1RMDA

Rag1 dimerization domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
NCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILNSLMVKCPAQDCNEEVSLEKYNHHVSSHKESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAG1
publication title Crystal structure of the RAG1 dimerization domain reveals multiple zinc-binding motifs including a novel zinc binuclear cluster.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 30
structure length 116
sequence length 116
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 1997-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
A PF10426 zf-RAG1 Recombination-activating protein 1 zinc-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1rmdA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1rmdA02
5FB1A 2DLQA 5D1MB 2H0DB 2EOIA 3HTKC 2YRMA 3O34A 4L7XA 2EGPA 4FJCA 1YUJA 1X6HA 4F2JC 2EOQA 3LRQA 2EOEA 2ADRA 4PPEA 2EA6A 4R2DA 1JM7B 1F62A 1Z1BA 5C11A 2K1JA 2KWJA 4YC9A 3ZNIA 5TBNA 3T6RA 1WILA 2LQ6A 3ZYQA 2M3HA 3MHHA 3M99B 1E4UA 2EPCA 2E6SA 5H1UA 1TF6A 1MEYC 2ENCA 2JMDA 4M9VC 2DRPA 2XB1A 3O35A 2H0DA 2XEUA 2ZETC 1X5WA 3HCSA 2DX8A 3M62A 3EPJA 4AYCB 1MM3A 2VPBA 4PTBA 2UZGA 1G2DC 4R2AA 1FBVA 2L0BA 2MD8C 2L43A 5FB0A 1WEEA 1XWHA 5LKZA 1DVPA 1JM7A 2ECGA 4LKAA 3C5KA 2LGVA 4B86C 4A0CD 2C2LA 4S3OB 3EB6A 2G43A 4A4CA 2L75A 1RMDA 5KH7A 2YU8A 2MIQA 5KL6A 4A4BA 5G0FA 1BBOA 4ZDTA 1A1FA 4QF2A 2YTIA 3O70A 5B8DA 3I2DA 2LV2A 5G05B 3ZVZB 2YTEA 1X4UA 3ZVYA 2EM3A 1WEPA 2EMFA 4N4FA 3O7AA 1X4IA 4IS1C 2R1FA 2EOFA 5B76A 4I7DA 2QJ0A 2DGCA 1BB8A 1JK1A 4YBSA 2EOYA 4WZ0A 1WGMA 4CA1A 1ZBDB 2LGKA 3VHTB 2EQ1A 4ZQLA 2LGGA 3SOUA 4WZ2A 5KL5A 2EPXA 2VNFA 2YW8A 3ZPVE 3O37A 3T7LA 1UBDC 2YSMA 2KFTA 1WESA 3DPLR 1TN9A 3ZPV1 3U5OA 1X4JA 4FO9A 2G45A 2F42A 3GL6A 2EM8A 3SHBA 3N9NA 3HCTA 3PUQA 2LXPC 3VK6A 2EN4A 1VD4A 5DKAA 2K4DA 2EL4A 2EMHA 3ASLA 1JK2A 1TF3A 2YRKA 1A1LA 4GB0A 4YAXA 2EN8A 3KV6A 1UN6B 2EN2A 5FERA 2EMCA 2YSJA 4FK5C 2MA6A 2EL5A 3SOXA 3DQVR 2EM5A 2EQ0A 2KU3A 3N9LA 2HYED 4O64A 1YSAC 2RSIA 2M85A 2M1RA 4L58A 2KGGA 2GHFA 2CSZA 4A49A 3N9PA 2JMIA 3IHPA 4GNDA 4X9JA 3MHSC 2LDRA 4P5OB 3L1ZB 2EL6A 2ECJA 5KL4A 2MNZA 4R2PA 2YTPA 2YURA 4C9ZA 2EPRA 2EM7A 5B77A 1G2FC 2YTNA 2EODA 3KQIA 3UK3C 5H1VA 2EPAA 3U5PA 2EMXA 1WEQA 2VJEA 3ZTGA 1WE9A 2MA5A 2EN6A 2M9AA 4F6MA 2KWNA 1T1HA 2I50A 4AP4A 4F6NA 5KH9A 2KWOA 3O33A 2EM2A 4BBQA 4R2QA 3QZVA 3EPHA 3O36A 2EOMA 4R2YA 2BAYA 1KJKA 3FL2A 2EM4A 2AN6A 4LLBA 2LCEA 2LRIC 2ENAA 3EB5A 4WA6A 3MHHC 1YUIA 2YT5A 1X3CA 4YBTA 1F2IG 2FSAA 5JG6A 2YYRA 2EN3A 2EMIA 3M99A 5TDRA 2L80A 2VPGA 4LJNA 2YTQA 2MUMA 1DGCA 4R7EA 2ECTA 4YATA 4YADA 2YTDA 4AYCA 2ECNA 2IDAA 3U5NA 2EMGA 2ELZA 1LLMC 2D8SA 2Y1NA 1WEUA 4V3LC 2YU5A 2D9HA 2RPCA 2EMWA 2LO3A 4AUQB 2WBSA 2ECIA 4QF3A 2MKDA 2EOZA 2EORA 5KL2A 3M63A 5KH3A 2VPDA 4GNGA 4W4UA 2L5UA 2EQ3A 2EPPA 1B69A 3LQIA 2EMZA 1A1HA 5D1KB 3EPKA 2YSOA 1IYMA 2A25A 2FUUA 2CTDA 2KYUA 5EYAF 4IJDA 2F6NA 2EOJA 4YBMA 4UI9B 1G25A 1WFKA 2EPZA 3RPGC 2CKLB 1A1JA 5D1LB 2RI7A 2EP3A 2KGIA 2LVHA 2JRJA 2KREA 2MT5A 1WEVA 3LQJA 2YSPA 2PUYA 2CSHA 3N9OA 4LADB 3L11A 2BB8A 3MHSA 2ELYA 3N9MA 2NABA 1Z2QA 2I13A 4F52B 5LKXA 5H9MA 2M6MA 2VJFB 1WJPA 2YTFA 3PHDA 5KL7A 2NAAA 5TDWA 2CKLA 1HYIA 2EM0A 1K2FA 4X3GA 2EN1A 1VYXA 3SOWA 2E6RA 2YQMA 2PNXA 2KR4A 1LDJB 1WENA 2FUIA 2LT7A 2GLIA 5C13A 3GV4A 2PRTA 4LK9A 3L1XA 3RTRB 2LV9A 2EM9A 1AAYA 4B7YC 4UP5A 2JP9A 2VPEA 1MM2A 2LXHC 2Y1MA 2EOXA 2YRHA 1VFYA 1P47A 4ZUXU 2EMYA 2VJFA 1WIMA 1X6EA 5TRBA 2KIZA 2CSYA 5FEYA 4R2RA 1U6GB 2EN7A 2VP7A 2MKNA 2JMJA 4MVTA 4IC3A 5AITA 5LCWB 4N3WA 2WBTA 5H1TA 2HDPA 2KE1A 2KWKA 2HGHA 2OXQC 2EOHA 4FIPA 2EM6A 1ZU1A 1N87A 5G04B 2DLKA 3RPGB 5B75A 1HYJA 4Q6FA 4V3KC 4CCGX 4YABA 1A1GA 1CHCA 2EPUA 2YTJA 3KV5A 2MD7B 2EOSA 2LGLA 2YTGA 4BHWA 1FP0A 4I7CA 5TABA 2VRDA 3C6WA 4NN2A 2YTOA 2WCC3 1WEOA 1LDKC 2MDGA 5LKTA 2F6JA 2EMLA 4R2CA 2K17A 5KL3A 2CT1A 3EPLA 3N9QA 1BORA 4I7BA 5DINA 1V87A 4AVXA 3NG2A 5B79A 2EMKA 2Y43A 2EOOA 5I3LA 2MNYA 2CT2A 3U5MA 2QICA 5B78A 2YU4A 4XI1A 2ENHA 2RSDA 5LKUA 2EMBA 2EJ4A 2EMAA 2YUCA 4IC2A 3HCUA 4FK5A 4GNEA 1ZAAC 4GNFA 1Z6UA 4UP0A 4S3OC 2G6QA 2DMIA 2K16A 1ZR9A 2YQLA 2ECWA 4R2SA 5AIUA 2YREA 4MSXA 2ECVA 2LN0A 1X6FA 2EE8A 2J7JA 2QIZA 4R8PK 1A1IA 2YHNA 3LQHA 3V43A 4WSGA 1JOCA 2YHOA 1Z60A 1NCSA 4WZ3B 3KNVA 2JPAA 4TKPB 2C2VS 4GZNC 2VJEB 1WEWA 2WBUA 1A1KA 4R2EA 3PURA 5J3XA 2E72A 1WEMA
chains in the Genus database with same CATH superfamily
1STUA 5FB1A 2DLQA 5D1MB 2H0DB 3FEHA 2EOIA 3HTKC 2YRMA 3O34A 4L7XA 4OX9E 2EGPA 4FJCA 4M0VA 1YUJA 3JUEA 1X6HA 2L7PA 4F2JC 1SFEA 2EOQA 3SUBA 2B0OE 3LRQA 2ADRA 2EOEA 3MSWA 4ZYDA 4PPEA 2EA6A 4R2DA 1YYKA 2L2NA 1JM7B 1F62A 3BIDA 5C11A 1Z1BA 2K1JA 3P1XA 3L00A 4GEQB 2CSVA 1IQOA 3KDEC 2KWJA 4YC9A 3ZNIA 5TBNA 2VQEE 3T6RA 1WILA 3ADJA 2LQ6A 3ZYQA 2M3HA 3MHHA 3M99B 2UUCE 1E4UA 2P57A 2E6SA 4QQ4A 5H1UA 2EPCA 2FTXB 1TF6A 1MEYC 4R03A 2ENCA 3OTOE 4LFCE 4BBYA 2JMDA 4M9VC 1X48A 2L2MA 2XB1A 3O35A 2DRPA 2H0DA 2XEUA 2ZETC 1GQEA 2E61A 2DX8A 3HCSA 3M62A 4Z0OA 1X5WA 3EPJA 4AYCB 1MM3A 5LL6R 2EPNA 2VPBA 1IBKE 4PTBA 2UZGA 1G2DC 4R2AA 1FBVA 2L0BA 2MD8C 2LJUA 2L43A 3VYXA 5FB0A 4DUZE 1WEEA 1XWHA 5LKZA 1DVPA 1JM7A 2ECGA 4LKAA 2L33A 3C5KA 2V85A 3E2DA 2LGVA 4B86C 4A0CD 2C2LA 4Q35B 1IBLE 2XOCA 1PKPA 4S3OB 1YPNA 3EB6A 1RQ0A 3FIGA 4RHBB 2G43A 4A4CA 4YHHE 4DR4E 2L75A 4BHCA 4LF9E 2DJAA 4OOGC 2F8BA 1RMDA 5KH7A 2YU8A 2MIQA 5KL6A 2JY9A 4A4BA 3HQ1A 1ZBQA 5G0FA 1BBOA 4ZDTA 2LBSB 4QF2A 1BBGA 4WXDA 1A1FA 2YTIA 3O70A 1YYWA 2YZTA 5B8DA 2E1MA 2EXUA 3I2DA 2LV2A 5G05B 3ZVZB 2YTEA 3J7Yp 1X4UA 2MC5A 3ZVYA 4O4KA 2EM3A 2V88A 2UUAE 1WEPA 2EMFA 4N4FA 3O7AA 3IWDA 1X4IA 5SVXA 4IS1C 3FJUB 2R1FA 2EOFA 4WYQB 4DR7E 5B76A 3O47A 4I7DA 2QJ0A 3IWBA 1IQSA 4BMJA 2DGCA 1BB8A 1JK1A 4YBSA 2EOYA 4WZ0A 1WGMA 4CA1A 2YPNA 1ZBDB 2LGKA 3VHTB 5LMUE 1N32E 2EQ1A 3JTZA 1J5EE 4ZQLA 5A6BD 2LGGA 4WZ2A 3SOUA 1WHNA 5KL5A 4JYAE 1N33E 2EPXA 3KWRA 3MDBC 2VNFA 2YW8A 3ZPVE 3O37A 4DV5E 3T7LA 1UBDC 2YSMA 4BCAA 2KFTA 3T1YE 1WESA 3DPLR 1TN9A 2E5LE 3ZPV1 1HNWE 4HTGA 3U5OA 1X4JA 4FO9A 2G45A 3KZYA 2F42A 3GL6A 2EM8A 3SHBA 1HNXE 2XOZA 3N9NA 3HCTA 3PUQA 2LXPC 5DNYA 3VK6A 2EN4A 1VD4A 5DKAA 3KZZA 2K4DA 4JI6E 2EL4A 2V8QB 2EMHA 4DV3E 3ASLA 1FJGE 4JI3E 1YFHA 2EGMA 1JK2A 1TF3A 4KZSA 2YRKA 1A1LA 4GB0A 4YAXA 3K6QA 2EN8A 3KV6A 3C4BA 1UN6B 2EN2A 5FERA 2EMCA 2YSJA 2RSMA 1T4OA 4FK5C 2MA6A 2EL5A 3SOXA 2UXDE 1MGTA 3DQVR 5F3WA 2KKXA 3AUZA 4O62A 4YY3E 2EM5A 2EQ0A 4N4RB 2KU3A 4I8OA 3N9LA 2HYED 4O64A 1YSAC 3ZOQB 3ADLA 4AQYE 3LVQE 2RSIA 2M85A 2M1RA 4L58A 2KGGA 2GHFA 4DV6E 2Q8UA 2F4VE 2CSZA 2EPMX 4A49A 1XNQE 3N9PA 2LMZA 2JMIA 2CONA 4OGCA 3IHPA 4GNDA 3DJWA 3MHSC 4X9JA 2LDRA 4P5OB 2N3GA 3L1ZB 2EL6A 3DDTA 2ECJA 1T39A 5KL4A 2MNZA 4R2PA 1IMUA 2YTPA 2YURA 4ZYEA 4WXCA 1N36E 3C6MA 3TQMA 4C9ZA 2EPRA 2EM7A 5B77A 3BF2A 2YTNA 1G2FC 2EODA 3KQIA 4O24A 4BC7A 3UK3C 4J8ZA 4L5NC 5H1VA 4M30A 2EPAA 2ZM6E 5SVIB 2CRWA 2N3HA 3U5PA 4M2ZA 2EMXA 1WEQA 2VJEA 3ZTGA 4X62E 1WE9A 2MA5A 1UILA 2EN6A 2KONA 4JI4E 2M9AA 4B3SE 4F6MA 1XMQE 4MLQA 2KWNA 2HC5A 2LUPB 4TUIA 1T1HA 2I50A 4AP4A 5A6KA 5A6JA 4F6NA 5IT9C 1O0WA 4DV0E 5KH9A 2VF1A 4WSPA 4TUGA 2KWOA 3LLHA 3O33A 4DR2E 2EM2A 4BBQA 3JAMC 4R2QA 3QZVA 3ADIA 3EPHA 3O36A 2EOMA 4R2YA 2BAYA 3OMLA 3FL2A 2EM4A 2LE2A 4BHBA 2ODRC 3HXLA 2YVRA 5ADZA 2AN6A 4LLBA 4NHRA 3AV0A 2M1SA 2LCEA 2M4IA 1EH6A 2LRIC 2B9DA 3J7AG 2ENAA 3EB5A 4WA6A 2JWOA 3MHHC 4X66E 1YUIA 2YT5A 1X3CA 4LFBE 4YBTA 1SR9A 3IWCA 2KOUA 1F2IG 2FSAA 5JG6A 2YYRA 1EH7A 2EMIA 2EN3A 4GKJE 3M99A 5SVIA 5TDRA 2K4VA 2L80A 4LF7E 2VPGA 3LJUX 3ADGA 4LJNA 2YTQA 3H7HA 3RMPA 2MUMA 4JV5E 2DMYA 1DGCA 3T1HE 4R7EA 2ECTA 2N8XA 4YATA 2JOBA 4O43A 4P78A 4X65E 4F54A 1HR0E 4JI0E 4YADA 2YTDA 4AYCA 2ECNA 2IDAA 4P7DA 3U5NA 2LAUA 2RS7A 2CRRA 2EMGA 2ELZA 1LLMC 4DUYE 4B3TE 4F9AB 2D8SA 2Y1NA 1UHZA 1WEUA 4V3LC 4LF8E 2YU5A 2D9HA 2RPCA 2EMWA 2LO3A 4AUQB 2WBSA 2L2KB 2ECIA 4QF3A 1WHQA 2MKDA 1NEIA 2EOZA 2EORA 3DF6A 1QNTA 5KL2A 4R8OA 3M63A 5KH3A 2HJJA 3HPZA 2VPDA 4GNGA 4W4UA 2UU9E 2L5UA 2EQ3A 2RR4A 5TSEA 2EPPA 1B69A 3LQIA 2EMZA 2FD4A 2JR1A 3F6HA 2VQFE 1A1HA 2UXCE 5D1KB 2RS6A 3EPKA 2YSOA 4RH8A 2L3JA 1IYMA 2H36X 2V89A 2A25A 2FUUA 2CTDA 2KYUA 5EYAF 4KHPE 1DCQA 4IJDA 2F6NA 2EOJA 1EH8A 4YBMA 2JYAA 4UI9B 1G25A 1WFKA 2EPZA 3RPGC 2CKLB 3M7KA 1A1JA 5A6BA 3J80C 5D1LB 2M13A 1DI2A 2RI7A 2IHR1 4WPYA 3LVRE 2EP3A 1KYQA 2KGIA 2LVHA 4LF6E 2JRJA 2L3CA 2V83A 3Q1DA 2KREA 2MT5A 1WEVA 2RQLA 2V86A 4MLVA 4K0KE 2EZ6A 4X64E 4OGEA 3LQJA 2YSPA 2PUYA 2CSHA 2JUNA 3N9OA 2WZOA 4LF4E 2YWQA 4LADB 3L11A 2BB8A 3BBGA 3C4TA 3F6GA 3MHSA 2ELYA 2XP0A 4BS9A 4ZYGA 3N9MA 2NABA 1Z2QA 2LUQA 4HEIA 3DWDA 2MDRA 2I13A 4F52B 2KHXA 5LKXA 5H9MA 2EWLA 2M6MA 2VJFB 3THNA 1WJPA 2YTFA 4DV7E 3FAOA 4JI7E 3PHDA 4DV4E 5KL7A 2NAAA 5TDWA 2L8TA 2CKLA 1HYIA 2YT4A 2ODRD 2EM0A 3FANA 4GKKE 1J26A 1K2FA 4X3GA 2EN1A 1VYXA 3SOWA 2FFWA 2E6RA 2YQMA 2PNXA 4O5GA 2KR4A 1LDJB 1WENA 2FUIA 2DIXA 5AC4A 1HNZE 4WFTA 2LT7A 2GLIA 3ECRA 5C13A 3GV4A 2PRTA 2JOXA 1RC7A 4LK9A 1L4SA 3L1XA 3RTRB 4DR5E 2LV9A 5LMNE 2EM9A 1AAYA 4LFAE 4B7YC 2CPNA 1GZ6A 2HHHE 4UP5A 2JP9A 2VPEA 1EKZA 5IV8B 1IBME 1MM2A 1N34E 2LXHC 2Y1MA 2LRSA 2DSMA 2EOXA 2YRHA 1VFYA 1XMOE 1P47A 4ZUXU 1WRJA 2EMYA 5IWAE 4F9CB 2VJFA 1PJQA 1WIMA 2IQJA 4F9BB 3JU0A 1X6EA 5TRBA 2KIZA 2DB2A 2CSYA 2K7IA 1FKAE 5FEYA 4R2RA 1U6GB 2EN7A 2LJHA 2VP7A 2MKNA 2R76A 2JMJA 4NXME 4MVTA 4IC3A 2V87A 5AITA 5LCWB 3VYYA 4N3WA 2WBTA 5H1TA 4DV1E 2HDPA 2KE1A 2KWKA 4H9DA 2HGHA 2NUFA 5AE2A 2OXQC 2BBGA 4DV2E 2EOHA 4FIPA 2EM6A 1ZU1A 1N87A 1QU6A 1T4LB 4DKKA 5SVYA 5G04B 2DSYA 2D8UA 3FM8C 1X47A 2DLKA 1YZ9A 3RPGB 2B3TB 4LF5E 5B75A 1HYJA 4Q6FA 4V3KC 5BR8E 4CCGX 4YABA 2G7HA 1A1GA 1CHCA 2EPUA 2YTJA 3KV5A 2MD7B 2L92A 3PLWA 1YYOA 2FV4B 1PJSA 1I94E 2EOSA 3EQ1A 4JI2E 2LGLA 2XOYA 2YTGA 5AC5A 5CFFE 3LMLA 1DQ3A 4WX9A 4B3RE 4BC9A 4BHWA 3H09A 1FP0A 4I7CA 2EPLX 3HTXA 5TABA 1ZBTA 3J81C 4DR6E 2VRDA 3C6WA 2MC6A 1X49A 4NN2A 2YTOA 2WCC3 1WEOA 1LDKC 2MDGA 2RTXA 5LKTA 2EPOA 3C6KA 2F6JA 2EMLA 2L6MA 4R2CA 2K17A 5K3QA 1WXRA 4DR3E 1T38A 5A69A 1MBMA 5KL3A 3LDYA 2CT1A 2VE7C 3N9QA 1BORA 4I7BA 3EPLA 5DINA 3THOB 1V87A 4AVXA 3NG2A 5B79A 2EMKA 2Y43A 2EOOA 4X8WA 2FGGA 3T9KA 4ZYHA 4NXNE 5I3LA 2LTRA 2B7TA 2MNYA 1AH5A 2CT2A 3U5MA 2QICA 5B78A 1XNRE 2YU4A 4XI1A 4LU9A 5T6JA 2ENHA 2NUGA 2RSDA 4JI1E 2NA2A 2MKEA 5IXMB 4JI5E 5LKUA 2EMBA 2EJ4A 2EMAA 2YUCA 2JXPA 4IC2A 3HCUA 4FK5A 4GNEA 4KWYA 1ZAAC 4GNFA 3BGHA 4Q28A 2JM3A 1Z6UA 5AE1A 3QG5C 4UP0A 4S3OC 2G6QA 2DMIA 2K16A 1PDAA 4DR1E 5FLXC 4B3ME 1ZR9A 2YQLA 2JVAA 2ECWA 4DMIA 2LTSA 5AASA 2UUBE 2KKYA 2UXBE 4NZVA 2OWAA 4F1PA 2I9IA 5AIUA 5A6AA 2YREA 4R2SA 4MSXA 2ECVA 2LN0A 1X6FA 2EE8A 2B7VA 2GPIA 5A2QC 2NUEA 4JI8E 2J7JA 2QIZA 4R8PK 1A1IA 2YHNA 3LQHA 3V43A 4WSGA 1N3GA 1GTKA 1JOCA 2YHOA 5LLQA 1Z60A 3HPSA 4LTYA 1NCSA 5AE3A 4WZ3B 3KNVA 4Z0RA 4TKPB 2JPAA 2C2VS 4GZNC 2VJEB 4L8NA 1PJTA 1WEWA 2WBUA 1A1KA 4R2EA 1KJKA 2M7QA 3PURA 5J3XA 1T4NA 2EPKX 2E72A 1WEMA
chains in the Genus database with same CATH topology
5FB1A 2DLQA 5D1MB 2H0DB 2EOIA 3HTKC 2YRMA 3O34A 4L7XA 2EGPA 4FJCA 1YUJA 1X6HA 4F2JC 2EOQA 3LRQA 2EOEA 2ADRA 4PPEA 2EA6A 4R2DA 1JM7B 1F62A 1Z1BA 5C11A 2K1JA 2KWJA 4YC9A 3ZNIA 5TBNA 3T6RA 1WILA 2LQ6A 3ZYQA 2M3HA 3MHHA 3M99B 1E4UA 2EPCA 2E6SA 5H1UA 1TF6A 1MEYC 2ENCA 2JMDA 4M9VC 2DRPA 2XB1A 3O35A 2H0DA 2XEUA 2ZETC 1X5WA 3HCSA 2DX8A 3M62A 3EPJA 4AYCB 1MM3A 2VPBA 4PTBA 2UZGA 1G2DC 4R2AA 1FBVA 2L0BA 2MD8C 2L43A 5FB0A 1WEEA 1XWHA 5LKZA 1DVPA 1JM7A 2ECGA 4LKAA 3C5KA 2LGVA 4B86C 4A0CD 2C2LA 4S3OB 3EB6A 2G43A 4A4CA 2L75A 1RMDA 5KH7A 2YU8A 2MIQA 5KL6A 4A4BA 5G0FA 1BBOA 4ZDTA 1A1FA 4QF2A 2YTIA 3O70A 5B8DA 3I2DA 2LV2A 5G05B 3ZVZB 2YTEA 1X4UA 3ZVYA 2EM3A 1WEPA 2EMFA 4N4FA 3O7AA 1X4IA 4IS1C 2R1FA 2EOFA 5B76A 4I7DA 2QJ0A 2DGCA 1BB8A 1JK1A 4YBSA 2EOYA 4WZ0A 1WGMA 4CA1A 1ZBDB 2LGKA 3VHTB 2EQ1A 4ZQLA 2LGGA 3SOUA 4WZ2A 5KL5A 2EPXA 2VNFA 2YW8A 3ZPVE 3O37A 3T7LA 1UBDC 2YSMA 2KFTA 1WESA 3DPLR 1TN9A 3ZPV1 3U5OA 1X4JA 4FO9A 2G45A 2F42A 3GL6A 2EM8A 3SHBA 3N9NA 3HCTA 3PUQA 2LXPC 3VK6A 2EN4A 1VD4A 5DKAA 2K4DA 2EL4A 2EMHA 3ASLA 1JK2A 1TF3A 2YRKA 1A1LA 4GB0A 4YAXA 2EN8A 3KV6A 1UN6B 2EN2A 5FERA 2EMCA 2YSJA 4FK5C 2MA6A 2EL5A 3SOXA 3DQVR 2EM5A 2EQ0A 2KU3A 3N9LA 2HYED 4O64A 1YSAC 2RSIA 2M85A 2M1RA 4L58A 2KGGA 2GHFA 2CSZA 4A49A 3N9PA 2JMIA 3IHPA 4GNDA 4X9JA 3MHSC 2LDRA 4P5OB 3L1ZB 2EL6A 2ECJA 5KL4A 2MNZA 4R2PA 2YTPA 2YURA 4C9ZA 2EPRA 2EM7A 5B77A 1G2FC 2YTNA 2EODA 3KQIA 3UK3C 5H1VA 2EPAA 3U5PA 2EMXA 1WEQA 2VJEA 3ZTGA 1WE9A 2MA5A 2EN6A 2M9AA 4F6MA 2KWNA 1T1HA 2I50A 4AP4A 4F6NA 5KH9A 2KWOA 3O33A 2EM2A 4BBQA 4R2QA 3QZVA 3EPHA 3O36A 2EOMA 4R2YA 2BAYA 1KJKA 3FL2A 2EM4A 2AN6A 4LLBA 2LCEA 2LRIC 2ENAA 3EB5A 4WA6A 3MHHC 1YUIA 2YT5A 1X3CA 4YBTA 1F2IG 2FSAA 5JG6A 2YYRA 2EN3A 2EMIA 3M99A 5TDRA 2L80A 2VPGA 4LJNA 2YTQA 2MUMA 1DGCA 4R7EA 2ECTA 4YATA 4YADA 2YTDA 4AYCA 2ECNA 2IDAA 3U5NA 2EMGA 2ELZA 1LLMC 2D8SA 2Y1NA 1WEUA 4V3LC 2YU5A 2D9HA 2RPCA 2EMWA 2LO3A 4AUQB 2WBSA 2ECIA 4QF3A 2MKDA 2EOZA 2EORA 5KL2A 3M63A 5KH3A 2VPDA 4GNGA 4W4UA 2L5UA 2EQ3A 2EPPA 1B69A 3LQIA 2EMZA 1A1HA 5D1KB 3EPKA 2YSOA 1IYMA 2A25A 2FUUA 2CTDA 2KYUA 5EYAF 4IJDA 2F6NA 2EOJA 4YBMA 4UI9B 1G25A 1WFKA 2EPZA 3RPGC 2CKLB 1A1JA 5D1LB 2RI7A 2EP3A 2KGIA 2LVHA 2JRJA 2KREA 2MT5A 1WEVA 3LQJA 2YSPA 2PUYA 2CSHA 3N9OA 4LADB 3L11A 2BB8A 3MHSA 2ELYA 3N9MA 2NABA 1Z2QA 2I13A 4F52B 5LKXA 5H9MA 2M6MA 2VJFB 1WJPA 2YTFA 3PHDA 5KL7A 2NAAA 5TDWA 2CKLA 1HYIA 2EM0A 1K2FA 4X3GA 2EN1A 1VYXA 3SOWA 2E6RA 2YQMA 2PNXA 2KR4A 1LDJB 1WENA 2FUIA 2LT7A 2GLIA 5C13A 3GV4A 2PRTA 4LK9A 3L1XA 3RTRB 2LV9A 2EM9A 1AAYA 4B7YC 4UP5A 2JP9A 2VPEA 1MM2A 2LXHC 2Y1MA 2EOXA 2YRHA 1VFYA 1P47A 4ZUXU 2EMYA 2VJFA 1WIMA 1X6EA 5TRBA 2KIZA 2CSYA 5FEYA 4R2RA 1U6GB 2EN7A 2VP7A 2MKNA 2JMJA 4MVTA 4IC3A 5AITA 5LCWB 4N3WA 2WBTA 5H1TA 2HDPA 2KE1A 2KWKA 2HGHA 2OXQC 2EOHA 4FIPA 2EM6A 1ZU1A 1N87A 5G04B 2DLKA 3RPGB 5B75A 1HYJA 4Q6FA 4V3KC 4CCGX 4YABA 1A1GA 1CHCA 2EPUA 2YTJA 3KV5A 2MD7B 2EOSA 2LGLA 2YTGA 4BHWA 1FP0A 4I7CA 5TABA 2VRDA 3C6WA 4NN2A 2YTOA 2WCC3 1WEOA 1LDKC 2MDGA 5LKTA 2F6JA 2EMLA 4R2CA 2K17A 5KL3A 2CT1A 3EPLA 3N9QA 1BORA 4I7BA 5DINA 1V87A 4AVXA 3NG2A 5B79A 2EMKA 2Y43A 2EOOA 5I3LA 2MNYA 2CT2A 3U5MA 2QICA 5B78A 2YU4A 4XI1A 2ENHA 2RSDA 5LKUA 2EMBA 2EJ4A 2EMAA 2YUCA 4IC2A 3HCUA 4FK5A 4GNEA 1ZAAC 4GNFA 1Z6UA 4UP0A 4S3OC 2G6QA 2DMIA 2K16A 1ZR9A 2YQLA 2ECWA 4R2SA 5AIUA 2YREA 4MSXA 2ECVA 2LN0A 1X6FA 2EE8A 2J7JA 2QIZA 4R8PK 1A1IA 2YHNA 3LQHA 3V43A 4WSGA 1JOCA 2YHOA 1Z60A 1NCSA 4WZ3B 3KNVA 2JPAA 4TKPB 2C2VS 4GZNC 2VJEB 1WEWA 2WBUA 1A1KA 4R2EA 3PURA 5J3XA 2E72A 1WEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB1 A;  2DLQ A;  5D1M B;  2H0D B;  2EOI A;  3HTK C;  2YRM A;  3O34 A;  4L7X A;  2EGP A;  4FJC A;  1YUJ A;  1X6H A;  4F2J C;  2EOQ A;  3LRQ A;  2EOE A;  2ADR A;  4PPE A;  2EA6 A;  4R2D A;  1JM7 B;  1F62 A;  1Z1B A;  5C11 A;  2K1J A;  2KWJ A;  4YC9 A;  3ZNI A;  5TBN A;  3T6R A;  1WIL A;  2LQ6 A;  3ZYQ A;  2M3H A;  3MHH A;  3M99 B;  1E4U A;  2EPC A;  2E6S A;  5H1U A;  1TF6 A;  1MEY C;  2ENC A;  2JMD A;  4M9V C;  2DRP A;  2XB1 A;  3O35 A;  2H0D A;  2XEU A;  2ZET C;  1X5W A;  3HCS A;  2DX8 A;  3M62 A;  3EPJ A;  4AYC B;  1MM3 A;  2VPB A;  4PTB A;  2UZG A;  1G2D C;  4R2A A;  1FBV A;  2L0B A;  2MD8 C;  2L43 A;  5FB0 A;  1WEE A;  1XWH A;  5LKZ A;  1DVP A;  1JM7 A;  2ECG A;  4LKA A;  3C5K A;  2LGV A;  4B86 C;  4A0C D;  2C2L A;  4S3O B;  3EB6 A;  2G43 A;  4A4C A;  2L75 A;  1RMD A;  5KH7 A;  2YU8 A;  2MIQ A;  5KL6 A;  4A4B A;  5G0F A;  1BBO A;  4ZDT A;  1A1F A;  4QF2 A;  2YTI A;  3O70 A;  5B8D A;  3I2D A;  2LV2 A;  5G05 B;  3ZVZ B;  2YTE A;  1X4U A;  3ZVY A;  2EM3 A;  1WEP A;  2EMF A;  4N4F A;  3O7A A;  1X4I A;  4IS1 C;  2R1F A;  2EOF A;  5B76 A;  4I7D A;  2QJ0 A;  2DGC A;  1BB8 A;  1JK1 A;  4YBS A;  2EOY A;  4WZ0 A;  1WGM A;  4CA1 A;  1ZBD B;  2LGK A;  3VHT B;  2EQ1 A;  4ZQL A;  2LGG A;  3SOU A;  4WZ2 A;  5KL5 A;  2EPX A;  2VNF A;  2YW8 A;  3ZPV E;  3O37 A;  3T7L A;  1UBD C;  2YSM A;  2KFT A;  1WES A;  3DPL R;  1TN9 A;  3ZPV 1;  3U5O A;  1X4J A;  4FO9 A;  2G45 A;  2F42 A;  3GL6 A;  2EM8 A;  3SHB A;  3N9N A;  3HCT A;  3PUQ A;  2LXP C;  3VK6 A;  2EN4 A;  1VD4 A;  5DKA A;  2K4D A;  2EL4 A;  2EMH A;  3ASL A;  1JK2 A;  1TF3 A;  2YRK A;  1A1L A;  4GB0 A;  4YAX A;  2EN8 A;  3KV6 A;  1UN6 B;  2EN2 A;  5FER A;  2EMC A;  2YSJ A;  4FK5 C;  2MA6 A;  2EL5 A;  3SOX A;  3DQV R;  2EM5 A;  2EQ0 A;  2KU3 A;  3N9L A;  2HYE D;  4O64 A;  1YSA C;  2RSI A;  2M85 A;  2M1R A;  4L58 A;  2KGG A;  2GHF A;  2CSZ A;  4A49 A;  3N9P A;  2JMI A;  3IHP A;  4GND A;  4X9J A;  3MHS C;  2LDR A;  4P5O B;  3L1Z B;  2EL6 A;  2ECJ A;  5KL4 A;  2MNZ A;  4R2P A;  2YTP A;  2YUR A;  4C9Z A;  2EPR A;  2EM7 A;  5B77 A;  1G2F C;  2YTN A;  2EOD A;  3KQI A;  3UK3 C;  5H1V A;  2EPA A;  3U5P A;  2EMX A;  1WEQ A;  2VJE A;  3ZTG A;  1WE9 A;  2MA5 A;  2EN6 A;  2M9A A;  4F6M A;  2KWN A;  1T1H A;  2I50 A;  4AP4 A;  4F6N A;  5KH9 A;  2KWO A;  3O33 A;  2EM2 A;  4BBQ A;  4R2Q A;  3QZV A;  3EPH A;  3O36 A;  2EOM A;  4R2Y A;  2BAY A;  1KJK A;  3FL2 A;  2EM4 A;  2AN6 A;  4LLB A;  2LCE A;  2LRI C;  2ENA A;  3EB5 A;  4WA6 A;  3MHH C;  1YUI A;  2YT5 A;  1X3C A;  4YBT A;  1F2I G;  2FSA A;  5JG6 A;  2YYR A;  2EN3 A;  2EMI A;  3M99 A;  5TDR A;  2L80 A;  2VPG A;  4LJN A;  2YTQ A;  2MUM A;  1DGC A;  4R7E A;  2ECT A;  4YAT A;  4YAD A;  2YTD A;  4AYC A;  2ECN A;  2IDA A;  3U5N A;  2EMG A;  2ELZ A;  1LLM C;  2D8S A;  2Y1N A;  1WEU A;  4V3L C;  2YU5 A;  2D9H A;  2RPC A;  2EMW A;  2LO3 A;  4AUQ B;  2WBS A;  2ECI A;  4QF3 A;  2MKD A;  2EOZ A;  2EOR A;  5KL2 A;  3M63 A;  5KH3 A;  2VPD A;  4GNG A;  4W4U A;  2L5U A;  2EQ3 A;  2EPP A;  1B69 A;  3LQI A;  2EMZ A;  1A1H A;  5D1K B;  3EPK A;  2YSO A;  1IYM A;  2A25 A;  2FUU A;  2CTD A;  2KYU A;  5EYA F;  4IJD A;  2F6N A;  2EOJ A;  4YBM A;  4UI9 B;  1G25 A;  1WFK A;  2EPZ A;  3RPG C;  2CKL B;  1A1J A;  5D1L B;  2RI7 A;  2EP3 A;  2KGI A;  2LVH A;  2JRJ A;  2KRE A;  2MT5 A;  1WEV A;  3LQJ A;  2YSP A;  2PUY A;  2CSH A;  3N9O A;  4LAD B;  3L11 A;  2BB8 A;  3MHS A;  2ELY A;  3N9M A;  2NAB A;  1Z2Q A;  2I13 A;  4F52 B;  5LKX A;  5H9M A;  2M6M A;  2VJF B;  1WJP A;  2YTF A;  3PHD A;  5KL7 A;  2NAA A;  5TDW A;  2CKL A;  1HYI A;  2EM0 A;  1K2F A;  4X3G A;  2EN1 A;  1VYX A;  3SOW A;  2E6R A;  2YQM A;  2PNX A;  2KR4 A;  1LDJ B;  1WEN A;  2FUI A;  2LT7 A;  2GLI A;  5C13 A;  3GV4 A;  2PRT A;  4LK9 A;  3L1X A;  3RTR B;  2LV9 A;  2EM9 A;  1AAY A;  4B7Y C;  4UP5 A;  2JP9 A;  2VPE A;  1MM2 A;  2LXH C;  2Y1M A;  2EOX A;  2YRH A;  1VFY A;  1P47 A;  4ZUX U;  2EMY A;  2VJF A;  1WIM A;  1X6E A;  5TRB A;  2KIZ A;  2CSY A;  5FEY A;  4R2R A;  1U6G B;  2EN7 A;  2VP7 A;  2MKN A;  2JMJ A;  4MVT A;  4IC3 A;  5AIT A;  5LCW B;  4N3W A;  2WBT A;  5H1T A;  2HDP A;  2KE1 A;  2KWK A;  2HGH A;  2OXQ C;  2EOH A;  4FIP A;  2EM6 A;  1ZU1 A;  1N87 A;  5G04 B;  2DLK A;  3RPG B;  5B75 A;  1HYJ A;  4Q6F A;  4V3K C;  4CCG X;  4YAB A;  1A1G A;  1CHC A;  2EPU A;  2YTJ A;  3KV5 A;  2MD7 B;  2EOS A;  2LGL A;  2YTG A;  4BHW A;  1FP0 A;  4I7C A;  5TAB A;  2VRD A;  3C6W A;  4NN2 A;  2YTO A;  2WCC 3;  1WEO A;  1LDK C;  2MDG A;  5LKT A;  2F6J A;  2EML A;  4R2C A;  2K17 A;  5KL3 A;  2CT1 A;  3EPL A;  3N9Q A;  1BOR A;  4I7B A;  5DIN A;  1V87 A;  4AVX A;  3NG2 A;  5B79 A;  2EMK A;  2Y43 A;  2EOO A;  5I3L A;  2MNY A;  2CT2 A;  3U5M A;  2QIC A;  5B78 A;  2YU4 A;  4XI1 A;  2ENH A;  2RSD A;  5LKU A;  2EMB A;  2EJ4 A;  2EMA A;  2YUC A;  4IC2 A;  3HCU A;  4FK5 A;  4GNE A;  1ZAA C;  4GNF A;  1Z6U A;  4UP0 A;  4S3O C;  2G6Q A;  2DMI A;  2K16 A;  1ZR9 A;  2YQL A;  2ECW A;  4R2S A;  5AIU A;  2YRE A;  4MSX A;  2ECV A;  2LN0 A;  1X6F A;  2EE8 A;  2J7J A;  2QIZ A;  4R8P K;  1A1I A;  2YHN A;  3LQH A;  3V43 A;  4WSG A;  1JOC A;  2YHO A;  1Z60 A;  1NCS A;  4WZ3 B;  3KNV A;  2JPA A;  4TKP B;  2C2V S;  4GZN C;  2VJE B;  1WEW A;  2WBU A;  1A1K A;  4R2E A;  3PUR A;  5J3X A;  2E72 A;  1WEM A; 
#chains in the Genus database with same CATH topology
 1STU A;  5FB1 A;  2DLQ A;  5D1M B;  2H0D B;  3FEH A;  2EOI A;  3HTK C;  2YRM A;  3O34 A;  4L7X A;  4OX9 E;  2EGP A;  4FJC A;  4M0V A;  1YUJ A;  3JUE A;  1X6H A;  2L7P A;  4F2J C;  1SFE A;  2EOQ A;  3SUB A;  2B0O E;  3LRQ A;  2ADR A;  2EOE A;  3MSW A;  4ZYD A;  4PPE A;  2EA6 A;  4R2D A;  1YYK A;  2L2N A;  1JM7 B;  1F62 A;  3BID A;  5C11 A;  1Z1B A;  2K1J A;  3P1X A;  3L00 A;  4GEQ B;  2CSV A;  1IQO A;  3KDE C;  2KWJ A;  4YC9 A;  3ZNI A;  5TBN A;  2VQE E;  3T6R A;  1WIL A;  3ADJ A;  2LQ6 A;  3ZYQ A;  2M3H A;  3MHH A;  3M99 B;  2UUC E;  1E4U A;  2P57 A;  2E6S A;  4QQ4 A;  5H1U A;  2EPC A;  2FTX B;  1TF6 A;  1MEY C;  4R03 A;  2ENC A;  3OTO E;  4LFC E;  4BBY A;  2JMD A;  4M9V C;  1X48 A;  2L2M A;  2XB1 A;  3O35 A;  2DRP A;  2H0D A;  2XEU A;  2ZET C;  1GQE A;  2E61 A;  2DX8 A;  3HCS A;  3M62 A;  4Z0O A;  1X5W A;  3EPJ A;  4AYC B;  1MM3 A;  5LL6 R;  2EPN A;  2VPB A;  1IBK E;  4PTB A;  2UZG A;  1G2D C;  4R2A A;  1FBV A;  2L0B A;  2MD8 C;  2LJU A;  2L43 A;  3VYX A;  5FB0 A;  4DUZ E;  1WEE A;  1XWH A;  5LKZ A;  1DVP A;  1JM7 A;  2ECG A;  4LKA A;  2L33 A;  3C5K A;  2V85 A;  3E2D A;  2LGV A;  4B86 C;  4A0C D;  2C2L A;  4Q35 B;  1IBL E;  2XOC A;  1PKP A;  4S3O B;  1YPN A;  3EB6 A;  1RQ0 A;  3FIG A;  4RHB B;  2G43 A;  4A4C A;  4YHH E;  4DR4 E;  2L75 A;  4BHC A;  4LF9 E;  2DJA A;  4OOG C;  2F8B A;  1RMD A;  5KH7 A;  2YU8 A;  2MIQ A;  5KL6 A;  2JY9 A;  4A4B A;  3HQ1 A;  1ZBQ A;  5G0F A;  1BBO A;  4ZDT A;  2LBS B;  4QF2 A;  1BBG A;  4WXD A;  1A1F A;  2YTI A;  3O70 A;  1YYW A;  2YZT A;  5B8D A;  2E1M A;  2EXU A;  3I2D A;  2LV2 A;  5G05 B;  3ZVZ B;  2YTE A;  3J7Y p;  1X4U A;  2MC5 A;  3ZVY A;  4O4K A;  2EM3 A;  2V88 A;  2UUA E;  1WEP A;  2EMF A;  4N4F A;  3O7A A;  3IWD A;  1X4I A;  5SVX A;  4IS1 C;  3FJU B;  2R1F A;  2EOF A;  4WYQ B;  4DR7 E;  5B76 A;  3O47 A;  4I7D A;  2QJ0 A;  3IWB A;  1IQS A;  4BMJ A;  2DGC A;  1BB8 A;  1JK1 A;  4YBS A;  2EOY A;  4WZ0 A;  1WGM A;  4CA1 A;  2YPN A;  1ZBD B;  2LGK A;  3VHT B;  5LMU E;  1N32 E;  2EQ1 A;  3JTZ A;  1J5E E;  4ZQL A;  5A6B D;  2LGG A;  4WZ2 A;  3SOU A;  1WHN A;  5KL5 A;  4JYA E;  1N33 E;  2EPX A;  3KWR A;  3MDB C;  2VNF A;  2YW8 A;  3ZPV E;  3O37 A;  4DV5 E;  3T7L A;  1UBD C;  2YSM A;  4BCA A;  2KFT A;  3T1Y E;  1WES A;  3DPL R;  1TN9 A;  2E5L E;  3ZPV 1;  1HNW E;  4HTG A;  3U5O A;  1X4J A;  4FO9 A;  2G45 A;  3KZY A;  2F42 A;  3GL6 A;  2EM8 A;  3SHB A;  1HNX E;  2XOZ A;  3N9N A;  3HCT A;  3PUQ A;  2LXP C;  5DNY A;  3VK6 A;  2EN4 A;  1VD4 A;  5DKA A;  3KZZ A;  2K4D A;  4JI6 E;  2EL4 A;  2V8Q B;  2EMH A;  4DV3 E;  3ASL A;  1FJG E;  4JI3 E;  1YFH A;  2EGM A;  1JK2 A;  1TF3 A;  4KZS A;  2YRK A;  1A1L A;  4GB0 A;  4YAX A;  3K6Q A;  2EN8 A;  3KV6 A;  3C4B A;  1UN6 B;  2EN2 A;  5FER A;  2EMC A;  2YSJ A;  2RSM A;  1T4O A;  4FK5 C;  2MA6 A;  2EL5 A;  3SOX A;  2UXD E;  1MGT A;  3DQV R;  5F3W A;  2KKX A;  3AUZ A;  4O62 A;  4YY3 E;  2EM5 A;  2EQ0 A;  4N4R B;  2KU3 A;  4I8O A;  3N9L A;  2HYE D;  4O64 A;  1YSA C;  3ZOQ B;  3ADL A;  4AQY E;  3LVQ E;  2RSI A;  2M85 A;  2M1R A;  4L58 A;  2KGG A;  2GHF A;  4DV6 E;  2Q8U A;  2F4V E;  2CSZ A;  2EPM X;  4A49 A;  1XNQ E;  3N9P A;  2LMZ A;  2JMI A;  2CON A;  4OGC A;  3IHP A;  4GND A;  3DJW A;  3MHS C;  4X9J A;  2LDR A;  4P5O B;  2N3G A;  3L1Z B;  2EL6 A;  3DDT A;  2ECJ A;  1T39 A;  5KL4 A;  2MNZ A;  4R2P A;  1IMU A;  2YTP A;  2YUR A;  4ZYE A;  4WXC A;  1N36 E;  3C6M A;  3TQM A;  4C9Z A;  2EPR A;  2EM7 A;  5B77 A;  3BF2 A;  2YTN A;  1G2F C;  2EOD A;  3KQI A;  4O24 A;  4BC7 A;  3UK3 C;  4J8Z A;  4L5N C;  5H1V A;  4M30 A;  2EPA A;  2ZM6 E;  5SVI B;  2CRW A;  2N3H A;  3U5P A;  4M2Z A;  2EMX A;  1WEQ A;  2VJE A;  3ZTG A;  4X62 E;  1WE9 A;  2MA5 A;  1UIL A;  2EN6 A;  2KON A;  4JI4 E;  2M9A A;  4B3S E;  4F6M A;  1XMQ E;  4MLQ A;  2KWN A;  2HC5 A;  2LUP B;  4TUI A;  1T1H A;  2I50 A;  4AP4 A;  5A6K A;  5A6J A;  4F6N A;  5IT9 C;  1O0W A;  4DV0 E;  5KH9 A;  2VF1 A;  4WSP A;  4TUG A;  2KWO A;  3LLH A;  3O33 A;  4DR2 E;  2EM2 A;  4BBQ A;  3JAM C;  4R2Q A;  3QZV A;  3ADI A;  3EPH A;  3O36 A;  2EOM A;  4R2Y A;  2BAY A;  3OML A;  3FL2 A;  2EM4 A;  2LE2 A;  4BHB A;  2ODR C;  3HXL A;  2YVR A;  5ADZ A;  2AN6 A;  4LLB A;  4NHR A;  3AV0 A;  2M1S A;  2LCE A;  2M4I A;  1EH6 A;  2LRI C;  2B9D A;  3J7A G;  2ENA A;  3EB5 A;  4WA6 A;  2JWO A;  3MHH C;  4X66 E;  1YUI A;  2YT5 A;  1X3C A;  4LFB E;  4YBT A;  1SR9 A;  3IWC A;  2KOU A;  1F2I G;  2FSA A;  5JG6 A;  2YYR A;  1EH7 A;  2EMI A;  2EN3 A;  4GKJ E;  3M99 A;  5SVI A;  5TDR A;  2K4V A;  2L80 A;  4LF7 E;  2VPG A;  3LJU X;  3ADG A;  4LJN A;  2YTQ A;  3H7H A;  3RMP A;  2MUM A;  4JV5 E;  2DMY A;  1DGC A;  3T1H E;  4R7E A;  2ECT A;  2N8X A;  4YAT A;  2JOB A;  4O43 A;  4P78 A;  4X65 E;  4F54 A;  1HR0 E;  4JI0 E;  4YAD A;  2YTD A;  4AYC A;  2ECN A;  2IDA A;  4P7D A;  3U5N A;  2LAU A;  2RS7 A;  2CRR A;  2EMG A;  2ELZ A;  1LLM C;  4DUY E;  4B3T E;  4F9A B;  2D8S A;  2Y1N A;  1UHZ A;  1WEU A;  4V3L C;  4LF8 E;  2YU5 A;  2D9H A;  2RPC A;  2EMW A;  2LO3 A;  4AUQ B;  2WBS A;  2L2K B;  2ECI A;  4QF3 A;  1WHQ A;  2MKD A;  1NEI A;  2EOZ A;  2EOR A;  3DF6 A;  1QNT A;  5KL2 A;  4R8O A;  3M63 A;  5KH3 A;  2HJJ A;  3HPZ A;  2VPD A;  4GNG A;  4W4U A;  2UU9 E;  2L5U A;  2EQ3 A;  2RR4 A;  5TSE A;  2EPP A;  1B69 A;  3LQI A;  2EMZ A;  2FD4 A;  2JR1 A;  3F6H A;  2VQF E;  1A1H A;  2UXC E;  5D1K B;  2RS6 A;  3EPK A;  2YSO A;  4RH8 A;  2L3J A;  1IYM A;  2H36 X;  2V89 A;  2A25 A;  2FUU A;  2CTD A;  2KYU A;  5EYA F;  4KHP E;  1DCQ A;  4IJD A;  2F6N A;  2EOJ A;  1EH8 A;  4YBM A;  2JYA A;  4UI9 B;  1G25 A;  1WFK A;  2EPZ A;  3RPG C;  2CKL B;  3M7K A;  1A1J A;  5A6B A;  3J80 C;  5D1L B;  2M13 A;  1DI2 A;  2RI7 A;  2IHR 1;  4WPY A;  3LVR E;  2EP3 A;  1KYQ A;  2KGI A;  2LVH A;  4LF6 E;  2JRJ A;  2L3C A;  2V83 A;  3Q1D A;  2KRE A;  2MT5 A;  1WEV A;  2RQL A;  2V86 A;  4MLV A;  4K0K E;  2EZ6 A;  4X64 E;  4OGE A;  3LQJ A;  2YSP A;  2PUY A;  2CSH A;  2JUN A;  3N9O A;  2WZO A;  4LF4 E;  2YWQ A;  4LAD B;  3L11 A;  2BB8 A;  3BBG A;  3C4T A;  3F6G A;  3MHS A;  2ELY A;  2XP0 A;  4BS9 A;  4ZYG A;  3N9M A;  2NAB A;  1Z2Q A;  2LUQ A;  4HEI A;  3DWD A;  2MDR A;  2I13 A;  4F52 B;  2KHX A;  5LKX A;  5H9M A;  2EWL A;  2M6M A;  2VJF B;  3THN A;  1WJP A;  2YTF A;  4DV7 E;  3FAO A;  4JI7 E;  3PHD A;  4DV4 E;  5KL7 A;  2NAA A;  5TDW A;  2L8T A;  2CKL A;  1HYI A;  2YT4 A;  2ODR D;  2EM0 A;  3FAN A;  4GKK E;  1J26 A;  1K2F A;  4X3G A;  2EN1 A;  1VYX A;  3SOW A;  2FFW A;  2E6R A;  2YQM A;  2PNX A;  4O5G A;  2KR4 A;  1LDJ B;  1WEN A;  2FUI A;  2DIX A;  5AC4 A;  1HNZ E;  4WFT A;  2LT7 A;  2GLI A;  3ECR A;  5C13 A;  3GV4 A;  2PRT A;  2JOX A;  1RC7 A;  4LK9 A;  1L4S A;  3L1X A;  3RTR B;  4DR5 E;  2LV9 A;  5LMN E;  2EM9 A;  1AAY A;  4LFA E;  4B7Y C;  2CPN A;  1GZ6 A;  2HHH E;  4UP5 A;  2JP9 A;  2VPE A;  1EKZ A;  5IV8 B;  1IBM E;  1MM2 A;  1N34 E;  2LXH C;  2Y1M A;  2LRS A;  2DSM A;  2EOX A;  2YRH A;  1VFY A;  1XMO E;  1P47 A;  4ZUX U;  1WRJ A;  2EMY A;  5IWA E;  4F9C B;  2VJF A;  1PJQ A;  1WIM A;  2IQJ A;  4F9B B;  3JU0 A;  1X6E A;  5TRB A;  2KIZ A;  2DB2 A;  2CSY A;  2K7I A;  1FKA E;  5FEY A;  4R2R A;  1U6G B;  2EN7 A;  2LJH A;  2VP7 A;  2MKN A;  2R76 A;  2JMJ A;  4NXM E;  4MVT A;  4IC3 A;  2V87 A;  5AIT A;  5LCW B;  3VYY A;  4N3W A;  2WBT A;  5H1T A;  4DV1 E;  2HDP A;  2KE1 A;  2KWK A;  4H9D A;  2HGH A;  2NUF A;  5AE2 A;  2OXQ C;  2BBG A;  4DV2 E;  2EOH A;  4FIP A;  2EM6 A;  1ZU1 A;  1N87 A;  1QU6 A;  1T4L B;  4DKK A;  5SVY A;  5G04 B;  2DSY A;  2D8U A;  3FM8 C;  1X47 A;  2DLK A;  1YZ9 A;  3RPG B;  2B3T B;  4LF5 E;  5B75 A;  1HYJ A;  4Q6F A;  4V3K C;  5BR8 E;  4CCG X;  4YAB A;  2G7H A;  1A1G A;  1CHC A;  2EPU A;  2YTJ A;  3KV5 A;  2MD7 B;  2L92 A;  3PLW A;  1YYO A;  2FV4 B;  1PJS A;  1I94 E;  2EOS A;  3EQ1 A;  4JI2 E;  2LGL A;  2XOY A;  2YTG A;  5AC5 A;  5CFF E;  3LML A;  1DQ3 A;  4WX9 A;  4B3R E;  4BC9 A;  4BHW A;  3H09 A;  1FP0 A;  4I7C A;  2EPL X;  3HTX A;  5TAB A;  1ZBT A;  3J81 C;  4DR6 E;  2VRD A;  3C6W A;  2MC6 A;  1X49 A;  4NN2 A;  2YTO A;  2WCC 3;  1WEO A;  1LDK C;  2MDG A;  2RTX A;  5LKT A;  2EPO A;  3C6K A;  2F6J A;  2EML A;  2L6M A;  4R2C A;  2K17 A;  5K3Q A;  1WXR A;  4DR3 E;  1T38 A;  5A69 A;  1MBM A;  5KL3 A;  3LDY A;  2CT1 A;  2VE7 C;  3N9Q A;  1BOR A;  4I7B A;  3EPL A;  5DIN A;  3THO B;  1V87 A;  4AVX A;  3NG2 A;  5B79 A;  2EMK A;  2Y43 A;  2EOO A;  4X8W A;  2FGG A;  3T9K A;  4ZYH A;  4NXN E;  5I3L A;  2LTR A;  2B7T A;  2MNY A;  1AH5 A;  2CT2 A;  3U5M A;  2QIC A;  5B78 A;  1XNR E;  2YU4 A;  4XI1 A;  4LU9 A;  5T6J A;  2ENH A;  2NUG A;  2RSD A;  4JI1 E;  2NA2 A;  2MKE A;  5IXM B;  4JI5 E;  5LKU A;  2EMB A;  2EJ4 A;  2EMA A;  2YUC A;  2JXP A;  4IC2 A;  3HCU A;  4FK5 A;  4GNE A;  4KWY A;  1ZAA C;  4GNF A;  3BGH A;  4Q28 A;  2JM3 A;  1Z6U A;  5AE1 A;  3QG5 C;  4UP0 A;  4S3O C;  2G6Q A;  2DMI A;  2K16 A;  1PDA A;  4DR1 E;  5FLX C;  4B3M E;  1ZR9 A;  2YQL A;  2JVA A;  2ECW A;  4DMI A;  2LTS A;  5AAS A;  2UUB E;  2KKY A;  2UXB E;  4NZV A;  2OWA A;  4F1P A;  2I9I A;  5AIU A;  5A6A A;  2YRE A;  4R2S A;  4MSX A;  2ECV A;  2LN0 A;  1X6F A;  2EE8 A;  2B7V A;  2GPI A;  5A2Q C;  2NUE A;  4JI8 E;  2J7J A;  2QIZ A;  4R8P K;  1A1I A;  2YHN A;  3LQH A;  3V43 A;  4WSG A;  1N3G A;  1GTK A;  1JOC A;  2YHO A;  5LLQ A;  1Z60 A;  3HPS A;  4LTY A;  1NCS A;  5AE3 A;  4WZ3 B;  3KNV A;  4Z0R A;  4TKP B;  2JPA A;  2C2V S;  4GZN C;  2VJE B;  4L8N A;  1PJT A;  1WEW A;  2WBU A;  1A1K A;  4R2E A;  1KJK A;  2M7Q A;  3PUR A;  5J3X A;  1T4N A;  2EPK X;  2E72 A;  1WEM A; 
#chains in the Genus database with same CATH homology
 5FB1 A;  2DLQ A;  5D1M B;  2H0D B;  2EOI A;  3HTK C;  2YRM A;  3O34 A;  4L7X A;  2EGP A;  4FJC A;  1YUJ A;  1X6H A;  4F2J C;  2EOQ A;  3LRQ A;  2EOE A;  2ADR A;  4PPE A;  2EA6 A;  4R2D A;  1JM7 B;  1F62 A;  1Z1B A;  5C11 A;  2K1J A;  2KWJ A;  4YC9 A;  3ZNI A;  5TBN A;  3T6R A;  1WIL A;  2LQ6 A;  3ZYQ A;  2M3H A;  3MHH A;  3M99 B;  1E4U A;  2EPC A;  2E6S A;  5H1U A;  1TF6 A;  1MEY C;  2ENC A;  2JMD A;  4M9V C;  2DRP A;  2XB1 A;  3O35 A;  2H0D A;  2XEU A;  2ZET C;  1X5W A;  3HCS A;  2DX8 A;  3M62 A;  3EPJ A;  4AYC B;  1MM3 A;  2VPB A;  4PTB A;  2UZG A;  1G2D C;  4R2A A;  1FBV A;  2L0B A;  2MD8 C;  2L43 A;  5FB0 A;  1WEE A;  1XWH A;  5LKZ A;  1DVP A;  1JM7 A;  2ECG A;  4LKA A;  3C5K A;  2LGV A;  4B86 C;  4A0C D;  2C2L A;  4S3O B;  3EB6 A;  2G43 A;  4A4C A;  2L75 A;  1RMD A;  5KH7 A;  2YU8 A;  2MIQ A;  5KL6 A;  4A4B A;  5G0F A;  1BBO A;  4ZDT A;  1A1F A;  4QF2 A;  2YTI A;  3O70 A;  5B8D A;  3I2D A;  2LV2 A;  5G05 B;  3ZVZ B;  2YTE A;  1X4U A;  3ZVY A;  2EM3 A;  1WEP A;  2EMF A;  4N4F A;  3O7A A;  1X4I A;  4IS1 C;  2R1F A;  2EOF A;  5B76 A;  4I7D A;  2QJ0 A;  2DGC A;  1BB8 A;  1JK1 A;  4YBS A;  2EOY A;  4WZ0 A;  1WGM A;  4CA1 A;  1ZBD B;  2LGK A;  3VHT B;  2EQ1 A;  4ZQL A;  2LGG A;  3SOU A;  4WZ2 A;  5KL5 A;  2EPX A;  2VNF A;  2YW8 A;  3ZPV E;  3O37 A;  3T7L A;  1UBD C;  2YSM A;  2KFT A;  1WES A;  3DPL R;  1TN9 A;  3ZPV 1;  3U5O A;  1X4J A;  4FO9 A;  2G45 A;  2F42 A;  3GL6 A;  2EM8 A;  3SHB A;  3N9N A;  3HCT A;  3PUQ A;  2LXP C;  3VK6 A;  2EN4 A;  1VD4 A;  5DKA A;  2K4D A;  2EL4 A;  2EMH A;  3ASL A;  1JK2 A;  1TF3 A;  2YRK A;  1A1L A;  4GB0 A;  4YAX A;  2EN8 A;  3KV6 A;  1UN6 B;  2EN2 A;  5FER A;  2EMC A;  2YSJ A;  4FK5 C;  2MA6 A;  2EL5 A;  3SOX A;  3DQV R;  2EM5 A;  2EQ0 A;  2KU3 A;  3N9L A;  2HYE D;  4O64 A;  1YSA C;  2RSI A;  2M85 A;  2M1R A;  4L58 A;  2KGG A;  2GHF A;  2CSZ A;  4A49 A;  3N9P A;  2JMI A;  3IHP A;  4GND A;  4X9J A;  3MHS C;  2LDR A;  4P5O B;  3L1Z B;  2EL6 A;  2ECJ A;  5KL4 A;  2MNZ A;  4R2P A;  2YTP A;  2YUR A;  4C9Z A;  2EPR A;  2EM7 A;  5B77 A;  1G2F C;  2YTN A;  2EOD A;  3KQI A;  3UK3 C;  5H1V A;  2EPA A;  3U5P A;  2EMX A;  1WEQ A;  2VJE A;  3ZTG A;  1WE9 A;  2MA5 A;  2EN6 A;  2M9A A;  4F6M A;  2KWN A;  1T1H A;  2I50 A;  4AP4 A;  4F6N A;  5KH9 A;  2KWO A;  3O33 A;  2EM2 A;  4BBQ A;  4R2Q A;  3QZV A;  3EPH A;  3O36 A;  2EOM A;  4R2Y A;  2BAY A;  1KJK A;  3FL2 A;  2EM4 A;  2AN6 A;  4LLB A;  2LCE A;  2LRI C;  2ENA A;  3EB5 A;  4WA6 A;  3MHH C;  1YUI A;  2YT5 A;  1X3C A;  4YBT A;  1F2I G;  2FSA A;  5JG6 A;  2YYR A;  2EN3 A;  2EMI A;  3M99 A;  5TDR A;  2L80 A;  2VPG A;  4LJN A;  2YTQ A;  2MUM A;  1DGC A;  4R7E A;  2ECT A;  4YAT A;  4YAD A;  2YTD A;  4AYC A;  2ECN A;  2IDA A;  3U5N A;  2EMG A;  2ELZ A;  1LLM C;  2D8S A;  2Y1N A;  1WEU A;  4V3L C;  2YU5 A;  2D9H A;  2RPC A;  2EMW A;  2LO3 A;  4AUQ B;  2WBS A;  2ECI A;  4QF3 A;  2MKD A;  2EOZ A;  2EOR A;  5KL2 A;  3M63 A;  5KH3 A;  2VPD A;  4GNG A;  4W4U A;  2L5U A;  2EQ3 A;  2EPP A;  1B69 A;  3LQI A;  2EMZ A;  1A1H A;  5D1K B;  3EPK A;  2YSO A;  1IYM A;  2A25 A;  2FUU A;  2CTD A;  2KYU A;  5EYA F;  4IJD A;  2F6N A;  2EOJ A;  4YBM A;  4UI9 B;  1G25 A;  1WFK A;  2EPZ A;  3RPG C;  2CKL B;  1A1J A;  5D1L B;  2RI7 A;  2EP3 A;  2KGI A;  2LVH A;  2JRJ A;  2KRE A;  2MT5 A;  1WEV A;  3LQJ A;  2YSP A;  2PUY A;  2CSH A;  3N9O A;  4LAD B;  3L11 A;  2BB8 A;  3MHS A;  2ELY A;  3N9M A;  2NAB A;  1Z2Q A;  2I13 A;  4F52 B;  5LKX A;  5H9M A;  2M6M A;  2VJF B;  1WJP A;  2YTF A;  3PHD A;  5KL7 A;  2NAA A;  5TDW A;  2CKL A;  1HYI A;  2EM0 A;  1K2F A;  4X3G A;  2EN1 A;  1VYX A;  3SOW A;  2E6R A;  2YQM A;  2PNX A;  2KR4 A;  1LDJ B;  1WEN A;  2FUI A;  2LT7 A;  2GLI A;  5C13 A;  3GV4 A;  2PRT A;  4LK9 A;  3L1X A;  3RTR B;  2LV9 A;  2EM9 A;  1AAY A;  4B7Y C;  4UP5 A;  2JP9 A;  2VPE A;  1MM2 A;  2LXH C;  2Y1M A;  2EOX A;  2YRH A;  1VFY A;  1P47 A;  4ZUX U;  2EMY A;  2VJF A;  1WIM A;  1X6E A;  5TRB A;  2KIZ A;  2CSY A;  5FEY A;  4R2R A;  1U6G B;  2EN7 A;  2VP7 A;  2MKN A;  2JMJ A;  4MVT A;  4IC3 A;  5AIT A;  5LCW B;  4N3W A;  2WBT A;  5H1T A;  2HDP A;  2KE1 A;  2KWK A;  2HGH A;  2OXQ C;  2EOH A;  4FIP A;  2EM6 A;  1ZU1 A;  1N87 A;  5G04 B;  2DLK A;  3RPG B;  5B75 A;  1HYJ A;  4Q6F A;  4V3K C;  4CCG X;  4YAB A;  1A1G A;  1CHC A;  2EPU A;  2YTJ A;  3KV5 A;  2MD7 B;  2EOS A;  2LGL A;  2YTG A;  4BHW A;  1FP0 A;  4I7C A;  5TAB A;  2VRD A;  3C6W A;  4NN2 A;  2YTO A;  2WCC 3;  1WEO A;  1LDK C;  2MDG A;  5LKT A;  2F6J A;  2EML A;  4R2C A;  2K17 A;  5KL3 A;  2CT1 A;  3EPL A;  3N9Q A;  1BOR A;  4I7B A;  5DIN A;  1V87 A;  4AVX A;  3NG2 A;  5B79 A;  2EMK A;  2Y43 A;  2EOO A;  5I3L A;  2MNY A;  2CT2 A;  3U5M A;  2QIC A;  5B78 A;  2YU4 A;  4XI1 A;  2ENH A;  2RSD A;  5LKU A;  2EMB A;  2EJ4 A;  2EMA A;  2YUC A;  4IC2 A;  3HCU A;  4FK5 A;  4GNE A;  1ZAA C;  4GNF A;  1Z6U A;  4UP0 A;  4S3O C;  2G6Q A;  2DMI A;  2K16 A;  1ZR9 A;  2YQL A;  2ECW A;  4R2S A;  5AIU A;  2YRE A;  4MSX A;  2ECV A;  2LN0 A;  1X6F A;  2EE8 A;  2J7J A;  2QIZ A;  4R8P K;  1A1I A;  2YHN A;  3LQH A;  3V43 A;  4WSG A;  1JOC A;  2YHO A;  1Z60 A;  1NCS A;  4WZ3 B;  3KNV A;  2JPA A;  4TKP B;  2C2V S;  4GZN C;  2VJE B;  1WEW A;  2WBU A;  1A1K A;  4R2E A;  3PUR A;  5J3X A;  2E72 A;  1WEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...