 A;  4ZUX U;  1G2F C;  2D8S A;  3N9O A;  4TKP B;  4I7B A;  2WBU A;  2YRH A;  3N9N A;  2LN0 A;  2YU8 A;  1T1H A;  2MD7 B;  1LDJ B;  1Z6U A;  2EPP A;  1WIL A;  1K2F A;  5TDR A;  1MEY C;  2VPG A;  2WBT A;  2F42 A;  2MKD A;  4V3K C;  2MDG A;  2GLI A;  2EOI A;  2C2V S;  3EPH A;  2FSA A;  2EOZ A;  2EMB A;  4MSX A;  2G6Q A;  4L58 A;  2JRJ A;  4Q6F A;  4FO9 A;  2JMI A;  3SOX A;  5H1T A;  2G43 A;  2EOM A;  5G05 B;  2YTI A;  1WEV A;  2VNF A;  1VD4 A;  4AYC B;  2ELY A;  2H0D A;  1WEQ A;  3MHS C;  1A1J A;  3LQI A;  2C2L A;  2HGH A;  2EGP A;  3ZNI A;  4GB0 A;  2EPZ A;  2EOF A;  3SOU A;  3V43 A;  2RI7 A;  3ZYQ A;  4YBS A;  2LGG A;  2HDP A;  2KWK A;  4FK5 A;  4XI1 A;  4AP4 A;  1G2D C;  1X6F A;  2EOH A;  3C6W A;  1A1G A;  4GNF A;  1WIM A;  1KJK A;  2YSM A;  1F2I G;  3VK6 A;  1Z60 A;  2KU3 A;  2K16 A;  2L80 A;  2ECV A;  2XB1 A;  4R2D A;  4R2A A;  4M9V C;  4ZDT A;  2YRE A;  3L1Z B;  5LKT A;  5FER A;  4ZQL A;  4QF2 A;  5KL6 A;  4R2Q A;  2NAA A;  3NG2 A;  2CSY A;  3N9P A;  2DGC A;  4F6N A;  1WEM A;  3EPJ A;  2MIQ A;  2KGI A;  3KNV A;  2CTD A;  4A0C D;  1RMD A;  2EM9 A;  3EB6 A;  2IDA A;  4AYC A;  4F52 B;  3HTK C;  2FUU A;  2YUC A;  1JK2 A;  1VYX A;  2PNX A;  1MM3 A;  2PUY A;  2EMF A;  2QIZ A;  2EN3 A;  3O36 A;  2EM4 A;  4B86 C;  4BHW A;  2EOQ A;  1A1F A;  1HYI A;  2YRK A;  4GNE A;  2EM0 A;  2M3H A;  1XWH A;  2DLK A;  2EOY A;  2YTN A;  1BOR A;  4GND A;  3EB5 A;  5KL3 A;  4IJD A;  2DLQ A;  5B8D A;  2M85 A;  2VRD A;  2LGK A;  5DIN A;  5KL4 A;  2R1F A;  4FK5 C;  2YSP A;  2CSH A;  4NN2 A;  2KWJ A;  2YW8 A;  3U5O A;  1AAY A;  2G45 A;  2LXP C;  4GZN C;  1YUI A;  4R2S A;  4CA1 A;  4P5O B;  2EOS A;  2WCC 3;  2WBS A;  4BBQ A;  2MNZ A;  5KL2 A;  2EMZ A;  1CHC A;  4R2R A;  2LV9 A;  2F6N A;  1MM2 A;  2YYR A;  2ECI A;  2I50 A;  2RSI A;  1X3C A;  5LKX A;  1X5W A;  2BAY A;  1ZAA C;  2EOR A;  4YAB A;  2L75 A;  3HCS A;  3SOW A;  1WEP A;  2Y1N A;  4I7D A;  4WZ3 B;  4A49 A;  2ENH A;  2LRI C;  4YBM A;  2M9A A;  3O7A A;  2EPR A;  5J3X A;  5FB1 A;  2LV2 A;  2EOO A;  3M63 A;  2YU5 A;  1VFY A;  2YSJ A;  2LGL A;  5H1U A;  4C9Z A;  1NCS A;  2EN2 A;  1X4I A;  2KIZ A;  1JOC A;  2VJF B;  1WEN A;  3O37 A;  5D1K B;  4CCG X;  2KYU A;  1V87 A;  2UZG A;  1ZR9 A;  2LT7 A;  4I7C A;  1TF6 A;  2LCE A;  2E6S A;  3U5P A;  1UBD C;  2LDR A;  3RTR B;  4F2J C;  4WSG A;  1WES A;  2EM7 A;  4L7X A;  2LGV A;  2EPC A;  2EPA A;  2EPX A;  3L1X A;  5KH7 A;  2F6J A;  2EM3 A;  1WEW A;  3DPL R;  4WZ0 A;  2EOJ A;  3M99 B;  2MA6 A;  4YAX A;  5C11 A;  2PRT A;  5LKZ A;  3T6R A;  3IHP A;  2EN8 A;  2L5U A;  5DKA A;  4IS1 C;  1FP0 A;  2ECJ A;  1X6E A;  5TRB A;  2CT2 A;  3O70 A;  1WGM A;  1G25 A;  3C5K A;  2EMK A;  1N87 A;  5JG6 A;  2MD8 C;  2LXH C;  1P47 A;  2EMG A;  2RPC A;  2EQ1 A;  4R2E A;  1DVP A;  2KR4 A;  3ZPV 1;  3RPG B;  1WEE A;  3GL6 A;  5H1V A;  4N4F A;  4PPE A;  4QF3 A;  2BB8 A;  2M1R A;  1A1L A;  4LAD B;  2MT5 A;  2VJF A;  2ADR A;  1WE9 A;  4R2C A;  2CKL B;  3LRQ A;  4AVX A;  2XEU A;  2EPU A;  4LLB A;  4UI9 B;  2ECN A;  3PHD A;  5B75 A;  1BBO A;  1A1H A;  3O34 A;  2MUM A;  3ASL A;  1WJP A;  2EJ4 A;  2JP9 A;  2VPD A;  3L11 A;  2ENC A;  2VPB A;  2Y43 A;  3M99 A;  2EMW A;  1F62 A;  3EPL A;  2EMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...