1RN7A

Structure of human cystatin d
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
AGGIHATDLNDKSVQRALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin D
publication title Crystal structure of human cystatin D, a cysteine peptidase inhibitor with restricted inhibition profile.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1rn7A00
5LC7A 1MOLA 1EQKA 1NB5I 2W9PA 1N5PA 5ELUA 1CEWI 3SVAA 1A90A 1G96A 1A67A 2BO9B 1PFPA 1TIJA 1FUWA 1GD4A 1ROAA 3PYJA 1KWIA 1STFI 3K9MC 4IT7A 4EYCA 2CH9A 3L0RA 2W9QA 1GD3A 1NB3I 2OCTA 4N6TA 3NX0A 4N6LA 3UL6A 3KSED 4N6UA 4TX4A 4ZM8A 5A0OB 3UL5A 3LH4A 1CYVA 1R4CA 1DVDA 1FA3A 1CYUA 5LC6A 1N5HA 1DVCA 1IV7A 3GAXA 3PXMA 4CCVA 4LZIA 1WNHA 1M9GA 4N6V0 4N6NB 1RN7A 1N9JA 3QRDA 5EQLA 3IMAB 3MWZA 5ELJA 3S67A 1LXEA 2O9UX 1IV9A 1YVBI 2KXGA 4N6OB 3Q2PA 3KFQC 1MNLA 3PS8A 4N6MA
chains in the Genus database with same CATH superfamily
3LTCA 1VQ63 3OX9A 5BVBA 2QGUA 2AADA 1EUIC 2ZL8A 3CD63 5CK6A 1V74A 4LGQA 3Q1CA 3LMLA 1UCJA 3DXOA 4X2HA 1D6UA 2I9WA 3B4OA 3SX1A 4J9AA 4FCMA 3LT8A 3CCE3 3CC73 1MGWA 4R4KA 3SVAA 1A2PA 2XR8B 4KFDA 1BIRA 3D5GA 2XGNA 2UGIA 1X1XA 1FGMA 4HM4B 3X3ZA 3A76A 3EN8A 1TIJA 3EQQB 3HX8A 3NBRA 1FGQA 3DZLA 3LTBA 2WOHA 3B4PA 3BIRA 3EX9A 1M1K4 3DUKA 1ZX2A 1M904 3LYGA 3N54B 1L5GB 1N8QA 3EBYA 2H0GA 2Z77A 4BIRA 2RSXA 4IT7A 2HMJB 4R80A 1W00A 1CH0A 2CWUA 1VQL3 4MMYB 1AR0A 1LOYA 3HZPA 4FCZA 4HM2B 1UCIA 5DRVA 1KQS2 1BOXA 2D42A 3L0RA 2R41A 3K63A 3K5TA 1NB3I 3X3XA 4N6TA 5FW5A 1TRQA 1YJ93 1T2HA 2W04A 3UL6A 1BSEA 3EJVA 1IT7A 3D79A 1YGEA 1E3RA 1OF5B 3AHSA 3GWRA 1HKXA 2P05A 3CNXA 5A0OB 3ZG5A 1RGHA 3CC43 3MSOA 2XSHB 1FW7A 4L8PA 3CMA3 4GHOA 4CDLA 3LH4A 1I2EA 1TFKA 1QMAA 2W56B 1YHQ3 1QVG2 3OW22 3U1WA 3RGAA 4HYZA 3F8HA 2KAAA 3AGOA 1BUQA 2AAEA 3N8BA 4STDA 1RLSA 3H51A 5KP3A 2W0QA 3NBJA 1OPYA 3G0KA 2Z6BA 1A2KA 3KKGA 1MWSA 3GSPA 3VF1A 3K0ZA 2KF6A 4KFFA 4R1KA 3V92A 1IV7A 1QJGA 3PXMA 3EF8A 5JPUA 3PCSA 1YJN3 1QVF2 3STDA 2ZHXB 5IEOA 3ALAA 1UCKA 2H0HA 5TGNA 6STDA 5AYRB 3MG2A 2F56A 1BNFA 3IPTA 3CCJ3 1KC84 4XBTA 1G0TA 1BSBA 3EC9A 2JQ5A 1Q814 1X1UA 4XBYA 5IERA 3G16A 4FMCA 4HVNA 1OCVA 1W2B2 1W01A 1IQ8A 1ZS7A 3JUQA 3HOHA 5AIIA 5EQLA 4J8TA 1IQXA 1RRLA 4XB5A 3SOYA 1LXEA 1U5OA 3V99A 1RCLA 3ROBA 2GEXA 3KCHA 1BNEA 2XEPA 2W56A 1US1A 3BLZA 1RN1A 5AYSC 4AKZA 5CXOA 1O7MB 5AI1A 3CC23 3JUMA 1BRIA 3DH2A 5RNTA 1IVVA 1WTHA 2LQVA 2ML5A 4I4KA 4EXRA 3CCU3 1B20A 4MJDA 3MG3A 3DMCA 2YFLB 5HOHA 6GSPA 4J5KA 2W03A 2P0MA 4WYKB 4ORLA 3ECFA 5IENA 4BL3A 2IUJA 3WMDA 4QWTA 2OOVA 1E3VA 1B3SA 1J2BA 3CCL3 1GYBA 3SEDA 2K54A 3NXJA 3SOAA 2CFLA 4N3VA 2OTL3 3GZBA 3SLUA 5CF2A 2W9PA 2HMOB 2F5MA 2RFRA 3TDGA 2KRTA 1MGRA 7STDA 2CHCA 3HK4A 1DE3A 1A90A 1RGKA 1I0VA 3E99A 4LEHA 5IF6A 3ZFZA 5M18A 1RMSA 1FUWA 1BU4A 4HM0B 1BRSA 3WA2X 1MWUA 1ROAA 1GSPA 4WFOA 2PZVA 3FG3A 1RJOA 1WQLB 3LZAA 1RDSA 3PYJA 1ZGXA 3PGBA 2FNQA 2K3DA 4WP5A 4AEQA 3FCSB 3KZTA 1ISKA 3WOFB 1GOVA 3HIGA 1JN5A 1X1YA 4HOHA 5D81A 4IIAA 4CPKA 5BU4A 1RGLA 1VQK3 4EYCA 1Y4KA 3GZRA 1DETA 1SIIA 1TP6A 3BNCA 4OVMA 3T8UA 3CXC2 2W9QA 1GD3A 2C11A 1KSIA 2YX9A 1VQO3 2OCTA 2IY2A 3CCQ3 4G1MB 1BNGA 1WMOA 4N6LA 2JDIH 3G8ZA 5AIFA 1LOWA 4HAAA 3RGRA 3S27A 4DKIA 3KSED 1O7NB 1YIT3 1E97A 3D4AA 3BB9A 1OH0A 2QIYA 3D5IA 3F7XA 2Y73A 1Q7Y4 1VQ53 4MMZB 2ZA4A 3VGNA 1W4NA 2GEYA 1EG9B 1LRAA 2P38A 3X41A 3NV0A 3MG1A 4JF8A 1I3FA 1FGOA 2XFTA 3AGNA 3VSYA 6RNTA 1BGSA 5JBSA 2WGOA 3CPOA 1Q824 4O3VA 3AHWA 2CFDA 4WHAA 1IQYA 1STDA 3LOYA 2FXTA 1AY7A 3KIIA 3B8LA 2OQEC 1FA3A 1VQN3 5IG5A 1TTOA 4XDVA 5CF1A 1FGRA 3FF0A 1GS3A 2BNGA 1BRJA 1RRHA 1LQMB 1DVCA 3GAXA 4LZIA 3EHCA 1IVWA 2B24B 4FCJA 1AVLA 2UX0A 1VQQA 1M9GA 2ML6A 1BSAA 5EEOA 3OV4A 2L4VA 2P09A 3MKIA 3PCRA 2GXFA 1BSCA 2XF3A 4FMAA 1IVXA 4N6NB 4N6V0 3WDGB 5KP4A 3UJMA 1GY6A 1RN7A 2CK3H 1C54A 1Q7HA 4BL2A 1RGGA 5BXQA 1Z1SA 1UDII 1Q40B 4WWUC 3IMAB 3MWZA 3MPHA 3I0YA 1IV9A 1W6CA 1I2FA 4FMDA 2CX0A 1B21A 3Q3FA 1B27A 2OOVC 1T2IA 4HZ9B 1M1XB 1W5ZA 1UI8A 2HMMB 3MYTA 4N6OB 1N8R4 5IG3A 1VQM3 1SQWA 1VQ43 1U8CB 4U13A 5M1AA 2KF3A 1BSDA 2J8XB 2Q07A 3PS8A 2HOHA 4H61A 1BRNL 1JNQA 1NO3A 3AMOB 3GZYB 1GY5A 2KF4A 2IA7A 1B2XA 1MOLA 1MWRA 2A15A 5DREA 5LC7A 5STDA 2CFGA 4MEIA 4O02B 3HI7A 5HGRA 3WHOA 1C7HA 1NB5I 3DGYA 1UGIA 3EE1A 1F8NA 1UUVB 5IEPA 1OF5A 2WGQA 1IYYA 2MF7A 2YFIB 1BNJA 1LQGC 4AKYA 1IU7A 2CKFB 2F5WA 2IYJA 1CEWI 2RCDA 2ZDJA 1DMQA 1QALA 1QAFA 2QEX3 1GOUA 1A67A 8RNTA 2BIRA 4ILFA 3D9RA 1PFPA 1JBTA 4PEJA 3WA3A 1GMQA 1IK3A 1GD4A 1TU5A 1ULJB 3FGYA 1MWTA 4HJLB 2CIUA 4RNTA 4XM4A 2XGLA 1JBRA 1NWWA 1KWIA 3I553 4KT3B 4R9KA 4HM8B 3FLJA 5M19A 1EKMA 1O7WB 3K9MC 5IG4A 1QAKA 1S5AA 1K8A4 2GU1A 2STDA 3AMOA 2BMRB 4EW5A 2BU4A 4XBXA 3DGOA 3NQYA 2OWPA 4I5QA 1WMPA 3F14A 3NM2A 7GSPA 1GMPA 2C10A 3BNBA 4LYLB 4O8SA 3NUVA 3NX0A 4FMBA 3CCS3 1CQSA 2RBIA 4K1UA 1OGZA 2R4IA 1V57A 1B2SA 1NDOB 2CW9A 3LTDA 4NREA 2E2VA 3FF2A 4K61A 1RTUA 3MHEA 2XSOB 2P0XA 2F4YA 2E2TA 1BNRA 4RZMA 5JPPA 2B1XB 3M8CA 1CYVA 3ZG0A 5KP1A 1GOYA 1PU4A 1YI23 1RGCA 2IUKA 3QK9A 5G1LA 1DVDA 1W02A 3DM8A 2HMKB 4WYKA 5I97A 1Q864 1CYUA 3SXXA 5BIRA 3BNEA 1JB2A 4BTXA 4RNZA 4X2OA 3RDEA 2RNTA 3G4S3 1JRQA 3NM7A 3J7Yd 3WOEB 1S723 3F8XA 2CG1A 3WODG 4KZ1A 2F98A 1VQ73 1BAOA 1IVUA 2CX1A 4CJNA 1WNHA 4HM7B 1OHOA 3A5EA 3FH1A 5CLKA 5EVHA 3DGLA 5D82A 1TUHA 2D1WA 3NBBA 3CNMA 1ASKA 3LT9A 4RBNA 3F9SA 5G2GA 5G1KA 2GBWB 1VQP3 2XH9A 1HZ1A 1RKYA 1JB5A 1EA2A 1FYSA 1N9JA 2IMJA 3QRDA 4HBRA 1UUGB 1B2ZA 5AIGA 3X40A 1DMMA 5ELJA 1O7PB 3S67A 1I2GA 2CWTA 2O9UX 1AV4A 2BT3A 1UGHI 2CC3A 1BVIA 1D6ZA 2L1SA 3BNDA 3LXUX 4HM1B 1BNIA 4JRFA 3URPA 4MMXB 4EC6A 1RSNA 1ZO2A 2MC8A 1T5YA 2W2CA 3KFQC 2F86B 2E2UA 3EB8A 1FUSA 1NNVA 3G713 3CCV3 3LTAA 3S28A 2K0MA 2Z7AA 4N6MA 3KN4A 3OWUA 1HU9A 1UUWB 2BHMA 4H3UA 3S29A 1T3BA 3JUPA 3RNTA 4BU4A 1EQKA 4J5GA 3FG1A 2HMNB 4OK0A 3U97A 1GY7A 1SJWA 2HMLB 1W6YA 1DMNA 1I8VA 4HM3B 5GSPA 2BMQB 3BU4A 3Q90A 1KD14 2RGQA 1AQZA 1VQ83 1OGXA 1Q9EA 1TRPA 2LYXA 3O8YA 1G02A 3JUNA 3S5CA 3I563 1Q42A 1N5PA 2Y74A 5ELUA 2CG0A 1G96A 1BRGA 7RNTA 1B2UA 1BUJA 5D83A 1SIHA 2BO9B 4EV5A 1NJI4 1FGTA 4OUQA 5AEUB 1K41A 4HKVB 4L7KA 4HZBB 2INXA 3KSPA 4KVHA 2GU3A 4NPBA 2CFKA 1TFOA 1BRHA 1SARA 1W7CA 1IDPA 1AVKA 1BRKA 1STFI 1W6GA 3X3YA 1V58A 3IJEB 1TJDA 3PZWA 1LNHA 2H0IA 3FZWA 1K734 3DGNA 1YIJ3 1RGEA 2CH9A 3GRDA 1JJ22 1PYLA 3NHXA 5AEWB 1OUNA 1RCKA 1Q40A 4BTWA 4RNYA 2M7OA 1UI7A 1X1WA 1BNSA 1OHPA 2QA43 4N6UA 3V98A 2OQEA 1EEJA 1LOXA 1LNIA 4O2HA 4R9LA 4TX4A 4XDWA 4ZM8A 2GSPA 2PNCA 4Q53A 9RNTA 1RNBA 1D6YA 1OHSA 1UW1A 1ROVA 4KFEA 3UL5A 3H3HA 3DGMA 3UB1A 1JBSA 2YFJB 2Z76A 2V1LA 1PY3A 2WO0A 4GSPA 3F40A 1R4CA 4LSOA 2KF5A 2XFSA 3CU3A 5IG0A 2W6JH 2CWVA 2F99A 1B2MA 1O7HB 1JKGB 1BANA 1I0XA 2GBXB 3G6E3 1GMRA 1N5HA 1UCLA 3K7CA 5LC6A 1YNVX 3X42A 4EBGA 1I70A 2CFWA 1RGFA 1WMNA 1YGWA 2BMOB 3SYUA 3NQZA 4NHFA 3T0UA 3N9HA 4K90B 3CCR3 2O3OA 3FSDA 4CCVA 1O7GB 3KE7A 5FGOA 1FUTA 1K28A 3EN1B 3F7SA 1RNTA 1SPUA 1NU3A 1ULIB 3JVCA 3HIIA 3UNLA 8CHOA 1JN5B 3FG4A 3CPW2 1JB4A 1N9EA 1LVNA 2FGTA 4K1VA 3T8NA 1RGAA 2WOFA 3GZXB 1FZUA 3B7CA 1YJW3 3CME3 5IW9A 3OWSA 1A2VA 3OWYA 1K9M4 4GL6A 1W2ZA 2UUGC 3D3LA 1YVSA 3EBTA 2XRXB 4LMIA 1VZZA 1IT8A 1DYUA 1YVBI 3FKAA 3DY5A 4BTYA 5AIHA 3OXAA 3CCM3 3ER7A 3JUOA 1RHLA 2KXGA 4HM5B 1JV2B 3NV0B 4FR9A 4IPBA 1HYFA 1JKGA 2OTJ3 1LOVA 3WR2A 3Q2PA 1R4YA 2SBLA 1MNLA 1I3IA 4GB5A 2KCDA 4HM6B 4L8OA 1RN4A 4EV2A 2SARA 1JZDA 1VQ93 2C4BA 1JZOA 1OACA
chains in the Genus database with same CATH topology
3LTCA 1VQ63 3OX9A 5BVBA 2QGUA 2ZL8A 3CD63 5CK6A 1V74A 4LGQA 3Q1CA 3LMLA 3DXOA 4X2HA 1D6UA 2I9WA 3B4OA 3SX1A 4J9AA 4FCMA 3LT8A 3CCE3 3CC73 4R4KA 3SVAA 4KFDA 2XR8B 2XGNA 1FGMA 4HM4B 3X3ZA 3A76A 3EN8A 1TIJA 3EQQB 3HX8A 3NBRA 1FGQA 3DZLA 3LTBA 2WOHA 3B4PA 3EX9A 1M1K4 3DUKA 1ZX2A 1M904 3LYGA 3N54B 1L5GB 1N8QA 3EBYA 2Z77A 2RSXA 4IT7A 2HMJB 4R80A 1W00A 2CWUA 4MMYB 1AR0A 3HZPA 4FCZA 4HM2B 5DRVA 1KQS2 2D42A 3L0RA 3K63A 3K5TA 1NB3I 3X3XA 4N6TA 5FW5A 1YJ93 2W04A 3UL6A 3EJVA 1IT7A 1YGEA 1E3RA 1OF5B 3GWRA 5A0OB 1HKXA 2P05A 3CNXA 3CC43 3MSOA 2XSHB 4L8PA 3CMA3 3LH4A 1TFKA 1QMAA 2W56B 1YHQ3 1QVG2 3OW22 3U1WA 3RGAA 4HYZA 3F8HA 1BUQA 3N8BA 4STDA 3H51A 5KP3A 2W0QA 3NBJA 1OPYA 3G0KA 2Z6BA 1A2KA 3KKGA 3VF1A 3K0ZA 4KFFA 4R1KA 3V92A 1IV7A 1QJGA 3PXMA 3EF8A 5JPUA 3PCSA 1YJN3 1QVF2 3STDA 5IEOA 3ALAA 5TGNA 6STDA 5AYRB 3MG2A 3CCJ3 3IPTA 1KC84 4XBTA 3EC9A 2JQ5A 1Q814 4XBYA 5IERA 3G16A 4FMCA 4HVNA 1OCVA 1W2B2 1W01A 1IQ8A 3JUQA 5AIIA 5EQLA 4J8TA 1IQXA 1RRLA 4XB5A 3SOYA 1LXEA 1U5OA 3V99A 3ROBA 2GEXA 2XEPA 2W56A 1US1A 3BLZA 5AYSC 4AKZA 5CXOA 1O7MB 5AI1A 3CC23 3JUMA 1IVVA 1WTHA 2LQVA 2ML5A 4I4KA 4EXRA 3CCU3 4MJDA 3MG3A 3DMCA 2YFLB 2W03A 2P0MA 4WYKB 4ORLA 3ECFA 5IENA 2IUJA 3WMDA 4QWTA 2OOVA 1E3VA 1J2BA 3CCL3 1GYBA 3SEDA 2K54A 3NXJA 3SOAA 2CFLA 4N3VA 2OTL3 3GZBA 3SLUA 5CF2A 2W9PA 2HMOB 3TDGA 2RFRA 2KRTA 7STDA 2CHCA 3HK4A 1A90A 4LEHA 3E99A 1FUWA 4HM0B 3WA2X 1ROAA 4WFOA 2PZVA 3FG3A 1RJOA 1WQLB 3LZAA 3PYJA 3PGBA 2FNQA 4WP5A 4AEQA 3FCSB 3KZTA 1ISKA 3WOFB 3HIGA 1JN5A 5D81A 4IIAA 1VQK3 4EYCA 1Y4KA 3GZRA 3BNCA 1SIIA 1TP6A 4OVMA 3T8UA 3CXC2 2W9QA 1GD3A 2C11A 1KSIA 2YX9A 1VQO3 2OCTA 3CCQ3 4G1MB 1WMOA 4N6LA 2JDIH 3G8ZA 5AIFA 3RGRA 3S27A 3KSED 1O7NB 1YIT3 1E97A 1VQ53 3BB9A 1OH0A 2QIYA 3F7XA 1Q7Y4 2Y73A 4MMZB 3VGNA 1W4NA 2GEYA 1EG9B 2P38A 3X41A 3NV0A 3MG1A 4JF8A 2XFTA 1FGOA 3VSYA 1Q824 5JBSA 2WGOA 3CPOA 4O3VA 4WHAA 2CFDA 1IQYA 1STDA 3LOYA 2FXTA 3KIIA 3B8LA 2OQEC 1FA3A 1VQN3 5IG5A 4XDVA 5CF1A 1FGRA 3FF0A 1GS3A 2BNGA 1RRHA 1DVCA 3GAXA 4LZIA 3EHCA 1IVWA 2B24B 4FCJA 1AVLA 2UX0A 1M9GA 2ML6A 5EEOA 3OV4A 2L4VA 2P09A 3MKIA 3PCRA 2GXFA 2XF3A 4FMAA 4N6NB 1IVXA 4N6V0 3WDGB 5KP4A 3UJMA 1GY6A 1RN7A 2CK3H 5BXQA 1Z1SA 1Q40B 4WWUC 3IMAB 3MWZA 3MPHA 3I0YA 1IV9A 1W6CA 4FMDA 2OOVC 4HZ9B 1M1XB 1W5ZA 1UI8A 2HMMB 3MYTA 4N6OB 1N8R4 5IG3A 1VQM3 1SQWA 1VQ43 1U8CB 4U13A 2Q07A 3PS8A 4H61A 1JNQA 1NO3A 3AMOB 3GZYB 1GY5A 5DREA 2IA7A 1MOLA 5LC7A 5STDA 2A15A 4CDLA 1IK3A 2CFGA 4MEIA 4O02B 3HI7A 5HGRA 1C7HA 1NB5I 3EE1A 1F8NA 1UUVB 5IEPA 1OF5A 2WGQA 2MF7A 2YFIB 4AKYA 1IU7A 2CKFB 1CEWI 2RCDA 2ZDJA 1DMQA 1QALA 1QAFA 2QEX3 1A67A 3D9RA 1PFPA 4PEJA 3WA3A 1GD4A 1TU5A 1ULJB 3FGYA 4HJLB 2CIUA 4XM4A 2XGLA 1NWWA 1KWIA 3I553 4R9KA 4HM8B 3FLJA 1EKMA 1O7WB 3K9MC 5IG4A 1QAKA 1S5AA 1K8A4 2GU1A 2STDA 3AMOA 2BMRB 4XBXA 3DGOA 3NQYA 2OWPA 1WMPA 3F14A 3NM2A 2C10A 3BNBA 4O8SA 3NUVA 3NX0A 4FMBA 3CCS3 1CQSA 4K1UA 1OGZA 2R4IA 1NDOB 2CW9A 3LTDA 4NREA 2E2VA 3FF2A 4K61A 3MHEA 2XSOB 2P0XA 2E2TA 4RZMA 5JPPA 2B1XB 3M8CA 1CYVA 5KP1A 1PU4A 1YI23 3QK9A 2IUKA 1DVDA 1W02A 3DM8A 2HMKB 4WYKA 5I97A 1Q864 1CYUA 3SXXA 3BNEA 1JB2A 4BTXA 4RNZA 4X2OA 3RDEA 3G4S3 1JRQA 3NM7A 3J7Yd 3WOEB 1S723 3F8XA 2CG1A 3WODG 4KZ1A 2F98A 1VQ73 1IVUA 1WNHA 4HM7B 1OHOA 3FH1A 5CLKA 5EVHA 3DGLA 5D82A 1TUHA 2D1WA 3NBBA 3CNMA 1ASKA 3LT9A 4RBNA 3F9SA 5G2GA 2GBWB 1VQP3 2XH9A 1RKYA 1JB5A 1EA2A 1N9JA 2IMJA 3QRDA 4HBRA 5AIGA 3X40A 1DMMA 5ELJA 1O7PB 3S67A 2CWTA 2O9UX 1AV4A 2BT3A 5IF6A 2CC3A 1D6ZA 3BNDA 3LXUX 4HM1B 4JRFA 4MMXB 4EC6A 1ZO2A 2MC8A 1T5YA 2W2CA 3KFQC 2F86B 2E2UA 3EB8A 3CCV3 3G713 3LTAA 3S28A 2K0MA 2Z7AA 4N6MA 3KN4A 3OWUA 1HU9A 1UUWB 2BHMA 4H3UA 3S29A 3JUPA 1EQKA 3FG1A 2HMNB 4OK0A 3U97A 1GY7A 1SJWA 2HMLB 1W6YA 1DMNA 4HM3B 1KD14 2BMQB 3Q90A 2RGQA 1VQ83 1OGXA 3O8YA 2LYXA 3JUNA 3S5CA 3I563 1Q42A 1N5PA 2Y74A 5ELUA 2CG0A 1G96A 5D83A 1SIHA 2BO9B 4EV5A 1NJI4 1FGTA 4OUQA 5AEUB 1K41A 4HKVB 4L7KA 4HZBB 2INXA 3KSPA 4KVHA 2GU3A 2CFKA 1TFOA 1W7CA 1IDPA 1AVKA 1STFI 1W6GA 3X3YA 3IJEB 3PZWA 1LNHA 3FZWA 1K734 3DGNA 1YIJ3 2CH9A 3GRDA 1JJ22 3NHXA 5AEWB 1OUNA 1Q40A 4BTWA 4RNYA 2M7OA 1UI7A 1OHPA 2QA43 4N6UA 3V98A 2OQEA 1LOXA 4O2HA 4R9LA 4TX4A 4XDWA 4ZM8A 2PNCA 4Q53A 1D6YA 1OHSA 1UW1A 1ROVA 4KFEA 3UL5A 3H3HA 3DGMA 3UB1A 2YFJB 2Z76A 2V1LA 2WO0A 3F40A 1R4CA 4LSOA 2XFSA 3CU3A 5IG0A 2W6JH 2CWVA 2F99A 1O7HB 1JKGB 1VQL3 2GBXB 3G6E3 3K7CA 1N5HA 5LC6A 3X42A 4EBGA 2CFWA 1WMNA 2BMOB 3NQZA 4NHFA 3T0UA 3N9HA 4K90B 3CCR3 2O3OA 3FSDA 4CCVA 1O7GB 3KE7A 5FGOA 1K28A 3F7SA 3EN1B 1SPUA 1NU3A 1ULIB 3JVCA 3HIIA 3UNLA 8CHOA 1JN5B 3FG4A 3CPW2 1JB4A 1N9EA 1LVNA 2FGTA 4K1VA 3T8NA 2WOFA 3GZXB 3B7CA 1YJW3 3CME3 5IW9A 3OWSA 1A2VA 3OWYA 1K9M4 4GL6A 1W2ZA 3D3LA 3EBTA 2XRXB 4LMIA 1VZZA 1IT8A 1DYUA 1YVBI 3FKAA 3DY5A 4BTYA 5AIHA 3OXAA 3CCM3 3ER7A 3JUOA 2KXGA 4HM5B 1JV2B 3NV0B 4FR9A 4IPBA 2OTJ3 1JKGA 3Q2PA 4GB5A 2SBLA 1MNLA 4HM6B 2KCDA 4L8OA 4EV2A 1VQ93 1OACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LC7 A;  1MOL A;  1EQK A;  1NB5 I;  2W9P A;  1N5P A;  5ELU A;  1CEW I;  3SVA A;  1A90 A;  1G96 A;  1A67 A;  2BO9 B;  1PFP A;  1TIJ A;  1FUW A;  1GD4 A;  1ROA A;  3PYJ A;  1KWI A;  1STF I;  3K9M C;  4IT7 A;  4EYC A;  2CH9 A;  3L0R A;  2W9Q A;  1GD3 A;  1NB3 I;  2OCT A;  4N6T A;  3NX0 A;  4N6L A;  3UL6 A;  3KSE D;  4N6U A;  4TX4 A;  4ZM8 A;  5A0O B;  3UL5 A;  3LH4 A;  1CYV A;  1R4C A;  1DVD A;  1FA3 A;  1CYU A;  5LC6 A;  1N5H A;  1DVC A;  1IV7 A;  3GAX A;  3PXM A;  4CCV A;  4LZI A;  1WNH A;  1M9G A;  4N6V 0;  4N6N B;  1RN7 A;  1N9J A;  3QRD A;  5EQL A;  3IMA B;  3MWZ A;  5ELJ A;  3S67 A;  1LXE A;  2O9U X;  1IV9 A;  1YVB I;  2KXG A;  4N6O B;  3Q2P A;  3KFQ C;  1MNL A;  3PS8 A;  4N6M A; 
#chains in the Genus database with same CATH topology
 3LTC A;  1VQ6 3;  3OX9 A;  5BVB A;  2QGU A;  2AAD A;  1EUI C;  2ZL8 A;  3CD6 3;  5CK6 A;  1V74 A;  4LGQ A;  3Q1C A;  3LML A;  1UCJ A;  3DXO A;  4X2H A;  1D6U A;  2I9W A;  3B4O A;  3SX1 A;  4J9A A;  4FCM A;  3LT8 A;  3CCE 3;  3CC7 3;  1MGW A;  4R4K A;  3SVA A;  1A2P A;  2XR8 B;  4KFD A;  1BIR A;  3D5G A;  2XGN A;  2UGI A;  1X1X A;  1FGM A;  4HM4 B;  3X3Z A;  3A76 A;  3EN8 A;  1TIJ A;  3EQQ B;  3HX8 A;  3NBR A;  1FGQ A;  3DZL A;  3LTB A;  2WOH A;  3B4P A;  3BIR A;  3EX9 A;  1M1K 4;  3DUK A;  1ZX2 A;  1M90 4;  3LYG A;  3N54 B;  1L5G B;  1N8Q A;  3EBY A;  2H0G A;  2Z77 A;  4BIR A;  2RSX A;  4IT7 A;  2HMJ B;  4R80 A;  1W00 A;  1CH0 A;  2CWU A;  1VQL 3;  4MMY B;  1AR0 A;  1LOY A;  3HZP A;  4FCZ A;  4HM2 B;  1UCI A;  5DRV A;  1KQS 2;  1BOX A;  2D42 A;  3L0R A;  2R41 A;  3K63 A;  3K5T A;  1NB3 I;  3X3X A;  4N6T A;  5FW5 A;  1TRQ A;  1YJ9 3;  1T2H A;  2W04 A;  3UL6 A;  1BSE A;  3EJV A;  1IT7 A;  3D79 A;  1YGE A;  1E3R A;  1OF5 B;  3AHS A;  3GWR A;  1HKX A;  2P05 A;  3CNX A;  5A0O B;  3ZG5 A;  1RGH A;  3CC4 3;  3MSO A;  2XSH B;  1FW7 A;  4L8P A;  3CMA 3;  4GHO A;  4CDL A;  3LH4 A;  1I2E A;  1TFK A;  1QMA A;  2W56 B;  1YHQ 3;  1QVG 2;  3OW2 2;  3U1W A;  3RGA A;  4HYZ A;  3F8H A;  2KAA A;  3AGO A;  1BUQ A;  2AAE A;  3N8B A;  4STD A;  1RLS A;  3H51 A;  5KP3 A;  2W0Q A;  3NBJ A;  1OPY A;  3G0K A;  2Z6B A;  1A2K A;  3KKG A;  1MWS A;  3GSP A;  3VF1 A;  3K0Z A;  2KF6 A;  4KFF A;  4R1K A;  3V92 A;  1IV7 A;  1QJG A;  3PXM A;  3EF8 A;  5JPU A;  3PCS A;  1YJN 3;  1QVF 2;  3STD A;  2ZHX B;  5IEO A;  3ALA A;  1UCK A;  2H0H A;  5TGN A;  6STD A;  5AYR B;  3MG2 A;  2F56 A;  1BNF A;  3IPT A;  3CCJ 3;  1KC8 4;  4XBT A;  1G0T A;  1BSB A;  3EC9 A;  2JQ5 A;  1Q81 4;  1X1U A;  4XBY A;  5IER A;  3G16 A;  4FMC A;  4HVN A;  1OCV A;  1W2B 2;  1W01 A;  1IQ8 A;  1ZS7 A;  3JUQ A;  3HOH A;  5AII A;  5EQL A;  4J8T A;  1IQX A;  1RRL A;  4XB5 A;  3SOY A;  1LXE A;  1U5O A;  3V99 A;  1RCL A;  3ROB A;  2GEX A;  3KCH A;  1BNE A;  2XEP A;  2W56 A;  1US1 A;  3BLZ A;  1RN1 A;  5AYS C;  4AKZ A;  5CXO A;  1O7M B;  5AI1 A;  3CC2 3;  3JUM A;  1BRI A;  3DH2 A;  5RNT A;  1IVV A;  1WTH A;  2LQV A;  2ML5 A;  4I4K A;  4EXR A;  3CCU 3;  1B20 A;  4MJD A;  3MG3 A;  3DMC A;  2YFL B;  5HOH A;  6GSP A;  4J5K A;  2W03 A;  2P0M A;  4WYK B;  4ORL A;  3ECF A;  5IEN A;  4BL3 A;  2IUJ A;  3WMD A;  4QWT A;  2OOV A;  1E3V A;  1B3S A;  1J2B A;  3CCL 3;  1GYB A;  3SED A;  2K54 A;  3NXJ A;  3SOA A;  2CFL A;  4N3V A;  2OTL 3;  3GZB A;  3SLU A;  5CF2 A;  2W9P A;  2HMO B;  2F5M A;  2RFR A;  3TDG A;  2KRT A;  1MGR A;  7STD A;  2CHC A;  3HK4 A;  1DE3 A;  1A90 A;  1RGK A;  1I0V A;  3E99 A;  4LEH A;  5IF6 A;  3ZFZ A;  5M18 A;  1RMS A;  1FUW A;  1BU4 A;  4HM0 B;  1BRS A;  3WA2 X;  1MWU A;  1ROA A;  1GSP A;  4WFO A;  2PZV A;  3FG3 A;  1RJO A;  1WQL B;  3LZA A;  1RDS A;  3PYJ A;  1ZGX A;  3PGB A;  2FNQ A;  2K3D A;  4WP5 A;  4AEQ A;  3FCS B;  3KZT A;  1ISK A;  3WOF B;  1GOV A;  3HIG A;  1JN5 A;  1X1Y A;  4HOH A;  5D81 A;  4IIA A;  4CPK A;  5BU4 A;  1RGL A;  1VQK 3;  4EYC A;  1Y4K A;  3GZR A;  1DET A;  1SII A;  1TP6 A;  3BNC A;  4OVM A;  3T8U A;  3CXC 2;  2W9Q A;  1GD3 A;  2C11 A;  1KSI A;  2YX9 A;  1VQO 3;  2OCT A;  2IY2 A;  3CCQ 3;  4G1M B;  1BNG A;  1WMO A;  4N6L A;  2JDI H;  3G8Z A;  5AIF A;  1LOW A;  4HAA A;  3RGR A;  3S27 A;  4DKI A;  3KSE D;  1O7N B;  1YIT 3;  1E97 A;  3D4A A;  3BB9 A;  1OH0 A;  2QIY A;  3D5I A;  3F7X A;  2Y73 A;  1Q7Y 4;  1VQ5 3;  4MMZ B;  2ZA4 A;  3VGN A;  1W4N A;  2GEY A;  1EG9 B;  1LRA A;  2P38 A;  3X41 A;  3NV0 A;  3MG1 A;  4JF8 A;  1I3F A;  1FGO A;  2XFT A;  3AGN A;  3VSY A;  6RNT A;  1BGS A;  5JBS A;  2WGO A;  3CPO A;  1Q82 4;  4O3V A;  3AHW A;  2CFD A;  4WHA A;  1IQY A;  1STD A;  3LOY A;  2FXT A;  1AY7 A;  3KII A;  3B8L A;  2OQE C;  1FA3 A;  1VQN 3;  5IG5 A;  1TTO A;  4XDV A;  5CF1 A;  1FGR A;  3FF0 A;  1GS3 A;  2BNG A;  1BRJ A;  1RRH A;  1LQM B;  1DVC A;  3GAX A;  4LZI A;  3EHC A;  1IVW A;  2B24 B;  4FCJ A;  1AVL A;  2UX0 A;  1VQQ A;  1M9G A;  2ML6 A;  1BSA A;  5EEO A;  3OV4 A;  2L4V A;  2P09 A;  3MKI A;  3PCR A;  2GXF A;  1BSC A;  2XF3 A;  4FMA A;  1IVX A;  4N6N B;  4N6V 0;  3WDG B;  5KP4 A;  3UJM A;  1GY6 A;  1RN7 A;  2CK3 H;  1C54 A;  1Q7H A;  4BL2 A;  1RGG A;  5BXQ A;  1Z1S A;  1UDI I;  1Q40 B;  4WWU C;  3IMA B;  3MWZ A;  3MPH A;  3I0Y A;  1IV9 A;  1W6C A;  1I2F A;  4FMD A;  2CX0 A;  1B21 A;  3Q3F A;  1B27 A;  2OOV C;  1T2I A;  4HZ9 B;  1M1X B;  1W5Z A;  1UI8 A;  2HMM B;  3MYT A;  4N6O B;  1N8R 4;  5IG3 A;  1VQM 3;  1SQW A;  1VQ4 3;  1U8C B;  4U13 A;  5M1A A;  2KF3 A;  1BSD A;  2J8X B;  2Q07 A;  3PS8 A;  2HOH A;  4H61 A;  1BRN L;  1JNQ A;  1NO3 A;  3AMO B;  3GZY B;  1GY5 A;  2KF4 A;  2IA7 A;  1B2X A;  1MOL A;  1MWR A;  2A15 A;  5DRE A;  5LC7 A;  5STD A;  2CFG A;  4MEI A;  4O02 B;  3HI7 A;  5HGR A;  3WHO A;  1C7H A;  1NB5 I;  3DGY A;  1UGI A;  3EE1 A;  1F8N A;  1UUV B;  5IEP A;  1OF5 A;  2WGQ A;  1IYY A;  2MF7 A;  2YFI B;  1BNJ A;  1LQG C;  4AKY A;  1IU7 A;  2CKF B;  2F5W A;  2IYJ A;  1CEW I;  2RCD A;  2ZDJ A;  1DMQ A;  1QAL A;  1QAF A;  2QEX 3;  1GOU A;  1A67 A;  8RNT A;  2BIR A;  4ILF A;  3D9R A;  1PFP A;  1JBT A;  4PEJ A;  3WA3 A;  1GMQ A;  1IK3 A;  1GD4 A;  1TU5 A;  1ULJ B;  3FGY A;  1MWT A;  4HJL B;  2CIU A;  4RNT A;  4XM4 A;  2XGL A;  1JBR A;  1NWW A;  1KWI A;  3I55 3;  4KT3 B;  4R9K A;  4HM8 B;  3FLJ A;  5M19 A;  1EKM A;  1O7W B;  3K9M C;  5IG4 A;  1QAK A;  1S5A A;  1K8A 4;  2GU1 A;  2STD A;  3AMO A;  2BMR B;  4EW5 A;  2BU4 A;  4XBX A;  3DGO A;  3NQY A;  2OWP A;  4I5Q A;  1WMP A;  3F14 A;  3NM2 A;  7GSP A;  1GMP A;  2C10 A;  3BNB A;  4LYL B;  4O8S A;  3NUV A;  3NX0 A;  4FMB A;  3CCS 3;  1CQS A;  2RBI A;  4K1U A;  1OGZ A;  2R4I A;  1V57 A;  1B2S A;  1NDO B;  2CW9 A;  3LTD A;  4NRE A;  2E2V A;  3FF2 A;  4K61 A;  1RTU A;  3MHE A;  2XSO B;  2P0X A;  2F4Y A;  2E2T A;  1BNR A;  4RZM A;  5JPP A;  2B1X B;  3M8C A;  1CYV A;  3ZG0 A;  5KP1 A;  1GOY A;  1PU4 A;  1YI2 3;  1RGC A;  2IUK A;  3QK9 A;  5G1L A;  1DVD A;  1W02 A;  3DM8 A;  2HMK B;  4WYK A;  5I97 A;  1Q86 4;  1CYU A;  3SXX A;  5BIR A;  3BNE A;  1JB2 A;  4BTX A;  4RNZ A;  4X2O A;  3RDE A;  2RNT A;  3G4S 3;  1JRQ A;  3NM7 A;  3J7Y d;  3WOE B;  1S72 3;  3F8X A;  2CG1 A;  3WOD G;  4KZ1 A;  2F98 A;  1VQ7 3;  1BAO A;  1IVU A;  2CX1 A;  4CJN A;  1WNH A;  4HM7 B;  1OHO A;  3A5E A;  3FH1 A;  5CLK A;  5EVH A;  3DGL A;  5D82 A;  1TUH A;  2D1W A;  3NBB A;  3CNM A;  1ASK A;  3LT9 A;  4RBN A;  3F9S A;  5G2G A;  5G1K A;  2GBW B;  1VQP 3;  2XH9 A;  1HZ1 A;  1RKY A;  1JB5 A;  1EA2 A;  1FYS A;  1N9J A;  2IMJ A;  3QRD A;  4HBR A;  1UUG B;  1B2Z A;  5AIG A;  3X40 A;  1DMM A;  5ELJ A;  1O7P B;  3S67 A;  1I2G A;  2CWT A;  2O9U X;  1AV4 A;  2BT3 A;  1UGH I;  2CC3 A;  1BVI A;  1D6Z A;  2L1S A;  3BND A;  3LXU X;  4HM1 B;  1BNI A;  4JRF A;  3URP A;  4MMX B;  4EC6 A;  1RSN A;  1ZO2 A;  2MC8 A;  1T5Y A;  2W2C A;  3KFQ C;  2F86 B;  2E2U A;  3EB8 A;  1FUS A;  1NNV A;  3G71 3;  3CCV 3;  3LTA A;  3S28 A;  2K0M A;  2Z7A A;  4N6M A;  3KN4 A;  3OWU A;  1HU9 A;  1UUW B;  2BHM A;  4H3U A;  3S29 A;  1T3B A;  3JUP A;  3RNT A;  4BU4 A;  1EQK A;  4J5G A;  3FG1 A;  2HMN B;  4OK0 A;  3U97 A;  1GY7 A;  1SJW A;  2HML B;  1W6Y A;  1DMN A;  1I8V A;  4HM3 B;  5GSP A;  2BMQ B;  3BU4 A;  3Q90 A;  1KD1 4;  2RGQ A;  1AQZ A;  1VQ8 3;  1OGX A;  1Q9E A;  1TRP A;  2LYX A;  3O8Y A;  1G02 A;  3JUN A;  3S5C A;  3I56 3;  1Q42 A;  1N5P A;  2Y74 A;  5ELU A;  2CG0 A;  1G96 A;  1BRG A;  7RNT A;  1B2U A;  1BUJ A;  5D83 A;  1SIH A;  2BO9 B;  4EV5 A;  1NJI 4;  1FGT A;  4OUQ A;  5AEU B;  1K41 A;  4HKV B;  4L7K A;  4HZB B;  2INX A;  3KSP A;  4KVH A;  2GU3 A;  4NPB A;  2CFK A;  1TFO A;  1BRH A;  1SAR A;  1W7C A;  1IDP A;  1AVK A;  1BRK A;  1STF I;  1W6G A;  3X3Y A;  1V58 A;  3IJE B;  1TJD A;  3PZW A;  1LNH A;  2H0I A;  3FZW A;  1K73 4;  3DGN A;  1YIJ 3;  1RGE A;  2CH9 A;  3GRD A;  1JJ2 2;  1PYL A;  3NHX A;  5AEW B;  1OUN A;  1RCK A;  1Q40 A;  4BTW A;  4RNY A;  2M7O A;  1UI7 A;  1X1W A;  1BNS A;  1OHP A;  2QA4 3;  4N6U A;  3V98 A;  2OQE A;  1EEJ A;  1LOX A;  1LNI A;  4O2H A;  4R9L A;  4TX4 A;  4XDW A;  4ZM8 A;  2GSP A;  2PNC A;  4Q53 A;  9RNT A;  1RNB A;  1D6Y A;  1OHS A;  1UW1 A;  1ROV A;  4KFE A;  3UL5 A;  3H3H A;  3DGM A;  3UB1 A;  1JBS A;  2YFJ B;  2Z76 A;  2V1L A;  1PY3 A;  2WO0 A;  4GSP A;  3F40 A;  1R4C A;  4LSO A;  2KF5 A;  2XFS A;  3CU3 A;  5IG0 A;  2W6J H;  2CWV A;  2F99 A;  1B2M A;  1O7H B;  1JKG B;  1BAN A;  1I0X A;  2GBX B;  3G6E 3;  1GMR A;  1N5H A;  1UCL A;  3K7C A;  5LC6 A;  1YNV X;  3X42 A;  4EBG A;  1I70 A;  2CFW A;  1RGF A;  1WMN A;  1YGW A;  2BMO B;  3SYU A;  3NQZ A;  4NHF A;  3T0U A;  3N9H A;  4K90 B;  3CCR 3;  2O3O A;  3FSD A;  4CCV A;  1O7G B;  3KE7 A;  5FGO A;  1FUT A;  1K28 A;  3EN1 B;  3F7S A;  1RNT A;  1SPU A;  1NU3 A;  1ULI B;  3JVC A;  3HII A;  3UNL A;  8CHO A;  1JN5 B;  3FG4 A;  3CPW 2;  1JB4 A;  1N9E A;  1LVN A;  2FGT A;  4K1V A;  3T8N A;  1RGA A;  2WOF A;  3GZX B;  1FZU A;  3B7C A;  1YJW 3;  3CME 3;  5IW9 A;  3OWS A;  1A2V A;  3OWY A;  1K9M 4;  4GL6 A;  1W2Z A;  2UUG C;  3D3L A;  1YVS A;  3EBT A;  2XRX B;  4LMI A;  1VZZ A;  1IT8 A;  1DYU A;  1YVB I;  3FKA A;  3DY5 A;  4BTY A;  5AIH A;  3OXA A;  3CCM 3;  3ER7 A;  3JUO A;  1RHL A;  2KXG A;  4HM5 B;  1JV2 B;  3NV0 B;  4FR9 A;  4IPB A;  1HYF A;  1JKG A;  2OTJ 3;  1LOV A;  3WR2 A;  3Q2P A;  1R4Y A;  2SBL A;  1MNL A;  1I3I A;  4GB5 A;  2KCD A;  4HM6 B;  4L8O A;  1RN4 A;  4EV2 A;  2SAR A;  1JZD A;  1VQ9 3;  2C4B A;  1JZO A;  1OAC A; 
#chains in the Genus database with same CATH homology
 3LTC A;  1VQ6 3;  3OX9 A;  5BVB A;  2QGU A;  2ZL8 A;  3CD6 3;  5CK6 A;  1V74 A;  4LGQ A;  3Q1C A;  3LML A;  3DXO A;  4X2H A;  1D6U A;  2I9W A;  3B4O A;  3SX1 A;  4J9A A;  4FCM A;  3LT8 A;  3CCE 3;  3CC7 3;  4R4K A;  3SVA A;  4KFD A;  2XR8 B;  2XGN A;  1FGM A;  4HM4 B;  3X3Z A;  3A76 A;  3EN8 A;  1TIJ A;  3EQQ B;  3HX8 A;  3NBR A;  1FGQ A;  3DZL A;  3LTB A;  2WOH A;  3B4P A;  3EX9 A;  1M1K 4;  3DUK A;  1ZX2 A;  1M90 4;  3LYG A;  3N54 B;  1L5G B;  1N8Q A;  3EBY A;  2Z77 A;  2RSX A;  4IT7 A;  2HMJ B;  4R80 A;  1W00 A;  2CWU A;  4MMY B;  1AR0 A;  3HZP A;  4FCZ A;  4HM2 B;  5DRV A;  1KQS 2;  2D42 A;  3L0R A;  3K63 A;  3K5T A;  1NB3 I;  3X3X A;  4N6T A;  5FW5 A;  1YJ9 3;  2W04 A;  3UL6 A;  3EJV A;  1IT7 A;  1YGE A;  1E3R A;  1OF5 B;  3GWR A;  5A0O B;  1HKX A;  2P05 A;  3CNX A;  3CC4 3;  3MSO A;  2XSH B;  4L8P A;  3CMA 3;  3LH4 A;  1TFK A;  1QMA A;  2W56 B;  1YHQ 3;  1QVG 2;  3OW2 2;  3U1W A;  3RGA A;  4HYZ A;  3F8H A;  1BUQ A;  3N8B A;  4STD A;  3H51 A;  5KP3 A;  2W0Q A;  3NBJ A;  1OPY A;  3G0K A;  2Z6B A;  1A2K A;  3KKG A;  3VF1 A;  3K0Z A;  4KFF A;  4R1K A;  3V92 A;  1IV7 A;  1QJG A;  3PXM A;  3EF8 A;  5JPU A;  3PCS A;  1YJN 3;  1QVF 2;  3STD A;  5IEO A;  3ALA A;  5TGN A;  6STD A;  5AYR B;  3MG2 A;  3CCJ 3;  3IPT A;  1KC8 4;  4XBT A;  3EC9 A;  2JQ5 A;  1Q81 4;  4XBY A;  5IER A;  3G16 A;  4FMC A;  4HVN A;  1OCV A;  1W2B 2;  1W01 A;  1IQ8 A;  3JUQ A;  5AII A;  5EQL A;  4J8T A;  1IQX A;  1RRL A;  4XB5 A;  3SOY A;  1LXE A;  1U5O A;  3V99 A;  3ROB A;  2GEX A;  2XEP A;  2W56 A;  1US1 A;  3BLZ A;  5AYS C;  4AKZ A;  5CXO A;  1O7M B;  5AI1 A;  3CC2 3;  3JUM A;  1IVV A;  1WTH A;  2LQV A;  2ML5 A;  4I4K A;  4EXR A;  3CCU 3;  4MJD A;  3MG3 A;  3DMC A;  2YFL B;  2W03 A;  2P0M A;  4WYK B;  4ORL A;  3ECF A;  5IEN A;  2IUJ A;  3WMD A;  4QWT A;  2OOV A;  1E3V A;  1J2B A;  3CCL 3;  1GYB A;  3SED A;  2K54 A;  3NXJ A;  3SOA A;  2CFL A;  4N3V A;  2OTL 3;  3GZB A;  3SLU A;  5CF2 A;  2W9P A;  2HMO B;  3TDG A;  2RFR A;  2KRT A;  7STD A;  2CHC A;  3HK4 A;  1A90 A;  4LEH A;  3E99 A;  1FUW A;  4HM0 B;  3WA2 X;  1ROA A;  4WFO A;  2PZV A;  3FG3 A;  1RJO A;  1WQL B;  3LZA A;  3PYJ A;  3PGB A;  2FNQ A;  4WP5 A;  4AEQ A;  3FCS B;  3KZT A;  1ISK A;  3WOF B;  3HIG A;  1JN5 A;  5D81 A;  4IIA A;  1VQK 3;  4EYC A;  1Y4K A;  3GZR A;  3BNC A;  1SII A;  1TP6 A;  4OVM A;  3T8U A;  3CXC 2;  2W9Q A;  1GD3 A;  2C11 A;  1KSI A;  2YX9 A;  1VQO 3;  2OCT A;  3CCQ 3;  4G1M B;  1WMO A;  4N6L A;  2JDI H;  3G8Z A;  5AIF A;  3RGR A;  3S27 A;  3KSE D;  1O7N B;  1YIT 3;  1E97 A;  1VQ5 3;  3BB9 A;  1OH0 A;  2QIY A;  3F7X A;  1Q7Y 4;  2Y73 A;  4MMZ B;  3VGN A;  1W4N A;  2GEY A;  1EG9 B;  2P38 A;  3X41 A;  3NV0 A;  3MG1 A;  4JF8 A;  2XFT A;  1FGO A;  3VSY A;  1Q82 4;  5JBS A;  2WGO A;  3CPO A;  4O3V A;  4WHA A;  2CFD A;  1IQY A;  1STD A;  3LOY A;  2FXT A;  3KII A;  3B8L A;  2OQE C;  1FA3 A;  1VQN 3;  5IG5 A;  4XDV A;  5CF1 A;  1FGR A;  3FF0 A;  1GS3 A;  2BNG A;  1RRH A;  1DVC A;  3GAX A;  4LZI A;  3EHC A;  1IVW A;  2B24 B;  4FCJ A;  1AVL A;  2UX0 A;  1M9G A;  2ML6 A;  5EEO A;  3OV4 A;  2L4V A;  2P09 A;  3MKI A;  3PCR A;  2GXF A;  2XF3 A;  4FMA A;  4N6N B;  1IVX A;  4N6V 0;  3WDG B;  5KP4 A;  3UJM A;  1GY6 A;  1RN7 A;  2CK3 H;  5BXQ A;  1Z1S A;  1Q40 B;  4WWU C;  3IMA B;  3MWZ A;  3MPH A;  3I0Y A;  1IV9 A;  1W6C A;  4FMD A;  2OOV C;  4HZ9 B;  1M1X B;  1W5Z A;  1UI8 A;  2HMM B;  3MYT A;  4N6O B;  1N8R 4;  5IG3 A;  1VQM 3;  1SQW A;  1VQ4 3;  1U8C B;  4U13 A;  2Q07 A;  3PS8 A;  4H61 A;  1JNQ A;  1NO3 A;  3AMO B;  3GZY B;  1GY5 A;  5DRE A;  2IA7 A;  1MOL A;  5LC7 A;  5STD A;  2A15 A;  4CDL A;  1IK3 A;  2CFG A;  4MEI A;  4O02 B;  3HI7 A;  5HGR A;  1C7H A;  1NB5 I;  3EE1 A;  1F8N A;  1UUV B;  5IEP A;  1OF5 A;  2WGQ A;  2MF7 A;  2YFI B;  4AKY A;  1IU7 A;  2CKF B;  1CEW I;  2RCD A;  2ZDJ A;  1DMQ A;  1QAL A;  1QAF A;  2QEX 3;  1A67 A;  3D9R A;  1PFP A;  4PEJ A;  3WA3 A;  1GD4 A;  1TU5 A;  1ULJ B;  3FGY A;  4HJL B;  2CIU A;  4XM4 A;  2XGL A;  1NWW A;  1KWI A;  3I55 3;  4R9K A;  4HM8 B;  3FLJ A;  1EKM A;  1O7W B;  3K9M C;  5IG4 A;  1QAK A;  1S5A A;  1K8A 4;  2GU1 A;  2STD A;  3AMO A;  2BMR B;  4XBX A;  3DGO A;  3NQY A;  2OWP A;  1WMP A;  3F14 A;  3NM2 A;  2C10 A;  3BNB A;  4O8S A;  3NUV A;  3NX0 A;  4FMB A;  3CCS 3;  1CQS A;  4K1U A;  1OGZ A;  2R4I A;  1NDO B;  2CW9 A;  3LTD A;  4NRE A;  2E2V A;  3FF2 A;  4K61 A;  3MHE A;  2XSO B;  2P0X A;  2E2T A;  4RZM A;  5JPP A;  2B1X B;  3M8C A;  1CYV A;  5KP1 A;  1PU4 A;  1YI2 3;  3QK9 A;  2IUK A;  1DVD A;  1W02 A;  3DM8 A;  2HMK B;  4WYK A;  5I97 A;  1Q86 4;  1CYU A;  3SXX A;  3BNE A;  1JB2 A;  4BTX A;  4RNZ A;  4X2O A;  3RDE A;  3G4S 3;  1JRQ A;  3NM7 A;  3J7Y d;  3WOE B;  1S72 3;  3F8X A;  2CG1 A;  3WOD G;  4KZ1 A;  2F98 A;  1VQ7 3;  1IVU A;  1WNH A;  4HM7 B;  1OHO A;  3FH1 A;  5CLK A;  5EVH A;  3DGL A;  5D82 A;  1TUH A;  2D1W A;  3NBB A;  3CNM A;  1ASK A;  3LT9 A;  4RBN A;  3F9S A;  5G2G A;  2GBW B;  1VQP 3;  2XH9 A;  1RKY A;  1JB5 A;  1EA2 A;  1N9J A;  2IMJ A;  3QRD A;  4HBR A;  5AIG A;  3X40 A;  1DMM A;  5ELJ A;  1O7P B;  3S67 A;  2CWT A;  2O9U X;  1AV4 A;  2BT3 A;  5IF6 A;  2CC3 A;  1D6Z A;  3BND A;  3LXU X;  4HM1 B;  4JRF A;  4MMX B;  4EC6 A;  1ZO2 A;  2MC8 A;  1T5Y A;  2W2C A;  3KFQ C;  2F86 B;  2E2U A;  3EB8 A;  3CCV 3;  3G71 3;  3LTA A;  3S28 A;  2K0M A;  2Z7A A;  4N6M A;  3KN4 A;  3OWU A;  1HU9 A;  1UUW B;  2BHM A;  4H3U A;  3S29 A;  3JUP A;  1EQK A;  3FG1 A;  2HMN B;  4OK0 A;  3U97 A;  1GY7 A;  1SJW A;  2HML B;  1W6Y A;  1DMN A;  4HM3 B;  1KD1 4;  2BMQ B;  3Q90 A;  2RGQ A;  1VQ8 3;  1OGX A;  3O8Y A;  2LYX A;  3JUN A;  3S5C A;  3I56 3;  1Q42 A;  1N5P A;  2Y74 A;  5ELU A;  2CG0 A;  1G96 A;  5D83 A;  1SIH A;  2BO9 B;  4EV5 A;  1NJI 4;  1FGT A;  4OUQ A;  5AEU B;  1K41 A;  4HKV B;  4L7K A;  4HZB B;  2INX A;  3KSP A;  4KVH A;  2GU3 A;  2CFK A;  1TFO A;  1W7C A;  1IDP A;  1AVK A;  1STF I;  1W6G A;  3X3Y A;  3IJE B;  3PZW A;  1LNH A;  3FZW A;  1K73 4;  3DGN A;  1YIJ 3;  2CH9 A;  3GRD A;  1JJ2 2;  3NHX A;  5AEW B;  1OUN A;  1Q40 A;  4BTW A;  4RNY A;  2M7O A;  1UI7 A;  1OHP A;  2QA4 3;  4N6U A;  3V98 A;  2OQE A;  1LOX A;  4O2H A;  4R9L A;  4TX4 A;  4XDW A;  4ZM8 A;  2PNC A;  4Q53 A;  1D6Y A;  1OHS A;  1UW1 A;  1ROV A;  4KFE A;  3UL5 A;  3H3H A;  3DGM A;  3UB1 A;  2YFJ B;  2Z76 A;  2V1L A;  2WO0 A;  3F40 A;  1R4C A;  4LSO A;  2XFS A;  3CU3 A;  5IG0 A;  2W6J H;  2CWV A;  2F99 A;  1O7H B;  1JKG B;  1VQL 3;  2GBX B;  3G6E 3;  3K7C A;  1N5H A;  5LC6 A;  3X42 A;  4EBG A;  2CFW A;  1WMN A;  2BMO B;  3NQZ A;  4NHF A;  3T0U A;  3N9H A;  4K90 B;  3CCR 3;  2O3O A;  3FSD A;  4CCV A;  1O7G B;  3KE7 A;  5FGO A;  1K28 A;  3F7S A;  3EN1 B;  1SPU A;  1NU3 A;  1ULI B;  3JVC A;  3HII A;  3UNL A;  8CHO A;  1JN5 B;  3FG4 A;  3CPW 2;  1JB4 A;  1N9E A;  1LVN A;  2FGT A;  4K1V A;  3T8N A;  2WOF A;  3GZX B;  3B7C A;  1YJW 3;  3CME 3;  5IW9 A;  3OWS A;  1A2V A;  3OWY A;  1K9M 4;  4GL6 A;  1W2Z A;  3D3L A;  3EBT A;  2XRX B;  4LMI A;  1VZZ A;  1IT8 A;  1DYU A;  1YVB I;  3FKA A;  3DY5 A;  4BTY A;  5AIH A;  3OXA A;  3CCM 3;  3ER7 A;  3JUO A;  2KXG A;  4HM5 B;  1JV2 B;  3NV0 B;  4FR9 A;  4IPB A;  2OTJ 3;  1JKG A;  3Q2P A;  4GB5 A;  2SBL A;  1MNL A;  4HM6 B;  2KCD A;  4L8O A;  4EV2 A;  1VQ9 3;  1OAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...