1RMU1

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNYFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 43
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rmu100
1RUG1 1BBT2 1AYM1 2XBO1 4CEWA 2BPA2 1NCQB 1FOD3 5ACA1 5L7OC 4RR3B 1ZBE2 1MQTB 2ZZQA 2RS51 1QJU1 4Q4Y3 2RS11 4CDQA 1EV13 5BNNC 3VDDA 2BUKA 4RQPA 4CEWB 1BEV3 3JD73 2RS31 1W39A 5FMOL 1TME3 1MEC2 2RM22 1AR73 1RUC2 5FMOS 3VBSB 2HWF2 2X5IA 1TMF2 4IV1A 1R1A3 1HRI1 1VBD2 4CDQB 3VDDB 1C8M3 2RMU1 1ND2A 4RQPB 1VRH3 1PIV1 1V9U2 4QPGC 1E57A 1VBC2 1PO11 2RR11 1RUH2 5DDJ1 1PGW2 2WZR1 1RUG2 1Z7S3 2X5IB 1PO21 2HWE2 4IV1B 1ND3A 1ZBA1 1QJY1 2R042 3ZFGB 1ND2B 2PLV1 3TN92 1NA1C 4FTEA 4CEYC 1RHI1 5ACA2 4N53C 4CDXA 5K0UA 5ABJA 5BNOA 4Z92B 4IV3C 2WFF2 1ND3B 4Q4V1 4RS5C 5BNPA 5FOJB 4CDXB 3NAPC 2HWC1 3J8F1 5BNOB 5ABJB 5K0UB 1HRI2 3VBOC 4GB31 2WLPA 3VBRA 4YVSC 1QQP2 1HRV1 2HWB1 3VBHC 5CFDC 1F8VA 5BNPB 1D4M1 1AYN1 1RMU3 5DDJ2 1FPN2 3ZXAC 3ZFEA 1H8TB 4RFT0 1NCRA 4CDWB 1AR62 3VBRB 2PLV2 4AEDC 4Q4X2 1HXS1 1VBE3 1CD3G 5C8CC 1X33A 1K5MA 2R061 4GH4A 1RUE3 1AR92 1NCRB 1EAH2 1QJX3 1ZBE1 1R091 2TBVA 2ZTNA 4RHV2 1VBB1 4JGYA 1RVF1 2MEV2 1VBA3 1K5MB 3JB8A 5LK7B 4GH4B 5D8AA 4FTBA 2FZ1A 1MEC1 1COV3 2HWB2 2RM21 2WS92 2HWD2 1TMF1 4Q4W3 1FOD1 1RUJ3 1PVC2 1VAKA 4CDWC 4JGYB 1VBC1 1RUH1 1RUI2 4QPIC 5D8AB 3JB4C 1WCDJ 2DF7A 4JGZA 5J98B 2HWE1 1RUD2 1BEV1 1C8NA 1NY71 1VBA2 4NWWA 2R041 3TN91 3VBUC 1A6CA 1TME1 2R062 1AR71 1FMD2 3CJIC 5C9AC 4NWVA 4N43B 1C8M1 1AR83 1R092 4GMP3 4JGZB 2WFF1 1RUF3 1VBB2 1RVF2 1POV3 1PGL1 3ZFFC 2GH8A 4PDWA 4FSJA 4BCUA 1FOD2 1QQP1 2BFUL 1IHMA 3VBFC 2BFUS 4Q4Y2 2R073 1FPN1 1EV12 5A32A 1AYM3 2XBO3 1BEV2 3JD72 1NY72 1AR61 4PDWB 1NCQC 4CDUA 4Q4X1 1TME2 1AR72 4RR3C 1MQTC 1R083 4N43C 2RS53 1R1A2 2RS13 1C8M2 5A32B 1VRH2 4WM7A 3HAGA 5GKAC 4CEWC 1AR91 1EAH1 2RS33 4CDUB 1RMU1 1AL23 3VBSC 1Z7S2 1PGL2 4RHV1 4CDQC 1ASJ3 4WM8A 2MEV1 3VDDC 2RMU3 4RQPC 4WM7B 2WS91 1PO13 2RR13 2HWD1 2IZWA 4YVWA 2WZR3 2X5IC 5A33A 3DPRA 1PVC1 4IV1C 1NOVA 1ZBA3 4WM8B 1QJY3 3ZFGC 1ND2C 1AL0G 5JZGA 1RUI1 1RHI3 5C4WA 2QQPA 1RUD1 1OOPA 4YVWB 1B35A 1VBA1 2GSYA 5CFCA 3DPRB 1ND3C 3ZFEB 1FMD1 3JBG3 5JZGB 4Q4W1 1RMU2 4GMP0 4CDXC 5C4WB 1F2NA 2HWC3 1OOPB 1B35B 5ABJC 3J8F3 5BNOC 5K0UC 5L7OA 1POV0 5CFCB 1VB2A 1RB8G 1VBE2 1HRV3 4SBVA 5BNNA 5BNPC 1D4M3 3S6PA 1X36A 1RUE2 1H8TC 1QJX2 5L7OB 3VBRC 4Q4Y1 1OPOA 4GMP1 1HXS3 1EV11 5BNNB 1BBT3 1QJZA 3JD71 4QPGA 1POV1 3ZFEC 1BMV2 1NCRC 1NG0A 1HX6A 1COV2 1ZBE3 4Q4W2 1R1A1 5J96B 1RUJ2 1VRH1 1NA1A 4CEYA 5AC93 2Y26A 4QPGB 4N53A 2R071 1K5MC 4GH4C 1MEC3 2RM23 1RUC3 1Z7S1 4IV3A 2HWF3 1TMF3 4RS5A 1VBD3 1NA1B 2BBVA 4CEYB 1R081 3VBSA 1V9U3 4N53B 4JGYC 3NAPA 2XPJA 1VBC3 1RUH3 5D8AC 1AR82 4IV3B 5AC92 1RUG3 3VBOA 2HWE3 4YVSA 4RS5B 3VBHA 5CFDA 1AUYA 1RUF2 2R043 1AL21 3TN93 3NAPB 5ACA3 1ASJ1 1QJU3 3ZFGA 4JGZC 3VBOB 2WFF3 4YVSB 4AEDA 3VBHB 5CFDB 5C8CA 1GFF2 2R072 1AYM2 2XBO2 1HRI3 4AEDB 1QQP3 1VBE1 1PIV3 3IDEA 1R082 5C8CB 2RS52 1QJU2 2RS12 5DDJ3 1FPN3 4EJRA 4LLFA 1RUE1 1QJX1 1PO23 3JBG1 2RS32 1AR63 4PDWC 2WWSA 1AL22 2PLV3 4Q4X3 4Y5Z0 1M06G 1H8TA 4CDWA 4FTSA 1ASJ2 2RMU2 1PIV2 5A33B 4QPIA 1BMV1 1AR93 4Q4V3 1EAH3 1COV1 1PO12 2RR12 4CDUC 2WZR2 1RUJ1 3VBUA 1PO22 1CJDA 1ZBA2 2VQ0A 4RHV3 1QJY2 1HQNA 3CJIA 5C9AA 2MEV3 4WM7C 4QPIB 3LOBA 4GB33 1OHFA 1RHI2 1BBT1 2HWB3 2ZAHA 2WS93 2HWD3 3M8LA 1AYN3 3VBUB 4Q4V2 1PVC3 5C9AB 1SMVA 3CJIB 3JBG2 4WM8C 3ZFFA 1RUI3 1AR81 2HWC2 5AC91 1RUD3 3J8F2 4YVWC 1DDLA 1RUF1 3VBFA 4GB32 3DPRC 1HRV2 2R063 1RUC1 1FMD3 2HWF1 3FBMA 1D4M2 3ZFFB 5JZGC 1VB4A 1VBD1 1AYN2 5C4WC 1R093 1NCQA 1OOPC 2FZ2A 1V9U1 1B35C 4Y4YA 4RR3A 3VBFB 1MQTA 5CFCC 1VBB3 4N43A 1RVF3 1PGW1 1HXS2
chains in the Genus database with same CATH superfamily
1DU3D 1RUG1 2JKXA 1JHJA 1GWLA 3V0AA 1WW6A 2QQIA 2R0HA 3ZPYA 3T1LA 1S1AA 1UMHA 3GHMA 4K9SA 1O4TA 1QHDA 3DCQA 5FUIA 2P17A 2CWSA 1DQ5A 1JTZX 1NCQB 2BZDA 3HVDA 5L7OC 5FYMA 4RR3B 3N9LA 2CY6A 5IK4A 1OUSA 4QHOA 3J26N 4FXKB 5FP9A 5FO9B 4CDQA 1YQCA 3VDDA 1VLNA 4HK9A 1QEXA 1SLAA 2W52A 1ZRFA 1CAVB 3WEZA 2VW2A 4Q1RA 2PA7A 2QE3A 2BVVA 4PQQA 4Y5SA 5FMDA 5IHRA 1OQEA 1SBDA 3ST7A 3VBSB 2VECA 1RUC2 3NJXA 4Y4RA 3NV2A 1JZ7A 4LHNA 3O1MA 4IV1A 4LXLA 1R1A3 2GNBA 2YPJA 3I3MA 2FDJA 5HCHA 4MHRA 2IXCA 1W6OB 4RQPB 4CUCA 3VD7A 5LZ6A 5FP3A 1V9U2 2YC2A 5APAA 5I93A 3AMMA 3FE5A 3KM5A 4QPGC 2RR11 1W0OA 3THDA 4XDPA 1JI6A 1V0AA 3OGSA 1F4AA 5FK7A 3H7YA 3K75B 4JKMA 1JUHA 5FXVA 2X5IB 2WQ4A 1I5ZA 1H9WA 1ZBA1 3MPBA 4FPYA 4A6OA 1O7FA 2RJ2A 4XJWA 4P9YA 5ANNA 1ND2B 3KVBA 2ETEA 3NJZA 4LUKA 2VVEA 1OPMA 3MIBA 3Q8BA 1X50A 2VMDA 4IGQA 2ZGSA 3VZKA 5B4NA 5JAXA 2PHDA 3O1VA 3TEYA 4B4QA 4M3CE 1W06A 5DABA 4Y26A 3MW3A 4M00A 3H9AA 3T2QA 2H0BA 4W6XA 2JXAA 2XL9A 2QVSB 1OFSA 3RRDA 1WW7A 4CDXB 4GWJA 3NAPC 4GALA 4CU9A 3J7MA 3N7LA 4L92A 4MGZE 4A41A 2OT7A 5FY7A 4UAPA 3J8F1 4KI5M 1W6MB 1KITA 3NJVA 1UU5A 3CHXA 3KV6A 3LIHA 4GB31 2ADDA 2VTXJ 2K9ZA 1HRV1 3VBHC 3CNAA 5C3RA 1F8VA 5BNPB 1UPSA 4V1PA 4CP1A 1T2XA 5FLIA 5KHIA 3LDKA 3MHZA 3GALA 5FY5A 1S0BA 3ACFA 1CAUB 1MS8A 3I3DA 3WNLA 3BOWA 1OVPA 3WNKA 3IKWA 3ZXAC 1CGPA 2VMEA 4YW2A 5IVVA 5FUPA 4ATFA 3SNMA 3A7QA 1J84A 4QM9A 4IEZA 1O3QA 1PGSA 2EALA 2JDUA 4YZ2A 4FP2A 3AKPA 1TNRA 2JIGA 2O8OA 4IEPA 4BYYA 3DKWA 3KF5A 2EIGA 4LBQD 5IVEA 3WOGA 3HN1A 1LTEA 1GNYA 1X33A 4LHLA 5I0UA 4C0HA 3LA3A 5FPBA 1NCRB 4XXAA 5DZFA 4Q0SA 3H7JA 1GP4A 4JX0A 4MGKE 1UMZA 3W20A 2JDAA 2PFWA 3WUCA 4LE3A 1MR5A 4BWOA 5JVVA 4KU7A 5F5IA 4ZU5A 4OQ9A 1IG3A 1ULGA 4XYXA 3SITA 3VHNA 1ENSA 1XYNA 3RZMA 4I0WB 4QX7A 4AQSA 4QKNA 2W1UA 2XG3A 1RVF1 2MEV2 3ZDVA 3JB8A 4BQ1A 4MYEA 2YGMA 1N1YA 3RMYA 2PYTA 3RNSA 2FDFA 3KHBA 4P9JA 1MEC1 1FATA 4QX3A 2VMGA 2WS92 1J58A 1XXNA 2P34A 1OT5A 4ASLA 5T5JA 4XHBA 1RUJ3 4XFIA 1IPKA 1VAKA 2YY1A 2WUHA 2Y64A 3OPZA 2ZA9A 1VBC1 1K12A 3AP6A 1LJ7A 1PNGA 2VL4A 2I74A 3WF1A 2JB8A 2W91A 1RITA 4NIIA 4JKKA 1MS0A 2VBBA 2OX0A 4QX8A 1IS4A 1LU2A 4QD2A 4OVEA 4ORFA 1IOAA 2E26A 4IETA 1H9PA 4ZZ8A 1UO9A 2R062 2OIIA 2A75A 5C9AC 5C71A 1AZDA 5J3UA 3LDRA 4Y3OA 1OC1A 3JUUA 4H14A 3OBZA 3J4UH 3AVSA 2AEZA 3ZXDA 3V0AB 1ONAA 2D6MA 3LB9A 4FO9A 4YFWA 3SCFA 2VNVA 4E27A 1KXGA 1RUF3 3CIHA 4ARYA 1S0EA 5FQ0A 3GDBA 1POV3 3AX4A 1OD3A 3MF6A 2YC4A 3ZFFC 1W99A 3HWJA 1W8HA 1ZZ6A 5C3SA 3NNGA 4FSJA 5KR7A 3ETQA 2EIEA 3Q8AA 4TLFA 3AZYA 5C3PA 1LKNA 2ZGRA 3KZ4C 2WWJA 3PU3A 4MXWB 2R073 3I2JA 4LNVA 5EZWA 1FPN1 4OCTA 4AI3A 4Z2WA 2VM9A 1CAXB 1N1VA 4PDWB 1H2LA 1YQ2A 3ILNA 4JZRA 4CDUA 4MLOA 4Q4X1 4XHXA 1MPXA 1S0FA 3HNYM 3QH6A 4KH9A 3GCWA 3FC0A 3PTYA 4M0HA 1R083 2R1BA 2XKOA 2OVUA 5SV5A 2GNTA 1ENRA 2RS53 1N3PA 4NPLA 4YWAA 2IC1A 4J25A 3T08A 1U5YA 3M7AA 5FZ0A 1VRH2 5FYZA 5GZCA 3V0BA 2VQUA 5FY1A 1TNFA 3MFCA 3KCXA 1LNSA 5TSWA 2I07B 1GYKA 2WDBA 4ZY9A 5F1RA 3VN4A 1AXZA 5L9BA 1PGL2 1Q8PA 3GJAA 3JCIA 4P02B 3UV9A 3IMNA 1VMFA 1ZM1A 2WQ8A 5FJKA 4D0QA 1NE6A 2C5DA 2ZX0A 2ZGNA 1ASJ3 1DYKA 5GM0A 3S0MA 3A4UA 3ELNA 2EVXA 4GJZA 4LITA 5DAVA 4YW7A 3O1OA 4AI9A 4KWJA 1XYOA 3HN3A 4G4FA 4AVCA 3W58A 4EQVA 2F17A 4CXWA 3T0DA 4XF4A 4EE2A 4FQZA 1ZX5A 5CG8A 1OQ1A 3DPRA 5FP8A 3UGFA 4I09A 1W6NB 1D2QA 2UWBA 4E2QA 3MZHA 5JZGA 3FLRA 1AXKA 1RUI1 3BN6A 2W92A 4MGYE 3VL8A 2CGNA 2AENA 3HT2A 5C4WA 1SEFA 4KG0A 5F6LB 5DZGA 5FYUA 2GC3A 4K1YA 4OHXA 4XIOA 2ZEXA 1I6XA 2WNOA 1LHWA 5C70A 1KS4A 1ND3C 1ZZBA 4D69A 5F39A 3E97A 3WW4A 4EN7B 1VJ2A 1W3VA 4XF3A 1WMXA 2VAUA 4ATEA 3IM0A 5IVBA 3DXUA 2C9AA 2VOVA 2Y6JA 4LBMA 3Q9OA 1S2KA 3DL3A 5FDBA 2YBSA 3EO6A 2HWC3 2JECA 1QNWA 3VKMA 2VVFA 2J42A 1B35B 5FTTC 5ABJC 4KGQA 1F31A 4LO5B 3V64A 5J48A 3DYPA 4LKDA 3GF6A 4Q26A 3ZXFA 1PK6C 5EYYA 1SLIA 1OXCA 3VDAA 4PQ9A 3KSCA 3M3QA 1RB8G 4XJZA 1S0GA 4BLIA 3KCYA 5IW0A 1LECA 5FRAA 2ZGPA 4YW4A 1D4M3 4I3GA 5BUVA 1G7YA 4XXPA 3AKSA 3ES4A 1YRZA 3S6PA 5FZKA 5FIXA 1RUE2 1LAJA 1H8TC 1QJX2 3EMRA 5C3OA 1RXGA 3AZWA 2XDVA 3ZXJA 2IFWA 3BOPA 4CCNA 1D7PM 5AFEA 1J83A 3ZMOA 1OPOA 1NQDA 4C91A 1EV11 4DXZA 3NO8A 1XB9A 2P4EA 3H1YA 4GQ7A 4QQ2A 5BNNB 3VDBA 1FNYA 3ETPA 3QD6A 1QJZA 4KBZA 2VNOA 2Q8DA 3N9MA 3JD71 3IDBB 3RJ2X 1C5HA 3OUIA 4EWEA 1G9BA 1POV1 4LE4A 4EN6B 1NXD1 4S2GA 1M4WA 2XVGA 2AYHA 1ZBE3 2KD7A 4QMAA 3VKLA 4F83A 5F3CA 1MVEA 1OH4A 3FBYA 3JQWA 4Q4W2 4BMBA 5I8TA 4OZXA 1H6YA 3R6SA 1KJLA 5AC93 1TEIA 5LBBA 2ZX1A 2R071 1K5MC 3SCGA 4UW5A 1IS3A 4YG0A 2ZHLA 5IVYA 2RM23 4IV3A 4M3CF 4QHZA 1V6OA 5GLVA 4DIQA 1OLRA 3N7KA 5KHKA 3OUHA 3VL9A 2BW8A 4XAEA 1XE8A 4Q8LA 4FBFA 3O0WA 1R081 1OD5A 1UYZA 4AI0A 1Y7BA 4BXFA 2LRPA 3UKTA 1W2TA 1RUH3 1G86A 4LBLA 4UFIA 5FQ0B 4MHUA 1IKPA 1OKQA 4D6RA 3BALA 2DTYA 5F5AA 4C0BA 1OVSA 1W2UA 2HWE3 2WYFA 4JQRA 4RS5B 3UKVA 4BLJA 1QH6A 3NNMA 2AH2A 1KFUL 2R043 3KVAA 2GN7A 3RYRA 4QT6A 1HKDA 3WNOA 1QMJA 3H0OA 5A7SA 2VY0A 1UZVA 5ACA3 3KQRA 2JDKA 5F5QA 1WKYA 4KNCA 5FYTA 1ASJ1 5FZ9A 4DY5A 3BTYA 4AHZA 4PF5A 4JGZC 1LOCA 5FXZA 3UYJA 1WW5A 2ZHNA 3KHCA 2WFF3 4YVSB 1W6QA 4IDZA 4I30A 4Q1PA 5DQ0A 5CFDB 1W9WA 2CGPA 4JDOA 4NHKA 3RFRA 1Q8QA 4E4DX 4RSUA 5C8CA 1GFF2 3PIJA 1HLCA 4O7XA 1GOGA 2WIIB 1CZTA 5DAQA 3BTAA 2YG0A 2BJSA 4G3YC 2PTMA 2XXZA 3FMGA 2UWAA 4X8PA 3DUIA 1DG6A 4PJYA 4HT1T 4NROA 5LA1A 4AEDB 1JUIA 1QQP3 1UOGA 1PIV3 2ET1A 1DGWX 1WCUA 1XE0A 3MEPA 3N35A 5JMCA 4E9KA 3ACGA 5DDJ3 4LK7A 3ZOIA 2R30A 3GM8A 4E2SA 2C0ZA 2ZEWA 4NMIA 1O91A 1PO23 1SLCA 2IVJA 2VQTA 2VOKA 2IXHA 3PUAA 1HB2A 3NMBA 1AL22 2PLV3 4R9CA 1J3RA 1UL9A 2Y34A 1BXHA 1VALA 3JXSA 3M3OA 3JU9A 3AFGA 2IWGB 1OF3A 4LEJA 5T55A 1M06G 2LROA 3WP4A 4CDWA 4FTSA 3WP6A 2W1QA 2WINB 5G04L 3TEWA 1OH3A 1VPHA 1QY4A 3POEA 5KXEA 5EV7A 4DUVA 1JHNA 2H6BA 2RR12 5T52A 4P00B 5LRRA 5KHGA 5A7OA 2D3RA 2JENA 2GNDA 2AR6A 4Y24A 4IEWA 3VBUA 4XUOA 1ZBA2 1GNHA 4RHV3 1HQNA 3CJIA 5FPXA 4OI1A 2E7TA 3H50A 3LPGA 4I3PA 4JRLA 4QPIB 4YGEA 1W9YA 1PZ9A 1QH7A 2VW1A 3FN9A 4LKEA 4Z82A 4WZCA 1QF3A 5DAPA 3MIDA 4HVRA 1O8SA 4JQTA 4HSJA 1CAWA 1AYN3 3TNQA 1JMUB 4LULA 1UXZA 4H7LA 1AF9A 2XUEA 4FOWA 3WDVA 1HW5A 3DV8A 2XGXA 1E5SA 5T5OA 2W1SA 5HCAA 4YM2A 1JYXA 2J1EA 2DCJA 5IATA 1AR81 3AMPA 1CVNA 4HKOA 4L97A 5AC91 2QZ3A 1O4YA 2PHRA 4OUMA 3J8F2 1W9TA 4YVWC 1TG7A 5KWRA 1J3QA 4OHWA 4N9IA 4LKFA 3VBFA 4LO4B 4GB32 4UFKA 1JU3A 1HB3A 3WW1A 1HRV2 2R32A 3P3PA 3DECA 5CVRA 1FMD3 3EBRA 1XNBA 1VB4A 3NKGA 2JG8C 2VQAA 3I2HA 2VOXA 2Z4FA 4COYA 1UIKA 1R093 2QDNA 1NCQA 3M4FA 2VMHA 2FZ2A 3WV6A 3WDXA 4RR3A 4YRDA 2FQPA 3GJBA 5CFCC 1VBB3 1DGWA 4B4PA 1LGCA 4LT5A 2W39A 3K4DA 1H6XA 4R9AA 4D7SA 2WN3A 2J1SA 1AYM1 3H8XA 5FCCA 4P9IA 1CAVA 2RJLA 4R4ZA 5SV8A 4AFCA 1YIFA 2WRAA 2BPA2 2ZGQA 1FOD3 4LA3A 5ACA1 4LBOA 3LEIA 1MQTB 2ZZQA 2W2IA 4AF9A 5LWBA 2R7EB 4XDOA 2N7GA 4Q4Y3 5FFOC 5GLWA 1GNZA 3DEMA 4ZS3A 2ENRA 4BH9A 1W6OA 4RQPA 1WLCA 1YQ6A 3DF0A 4CEWB 3APBA 1BEV3 4LBKA 2RS31 1OI6A 5CIRA 1MZ6A 4BDVB 2KM2A 2WL1A 1TME3 1MEC2 2PHFA 1AR73 1OFNA 2QZ2A 2VZOA 5GZEA 1CZVA 2HWF2 2WNUB 2X5IA 5L36A 2VPVA 2YBPA 3AXDA 1VBD2 2VZPA 3OEBA 4BMEA 2DYCA 2VUAA 5DUVA 4R9DA 2BDRA 1C8M3 3JZVA 1ND2A 4XBLA 5FPVA 1PIV1 4PT6A 2CAVA 1O59A 3AZVA 1VBC2 3CBNA 5GLTA 1PO11 1GP5A 2CU5A 2ZHKA 1PMIA 1P8JA 5DDJ1 4AI8A 3L2YA 2E33A 2VMCA 2WO3A 4XAAA 1UY1A 2WZR1 2OPKA 1GUIA 3GCXA 4Q5OA 1Z7S3 2LUWA 5A80A 1PO21 3GNEA 2CHHA 1SZBA 2ADEA 5FBJA 3A0KA 2QFEA 2NYYA 5DPNA 2PLV1 3C7GA 2WNEA 1NA1C 4SLIA 3WXPA 4CEYC 5IK8A 2NM1A 3LSDA 1W6QB 2W87A 3Q8FA 4N53C 4CDXA 1GSLA 5HCFA 3ZIWA 1X7NA 4GZ9A 2WJSA 2BOIA 1GANA 2CNAA 2NMOA 3LEGA 3OY8B 3LOIA 1W6MA 4XQ4A 3HQXA 4AOCA 5FPAA 4Z92B 3HNMA 1X82A 1Q3EA 4IW3A 1N1TA 4W6WA 1C28A 1NXMA 2ZMLA 4LHKA 5FZOB 1RINA 4AHXA 2VNRA 4CP9B 1C4RA 5BNPA 3LWCA 4HXCA 1FV2A 3I2KA 1XQNA 4QAWA 3WG1A 1CAUA 4DRVA 2BNMA 1W0PA 2ZEYA 4XFFA 3ZYHA 5K0UB 5BNOB 1HRI2 3HJRA 5FZMA 2X10A 4LMFA 1DZRA 1FT9A 4CZSA 4QB6A 2EAKA 3VBOC 2F4LA 4J1WA 2V5YA 3KV5A 2ZGLA 4NPRA 1LENA 4OI4A 1AYN1 1FPN2 3T3YA 3PDQA 1DLCA 2SBAA 1WCSA 5E1RA 2HYKA 5E89A 3ZFEA 4PCRA 2Z42A 2A6YA 1ZRDA 1NCRA 4CDWB 1SHWB 3VBRB 2AZ5A 5FYYA 2FDHA 4Q4X2 5HPOA 1CQ9A 2D6NA 1SLTA 1VBE3 4TXWA 1CD3G 1IG0A 2Q4SA 5LEKA 4MG2A 3TOJA 1QIQA 1VE0A 3MUZ1 4CU8A 1XNAA 2DURA 1BKZA 2YPDA 4E8DA 3NQHA 3HEIA 3PVNA 2BGPA 5J1XA 5A3NA 1O3TA 1I5PA 5JIUA 1YCIA 3D4KA 4COZA 1LHUA 2JDYA 3GXUA 5DUUA 3THTA 4I2OA 1R091 2WA3A 3OBAA 4BISA 2GP3A 3MV11 4XF0A 2WBKA 3RQ0A 2BNNA 4EYUA 2RHPA 3S7EA 5JCTA 2BQPA 2KXLA 2UWCA 1VBB1 3D82A 5FMBA 5GJ6A 5KC5A 1JZ5A 5LK7B 2ZMNA 5FYIA 4GH4B 1LOGA 3N7MA 2WZ8A 1T6BX 4LO8A 4M4RA 3BIEA 4FTBA 2JICA 3RZLA 2HWB2 1COV3 4XACA 4L9BA 4NIGA 4DS0A 4CCKA 3A21A 2FCUA 3ZXEA 1TMF1 3ZYGA 3RZHA 5FXWA 3BPSA 1SCSA 2A70A 3B02A 3CJXA 3FLTA 4HVOA 1FOD1 2GAUA 4H3WA 4BQ3A 2BOJA 5DAWA 4JGYB 4EWDA 2RJKA 3W9AA 5F9TA 1JZ3A 1RUI2 4L8QA 5D8AB 4ZKTB 4Z2AA 3FLPA 1WCDJ 3OG2A 4PF1A 1BEV1 1C8NA 4QDQA 2W1WA 4P08A 2B42B 1WCQA 3WZ1A 2VNGA 3TN91 3UGGA 5CADA 4AVVA 1TME1 4BQXA 1AR71 4HOOA 4LLOA 1EPZA 5L9RA 1LHVA 3POFA 4LUMA 3R4DB 1H0BA 1YJLA 1C8M1 2DBIA 2NLRA 2BU9A 2JG9C 4AGVA 3C2UA 3O1UA 4ASMB 3GBWA 1VRBA 2GMEA 2JKBA 1PZ8A 3KQ4B 2ZACA 3P3NA 3KCCA 4UWDA 2EXJA 1CR7A 4GWIA 4MXWA 1N3OA 2DUPA 1K3IA 2GH8A 3N3HA 4Y22B 2D93A 1YEWA 2D3SA 1L7LA 4NAMA 1CAXA 1DGLA 5CKNA 4PDWA 2SLIA 3LCPA 1LRHA 4BCUA 1JS9A 1W2NA 2YYOA 4GAZA 3I59A 4UFMA 1V6IA 2EA7A 2QCSB 1HDKA 3WNMA 1G9DA 2PHUA 1DP0A 1UKRA 1UZYA 1EV12 2AEYA 3P1IA 4YG6A 5JOWA 3PJYA 3OGVA 1BYHA 4DEVA 3ZX7A 4S2FA 3K51A 1MZ5A 2XBO3 3JD72 1NY72 1HB4A 1AR61 2P37A 4XURA 4N90A 2WNVB 4YSFA 1OURA 3NWKA 3PUSA 5CKMA 2FMDA 1DFQA 5I0DA 2XHKA 4FPOB 5CG9A 3LEMA 3N4MA 2RS13 4CCDA 4FXGB 2GALA 3KMHA 3UT0A 4COUA 2D6LX 2D7FA 3WQBA 3H42B 4XW3A 4X6QB 5GKAC 1AR91 4IL7A 3TEZA 1EAH1 5LASA 2Y0OA 4XFHA 2A1XA 4KBBA 4XE9A 2K2SA 4INDA 4HONA 2OZ6A 5FY0A 4BM8A 1W3XA 1GZ9A 4CDQC 4M0NA 2XWBB 1UYXA 1W6NA 2Y6FA 3ZR5A 2D97A 2ZGTA 4L0PA 3VDDC 2RMU3 1GICA 2B46X 4WM7B 1BK1A 4TWTA 4BIOA 5L73A 4A4AA 1RXFA 2ZMKA 4QX5A 3BODA 5FPLA 5JR7B 4B8EA 2KA3A 2Q30A 1JZ4A 2DWRA 2HWD1 1ULCA 4FT8A 3IN9A 4NE9A 3NNFA 4IEXA 1A8MA 2JB4A 5I0SA 1UF2C 4Y1XA 4FOQA 4IV1C 1PVC1 3RS6A 4AQ6A 1APNA 1QJY3 4WM8B 3ZYBA 3ZFGC 3AP4A 1AL0G 1D4VB 4LPLA 4MGTA 4J6GA 1JOBA 5IYYA 4AVSA 1FX5A 4AG4A 1RHI3 4AGGA 5BV6A 3RWNA 2QQPA 3CO2A 3B93A 4Q29A 5FZAA 2I45A 1RUD1 2XJTA 1B35A 3E6BA 1U5XA 2QQOA 4LIUA 3NVCA 4YW1A 3LE0A 3ZFEB 3OGGA 2DCZA 4YNIA 3JBG3 2C6SA 4UF0B 4ET7A 1UY4A 2X09A 4XCAA 1RMU2 2YDEA 5F32A 4GMP0 3AYDA 4MGSA 3LD8A 3EJKA 1OOPB 3FFQA 5A6QA 2VOWA 4AFMA 4OULA 5JMOA 4ONUA 2LALA 1W8UA 1W05A 2J1AA 4CUGA 1RUNA 3OBTA 2DUOA 2OW4A 5EYXA 1NLRA 2BGOA 5FPUA 4SBVA 5BNNA 4P9XA 3POYA 4Z1VA 1UZ0A 4NHYA 2ZKLA 1UY3A 1X36A 2K46A 4U2AA 3H8OA 2RDRA 1YFXA 5L7OB 4IESA 3OCPA 4YW6A 4FFHA 2G9FA 1HXS3 1WBLA 2W47A 1ENQA 3PNAA 1KDKA 5FV3A 3ACIA 4K8RB 5A3MA 1GLHA 1HQLA 2EXHA 4PLNA 5DZEA 4AXOA 1PZ7A 1Q8VA 2PAEA 2UYAA 4A2UA 1NG0A 3ZYJB 3PUIA 1IPSA 4CCOA 1DZQA 2QKDA 1Z78A 3R0RA 1R1A1 5LRSA 2IFRA 2BRTA 1MACA 3IMMA 4PIYA 4AVBA 3I2OA 1W8NA 3QOPA 3ES1A 3OD0A 2LTNA 3ZKYA 3MBWA 4QPGB 4V2WA 2R49A 2UY8A 4FQ4A 4OLLA 1S4CA 2ZBJA 2XJPA 1MS9A 3MPPG 4KWUA 4QQHA 5FY9A 4ARXA 5LEJA 3DXTA 4MVTA 4BQ2A 3ZSKA 1RUC3 1S0IA 2QQMA 3RJRA 4H7MA 2VXJA 4XCBA 3I3QA 3PJQA 3CU7A 4RS5A 4ES8A 1IKQA 2L9LA 3MLJA 4KQ7A 2VW0A 4LOSA 5LA2A 2BBVA 4OUEA 3POIA 2JDHA 3VD9A 1V9U3 4LBQA 4QHBA 2GMMA 4OI0A 3HMYA 2VUDA 3M3EA 1AR82 3OD4A 4CUAA 5AC92 1LGBA 3B3QE 4YVSA 3ILRA 3ON7A 4NR1A 5J37A 5CFDA 1AUYA 3NJYA 1OSGA 3T4VA 3VHRA 4AI2A 1G9CA 1UOBA 1HB1A 1XNCA 2Q1MA 2WO2A 3J9SA 4XUTA 1HV1A 2RDSA 2J1UA 3I59B 3K3OA 3NAPB 4MGIE 4QPYA 3T0AA 4HANA 5EFUA 4NOTA 1T6GC 1JYNA 1G8WA 1BJQA 1LHNA 2ZGUA 3J7HA 5JWPA 4HK8A 4CU7A 4B7EA 2W5FA 3AKTA 5A7NA 2P5BA 3WX5A 4IQPA 2DBNA 3TRSB 4HPKB 4AEDA 3VBHB 4PBPA 5GZDA 4BQ5A 3ROUA 3BYWA 2DFCA 3WW3A 4IEUA 2CL2A 1UY2A 1Y9GA 4QGLA 2OS2A 3O1TA 3OSDA 1AYM2 3OYWB 2AC1A 4AK3A 4G9SB 2ILMA 2BGCA 2PN5A 2VZTA 5FZCA 2VZVA 1EP0A 1J1LA 2W95A 4ZU4A 2OYZA 1WA6X 3KT1A 3LIGA 4C90A 1XNKA 4HN1A 1GZTA 2AACA 3M3CA 1V6KA 3FX3A 5FK8A 4IE6A 1WGPA 4HG6B 4EJRA 4CA9A 4CPBD 2VZRA 1YXWA 1SQ4A 2XJQA 3K4AA 3LZZA 4LLFA 1GQPA 3MDPA 4OI2A 3JBG1 1NZIA 1UOFA 3CL1A 2RS32 3KB5A 3K4ZA 4W6YA 5GALA 2ZXQA 4ZXEA 2YGLA 1PNFA 3LEKA 2E51A 5BNQA 3GBFA 2CDPA 4QGNA 2VMFA 5HXVA 5CBLA 1QDCA 4PLMA 1OQDA 2XB6C 2FDKA 4AZZA 3TB0A 1H8TA 4WVMA 2WO1A 4NUBA 1O3RA 3CKHA 3BU0A 2D6OX 5A1FA 3T0BA 4AFBA 3MW2A 1PIV2 1BMV1 4QPIA 1XJAA 1W9SA 3SH3A 1WWYA 3PHMA 4AAPA 4BQYA 1EUTA 1PO12 4CDUC 1JW6A 3C7EA 5T5PA 4IGOA 4TYSA 5HCBA 1W8TA 2WZR2 3B9CA 4LA2A 3IBMA 1RUJ1 4D94A 5L9VA 1PO22 5LATA 1B09A 2DV9A 3F2ZA 1NE4A 1S0CA 4UOJA 4Y1ZA 1KD7A 2XLFA 4QWNA 2MEV3 1XNTA 3LOBA 1F4HA 3WDWA 2WR9A 1OHFA 2G4IA 1Y4WA 3ZKUA 2ZAHA 2WS93 4XEZA 4GWMA 5FPZA 1VR3A 4O9GA 1NZCA 3M8LA 4QM8A 5BYNA 4NHMA 2BNOA 3D6EA 1XU2A 1GKBA 2RV9A 3I3BA 5T54A 5C9AB 1SMVA 2ARXA 4PIXA 4B1LA 4QU2A 1QU0A 2WO7A 3U78A 1CESA 3MIFA 3AL6A 1NX9A 4Y20B 5BXXA 5A3LA 2BTVC 4YLZA 2GNMA 2VUJA 1EY2A 1IGOA 3EQEA 4UBHA 5FYHA 1RUF1 4FFFA 5HI0A 2YB7A 4HBNA 3DPRC 1V70A 5LA9A 4EN8B 2R063 1RUC1 4BIFA 3S5AA 3FJSA 4FOVA 3DYMA 3FBMA 5FY8A 4OHZA 3ZFFB 5CB7A 3SLIA 5A6YA 5JZGC 1AYN2 5DG2A 3RWKX 4MX3A 5EPAA 5C4WC 1OMIA 1WLDA 4CE8A 1V9U1 2AUYA 3B01A 4RA0A 2X05A 4DUXA 1Q56A 2IXLA 1MQTA 3VZOA 4GA9A 4N43A 2DU1A 5CU1A 3BPZA 1YHFA 2W46A 2VTFA 1BBT2 2FCVA 4EN0A 3R4UA 2UURA 4CEWA 4MGQA 3OTFA 3WY6A 2QBXA 3TEXA 1RJ7A 5ISLA 3D0JA 3CQOA 3AZXA 1ODNA 3SH5A 5IVCA 4S2HA 2FBEA 4BQ4A 3UESA 4BA6A 2RS51 3ZSJA 2XQRA 2WNUA 3OUJA 5AFBA 2NN8A 5IJRA 4YPJA 3ZSMA 1LOFA 2ZAAA 4GD4A 3WNNA 4UW6A 4CXYA 3GZTB 5CZKA 5FZ3A 1W39A 5FMOL 4XIKA 1JXNA 4CVUA 5KHHA 5EXOA 4TSVA 3E1F1 5FMOS 1JYTA 4LBQB 1S2EA 4XABA 1JZ8A 1TMF2 1OKOA 2D5HA 5IFPA 4TZDA 2J1TA 4UW3A 2XR4A 1W04A 2PXJA 1VRH3 3IWZA 3E6CC 1DQ0A 1E57A 5C6CA 3ZO0B 1W0NA 3B7MA 1NUKA 2VXRA 1PGW2 3OY8A 4OZOA 1DIWA 1S55A 3RZZA 1RUG2 3FHIB 1SPPB 2G9ZA 4FVVA 5FZOA 5DUWA 4JTOA 1YQ5A 3IIAA 1F15A 1UPIA 2A6WA 3LQCA 3OBRA 3TN92 4CP9A 3B94A 4DUWA 4FTEA 5JLVA 1H1IA 5FJHA 1UN1A 4JAAA 1OA2A 1QGLA 5JR2A 5GLZA 5K0UA 4XMIA 2EAAA 3KV9A 4DPNA 5BNOA 3KT4A 4IV3C 1CIWA 2MNGA 1DQ2A 1ND3B 1UY0A 3TWIA 3WQ0A 3PIGA 2XMLA 5F3GA 4XFBA 2YFZA 3S7IA 4U36A 1W8ZA 1YUDA 2JDMA 4CU6A 4Q0QA 1O4ZA 2K0GA 4O9EA 4XTMA 4XBQA 2HWC1 2G1MA 5KBFA 4AWDA 2FD8A 4JDMA 3ZXGA 2HH9A 1AVBA 2W0XA 1VIWB 3UETA 4XF9A 4IXLA 1AHSA 1ZA7A 1ZVFA 3OPTA 5ABJB 1A3KA 1PK6B 1GZWB 3VBRA 2WLPA 4ZZ5A 1TZOA 1PM7A 2QTWB 3PLQA 1LODA 4XJAA 2Z79A 1D4M1 3U14A 2ARBA 4XC9A 1ALYA 2JE9A 2OQ6A 3IB3A 3VKOA 1WW4A 4IEQA 1HV0A 2OKXA 4LQRA 3V56A 4B29A 1GOHA 1NLQA 1OF4A 2XVKA 3ALQA 4GIQA 1H8TB 3LAGA 4RFT0 4WVMB 1AR62 1F9KA 1LOBA 2QQJA 4NRQA 1SBEA 3ATGA 3OPWA 4YW3A 1OUXA 3MGUA 2Q8EA 2QJVA 5C8CC 4NRPA 1EYBA 4I02A 3AC0A 3RYPA 3ZN5A 2PAKA 5CKQA 4WZFA 2V72A 5LCWL 1Q8OA 2YHJA 2XJVA 4UXAA 2R061 5FZIA 3SKJE 4GH4A 1RUE3 1AR92 2VCAA 1QJX3 1EAH2 4ZPIA 3KF3A 4LBNA 5LY2A 4ZU7A 1ZBE1 2X8KA 5E6HA 3HNBM 3OOXA 4GKYA 4CCLA 5IK7A 4FCAA 4ZXKA 4QB1A 3WDUA 4NIAA 1RYYA 5LB6A 1RJ8A 3A23A 4JCKA 3WDTA 2ZTNA 3UKNA 5J36A 5F7UA 4I0BA 4JGYA 2VZQA 3I2DA 1VBA3 1K5MB 2WC2A 3AVRA 4Q0PA 4AE2A 2Q8CA 2ZKNA 5D8AA 2FZ1A 3U11A 1A78A 2AREA 1N1SA 2D43A 2RM21 4QGMA 4XJUA 1RGSA 2ORZA 3U37A 4DINB 2HWD2 1ZZ7A 4Q4W3 3WVJA 4ISQA 3LPFA 4Z8BA 1WZXA 1PVC2 4DMIA 1HN1A 3MIGA 3POBA 4CDWC 2HYXA 3TNPB 1JH5A 1LOEA 1RUH1 3I3EA 5E88A 2WZPP 2WAOA 4BJ0A 1ZREA 1MS3A 5IVJA 2EICA 3JB4C 1STMA 4HZFA 2DF7A 4Q0UA 4PI0A 2OUJA 1KEXA 5A3UA 2HWE1 1RUD2 1YFWA 2EIDA 1GQHA 3WLUA 1L7RA 1ULPA 4NWWA 2R041 2PAMA 3VBUC 4IE7A 1FNZA 2LM3A 3O0VA 4R9BA 3RPQA 1QXRA 3O14A 3VKFC 2GC2A 3CJIC 5A7WB 3WG2A 4ES9A 4MUVA 4IEYA 3POSA 4NWVA 4Y22A 4N43B 4NAOA 1SBFA 5F8PA 5D1IA 4E2GA 4AW7A 2UY9A 4GMP3 4JGZB 2WFF1 2UU8A 1Y9MA 1Z0HA 1QKQA 4DZGA 4XF1A 1D0HA 1RVF2 2WT0A 5FY4A 5EJ3A 5C7GA 5JXIA 2A6XA 2WABA 1FAYA 3WCSA 3UL2A 5CEHA 1PGL1 1AXYA 2XH6A 1CN1A 3BI3A 3H3ZA 1PX3A 1ACCA 2FCTA 3THCA 3S57A 1ULFA 2J7MA 2WNVA 4A42A 3BUCA 5FUNA 1QQP1 2VCMA 5T3NA 1IHMA 2AGSA 2B5HA 5L19A 3E5XA 3VBFC 2ZGMA 5JUVA 4ZS2A 1UYYA 1X8EA 1YI9A 1DZTA 5FLJA 4QXKA 1MZEA 3DGTA 3VUOA 3W5NA 3M3IA 3POGA 2Y6LA 5G05L 4XQDA 2WYSA 4PIZA 2WA4A 1S0JA 4P5YA 4P9GA 1NCQC 5I91A 4EROA 5JXHA 4A7YA 4RR3C 4N7IA 1CZSA 1ENXA 1GBGA 3F95A 4LTAA 4XDQA 5B2GB 5IT6A 1R1A2 3ME2A 4NJ4A 1H8VA 4AYUA 4CUBA 5FZGA 2RVAA 5A32B 4RGKA 3UGHA 1VMHA 3AYAA 1H4HA 2H0VA 3FL7A 3KGZA 4N9HA 4WM7A 4B3NA 1JYCA 3AMNA 1WMFA 2VZSA 2YC0A 4RGAA 2HEVF 2YV8A 1OLME 4ITCA 1REEA 1AL23 1LULA 3VBSC 1GU3A 5IVFA 4RHV1 3ENRA 3ECQA 5JSPA 1I9RA 3WINE 4B7KA 4WM8A 1RIRA 4RQPC 2XKPA 1ULDA 2E7AA 2F4PA 3IZOA 3N7JA 4YZ4A 1OLQA 1W9FA 1UXXX 4FPFA 5FKBA 5K7PA 5LBEA 5FBZA 2RR13 3RDIA 1BK0A 4E4HA 1O3SA 5LY1A 2IZWA 1F5JA 4LORA 5A7QA 5K4LA 2B7YA 1GP6A 2A71A 5KC6A 2X5IC 5A33A 2TNFA 3ZMNA 2FDGA 1ZBA3 4QX1A 1G9FA 1BLZA 3ZSEA 2BWCA 1ND2C 3EYPA 3LA2A 4UF0A 3MUY1 2GDFA 1R1ZA 5FO8B 3G7DA 1OOPA 2B4KA 2WZEA 3QBQA 4YVWB 5FAXA 1VBA1 2R6QA 3SCHA 3AL5A 3PU8A 3USUB 2GSYA 2Y6KA 2YFUA 5JSOA 1H1MA 1UZZA 3IAQA 1FMD1 5FOBB 3B00A 1V6MA 2D98A 2GZWA 4Q4W1 3ZSLA 1QOSA 4A7KA 1W8WA 2JG8B 2YUEA 4CRQA 3O1RA 1U12A 4AHYA 4CDXC 2O1QA 1F2NA 1H30A 2BP6A 3ZYPA 2P3IA 4DXTA 3NV3A 3J8F3 5L7OA 4YM3A 1OA4A 1IS6A 1QJFA 5CFCB 2P3KA 4WVZA 2ZOEB 5LW9A 3I49A 2PQSA 1WCKA 4A44A 2VJXA 1HRV3 1QWRA 1SACA 2OZJA 3HR9A 1GR3A 5BNPC 2HLEA 3D0SA 2CYFA 1GMMA 3PUQA 4IE5A 4QX2A 5BPXA 4W4ZA 3GZEA 2RG4A 1LOAA 1DHKB 2ZGOA 3U0ZA 4CP0A 1UW8A 4Q4Y1 1WD3A 4FPJA 4GMP1 3C7OA 3RZJA 4DRRA 2XWJB 2R16A 1LU1A 2OQ7A 3PVOA 4OHYA 1PX4A 2VTXA 1YC61 1SCRA 3BGAA 4QPGA 4XJ8A 4A7ZA 2ARAA 1G9AA 3SMHA 3ZFEC 1BMV2 3T2PA 1S2BA 4B1MA 1NCRC 3WNPA 1HX6A 3FHAA 3KD4A 5IFTA 3NRUA 1TVGA 2Z2SB 4GWNA 4R4XA 5AVPA 4TTGA 1DLLA 1RUJ2 1W8OA 2A7AA 2P1BA 3HPNA 4WV8A 2VZ3A 2GU9A 2ZHMA 1WLTA 3NSTA 1S0DA 1J1TA 4EWAA 4DY3A 3U4XA 2Y33A 3UJOA 5C5TA 2DVFA 2P3JA 5F3IA 4OQ8A 3DN7A 1MEC3 3C7FA 1Z7S1 3SC7X 1JYWA 2HWF3 5K8SA 5FZ1A 5I0TA 3CF6E 1VBD3 4MH0E 3IPVA 2J22A 2WAAA 3AP5A 3UK9A 3WG3A 1ZZCA 3POWA 2O0OA 3GBGA 1NA1B 4UBGA 1DF0A 1GOFA 2A3XA 2Y8KA 4CEYB 5A6ZA 1REDA 4X8NA 4OFGA 4OMCA 4AHWA 4N53B 3UNPA 3NAPA 2D5FA 1PMHX 1VBC3 4RN5A 4EZHA 3DKQA 2QQUA 4YFZA 4HETA 4Y1YA 2HEYF 2PMWB 4F8AA 1JOJA 1MZFA 1SDWA 3VD3A 4HPKA 2O8QA 3VBHA 1RUF2 2VUCA 1NKGA 2J1RA 1AL21 5GZGA 3USSA 3H1WA 3HBZA 3J7NA 3RYKA 3WF4A 3VZNA 4Q8KA 2A6ZA 2DVBA 2HBUA 1IZ3A 4BQWA 1KFXL 4RGGA 3OYWA 2ZZJA 4FFGA 1F35A 1AX0A 1QJU3 2VULA 2ZX3A 4KGGA 3ZFGA 4E4ZA 4CP2A 3VBOB 4OUSA 1E5RA 4YGCA 4F7ZA 3BCWA 3HT1A 4URAA 4DQAA 4UI9L 2NPIA 2R072 2EF6A 3I2IA 3LA7A 3OGRA 1X8MA 4LKSA 2JX9A 4FAGA 5M0TA 3RMXA 1XBFA 2B9UA 1LHOA 5FLHA 2JE7A 1Y3TA 4B4RA 1KDMA 1Y9QA 3MLKA 2VVDA 3ZN6B 1CIYA 4AEKA 5IAXA 3T2TA 3S5QA 5H9QA 1HRI3 4YM1A 2O14A 4UFLA 4XETA 2Z69A 1NAEA 4LOTA 3RG0A 3WW2A 1VBE1 1L3JA 3IDEA 1HJFA 1R082 3O1PA 5GZFA 1UQXA 2RE9A 2RS52 1DCSA 2CDOA 2ZX2A 4XQWA 3AK0A 1FPN3 2VOTA 2ZX4A 5H9PA 1UKGA 1C1LA 2VC9A 4QKFA 2JE8A 2XUMA 4PDWC 1N47A 2PHXA 4Q4X3 3N36A 3PL0A 4RD7A 1NQJA 2FDIA 2TUNA 4KWLA 2BERA 5A70A 1IS5A 1WMEA 4XMAA 3BTXA 3FWEA 3H8UA 1ASJ2 1YFYA 2Q1ZB 1KQRA 2VU9A 5JOYA 5FZFA 4R52A 1IQAA 5A33B 1RTVA 5JDBA 3AB0A 1DQ1A 4Q4V3 5B4XA 4K1ZA 1COV1 1V6LA 4MADA 1U5IA 4XZUG 1OA3A 2XONA 5A6XA 2QQWA 3KLSA 4M3CB 3I2GA 3H8RA 5FP7A 3HIFA 4CCJA 1BQPA 5C9AA 3U1XA 5FZDA 3WUDA 4HN0A 3T2OA 5EWSA 2D6KA 3NNLA 3C8XA 2HWB3 4FPLA 4Y20A 3L2HA 3WF3A 1WUVA 2W68A 4YGDA 5FYVA 5I8YA 3P6BA 5JSRA 3GGLA 4RFRB 2R1DA 2RDNA 4KL1A 2WQZC 1LEDA 2PHWA 3ZFFA 3D8CA 1FI2A 4YGBA 4COWA 2KR2A 1RUI3 1XSRA 3MLLA 2WKKA 2QQNA 4N7UA 5A3TA 2IXIA 2JG9B 2HWC2 4TLGA 1CONA 3A22A 2XLAA 1BHGA 4DFSA 1XC6A 3IIIA 1O6UA 1DDLA 1OBNA 4HFSA 3AFKA 2YMZA 2G9GA 4IEVA 1DBNA 2DCKA 1XE7A 4J1XA 3FHQA 1I1EA 1BZWA 2HWF1 1SFNA 1D4M2 3A0NA 2CSGA 4BHPA 1VBD1 2E32A 1W28A 1QNYA 1XSQA 4QKBA 4HL0A 5CA6A 4D6QA 1B35C 2ZS6B 4H55A 4Y4YA 3WHTA 5FKCA 3W59A 2OA2A 4D6SA 4L11A 2GH2A 1JZ6A 2GC0A 3AMQA 2YU1A 2IXKA 3B9IA 4E4SA 5J09A 4K20A 4QX0A 1PMJX 3WF2A 3KS7A 3HOBA 2XL7A 2XBO1 4DXRA 4YARA 1E5IA 4QQLA 5FXXA 1R64A 3AKQA 4CCEA 5KXCA 3I8TA 1D0GA 4AQTA 1ZBE2 2X29A 3RI8A 4YZ3A 1QJU1 1UIJA 4FPHA 5KXBA 1US2A 2RS11 4N8MA 1EV13 5BNNC 3HQUA 5EJ1B 2BUKA 2YXSA 4BPZA 2YZ4A 2Z5WA 1XPWA 2JEMA 3K46A 3JD73 4AAXA 2CGOA 1CX4A 3IPVB 4JV4A 3BKZA 3NW4A 4QPWA 2B45X 4KWKA 3TBDA 3ZYRA 1MS1A 3ASIA 1Q43A 1V6JA 2RM22 4NPMA 1SPPA 3WP3A 2VZ1A 4META 4NIHA 1HRI1 4CDQB 1FXZA 2ZEZA 1C1FA 3URFA 2RMU1 1JN2P 3VDDB 2VE1A 4AL9A 1DQ6A 4BXSV 4EZ4A 5LBCA 4YG3A 3SH4A 3GZAA 4FAHA 2ZABA 1DYPA 5EIYB 1RUH2 1JYVA 3OEAA 4O61A 3SEEA 1XRUA 5CNAA 5DXDA 3ZYFA 2IUWA 5H9RA 3BTZA 2CTVA 2FMYA 4W8JA 1UYPA 2HWE2 3ORJA 4IV1B 1ND3A 3O7OA 5FP4A 4BU2A 1QJY1 2A73B 2R042 2VBDA 4QXHA 4E8CA 3ZFGB 5LA0A 3AMHA 4BOWA 3O12A 4IE4A 4W50A 4LO6B 2A3YA 1RHI1 1YLLA 4CXXA 3C3VA 3KWVA 5ACA2 2VCCA 2ATFA 4NHXA 3CMGA 4A3XA 5CISA 3NV1A 1KGYA 5ABJA 2EXKA 3VZJA 3WF0A 4LHSA 1U0AA 1W6PA 2NQYA 1PK6A 1GZWA 2WFF2 4JDNA 4ZONA 4TN7A 4Q4V1 4RS5C 5FZ8A 1LR5A 3MIHA 4IGPA 3G6JB 1PM4A 2A3WA 4LR4A 3PUHA 4OMDA 1KS5A 3LSEA 4XJ9A 4NN0A 3SISA 4CTEA 5FOJB 3RZKA 5DG1A 1F5FA 3RGBA 3FZ3A 4DO0A 2E9QA 4CYDA 3K77A 1PHMA 3DYOA 3GYDA 4IERA 3QLQA 1QQP2 4YVSC 1H2KA 4A3ZA 1RC6A 1X9TA 2HWB1 4HSLA 5CFDC 1H1AA 4M01A 2XVLA 4OYUA 2OPWA 2VCBA 3INAA 5EJZB 1J59A 1RMU3 2VMIA 3H3UA 5DDJ2 3N9PA 1A8DA 1GZCA 4M4PA 4P9WA 5LK5A 1UCXA 2MPFA 4QQOA 3O0XA 5A3OA 1ODMA 1CPMA 2PLV2 4AEDC 4AGRA 1HXS1 4MXVA 1KRIA 1TQ5A 2IXJA 1EUUA 3GZUC 3AKRA 3WR0A 3PMEA 2JJ6A 2WT2A 2J1VA 5C8WA 3POJA 1H2NA 2VZUA 3T30A 1K5MA 1XNDA 1XU1A 4XBNA 1D2SA 2BBAA 3MV01 3KT7A 3AM2A 2XJSA 2Y60A 4PLOA 4A45A 4D3WA 3OGJA 4NRMA 3OF1A 1UZWA 1ULEA 2TBVA 2WT1A 4RHV2 3AZZA 4Y1UA 2ID4A 1US3A 5HXMA 2JD9A 3AJZA 2YU2A 2DUQA 4YZ1A 5FZ4A 1Q8SA 2ZGKA 1SFYA 1AX1A 3M1HA 4K6BA 3VHOA 3Q8CA 5F37A 1W90A 3K2OA 2CWMA 3NL1A 3WSOA 2VBPA 4Y5TA 3B5LB 5F3EA 5FYSA 2V73A 4I01A 5DN2A 3ZR6A 1W2AX 5A7WA 5T50A 4CSWA 3BVCA 1UAIA 2A6VA 4QPIC 1MVQA 3M70A 4IUGA 3VDCA 4CPBA 3PMSA 4MV2A 4WVWA 4AR2A 1O8PA 4ISRA 4JGZA 5J98B 1O5UA 5CYYA 2Q1FA 3WT3A 1NY71 4HLTA 4KG8A 1VBA2 4AEJA 4FPGA 2C1FA 2RDQA 4BK4A 4D8MA 2UYBA 3BIWE 3VD5A 1DGRA 2E63A 2WSUA 1A6CA 2W3JA 2JDNA 1JU4A 4C8DA 1FMD2 3KV4A 1HJGA 2XHNA 1XOYA 4ZHNA 3VZLA 4AVAA 1AR83 2A5ZA 1R092 1JZ2A 5LBFA 2F6BA 3CEWA 1ZRCA 3V65A 3AJYA 4Y1VA 1ZA4A 4Y33A 3HQRA 4V2VA 5IAVA 3WQ7A 3VLBB 1LESA 5A3PA 1VBB2 1NT0A 4DEQA 4FI9A 3ABZA 3OB8A 1YIPA 5E16A 2P2KA 5FYBA 3PVBB 4BB3A 5IK5A 4YYOA 1Q5OA 2YROA 4EN9B 1SG3A 4UW4A 3PTRB 3T1MA 4QDSA 1ZRRA 3MW4A 3J7LA 3W5MA 1FOD2 1TE1B 3ZN4A 1QOTA 3Q8EA 1ZRIA 5A1LA 2BFUL 3NNJA 1Y43B 3VHPA 2V4AA 4Q27A 4R8HA 1DYOA 2BFUS 4Q4Y2 4QKDA 2JDPA 3MICA 4XFCA 1SDDB 1W2OA 1CJPA 3K3NA 4AFDA 5A32A 3O5SA 2CAUA 5E8AA 1AYM3 4D7TA 2VH9A 1BEV2 2DU0A 2Y0IA 3U75A 2QQLA 3CDZB 4BK5A 1FYUA 5FYCA 5KHJA 3L9JT 1WLWA 4HMZA 3FUOA 1JBCA 3SHRA 5K9YA 3I7DA 1TME2 2ZCWA 1AR72 4P14A 5T5LA 3I54A 1MQTC 3LFMA 2LW8A 4N43C 4P9LA 5J7MA 2WSVA 3WQ1A 4F3JA 5FZEA 1ZZ9A 2D44A 1PVXA 4AQ2A 2P6HA 1C8M2 4LJHA 3IDAA 4IE0A 2V09A 3HAGA 4CEWC 2CV6A 1YJKA 1WBFA 2IVIB 2RS33 4CDUB 3JQXA 3WNXA 1RMU1 3MFAA 5A7PA 5C3QA 2EXIA 2PQQA 5DAXA 1BVP1 3I97A 2WN2A 2ARCA 1Z7S2 2W08A 2PELA 2WNUC 1VMJA 2H6CA 2P3YA 3TAYA 1W03A 1AJOA 4JKLA 1UU4A 1LOFC 2MEV1 3MO4A 1W6PB 3V0BB 2HEWF 2DVAA 3IT8A 1MS4A 1OLMA 1E5HA 2WFPA 1JOPA 2WS91 1PO13 2D40A 1O5LA 4K7JA 1ULOA 4LBJA 5IUQA 4YVWA 1DQ4A 5JOXA 1WD4A 2WZR3 3W21A 1C5IA 3USUA 1NOVA 1IPJA 4XILA 4CCCA 1V00A 3ACHA 3NV4A 3QCWA 2MHFA 4MZUA 2JG8A 5FZ6A 3H3LA 1IQDC 2GMPA 5D21A 3LDBA 2QQKA 1JODA 2XOMA 4XZPA 2XJUA 4O65A 3H1MA 3N9NA 2E31A 3WD5A 1GWKA 3DPRB 4Q2FA 2C4XA 5CFCA 3VD4A 1YO8A 3IDCB 4DXSA 3AP9A 5JZGB 1AX2A 2Y38A 4Z07A 5C4WB 2HJIA 3T09A 4GULA 4XOGA 5JXGA 4KU8A 4RL7A 5K0UC 2E53A 4FOYA 3BB6A 3N9OA 5BNOC 1POV0 2D6PA 2Y6GA 1VB2A 1H2MA 2JD4A 3BU7A 3D5OA 1VBE2 1HIXA 2DCYA 3I4IA 4AFAA 3C7HA 3WP5A 1QJEA 3QH7A 2C26A 3ZPOA 4JHTA 3PURA 4WVVA 5JI7A 4YZ5A 1XYPA 1N3QA 2Q0AA 1RUOA 5A3WA 3P5BA 4XVHA 4L99A 5FZ7A 5GLUA 3VBRC 5FMCA 1LB2A 2EIBA 4D7YA 5F6KA 2B8MA 1LGNA 3IAPA 2GN3A 1GV9A 2DFBA 1BBT3 1I3HA 2OUHA 5HV0A 4QB2A 1CWPA 5CAZA 2GC1A 1GQGA 1NLSA 2VG9A 2W94A 1URXA 5HV4A 3E6DA 3VKNA 2W9XA 1COV2 5D2AA 1NYWA 5EQUA 3D3AA 1ZZ8A 2ZJCA 5ERLA 4XUQA 2XJRA 2C24A 1J3PA 4I0AA 5JIAA 1K45A 1ST8A 5EHDA 3RI9A 4EV0A 5A1AA 4HKWA 1VP6A 5C33A 5J96B 1VRH1 1NA1A 2QDRA 3E5UA 1YWKA 4CEYA 1SLLA 2BVBA 2Y26A 1SLBA 3AP7A 4NIDA 4N53A 2NP0A 3EB7A 4LIVA 2DVDA 2X53S 5BY5A 4BE3A 4GH4C 1EPWA 4DB5A 1UOJA 1UX6A 2V4VA 4AEMA 1A34A 1TMF3 1ZYBA 1CX1A 4NHLA 1BVVA 4K40A 3CLPA 4XTPA 2ET7A 2JWPA 5F2WA 4YW5A 4JHZA 3LF7A 3VBSA 3ZDSA 2GP5A 4JGYC 2XPJA 3HBKA 4GJYA 3OJBA 2B9VA 2ES3A 1SFPA 5D8AC 5DUXA 2QNKA 1UNBA 3FUQA 4QQPA 4QXBA 4IV3B 4UYBA 2Q5TA 4QXCA 1RUG3 4K21A 5I0RA 3O1SA 3VBOA 2VO5A 3RVHA 1VAVA 3SQOA 3LKJA 1UU6A 2E6VA 3TN93 1QXJA 3WG4A 3U07A 2DCTA 4DOUA 1LCLA 1MS5A 2ZPXA 3K48A 4MSVA 5FREA 5JPNB 3ZN6A 2PHTA 1W8FA 4X6RB 3MI8A 3X29B 3ZIXA 4XFAA 4PI2A 1AJKA 2FHRA 5FZHA 3EHKA 1HN0A 4QDRA 3SEPA 4FPEA 5JPMB 4BZ4A 2PHLA 5C5UA 3CZUA 1K5JA 4QU1A 3E5QA 3TYJA 5I8SA 4UT5A 4NO4A 5IWFA 2DDUA 1CPNA 1L7QA 1REFA 4PBOA 1JYIA 4IEOA 2XBO2 4JRAA 2ORXA 5DMYA 3ZYIB 4W65A 5F5CA 3MYXA 5FZLA 1QXPA 1YQ8A 4K8FA 4L2NA 4RYDA 2HKXA 1ZNPA 2BEOA 3VGIA 5HBAA 2DVGA 5FWJA 2BWAA 2E7QA 4DNYA 5C8CB 3WDYA 1K42A 4XPVA 3KGLA 1QJU2 2ERFA 4COVA 2RS12 4HKLA 1LEMA 2C9KA 1QDOA 2R0FA 1V6NA 2VR4A 3NKTA 1RUE1 5ANQA 1QJX1 4GXLA 4URTA 4FPKA 4JTNA 1AR63 3MF9A 3PVEA 4K3UA 2WWSA 2WNVC 1VAMA 2BYVE 2V5DA 1QOOA 3ITQA 3FFZA 3EXUA 4P5HA 3THPA 2DTWA 2BV4A 2HBTA 2WLQA 4Y5Z0 4M3CA 3AYEA 4XUNA 5H9SA 2Y6HA 3ZXLA 2LS6A 4NVPA 3RSJA 4YM0A 3ZM8A 2TEPA 2RMU2 2P6CA 3ILFA 3RZGA 1AR93 1EAH3 3VZMA 2OXBA 1U5ZA 4LO7A 2NZ9A 5FO7B 3WCRA 1GWMA 3GHNA 1CJDA 2VQ0A 2VGDA 4MOAA 1QJY2 2I2SA 4LK6A 5FWEA 5AVAA 2VD7A 3M2MA 3R4SA 4WM7C 3AYCA 4GKXA 4FPCA 4GB33 1RHI2 5JOZA 1KJRA 1UMIA 1BBT1 2JG9A 3LGRA 3T4HB 1POQA 4ASKA 3VB9A 4C1WA 1HQWA 4CCMA 2HWD3 3ZVXA 4C1XA 2XQXA 2QUOA 3VBUB 1YNAA 4OHVA 4Q4V2 3U4SA 1PVC3 1X9PA 4FP3A 4S2DA 3ACLA 4XUPA 4UFHA 3CJIB 1WMDA 3JBG2 4WM8C 3SXWA 1FV3A 3WHUA 1C57A 4A6SA 2JDZA 5JXJA 3I2FA 4HVQA 1YYNA 3U10A 3ZXKA 4AVTA 3SKVA 1YFUA 2D3PA 2YBKA 2JIJA 3R05A 3QACA 4JVAA 1RUD3 1BCXA 1CAWB 3CZJA 5F2SA 1UWWA 3HD8B 3S30A 2WWUA 3B69A 5EP9A 4JC1A 1G6NA 1C3HA 2NMNA 4KMQA 4XFGA 1UD1A 4Q0VA 3AXEA 3LFIA 4FFIA 2Q8OA 1YI7A 4PHZA 1RL3A 3MIEA 5FZBA 3N9QA 2XLGA 5FR3A 4AI1A 5KXDA 4WBBA 1H4GA 3VV1A 4H2AA 5JI9A 1OOPC 1UX7A 4MO3M 1WA4A 2B39A 3ZLIA 3VBFB 2G19A 3UJQA 1DGRN 1RVF3 4UFJA 1PGW1 1HXS2 2QQVA
chains in the Genus database with same CATH topology
1DU3D 1RUG1 3V0AA 1WW6A 2R0HA 3ZPYA 3T1LA 1S1AA 3GHMA 4K9SA 1O4TA 1QHDA 2P17A 2CWSA 1DQ5A 1JTZX 1NCQB 5L7OC 4RR3B 5IK4A 2CY6A 3J26N 4FXKB 5FO9B 4CDQA 3VDDA 1VLNA 4HK9A 1SLAA 2W52A 1ZRFA 1CAVB 2VW2A 4Q1RA 2PA7A 2QE3A 2BVVA 1OQEA 1SBDA 3ST7A 3VBSB 2VECA 1RUC2 3NV2A 4LHNA 4IV1A 1R1A3 2GNBA 2YPJA 2IXCA 1W6OB 4RQPB 1V9U2 5I93A 3AMMA 3FE5A 3KM5A 4QPGC 2RR11 1W0OA 3H7YA 1JUHA 2X5IB 2WQ4A 1I5ZA 1H9WA 1ZBA1 3MPBA 4FPYA 1O7FA 4XJWA 4P9YA 1ND2B 2ETEA 3NJZA 4LUKA 2VVEA 1OPMA 3MIBA 1X50A 2ZGSA 3VZKA 5JAXA 2PHDA 4B4QA 4M3CE 4Y26A 3MW3A 4M00A 3H9AA 2H0BA 4W6XA 2JXAA 2XL9A 2QVSB 1OFSA 3RRDA 1WW7A 4CDXB 3NAPC 4GALA 3N7LA 4L92A 4MGZE 3J8F1 1W6MB 1KITA 1UU5A 4GB31 2K9ZA 1HRV1 3VBHC 3CNAA 1F8VA 5BNPB 1UPSA 4V1PA 4CP1A 5FLIA 5KHIA 3GALA 1S0BA 1CAUB 1MS8A 3BOWA 1CGPA 3IKWA 3ZXAC 4YW2A 4ATFA 3SNMA 1O3QA 4QM9A 4IEZA 1PGSA 2EALA 4YZ2A 4FP2A 3AKPA 1TNRA 2O8OA 4IEPA 4BYYA 3DKWA 4LBQD 2EIGA 3WOGA 3HN1A 1LTEA 1X33A 5I0UA 4LHLA 4C0HA 3LA3A 1NCRB 4XXAA 5DZFA 4Q0SA 3H7JA 4MGKE 3WUCA 1UMZA 2PFWA 4LE3A 1MR5A 4BWOA 5JVVA 4KU7A 4ZU5A 1ULGA 3SITA 4XYXA 3VHNA 1ENSA 1XYNA 4I0WB 4AQSA 2XG3A 1RVF1 2MEV2 4BQ1A 3JB8A 4MYEA 2YGMA 1N1YA 3RMYA 2PYTA 3RNSA 4P9JA 1MEC1 1FATA 2VMGA 2WS92 1J58A 1XXNA 2P34A 4ASLA 5T5JA 4XHBA 1RUJ3 4XFIA 1IPKA 1VAKA 2YY1A 3OPZA 2ZA9A 1VBC1 3AP6A 1LJ7A 1PNGA 2I74A 1RITA 1MS0A 1IS4A 1LU2A 4QD2A 4OVEA 4ORFA 1IOAA 4IETA 1H9PA 2R062 2OIIA 2A75A 5C9AC 1AZDA 5J3UA 3JUUA 4H14A 3J4UH 3ZXDA 3V0AB 1ONAA 2D6MA 3LB9A 4FO9A 4YFWA 3SCFA 4E27A 1KXGA 1RUF3 1S0EA 5FQ0A 1POV3 3AX4A 3MF6A 3ZFFC 3HWJA 1ZZ6A 4FSJA 3ETQA 4TLFA 3AZYA 1LKNA 2ZGRA 3KZ4C 4MXWB 2R073 4LNVA 5EZWA 1FPN1 4AI3A 4Z2WA 1CAXB 1N1VA 4PDWB 1H2LA 3ILNA 4CDUA 4MLOA 4Q4X1 4XHXA 4KH9A 1S0FA 3QH6A 3FC0A 3PTYA 4M0HA 1R083 2R1BA 2XKOA 2OVUA 5SV5A 2GNTA 1ENRA 2RS53 1N3PA 2IC1A 1U5YA 3M7AA 1VRH2 5GZCA 3V0BA 1TNFA 3MFCA 3KCXA 5TSWA 2I07B 1GYKA 5F1RA 3VN4A 1AXZA 1PGL2 1Q8PA 3JCIA 3UV9A 3IMNA 1ZM1A 1NE6A 2C5DA 2ZX0A 2ZGNA 1ASJ3 1DYKA 5GM0A 3S0MA 3A4UA 3ELNA 2EVXA 4KWJA 1XYOA 4G4FA 4AVCA 3W58A 4XF4A 4FQZA 1ZX5A 5CG8A 1OQ1A 3DPRA 4I09A 1W6NB 1D2QA 2UWBA 4E2QA 3MZHA 5JZGA 3FLRA 1AXKA 1RUI1 3VL8A 4MGYE 2CGNA 2AENA 3HT2A 5C4WA 1SEFA 4KG0A 5F6LB 5DZGA 2GC3A 4K1YA 4OHXA 4XIOA 1I6XA 1LHWA 1KS4A 1ND3C 1ZZBA 4D69A 3E97A 3WW4A 4EN7B 1VJ2A 4XF3A 4ATEA 3IM0A 4LBMA 2C9AA 2VOVA 3Q9OA 1S2KA 3DL3A 5FDBA 3EO6A 2HWC3 2JECA 1QNWA 3VKMA 2VVFA 1B35B 5FTTC 5ABJC 4KGQA 1F31A 4LO5B 3V64A 5J48A 4Q26A 3ZXFA 3GF6A 1PK6C 5EYYA 1SLIA 4PQ9A 3KSCA 3M3QA 1RB8G 4XJZA 1S0GA 4BLIA 3KCYA 1LECA 5FRAA 2ZGPA 4YW4A 1D4M3 4I3GA 5BUVA 1G7YA 4XXPA 3AKSA 3ES4A 1YRZA 3S6PA 1RUE2 1H8TC 1QJX2 3AZWA 3ZXJA 2IFWA 3BOPA 5AFEA 3ZMOA 1OPOA 1NQDA 4C91A 1EV11 4DXZA 3NO8A 3H1YA 4GQ7A 4QQ2A 5BNNB 1FNYA 3QD6A 1QJZA 2VNOA 3JD71 3IDBB 3RJ2X 1C5HA 4EWEA 1G9BA 1POV1 4LE4A 4EN6B 1NXD1 4S2GA 1M4WA 2XVGA 2AYHA 1ZBE3 4QMAA 3VKLA 4F83A 1MVEA 3FBYA 3JQWA 5I8TA 4Q4W2 4BMBA 4OZXA 3R6SA 1KJLA 5AC93 1TEIA 2ZX1A 2R071 1K5MC 3SCGA 4UW5A 1IS3A 4YG0A 2ZHLA 2RM23 4IV3A 4M3CF 1V6OA 5GLVA 1OLRA 3N7KA 5KHKA 3VL9A 2BW8A 1XE8A 4Q8LA 4FBFA 3O0WA 1R081 1OD5A 4AI0A 1Y7BA 3UKTA 4LBLA 1RUH3 1G86A 5FQ0B 1IKPA 1OKQA 3BALA 2DTYA 4C0BA 1W2UA 2HWE3 4JQRA 3UKVA 4RS5B 4BLJA 1QH6A 3E6CC 2R043 1KFUL 2AH2A 3RYRA 2GN7A 4QT6A 1HKDA 1QMJA 3H0OA 2VY0A 5ACA3 3KQRA 5F5QA 4DY5A 4KNCA 1ASJ1 4AHZA 4PF5A 4JGZC 1LOCA 1WW5A 2ZHNA 2WFF3 4YVSB 1W6QA 4I30A 4Q1PA 2CGPA 5CFDB 4JDOA 4NHKA 1Q8QA 4E4DX 4RSUA 5C8CA 1GFF2 1HLCA 2WIIB 3BTAA 4G3YC 2PTMA 3FMGA 2UWAA 4X8PA 3DUIA 1DG6A 4PJYA 4HT1T 4AEDB 1JUIA 1QQP3 1PIV3 1DGWX 2ET1A 3MEPA 3N35A 5JMCA 4E9KA 5DDJ3 2R30A 4E2SA 2C0ZA 1O91A 1PO23 1SLCA 2VOKA 2IXHA 1AL22 2PLV3 4R9CA 1J3RA 1UL9A 1BXHA 1VALA 3M3OA 3JU9A 3AFGA 2IWGB 4LEJA 5T55A 1M06G 3WP4A 4CDWA 4FTSA 3WP6A 2WINB 5KXEA 1QY4A 5EV7A 1JHNA 2H6BA 2RR12 5T52A 5LRRA 5KHGA 2D3RA 2JENA 2GNDA 2AR6A 4Y24A 4IEWA 3VBUA 1ZBA2 1GNHA 4RHV3 1HQNA 3CJIA 5FPXA 4OI1A 2E7TA 3H50A 4I3PA 4JRLA 4QPIB 4YGEA 1PZ9A 1QH7A 2VW1A 4Z82A 4WZCA 1QF3A 3MIDA 4HVRA 4HSJA 1CAWA 1AYN3 3TNQA 4LULA 4H7LA 3WDVA 1AF9A 4FOWA 1HW5A 3DV8A 2XGXA 5T5OA 5HCAA 4YM2A 2DCJA 1AR81 3AMPA 1CVNA 4HKOA 4L97A 5AC91 2QZ3A 1O4YA 2PHRA 4OUMA 3J8F2 4YVWC 5KWRA 1J3QA 4OHWA 4N9IA 3VBFA 4LO4B 4GB32 3WW1A 1HRV2 2R32A 3P3PA 5CVRA 1FMD3 3EBRA 1XNBA 1VB4A 3NKGA 2JG8C 2VQAA 2VOXA 4COYA 1UIKA 1R093 2QDNA 1NCQA 3M4FA 2VMHA 2FZ2A 3WV6A 3WDXA 4RR3A 4YRDA 2FQPA 5CFCC 1VBB3 1DGWA 4B4PA 1LGCA 4LT5A 2W39A 4R9AA 4D7SA 1AYM1 5FCCA 4P9IA 1CAVA 2RJLA 4R4ZA 5SV8A 4AFCA 1YIFA 2BPA2 2ZGQA 1FOD3 4LA3A 5ACA1 4LBOA 1MQTB 2ZZQA 4AF9A 5GLWA 2N7GA 4Q4Y3 5FFOC 1GNZA 2ENRA 4BH9A 1W6OA 4RQPA 1WLCA 3DF0A 4CEWB 3APBA 1BEV3 4LBKA 2RS31 1OI6A 5CIRA 1MZ6A 2KM2A 2WL1A 1TME3 1MEC2 2PHFA 1AR73 1OFNA 2QZ2A 5GZEA 2HWF2 2WNUB 2X5IA 5L36A 2VPVA 3AXDA 4BMEA 1VBD2 2DYCA 2VUAA 5DUVA 4R9DA 1C8M3 3JZVA 1ND2A 4XBLA 1PIV1 2CAVA 3AZVA 1VBC2 5GLTA 1PO11 2ZHKA 1PMIA 5DDJ1 4AI8A 3L2YA 2WZR1 2OPKA 1Z7S3 2LUWA 1PO21 3GNEA 3A0KA 2QFEA 2NYYA 2PLV1 4SLIA 2WNEA 1NA1C 3WXPA 4CEYC 5IK8A 2NM1A 3LSDA 1W6QB 4N53C 4CDXA 1GSLA 5HCFA 3ZIWA 1X7NA 2WJSA 2NMOA 1GANA 2CNAA 3OY8B 4XQ4A 3LOIA 1W6MA 3HQXA 4Z92B 1X82A 1Q3EA 1N1TA 4W6WA 1C28A 1NXMA 2ZMLA 4LHKA 1RINA 4AHXA 2VNRA 1C4RA 5BNPA 3LWCA 1FV2A 1XQNA 3WG1A 1CAUA 4DRVA 2BNMA 1W0PA 4XFFA 5K0UB 5BNOB 1HRI2 1DZRA 1FT9A 4CZSA 3VBOC 2EAKA 4J1WA 2V5YA 4NPRA 2ZGLA 4OI4A 1LENA 1AYN1 1FPN2 2SBAA 1WCSA 5E1RA 2HYKA 5E89A 3ZFEA 4PCRA 2Z42A 2A6YA 1ZRDA 1NCRA 4CDWB 3VBRB 2AZ5A 4Q4X2 1CQ9A 2D6NA 1SLTA 1VBE3 1CD3G 2Q4SA 5LEKA 3TOJA 2DURA 1BKZA 3PVNA 1O3TA 5JIUA 1YCIA 3D4KA 4COZA 1LHUA 5DUUA 3THTA 4I2OA 1R091 2WA3A 4XF0A 3RQ0A 2BNNA 2RHPA 3S7EA 5JCTA 2BQPA 2KXLA 2UWCA 1VBB1 3D82A 5GJ6A 5KC5A 5LK7B 2ZMNA 4GH4B 1LOGA 3N7MA 4LO8A 4FTBA 2JICA 2HWB2 1COV3 4L9BA 4DS0A 3ZXEA 1TMF1 3ZYGA 1SCSA 2A70A 3B02A 3CJXA 3FLTA 4HVOA 1FOD1 2GAUA 4H3WA 4JGYB 4EWDA 2RJKA 3W9AA 5F9TA 1RUI2 4L8QA 5D8AB 4ZKTB 3FLPA 1WCDJ 1BEV1 1C8NA 2B42B 3WZ1A 2VNGA 3TN91 5CADA 1TME1 1AR71 4LLOA 1EPZA 1LHVA 4LUMA 3R4DB 1H0BA 1YJLA 1C8M1 2NLRA 2JG9C 4AGVA 3C2UA 4ASMB 3GBWA 2GMEA 2JKBA 1PZ8A 2ZACA 3P3NA 3KCCA 2EXJA 1CR7A 4MXWA 1N3OA 2DUPA 2GH8A 3N3HA 4Y22B 2D93A 2D3SA 1CAXA 1DGLA 4PDWA 2SLIA 3LCPA 1LRHA 4BCUA 2YYOA 3I59A 1V6IA 2EA7A 2QCSB 1HDKA 1G9DA 2PHUA 1UKRA 1UZYA 1EV12 4YG6A 5JOWA 3PJYA 1BYHA 3ZX7A 4S2FA 3K51A 1MZ5A 2XBO3 3JD72 1NY72 2P37A 1AR61 4N90A 2WNVB 4YSFA 3NWKA 2FMDA 1DFQA 2XHKA 4FPOB 5CG9A 3N4MA 2RS13 4FXGB 2GALA 3KMHA 4COUA 2D6LX 2D7FA 4XW3A 4X6QB 5GKAC 1AR91 4IL7A 1EAH1 2Y0OA 4XFHA 4KBBA 4XE9A 2K2SA 4INDA 2OZ6A 4BM8A 1GZ9A 4CDQC 4M0NA 2XWBB 1W6NA 2D97A 2ZGTA 3VDDC 4BIOA 2RMU3 1GICA 2B46X 4WM7B 1BK1A 4TWTA 5L73A 2ZMKA 4QX5A 3BODA 5JR7B 4B8EA 2KA3A 2Q30A 2DWRA 2HWD1 1ULCA 4FT8A 3IN9A 4IEXA 1A8MA 5I0SA 1UF2C 4Y1XA 4FOQA 4IV1C 1PVC1 3RS6A 4AQ6A 1APNA 1QJY3 4WM8B 3ZFGC 3AP4A 1AL0G 1D4VB 4J6GA 4AVSA 1FX5A 4AG4A 1RHI3 4AGGA 5BV6A 3RWNA 2QQPA 3CO2A 3B93A 4Q29A 2I45A 1RUD1 2XJTA 1B35A 3E6BA 1U5XA 3NVCA 4YW1A 3ZFEB 3OGGA 2DCZA 4YNIA 3JBG3 1RMU2 2YDEA 4GMP0 3AYDA 3EJKA 1OOPB 3FFQA 2VOWA 4AFMA 4OULA 4ONUA 2LALA 1RUNA 3OBTA 2DUOA 2OW4A 5EYXA 1NLRA 4SBVA 5BNNA 4P9XA 3POYA 4Z1VA 2ZKLA 1X36A 4U2AA 1YFXA 5L7OB 4IESA 3OCPA 2G9FA 1HXS3 1WBLA 1ENQA 3PNAA 1KDKA 5A3MA 1GLHA 1HQLA 2EXHA 4PLNA 5DZEA 4AXOA 1PZ7A 1Q8VA 2PAEA 2UYAA 4A2UA 1NG0A 3ZYJB 1DZQA 2QKDA 1Z78A 3R0RA 1R1A1 5LRSA 2IFRA 1MACA 4PIYA 4AVBA 3QOPA 3ES1A 3OD0A 2LTNA 4QPGB 2R49A 2UY8A 4FQ4A 4OLLA 4QQHA 2ZBJA 2XJPA 1MS9A 3MPPG 5LEJA 4MVTA 3ZSKA 1RUC3 1S0IA 3RJRA 4H7MA 3PJQA 3CU7A 4RS5A 4ES8A 1IKQA 3MLJA 4KQ7A 2VW0A 2BBVA 1V9U3 4LBQA 4QHBA 2GMMA 4OI0A 3HMYA 3M3EA 1AR82 3OD4A 5AC92 1LGBA 3B3QE 4YVSA 3ILRA 4NR1A 5J37A 5CFDA 1AUYA 3VHRA 1OSGA 1G9CA 4AI2A 1XNCA 2Q1MA 3J9SA 1HV1A 3I59B 3NAPB 4QPYA 4MGIE 4HANA 5EFUA 4NOTA 1T6GC 1G8WA 1BJQA 1LHNA 2ZGUA 5JWPA 4HK8A 4B7EA 3AKTA 3WX5A 4IQPA 3TRSB 4HPKB 4AEDA 3VBHB 4PBPA 5GZDA 3ROUA 2DFCA 3WW3A 4IEUA 2CL2A 4QGLA 1AYM2 3OYWB 4AK3A 4G9SB 2ILMA 2BGCA 2PN5A 1EP0A 1J1LA 4ZU4A 2OYZA 4C90A 3KT1A 1XNKA 4HN1A 3M3CA 1V6KA 3FX3A 1WGPA 4EJRA 1YXWA 1SQ4A 2XJQA 3LZZA 4LLFA 3MDPA 4OI2A 3JBG1 3KB5A 3CL1A 2RS32 4W6YA 5GALA 2YGLA 1PNFA 2E51A 5BNQA 3GBFA 4QGNA 5HXVA 5CBLA 1QDCA 4PLMA 1OQDA 2XB6C 3TB0A 1H8TA 4WVMA 1O3RA 2D6OX 4AFBA 3MW2A 1PIV2 1BMV1 4QPIA 3SH3A 3PHMA 1PO12 4CDUC 1JW6A 5T5PA 5HCBA 4TYSA 2WZR2 3B9CA 4LA2A 3IBMA 1RUJ1 4D94A 1PO22 1B09A 2DV9A 1NE4A 1S0CA 4Y1ZA 1KD7A 2XLFA 2MEV3 3LOBA 3WDWA 1OHFA 2G4IA 2ZAHA 2WS93 4XEZA 4GWMA 5FPZA 1VR3A 4O9GA 1NZCA 3M8LA 4QM8A 5BYNA 4NHMA 2BNOA 3D6EA 1XU2A 1GKBA 5T54A 5C9AB 1SMVA 2ARXA 4PIXA 4QU2A 1QU0A 1CESA 3MIFA 4Y20B 5BXXA 5A3LA 2BTVC 4YLZA 2GNMA 2VUJA 1EY2A 1IGOA 3EQEA 4UBHA 1RUF1 5HI0A 4HBNA 3DPRC 1V70A 4EN8B 2R063 1RUC1 4BIFA 3FJSA 4FOVA 3FBMA 3ZFFB 5JZGC 4OHZA 5CB7A 3SLIA 1AYN2 5DG2A 4MX3A 5C4WC 1OMIA 1WLDA 1V9U1 2AUYA 3B01A 4RA0A 1Q56A 2IXLA 1MQTA 3VZOA 4GA9A 4N43A 2DU1A 5CU1A 3BPZA 1YHFA 1BBT2 4EN0A 3R4UA 2UURA 4CEWA 3OTFA 3WY6A 1RJ7A 3D0JA 3AZXA 3SH5A 4S2HA 2FBEA 4BA6A 2RS51 3ZSJA 5AFBA 2WNUA 2NN8A 3ZSMA 1LOFA 2ZAAA 4UW6A 3GZTB 1W39A 5FMOL 4XIKA 1JXNA 5KHHA 5EXOA 4TSVA 5FMOS 4LBQB 1TMF2 2D5HA 4TZDA 4UW3A 1VRH3 3IWZA 1DQ0A 1E57A 5C6CA 3ZO0B 3B7MA 2VXRA 3OY8A 1PGW2 3RZZA 1DIWA 1S55A 1RUG2 3FHIB 4FVVA 5DUWA 4JTOA 3IIAA 2A6WA 1UPIA 3OBRA 3TN92 4FTEA 3B94A 5JLVA 1H1IA 1UN1A 4JAAA 1OA2A 1QGLA 5GLZA 5K0UA 4XMIA 2EAAA 4DPNA 5BNOA 3KT4A 4IV3C 1CIWA 2MNGA 1DQ2A 1ND3B 3TWIA 3WQ0A 4XFBA 3S7IA 4U36A 1YUDA 4Q0QA 1O4ZA 2K0GA 4O9EA 4XTMA 4XBQA 2HWC1 5KBFA 4AWDA 4JDMA 3ZXGA 1AVBA 2W0XA 1VIWB 4XF9A 4IXLA 1AHSA 1ZVFA 5ABJB 1A3KA 1PK6B 1GZWB 3VBRA 2WLPA 1PM7A 3PLQA 1LODA 4XJAA 2Z79A 1D4M1 2ARBA 1ALYA 2JE9A 3VKOA 1WW4A 4IEQA 1HV0A 3V56A 4B29A 3ALQA 4GIQA 2XVKA 1H8TB 3LAGA 4RFT0 4WVMB 1AR62 1F9KA 1LOBA 1SBEA 3ATGA 4YW3A 3MGUA 2QJVA 5C8CC 1EYBA 4I02A 3RYPA 3ZN5A 2PAKA 4WZFA 1Q8OA 2YHJA 2XJVA 4UXAA 2R061 4GH4A 1RUE3 1AR92 1QJX3 1EAH2 4LBNA 4ZU7A 1ZBE1 2X8KA 5IK7A 4GKYA 4FCAA 4ZXKA 3WDUA 1RJ8A 4JCKA 3WDTA 2ZTNA 3UKNA 5J36A 4I0BA 4JGYA 4AE2A 3I2DA 1VBA3 1K5MB 2WC2A 4Q0PA 2ZKNA 5D8AA 2FZ1A 3U11A 1A78A 2AREA 1N1SA 2D43A 2RM21 4QGMA 4XJUA 1RGSA 4DINB 2HWD2 1ZZ7A 4Q4W3 3WVJA 4ISQA 4Z8BA 1PVC2 4DMIA 3MIGA 4CDWC 3TNPB 1JH5A 1LOEA 1RUH1 5E88A 2WZPP 1ZREA 1MS3A 3JB4C 4HZFA 2DF7A 4Q0UA 2OUJA 2HWE1 1RUD2 1YFWA 1GQHA 3WLUA 4NWWA 2R041 2PAMA 3VBUC 1FNZA 2LM3A 3O0VA 4R9BA 3RPQA 1QXRA 3O14A 3VKFC