1RODA

Chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
b'SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPASPIVKKIIEKMLNSDKSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of a chimeric interleukin-8-melanoma-growth-stimulatory-activity protein.
pubmed doi rcsb
molecule keywords CHIMERIC PROTEIN OF INTERLEUKIN 8 AND HUMAN MELANOMA GROWTH
source organism Homo sapiens
molecule tags Chemokine
total genus 10
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rodA00
3MWYW 3DEPA 3DEOA 4ZKBB 2BDNA 2J7ZA 4X3UA 5JJZA 5EJWA 3TN2A 1WTQA 5EPJA 5EKIA 2FHTA 2K28A 1MGSA 1SDFA 3GV3A 4QUCA 4X3KA 1HUNA 1KNEA 2FINB 4HCSA 3I8ZA 3I91A 5COYA 1EQTA 1NCVA 2IL8A 1CM9A 3ONAB 1O7ZA 1A15A 3LWEA 2DY7A 1ZXTA 4X3TA 1VMCA 5E4XA 2L1BA 1KNAA 1ICWA 1NAPA 1HFNA 1MI2A 1WTPA 2MPMA 1DOMA 4RWSC 5CORA 5EPLA 2VXWA 1WTOA 2X69A 2XIWA 1AP0A 1PFNA 2B2YC 2KECA 1G2TA 1QG7A 5T1IA 4OIJA 2SDFA 1Q3LA 1IKMA 3H91A 2FFKB 4MHEA 5DNFA 1MSHA 2FJ2A 1F9RA 3N52A 2FMMA 2B2UA 2MGSA 1M8AA 2N88A 4IUVA 2L11A 3IL8A 1U4MA 1G91A 1XX8A 2KEDA 2Q8RE 3I3CA 4IUUA 2MP1A 1X32A 4CJ0B 1AZPA 1RTNA 1JICA 2Q8TA 3KUPA 2K1BA 1RJTA 4CJ1B 5E4WC 5CMDA 3GV6A 1XYIA 3D6WA 1ESRA 4XT3B 1BBXC 3F2UA 2MJ8A 1B2TA 1O7YA 2KVMA 1F2LA 4OIKA 2CVRA 1RHPA 2D9UA 2HCCA 4RA8A 2K05A 1F9PA 2L9HA 3FPUB 4R9WA 1SAPA 1B4OA 2B2VA 1SSOA 1CA5A 1EIGA 3KBXA 4DN4M 1B3AA 3SVMA 2B2TA 4IURA 2DY8A 1EIHA 4O42A 1PDQA 1HUMA 1U4RA 1PLFA 2HUGA 4LMQD 5T1GA 4ZKCB 1LV9A 2H1EA 4R8IA 1WTXA 2RVLA 1BF4A 4HAEA 2K04A 3G7LA 4HSVA 1G6ZA 2JYOA 4IUPA 3R93A 1WD1A 1IKLA 4RAUC 4CJ2C 1B53A 1WVLA 2N55A 1EL0A 4ZLTF 1X3QA 1DZ1A 1C8CA 2B2UC 1CA6A 2K03A 4UAIA 1IL8A 5EQ0A 1WTRA 1E0BA 2HDMA 2KEEA 2L12A 4NW2A 2B2WA 1VMPA 1J9OA 1QNKA 2NWGA 4XT1B 1J8IA 1HHVA 1PFMA 2KUMA 1QE6A 4QUFA 3IFDA 4ZK9B 2KOLA 1WD0A 1DOLA 1PFBA 1ILPA 5CBEE 3DM1A 5EPKA 1B50A 1NR4A 1RODA 1S4ZA 2K01A 2NYZD 3QO2A 2X6LA 4U68A 2HDLA 2HCIA 1JE4A 2B2VC 2RSOA 1F9QA 5D14A 1MSGA 1BO0A 1F9SA 1WTWA 3TZDA 3MTSA 4IUTA 1BNZA 2B2TC 1GUWA 1NR2A 4MN3A 4X3SA 4XDXA 2JP1A 3HP3A 1EOTA 1U4PA 2X6GA 1DONA 2B2YA 4ZAIA 1WTVA 1RTOA 3Q6SA 1G2SA 1HA6A 1U4LA 2R3ZA 5AFWA 1DOKA 1O80A 1TVXA 4IUQA 2NZ1D 3UI2A 1ML0D 2RA4A 1HFGA 2EPBA 1AZQA 1X3PA 2EE1A 5D65A 2RSNA 3P7JA 5CBAE 3FDTA 2M2LA 2L4NA 4HEDA 2B2WC 1HRJA 1ILQA 2EOTA 3I90A
chains in the Genus database with same CATH superfamily
3I4NG 4IJHA 4BY7H 1JJ2A 1X3FA 2YV5A 3E5SA 1LTSD 1XMOL 1KNEA 4NXMQ 2JJQA 1O7ZA 3LWEA 4R4OA 2AUJD 4IN3A 1KNAA 3J81E 1NAPA 3TEHB 4LF8Q 4DV6L 2OQKA 5CV7A 5CORA 4KI0A 3H94A 5IT9E 3HOWH 1AP0A 4A3BG 2TMPA 1G2TA 4DR1L 4OIJA 4KV6A 4LF4L 1IKMA 1GUSA 4GKKQ 4LF9Q 3RN5A 1VQJA 1GUGA 2B2UA 1M8AA 3EJIA 2HHHQ 4V190 2R7DA 1PXUA 2B29A 2A68C 2XRSD 4C3IH 3PSIA 1X32A 1H9MA 4R4IA 2F0JA 3PV0A 5I2YA 2VL6A 2OQ0A 4TQUS 2RKSA 3E6ZX 2DJFC 4RFBA 1H9JA 4G57A 2P5ZX 4DV1Q 1YJNA 3DWPA 2D2CC 4OEMB 2CVRA 4A3BB 4KN7C 2Z1CA 1JJCB 2JA7B 3RLNA 2F0WA 2E5LL 2KHSA 5ELBA 4Q5VA 5C3EG 2I5HA 4O42A 4DK3C 1PDQA 5C4JH 4LMQD 1E1OA 1JCKB 2H1EA 1X6OA 1WTXA 1LUZA 3HZXA 1T5EA 3G7LA 2DGYA 3HFZB 3R93A 1WOCA 4AQYL 4DR4L 1IBKQ 4MTNA 4K0KL 2NVTB 5I9OA 2OT2A 3TRZA 4JBJA 4A3JH 3GTKH 4AIMA 3HOUG 2LS01 1XTCD 2YYZA 5IGCA 1QE6A 3J7AF 1XJVA 5DM63 2JA5H 4OO1I 3S2DH 1G51A 1R4PB 3STBD 2RBMA 5I9PA 3AMUA 4JI4Q 4GOPA 2Q2IA 4K14A 1EUJA 4DV0L 4CHTB 5LMNQ 1M4VA 2RCNA 4XDXA 1EOTA 1U4PA 1M90C 1E3PA 3HOUB 5CV5A 1LO5D 4GLAC 1CZGA 2B8FA 5IP9G 3HOZG 2VUMG 3MXNB 3OIQA 3BVZA 1QUQB 2ENBA 1HCZA 4IQZA 1T5XD 2E74C 4P73A 5J22A 1U5KA 3H15A 3UE1A 3CRKC 1HZCA 5JJLA 1WTQA 4A3MH 3URYA 4LFCL 1EQTA 4DK0A 3HOZB 3Q23A 1A62A 2A73B 4OHJA 3HGBA 5M5WH 1CHQD 3H0GG 3I4MB 4BY7G 1I94Q 1B9NA 2FJ2A 3N52A 2FMMA 3TBIB 2UUBQ 2PPBC 3IL8A 3SR1A 2F0LA 1XMQL 5M3FG 1VQGA 4U673 2JA8B 3LGJA 1SYCA 1X3EA 3SXHA 3MEHA 2F0KA 1Y8NB 3TZUA 2E75C 2NVXH 2AHOB 4OIKA 4L5TA 3HOWG 4CKEA 3TP6A 2I5LX 1B4OA 4TRDA 1MIUA 1VQ4A 1Y1WH 3H0GB 1EIGA 3OW7A 1F2MA 4C3IG 2C9OA 1X55A 2E2HH 5M3FB 1NNXA 3CKIB 3NBHA 2D5DA 1EY7A 1B53A 4DV3L 1II3A 1F77A 1HNZQ 2BDOA 1ICFB 3M85A 4WJ3M 2K03A 1A6XA 1D1IA 2HIVA 4OL7A 1L1OA 1HHVA 1N33L 1CUKA 3K7UC 5C0XI 2JA6H 4NMZA 2F0TA 1CZWA 1Y14B 3NSWA 4LW1A 5LMNW 1BKBA 2AQ2B 1GKHA 5IP7G 1JE4A 1PZID 3WDNA 5IODA 1K83B 3BDCA 3TZDA 1PH8A 4C1NI 1TWGH 4A3JG 4LF7Q 1UE6A 5AFWA 3GTMB 1DCZA 2EPBA 1STGA 2PZWA 3C1EA 3BDOA 2HQLA 1QVGA 2ZXRA 2Q2UA 3T1HL 1IBLL 4KKTA 2R7ZB 1VQ5A 2Z4IA 2HIXA 3I90A 1SNCA 3DEOA 3KF8B 2ZJRA 5EJWA 1ENCA 2SEBD 2WAQG 4X65Q 3MA2B 2ZTCA 2NN6H 1K73C 3W3AA 4A3LG 1D8LA 5C0XJ 2I5MX 3K81C 4KHPQ 1YBYA 3ITPA 4BXXH 1ICWA 4JC0A 1TWAB 3DLLA 1YNND 3S14H 3AYHB 1QZHA 4Y7NH 5BR8Q 3NHHA 1Q3LA 3E9HA 4UY8C 2PO4A 2FFKB 2VQEQ 4A3DH 4A3MG 1VQLA 4IUNA 2MGSA 3KLWA 1I6HH 1N36Q 4UP9A 1U4MA 1G91A 3PUZA 1MJCA 1WTHA 2K50A 1RD9D 1PH2A 3JAME 3TDQA 3HKSA 2RQXA 4F8MA 3D6WA 2KJXA 3FMCA 2G5DA 3F2UA 1E2VA 2LXJA 4CKBA 2EDGA 3GQBA 4K8IA 3J7ZC 1YITA 4LFBQ 4HJ7A 2KVMA 3U4ZA 2N8NA 1D1KA 3D31A 5KIXA 2L9HA 3A8IE 3BVGA 1VQHA 1U9RA 2J0TD 1EYAA 2PNRC 4P71A 3OHXC 5G3LF 3QIAA 5C5LA 2PYKA 3SVMA 3K57A 5FLMH 2F0MA 3CMEA 1YNJC 1F2YA 3KYHC 1LV9A 1S5BD 4MIUA 4JYAQ 2WB1B 1T9HA 4JI7L 2PZTA 3OTOL 4UP8A 4DKAC 1BBUA 1CQVA 1Q90A 5DEHA 1HNWQ 2VNUD 3FKIB 3K58A 2K5DA 3RMHA 2IY5B 1YNNC 2O4XA 3HOXH 1AE2A 2KUMA 1SYEA 4DAYA 1SRUA 4I7AA 2VY3A 3P20A 5IT9L 4PZ6A 1JQYD 2QILA 4K5VA 2CW0D 5CBEE 5IYCG 4B3SL 4UPAA 1S4ZA 3S9WA 1W6KA 4CDFC 3S16B 1BDOA 4DV2L 3A56A 2NVYB 3X3MA 5ELEA 1BNZA 2B2TC 3SK6A 1J5EQ 4R4CA 3EA6A 1TWFH 2NVQH 1HA6A 1G2SA 4X66L 2E2IH 3A0JA 2I0QA 1SNQA 1AZQA 1B70B 1BVSA 4ALPA 3V2TA 4GLXA 2B8GA 2ZJPA 1ILQA 2D0OA 3KLSX 2WIIB 1KDAA 3TP7A 3SDZA 4WJ4A 1BQQT 1LT3D 4AYBB 2Y0SE 3I8ZA 3S17H 5M5XB 3F2DA 4X3TA 1VMCA 5JJKA 2F03A 2A69D 5C44G 3TS0A 3CCSA 4ME3A 3BVMA 1KLGD 1ET9A 5EKKA 3T13A 1Z9FA 3D4DA 3IRBA 1BOSA 2BCOA 3VYTA 1XX8A 1YEZA 5CYUA 2OF1A 3I2ZA 2NN6G 1MJEA 1RJTA 3GTQB 4YHHQ 4IFDH 1XYIA 1ESRA 3K7AH 5C44B 4BXXG 1O7YA 3O13A 3QOLA 3CCLA 2KA7A 3NTHA 1VQDA 2WV6D 1LT5D 3H6MA 1SSOA 3CMAA 1AH9A 3NQTA 1WJJA 1OXUA 4A3DG 1GD7A 1EIHA 3GTPB 2UXCL 1K8OA 2F0HA 4DNIA 2N3SA 4DAPA 4DAVA 3DMUA 1YHBA 3Q8DA 4DU9A 1JJGA 4IPCA 3CD6A 3GO5A 3HG9A 2M00A 4UAIA 2WP8J 4C3JG 5KYIA 4I65A 5FKAC 1QNKA 1V1PB 1Z6HA 2F0FA 1PV4A 5IY0A 5A35A 2GVBA 5FLMG 3HRZC 2RDGA 4G4KA 1PTOD 4LFAL 4DV6Q 4GN5A 3S1NH 1SNDA 1TU2B 3K5LA 4DR1Q 2K32A 4PMCA 4LF4Q 2JSOA 3W1BA 1XWEA 4X64L 3L2PA 2R92G 1YNXA 1CFMA 2EYOA 3CRLC 3AFQA 4N9TA 4C3JB 1R9TB 3MAQA 1D5XC 5FO8B 1I4GA 1S3OA 1NMGA 5D65A 4IPHA 3TSSA 3V96A 3RZDB 4DXGA 3J80c 2ZM6L 2EYMA 3QWNA 5JEAH 2E5LQ 3CCMA 3MWYW 3S1MB 4TSSA 2R92B 3CCUA 1VQBA 3H3VC 1XPUA 1NUCA 1MGSA 1K0SA 2ZXOA 4FF4A 1TXYA 1CKMA 2E2DC 1TY2A 4A3IG 1YJ9A 4AQYQ 1VF5C 2O2LD 1WTOA 4DR4Q 4OELB 2IPKD 4K0KQ 2ZTEA 3VR5A 2L55A 2R61A 3W5OA 1PTOC 2KECA 5I2XA 4DR3L 1JT8A 3NXWA 4GKJL 2RF4A 4QGUA 2JA7H 4A3BH 2YTYA 1EQVA 1UEAB 4P2CB 4N9PA 1GHKA 4H44C 1PH6A 2NZHA 1HZBA 3I56A 4DR5L 3H3VH 5E4WC 3M4OB 5EAYA 4DV0Q 4FNFA 3HEJA 4A3IB 2IHEA 3CW2C 3J80E 2HD3A 2NTSA 4L8JA 3PIP3 2TSSA 2F3IA 4EQOA 3FPUB 4FXDA 2GA4B 2NVTH 4J6HA 3GTJB 3SE0A 2CH4A 4KD3A 1HZ9A 2UUAL 3RD4A 3GTGB 1JB7A 4HSVA 1FGUA 2QEJC 4S3SA 1I4RA 5LL6S 1RL2A 3CHBD 4GN3B 4JOIC 4XT1B 2NWGA 4FP5D 4LFCQ 4MTKA 1PFMA 5IGEA 1EEID 3HOUH 4L63B 3DM1A 4ZUIA 1EYGA 3J81i 2SNMA 4ID6A 3PF5A 4L5QA 1LLRD 3CCRA 1PH3A 3RUZA 3I4LA 1W6JA 4MN3A 1UWVA 3WWVA 1IBML 1EY4A 2VS1A 1EOVA 2K75A 3K0XA 1FNVA 5FOBB 1XMQQ 2HT1A 1O80A 1XNQL 3CC7A 4BBRG 3U9OA 4N8FA 1X3PA 2PMZE 1BR9A 5IP9H 3FDTA 4HIDA 3HOZH 4DXFA 3KF8A 2Y0SG 4OWTB 1EU4A 2KQ3A 1SMYD 5HURA 3J81c 4DV7L 4DF7A 3I7FA 2OXPA 1HH2P 3GV3A 4IPGA 4C3HB 3I4MH 1GO3E 5FO9B 4JPBW 4G7HC 4X6AH 1YHQA 5A2QL 4BBRB 1Q8KA 4NB3A 1VQ6A 5EBDA 2JA8H 3PIO3 1UUPA 1JE5A 2PNHA 1S5ED 2B2YC 2SNSA 5CGKA 4Z9CB 4OX9Q 2A6ED 4BWGB 1XPRA 3X3NA 1Q8IA 3PF4A 3VDYA 2EJMA 3NP8A 5IGDA 2LY7A 4IUVA 3CXCA 3BZCA 1JWUD 3H0GH 5ELDA 1QCBD 1JICA 1FL0A 1VQFA 2CQOA 1SYBA 1KD1C 4B3ML 4FO2A 5M3FH 2MUYA 2LMCB 4JG2A 2UXDL 1TIID 2D9UA 1K8MA 1W3SA 1CQFA 1LTBD 2MFIA 1SAPA 3ER0A 2ATWA 2JA7G 1JORA 2F3WA 3ERQA 1VQAA 2IHFA 2PI2E 1FNUA 5T1GA 4DUYL 4DAMA 3PUXA 1LTTD 3KF6B 3D8GA 1DD2A 3U50C 3S15B 1STAA 1M1KC 1HA5A 4A3EB 1IW7D 3T1HQ 1IBLQ 4RAUC 4I7ZC 2K7VA 3NQIA 1AE3A 1K8AC 5EGTA 2L5TA 4HR7B 1K83H 5GAEC 3PO2G 4OONA 1VMPA 4DV5L 1J8IA 4PMBA 1EEFD 3FRPB 1LTLA 2K52A 1SEBD 2PQEA 1K28A 4PV1C 5EPKA 2WB1E 2K01A 5C5MA 2NYZD 3UDFA 1HR0L 3NWTA 2HCIA 3GTMH 1PRTF 1AW7A 3I73A 5KYLA 5IP7H 4KN4C 4V0BA 1N9WA 2R7ZH 2V1CC 1C9OA 3PO2B 1EYCA 1UNSA 3KOJA 2KHJA 4JI0L 3K59A 2H4OA 3EROA 4CBVA 1PTOB 2NZOA 1TS5A 1H9KA 2EE1A 5EBCA 3OW2A 1TWAH 2F0NA 3VA7A 3J7A5 1DXMA 1Z47A 1UE5A 1OXVA 3DEPA 5BN4A 1EIYB 4X3UA 1QNUA 5EKIA 4OO1H 1H95A 2YTVA 3GD7A 3S2HB 3HS0C 1WFQA 4FF1A 4IOAA 2ALYB 4B9XA 4A3LH 4BS9A 1IZ6A 3BJUA 2CKZB 3OTOQ 5EPLA 3CPWA 1KABA 1O7LA 2AMCB 2XN9C 2Q2HA 2IX1A 1PFNA 4C56C 1QG7A 5CV8A 1FJGL 1WI5A 4AYBE 1FGBD 4P75A 4JBWA 4JI6L 4NDXA 5AJ3L 1IXRA 3I4MG 1SE2A 4IUUA 2MP1A 1V9PA 2EIFA 4DK1A 1B1ZA 4UDUC 4EQ5A 1KXLA 4DV2Q 3EBEA 4KLKA 2JA8G 1CT1D 1H9SB 5CV4A 1F2LA 4YY3Q 3A7LA 5IIFA 3OWEB 2Q8IB 4EX5A 1CTMA 3A54A 2EJGC 5JPNC 4POFA 2DN8A 2IW3A 3FKIH 3STBC 3T53B 3PO3G 5GAGC 4X66Q 1PZKD 5JAVA 2HQEA 1VQOA 3JC66 3EN2A 3C1FA 1BF4A 2AQ1B 1KQSA 5GROA 1G6ZA 3NEMA 3S24A 5FJ8G 4KY5A 3S16H 1EIFA 2NVYH 1V8QA 2V4DA 3E3XA 5FO7B 1CKOA 2HDMA 1LABA 3M4QA 4BBSG 1BXTA 1QB5D 3PO3B 4ZK9B 1Q86C 3ZJYC 2ASBA 5IGGA 5ELFA 2X6LA 2XTIA 4QIWE 2EZVA 2F0PA 4R8NA 5IYCH 3NE5B 4TVAB 2M9VA 2K5WA 1PA6A 1MSGA 1OXTA 4JI3Q 2Z6KC 2BA0A 2Q2TA 4RG1A 2F0IA 5JPMC 3TS2A 2JP1A 1Y8PB 4Y52H 4R4TA 1PHJA 4BBSB 3U9SA 4DR2Q 1G291 4ZAIA 1A2UA 4ODGA 4RCNA 3OIPA 4A3FB 2NB0A 2R3ZA 4KKUA 5CV9A 3JAMi 4KD4A 2NZ1D 3G6EA 3ZYYX 2CCZA 2XSCA 5M5XH 4DUZL 2MO0A 4QQBX 1STEA 4B9WA 4GNXB 2NTTA 3SGIA 4DFAA 4RGMA 2IJ0A 1XTDA 3DUZA 5C0XH 2PMZB 3K6OA 2R7ZG 3T16A 3TREA 2UXCQ 1OXSC 3NUCA 2IL8A 3QG1A 3T1YQ 3GTQH 1TWHB 1UE1A 4RWSC 1S5DD 1I4QA 2ZT9C 3JAMc 5C44H 1W2BA 5ISRA 5T1IA 1HQRD 3FHWA 1KTKA 3G6JB 2D0PA 3G4SA 4JI5L 3I4OA 1VQNA 4OO1G 1EWCA 3I70A 5BN5A 2QA4A 4CJ0B 4LJZC 2Q8TA 4LFAQ 3A5UA 1LYLA 4GN4B 3GTPH 1K9MC 2JQOA 2XWJB 5JJIA 1L0XB 1SE8A 2VB3X 5K5PA 4DR7L 2UXBL 4X64Q 2WINB 1NE3A 5KGUA 2K5NA 5C4XG 2B2TA 3WOEA 3A8KE 1E22A 4HSPA 4LNQA 3EQLC 4RHRA 4DV1L 2ZJQA 2GVAA 2K04A 4L5SA 2XNAC 3CAMA 1PH4A 1IKLA 2ZM6Q 4FF2A 3A74A 2G9HD 1DJRD 2F3VA 2WB1G 5EQ0A 4NW2A 1EWHA 1E24A 3FKIG 5HGTA 3HOYB 5C4XB 4C3JH 1R9TH 3AEVA 5H1SE 3KBGA 1QWYA 2I46A 4JV5L 1IBKL 4DR3Q 2F52A 2C5CA 5DLQE 3GTLB 4GKJQ 3RZDH 2YU9B 4HMIA 5KNDA 4WFN3 2X6GA 2UU9L 2R92H 3L7ZC 3S1MH 4IJLA 2PW5A 3R2TA 1TS3A 4JI4L 4BA1I 3J81L 2C35B 2CWPA 4HEDA 3KDFA 4HJ5A 4RCOA 2F4VL 1SJED 3CU7A 3J7AV 1HRJA 4JCVE 3HOVG 4DGZA 1A3UA 3VR3A 5M9OA 1SN8A 3I91A 2UUAQ 5I6YA 3ONAB 1TKWB 3AFPA 1DYQA 4AYBG 1V43A 1TWCB 2NBFA 2XWBB 1VQ9A 3M4OH 2XIWA 4A3IH 1GOZA 4P74A 3HOVB 1JB3A 2B3GA 4MHEA 5C0XG 3BU2A 3VYSA 4C2MB 3CCJA 2EJFC 3ICEA 3GTJH 4ZUJA 4CJ1B 3SK5A 3BYYB 3M3YB 1ONLA 3R8BA 3GTGH 1IYVA 2EVBA 2EY6A 1HNXL 4BY1B 1F9PA 1LACA 2F1MA 2KCCA 2JEAI 1IBMQ 1CA5A 2CW0C 3NBIA 4HJAA 1C0AA 2OTLA 5E3FA 1XNQQ 1A3TA 2F0OA 1A63A 2HUGA 4ZCKA 3OYYA 2JYOA 5FLXc 3UE0A 5C6AA 3VYUA 3CQZB 4KHVA 4K8JA 4DV7Q 2A5HA 1VQMA 1K3RA 1S5CD 1AEXA 1SLJA 1E0BA 4PQXA 3QB3A 5ELCA 1SE4A 4RGOS 3E0EA 4QUFA 3T4AC 2I07B 3DWAA 4IFDI 1PFBA 1I3QB 1S40A 4H13C 4JW0A 2QKIC 3KLSA 4JI8L 2EQSA 2JE6I 5J3BA 3TMEA 3M7GA 4XYQA 2F0QA 2E8GA 1F2ZA 3NENA 3K5MA 3HP3A 3QOJA 4QIWB 3Q24A 2A69C 1SNOA 5KRUA 1JOKA 3Q6SA 4IUQA 1QOHA 4C3HH 1XMOQ 3UI2A 4R4QA 1C7YA 1DGSA 4B3MQ 3CCVA 5FLXE 2UXDQ 4DNTB 1JMCA 4BBRH 3J80i 1BCPD 1VQIA 1YZ6A 1TR5A 4A3GG 2O5JC 1PYSB 2EXDA 4XQNA 2Z0SA 1O7IA 2FINB 3VR2A 4DUYQ 3Q0AA 3NTKA 3MXNA 1Y1VB 2DUDA 1QUQA 1WTPA 2MPMA 4OWWB 2E2JB 1I6VC 3WOFA 3MEFA 4A3GB 4IPDA 3G71A 5DNFA 1NBWA 2N88A 2K5HA 4A76A 1E7ZA 1G6PA 4JOIA 2OTJA 3KUPA 3NBHB 3MC0B 4CDDC 5CMDA 2F0DA 5BR8L 4PZ7A 1HTPA 3S15H 4O0AA 4A3EH 4RA8A 1GVPA 4CDEC 4YCUA 1WYDA 1GUTA 1GJXA 3CC2A 4JI0Q 1BCPC 1Y69U 4H0LC 1X56A 4G7OC 5GQOA 1ASZA 2RCFA 1N32L 3ULJA 3S1RB 2A6HD 4RH6A 3CCQA 1KC8C 3DWQA 2CFMA 5K36G 1I4HA 2D62A 1L0WA 1Q81C 1ZYRD 1KHIA 4L5RC 1A3VA 2IWHA 1A8VA 4BA2I 3F2CA 3PO2H 1WD0A 4K5XA 3CC4A 5HGQA 1NSNS 5TSSA 1MBYA 3PUYA 5M5YB 1TS2A 1PTOH 3FP9A 5LHY1 3PIPA 2K5VA 3SK8A 2VQFL 1FD7D 2A8VA 1XXGA 5D14A 3M4YA 1FJGQ 3MTSA 1WCMG 4JI6Q 4K2KA 2B2YA 1KDBA 4XIGS 1ESFA 4JI1L 2OWOA 2R7FA 4A3KB 3W2DA 4FYDA 3CPFA 1ML0D 2RA4A 2RSNA 3S2HH 4DV4L 2PCFB 2M2LA 2Z8LA 4RMFA 3I3CA 1SFOB 4GS3A 4IALA 1WCMB 4KKSA 4DNRB 5IWAL 2DNEA 2K28A 4POGA 1CSPA 4HCSA 1PYBA 3PUVA 3P75A 4OGQC 3JAML 1PTOF 4C3HG 1EZ8A 4HJ8A 1PRTD 1CK1A 2FXQA 1B3QA 3E0JA 1DM0B 1DOMA 3B6YA 4APVA 1MD2D 4QY7A 4F87A 1TT2A 1LTGD 2PQAB 2QW7A 4X62L 1SE3A 2AKWB 2EYPA 1GXDC 4E6IA 4PZ8A 1ENAA 4CGYB 4JI2L 4YWLA 1JOOA 2R93B 2LFNA 4DV3Q 4J8QA 2L15A 4NP5A 3OMCA 1UAPA 5I6WA 1ET6A 4ZQ3A 2QDLA 5IYBG 5LMUL 2KENA 2VB2X 2WKDA 1ZKOA 3A55A 1N33Q 3GDEA 4UP7A 3PO3H 2JN4A 2N49A 4GNXC 1K0RA 3F1ZA 4HAEA 1Q1BA 2PI2A 2F0VA 2A68D 4MNOA 2OCEA 4K5WA 3TP5A 3VR6A 4ZLTF 5C3XA 1C8CA 2IX3A 3HKZB 1IL2A 1UEBA 4A3EG 1V1QA 5FJ8H 1I4XA 3LNNA 2PZUA 4B3RL 1KDCA 2BE5D 4B08A 5LL6X 4BBSH 1ILPA 1GHJA 3D4RA 3K5NA 4A3FH 1SMYC 1A2TA 4A93B 3BYTB 4ME5A 4KJNA 2B2VC 3FPPA 3NWSA 3L0OA 4YCWA 4HIMA 1VQ8A 4JI5Q 3RNUA 1EU3A 5IYDH 5CR3A 4FVMA 5IE8A 1SYGA 1LTRD 1PFSA 4LUZA 1TVXA 2WAQE 1JWMD 1HFGA 1D2BA 2A6EC 4HTHA 4DR7Q 3AU7A 1QVCA 3I4NB 2UXBQ 1RCVD 3RLOA 5C4HA 1RF2D 4LF6L 2B2WC 1TWHH 4LF5L 2ICEC 3GTOB 1CKNB 4ZKBB 5JJZA 1UE7A 1SR3A 1SDFA 1G8ZD 1HUNA 5EKLA 1SXTA 2DY7A 1ZXTA 4FXKC 2BE5C 1BCPB 1KIXA 1HZAA 1OO9B 2ICIA 2X69A 3K8AA 1IYUA 2F4IA 1SBBB 1EY5A 4CKCA 3H91A 1B44D 1E2WA 4F88A 2RDFA 4XQJA 1EFID 1IW7C 4A75A 2BA1A 2Z6BA 4PG3A 4JV5Q 1KL9A 4XT3B 4DR6L 5M3MG 3W1GA 3C46A 2MO1A 3SHLA 4NKLA 4KK7A 2F0EA 5C3EB 1U0LA 2K05A 4JI7Q 2EYJA 4R9WA 2UU9Q 1N34L 2SOBA 5KNCA 1MKHA 2B63G 1RKNA 3KBXA 4DN4M 5FLXL 2K14A 2Z6KA 4IURA 1PH1A 2L0CA 3KLRA 5C4XH 1Q82C 3HOYH 1B8AA 3ULPA 2H5XA 3D3RA 4DA2A 3RR5A 4HCEA 4IUPA 5M3MB 4B3SQ 2F4VQ 1NJIC 1PVOA 2KCMA 2N78A 3ND8A 1DZ1A 2B2UC 4B3TL 3GTLH 5NUCA 1WTRA 1VQCA 2YU9H 3DXJC 2RHSB 2B63B 3RZOB 3IFDA 3BDLA 4YWKA 1LTAD 1DOLA 3M4PA 2CH4W 2E76C 2BH8A 2CWAA 1YJWA 2LXKA 5JOBA 4FF3A 3A8JE 4IOCA 3PQIA 1BO0A 5IOCA 4KY7A 1I50B 1LT4D 2F0SA 3I72A 2Z9HA 2ZXPA 4TKOB 2VUMB 1V1PA 1RTOA 1EY0A 4ABNA 1C4QA 4GLVB 4A3FG 1PZJD 3OSOA 3S1QB 1HNXQ 2L4NA 3G48A 4NXNL 4O1NA 1TWCH 5KEEA 1D5MC 2R6GA 3GV6A 4EVOA 2EOTA 1PH5A 1NTGA 4YIJA 3MXGA 3ND9A 3TN2A 4YCVA 3HOVH 5EPJA 4K6DA 5IYDG 4GOPC 3D4WA 3AQQA 5G3LD 2MQHA 1VF7A 4C2MH 5E4XA 3J80L 1MI2A 1HFNA 1IYJB 2RHQB 1I5FA 2VXWA 3M3YH 4WRDA 4BY7B 3NTIA 1SYDA 1I4PA 3P1HA 4BY1H 1MSHA 1F9RA 1A0IA 1STYA 2L11A 1XNRL 2UUCL 1PRTB 3HOWB 4JI8Q 4OX9L 3QJYA 4HMJA 4K2LA 1D5ZC 2ID0A 3CQZH 3MXPA 3D6CA 4MZ9A 5D3IB 1QVFA 4C3IB 3Q22A 3M9BA 1S72A 1SNMA 5E7NA 1U4RA 1PLFA 4ZKCB 3UDGA 4NXML 3CF5A 4M1UB 5GADC 3C3LA 3N6RA 1I3QH 4UHVA 4CJ2C 4YWMA 4QMGA 4LF8L 2N55A 1X3QA 4OXPA 1KRSA 3KFUA 1IL8A 2F0UA 3A5ZB 4J15A 4GKKL 5C4JB 1P8LA 2JA5G 4LF9L 1EYDA 4XXEA 2HHHL 4H02A 3HOYG 2NN6I 4WJWA 1SJHD 1CHPD 1YNJD 2AWNA 3NK9A 1STHA 1GUWA 4LUVA 4IUTA 3GTKB 4A3JB 4HIKA 4IZ8A 4KMUC 2JA5B 3S2DB 4PNYA 2OEOA 2KCTA 4L6TB 1GUNA 2A74C 3P7JA 4ULLA 3M7NA 5J39A 1Y1VH 3OOCA 1L1OC 1OXXK 3BG3A 1D6EC 2AQ3B 2E2JH 2WAQB 2IX0A 1VDZA 1JR0D 4A3GH 4KJOA 3KK7A 1N32Q 1BUVT 2K6AA 5CV6A 5GAHC 2CHBD 1NCVA 2NUCA 2J4XA 1STNA 4RGNA 1B7YB 2PQAA 3MXUA 3C2PA 4DR5Q 1E1TA 5KNBA 1P16A 4A3MB 3FVQA 5LMNL 3J81j 1GUOA 3CP0A 3OPOA 5C3WA 1SYFA 2EYLA 1N8RC 2KEDA 4QB4A 1X3GA 4RHSA 2A19A 1SMXA 3IFTA 5IGFA 1BBXC 2VQFQ 4KY6A 5A2QE 5DM73 3S1RH 4Q0FA 2BH2A 1Q46A 1K8GA 4A3CH 2RDHA 5ELOA 3H09A 5M5WB 4G7ZC 1Y1WG 1EY6A 1X65A 1J6QA 1Z7TA 4JI1Q 4BY1G 1EWIA 1VS0A 2DY8A 2LKVA 2IT1A 5C4ZA 1FYCA 3R3OA 4DV4Q 2NVXB 5BN3A 4YY3L 2ES2A 3I55A 2F0GA 5M5YH 3KJOA 3SK4A 2EYHA 2K5QA 2LSSA 1Y1WB 3L9AX 2JA6G 1E2ZA 3L3OC 1CSQA 2YTXA 5IWAQ 5K36H 2QGQA 3BS1A 1J9OA 1PH7A 1I94L 4WORA 2E2HB 3D0FA 2UUBL 5J1ZA 3F8TA 3KF6A 1SROA 4AH6A 4A3KH 1NMFA 3HKZE 3TP8A 4ILWA 4GOPB 3J7YW 1F9SA 2PW7A 1OTCA 1YIJA 1NR2A 2G9DA 3E9IA 4X62Q 4LK1C 4X3SA 2JA6B 5IGBA 1SFOH 1KAWA 4M8AA 1FVIA 1WCMH 3FEWX 1TY0A 1U4LA 1DOKA 4CDCC 4JK1C 3ULLA 2EY2A 3BZDB 1LM0A 2GN5A 4JI2Q 4A4IA 4JI3L 1CKNA 3AB9A 2XGTA 1YVCA 2JK8A 3EVQA 1Q12A 1Y8OB 2DNCA 4DK6C 4EGVA 2BDNA 1HNZL 1TWGB 4DR2L 2K4KA 3PCOB 4HIOA 2FHTA 4OWXB 5LMUQ 4QUCA 3PMFA 4KHZA 4O2DA 5DAUA 1D7QA 3U4VA 5COYA 4EQPA 2KBNA 1FR3A 1AN8A 1A15A 4N8X1 5ELNA 4J1MA 1L0YB 1R4QB 1JWSD 3A7AB 2WKCA 1Y1VG 1QILA 1C48A 2SDFA 1HQMC 2R93H 3R2IA 4B3RQ 3KJPA 2JXMB 2Q8RE 2VW9A 1KLUD 3T1YL 1K3BC 1RTNA 3NELA 5JVH3 1KRTA 4LF7L 4QJFA 3S14B 5JVG3 2MJ8A 1B2TA 4Y7NB 1PH9A 3NPPA 1B9MA 1RHPA 2HCCA 1VQ7A 4JBMA 4A3DB 2JA9A 4IFDJ 3PGZA 1I6HB 2ZTDA 1GM5A 4LWCA 3OMGA 4X65L 4DV5Q 3CCEA 5IYBH 2KHIA 1KAAA 1AFPA 1EY8A 4LF6Q 3GP7A 4KHPL 2CQAA 5F2DA 4A93H 1EQRA 4LF5Q 2AWOA 1HR0Q 1H9SA 3ERSX 2XVSA 4A3CG 1EL0A 4QCLA 3HOXG 4NPSA 2L12A 4RGTA 3EIVA 4QF4A 2MHVA 4DPGA 5I4DA 4EQNA 1YI2A 1L2FA 1RDPD 2VQEL 2KOLA 5D3DA 4HJ9A 1ENFA 4JBKA 1N36L 3DM3A 1L1OB 1BBWA 1RODA 1VQPA 4LAAA 2HDLA 1H9RA 4FDBA 3I4NH 4LFBL 3TQYA 4IO9A 1EFWA 1LTID 3HOXB 1HPCA 2XRQD 3GTOH 1DONA 2WACA 3PUWA 3LWUA 3F2BA 1VQEA 4P72A 4DR6Q 2EYFA 1HTLD 3BZKA 2KCNA 4A3KG 2EY5A 3H3VI 1RIPA 4JYAL 4RKBA 1N34Q 4HN7A 1ZEQX 2J7ZA 1HNWL 3K5OA 3RLFA 1O78A 3IAYA 1MHWC 1TWFB 2NVQB 2EY1A 4X3KA 3VR4A 2E2IB 1JOQA 5JEAJ 1CM9A 3UDIA 1V1OA 5HY6A 5AJ3Q 1STBA 2L1BA 2QCPX 3T56B 4R1JA 2QF7A 2JEBI 4GNXA 4B3TQ 3K80C 1HXYD 4KTAA 5CC4A 5C3EH 1YHAA 2A6HC 3UDXA 3S17B 1FNWA 4IFDG 1AZPA 1J5EL 1VQKA 2EXZA 3MFYA 2K1BA 3T51B 4GZYC 1ZYRC 1TQOA 1BCPF 3U58A 2WFWA 3MZ5A 2B39A 3EFXD 5M3MH 2B2VA 1CI3M 3MHBA 4RKLA 1S5FD 3VYRA 2R93G 1B3AA 2QDBA 4F7XA 2AUKA 3MVVA 3OWFA 2O5IC 1HUMA 1HR0W 2B63H 3V05A 3SEBA 1VCIA 5L37A 3RZOH 1EY9A 3K7AB 4R8IA 4FXGC 2RVLA 1X54A 2FMCA 4NXNQ 1WD1A 1LT6D 1WVLA 2Z4HA 1NY4A 2K33A 3MFGA 4K6LA 1Q1EA 4XYOA 1QZGA 1CA6A 2KEEA 3K0YA 2B2WA 1TS4A 2QEXA 3HKZG 5FK9C 4ZYSA 1I50H 4JVZA 3LX0A 1IHZA 2DJGC 2VUMH 4C1NK 1HJPA 4DAYB 1B50A 1NR4A 3QO2A 3IKJA 4U68A 4YHHL 1ASYA 2BOSA 1EQQA 3QR8A 3KDFB 1QJOA 4H7BA 4DUZQ 3PIOA 3S1QH 4A93G 2RSOA 1F9QA 5IT9c 1JC7A 4QL5A 1SNPA 4LUOA 1WTWA 2MNAA 3DHQA 3VA5A 4XQQA 1X9NA 2A1AA 1EZ6A 1XNRQ 1PRTC 3RN2A 1PYWD 1WTVA 2VZAA 2UUCQ 1XPOA 4ZRZA 4PMWA 3S1NB 1PMRA 2Y0SB 1Q7YC 5CBAE 5JEAG 4XTCS 5E1FA
chains in the Genus database with same CATH topology
3E5SA 1LTSD 1KNEA 1O7ZA 3LWEA 2AUJD 4IN3A 1KNAA 3J81E 1NAPA 5CV7A 5CORA 4KI0A 3H94A 5IT9E 1AP0A 2TMPA 1G2TA 4OIJA 4KV6A 1IKMA 1GUSA 1GUGA 2B2UA 1M8AA 3EJIA 4V190 1PXUA 2A68C 2XRSD 1X32A 1H9MA 2F0JA 3PV0A 5I2YA 4TQUS 2RKSA 3E6ZX 4RFBA 1H9JA 4G57A 3DWPA 2D2CC 2CVRA 4A3BB 4KN7C 2Z1CA 2JA7B 2F0WA 2KHSA 5ELBA 4Q5VA 4O42A 1PDQA 4LMQD 1JCKB 2H1EA 1WTXA 3HZXA 1T5EA 3G7LA 3R93A 2NVTB 5I9OA 2OT2A 2LS01 1XTCD 2YYZA 5IGCA 1QE6A 3J7AF 5DM63 4OO1I 1R4PB 2RBMA 5I9PA 3AMUA 4K14A 4CHTB 1M4VA 4XDXA 1EOTA 1U4PA 3HOUB 5CV5A 1LO5D 1CZGA 2B8FA 3OIQA 3BVZA 2ENBA 1HCZA 4IQZA 1T5XD 2E74C 5J22A 3CRKC 1WTQA 3URYA 1EQTA 4DK0A 3HOZB 3Q23A 2A73B 4OHJA 3HGBA 1CHQD 3I4MB 1B9NA 2FJ2A 3N52A 2FMMA 3TBIB 2PPBC 3IL8A 3SR1A 2F0LA 4U673 2JA8B 1SYCA 3SXHA 3MEHA 2F0KA 1Y8NB 3TZUA 2E75C 4OIKA 4CKEA 3TP6A 1B4OA 4TRDA 3H0GB 1EIGA 3OW7A 1F2MA 4C3IG 2C9OA 5M3FB 3CKIB 3NBHA 2D5DA 1EY7A 1B53A 1II3A 1F77A 2BDOA 3M85A 2K03A 1A6XA 1D1IA 4OL7A 1HHVA 5C0XI 4NMZA 2F0TA 1CZWA 3NSWA 2AQ2B 1JE4A 1PZID 3WDNA 5IODA 1K83B 3BDCA 3TZDA 4C1NI 5AFWA 3GTMB 1DCZA 2EPBA 1STGA 2PZWA 3C1EA 3BDOA 2ZXRA 2R7ZB 4KKTA 2Z4IA 3I90A 1SNCA 3DEOA 5EJWA 1ENCA 2SEBD 3MA2B 2NN6H 3W3AA 5C0XJ 3ITPA 1ICWA 1TWAB 1YNND 3NHHA 1Q3LA 2PO4A 2FFKB 4IUNA 2MGSA 1U4MA 1G91A 3PUZA 1RD9D 3JAME 3TDQA 2RQXA 4F8MA 3D6WA 2KJXA 3FMCA 3F2UA 1E2VA 4CKBA 2EDGA 3GQBA 4K8IA 2KVMA 1D1KA 3D31A 5KIXA 2L9HA 3A8IE 3BVGA 1U9RA 2J0TD 1EYAA 2PNRC 3OHXC 5G3LF 3QIAA 5C5LA 2PYKA 3SVMA 3K57A 2F0MA 1YNJC 1F2YA 1LV9A 1S5BD 4MIUA 2WB1B 2PZTA 1CQVA 1Q90A 5DEHA 2VNUD 3FKIB 3K58A 2K5DA 3RMHA 1YNNC 2O4XA 2KUMA 1SYEA 4DAYA 3P20A 5IT9L 1JQYD 2QILA 4K5VA 2CW0D 5CBEE 1S4ZA 3S9WA 1W6KA 3S16B 1BDOA 3A56A 2NVYB 3X3MA 5ELEA 1BNZA 2B2TC 3SK6A 3EA6A 1HA6A 1G2SA 1SNQA 1AZQA 3V2TA 2B8GA 1ILQA 3KLSX 2WIIB 1KDAA 3TP7A 3SDZA 1BQQT 1LT3D 4AYBB 3I8ZA 5M5XB 4X3TA 1VMCA 2F03A 2A69D 3BVMA 1KLGD 1ET9A 5EKKA 3T13A 3D4DA 1BOSA 2BCOA 3VYTA 1XX8A 5CYUA 2OF1A 2NN6G 1RJTA 3GTQB 4IFDH 1XYIA 1ESRA 5C44B 1O7YA 3O13A 3QOLA 2KA7A 3NTHA 2WV6D 1LT5D 3H6MA 1SSOA 3NQTA 1OXUA 1EIHA 3GTPB 1K8OA 2F0HA 4DAPA 4DAVA 3DMUA 4DU9A 3GO5A 3HG9A 2M00A 4UAIA 4C3JG 2WP8J 5KYIA 4I65A 5FKAC 1QNKA 1V1PB 1Z6HA 2F0FA 5A35A 3HRZC 2RDGA 4G4KA 1PTOD 1SNDA 1TU2B 3K5LA 2K32A 4PMCA 2JSOA 1XWEA 3CRLC 1CFMA 2EYOA 4N9TA 4C3JB 1R9TB 3MAQA 1D5XC 5FO8B 1I4GA 5D65A 3TSSA 3V96A 3RZDB 4DXGA 2EYMA 3QWNA 5JEAH 3MWYW 3S1MB 4TSSA 2R92B 3H3VC 1NUCA 1MGSA 2ZXOA 4FF4A 2E2DC 1TY2A 1VF5C 2O2LD 1WTOA 2IPKD 3VR5A 2L55A 2R61A 1PTOC 2KECA 5I2XA 3NXWA 1EQVA 1UEAB 4P2CB 4N9PA 1GHKA 4H44C 5E4WC 3M4OB 4FNFA 3HEJA 4A3IB 3J80E 2NTSA 4L8JA 3PIP3 2TSSA 4EQOA 4FXDA 3FPUB 2GA4B 4J6HA 3GTJB 3SE0A 4KD3A 3RD4A 3GTGB 4HSVA 2QEJC 4S3SA 1I4RA 5LL6S 3CHBD 4XT1B 2NWGA 4FP5D 1PFMA 5IGEA 1EEID 4L63B 3DM1A 4ZUIA 2SNMA 4ID6A 1LLRD 3RUZA 3I4LA 1W6JA 4MN3A 1EY4A 1FNVA 5FOBB 1O80A 3U9OA 1X3PA 1BR9A 3FDTA 4DXFA 3KF8A 1EU4A 2KQ3A 1SMYD 5HURA 4DF7A 2OXPA 3GV3A 4C3HB 5FO9B 4G7HC 5A2QL 4BBRB 5EBDA 3PIO3 1UUPA 1S5ED 2B2YC 2SNSA 5CGKA 4Z9CB 2A6ED 4BWGB 3X3NA 1Q8IA 2EJMA 3NP8A 5IGDA 2LY7A 4IUVA 1JWUD 5ELDA 1QCBD 1JICA 1SYBA 4FO2A 2MUYA 2LMCB 1TIID 2D9UA 1K8MA 1CQFA 1LTBD 1SAPA 1JORA 2F3WA 3ERQA 1FNUA 5T1GA 3PUXA 1LTTD 3D8GA 1DD2A 3S15B 1STAA 1HA5A 4A3EB 1IW7D 4RAUC 4I7ZC 2K7VA 3NQIA 5EGTA 2L5TA 4HR7B 1VMPA 1J8IA 4PMBA 1EEFD 3FRPB 1SEBD 2PQEA 4PV1C 5EPKA 2K01A 5C5MA 2NYZD 3NWTA 2HCIA 1PRTF 1AW7A 3I73A 5KYLA 4KN4C 4V0BA 3PO2B 1EYCA 1UNSA 3K59A 2H4OA 3EROA 4CBVA 1PTOB 1TS5A 1H9KA 2EE1A 5EBCA 2F0NA 3VA7A 1DXMA 1Z47A 1OXVA 3DEPA 5BN4A 4X3UA 1QNUA 5EKIA 4OO1H 3GD7A 3S2HB 3HS0C 4FF1A 4B9XA 4BS9A 5EPLA 1KABA 1O7LA 2XN9C 2IX1A 1PFNA 4C56C 1QG7A 5CV8A 1FGBD 4JBWA 4NDXA 1SE2A 4IUUA 2MP1A 4DK1A 1B1ZA 4UDUC 1CT1D 1H9SB 5CV4A 1F2LA 3A7LA 5IIFA 3OWEB 2Q8IB 1CTMA 3A54A 2EJGC 5JPNC 2DN8A 2IW3A 3T53B 1PZKD 5JAVA 2HQEA 3C1FA 1BF4A 2AQ1B 1G6ZA 4KY5A 1V8QA 2V4DA 5FO7B 2HDMA 1LABA 1BXTA 1QB5D 3PO3B 4ZK9B 5IGGA 5ELFA 2X6LA 2EZVA 2F0PA 4R8NA 3NE5B 2M9VA 2K5WA 1MSGA 1OXTA 2BA0A 2F0IA 5JPMC 2JP1A 1Y8PB 4BBSB 3U9SA 1G291 4ZAIA 1A2UA 4ODGA 4RCNA 3OIPA 4A3FB 2NB0A 2R3ZA 4KKUA 5CV9A 4KD4A 2NZ1D 3ZYYX 2XSCA 1STEA 4B9WA 2NTTA 4DFAA 4RGMA 2IJ0A 3DUZA 5C0XH 2PMZB 3K6OA 3T16A 1OXSC 3NUCA 2IL8A 3QG1A 1TWHB 4RWSC 1S5DD 1I4QA 2ZT9C 5ISRA 5T1IA 1HQRD 1KTKA 3G6JB 4OO1G 1EWCA 3I70A 5BN5A 4CJ0B 4LJZC 2Q8TA 2XWJB 1L0XB 2VB3X 5K5PA 2WINB 5KGUA 2B2TA 3WOEA 3A8KE 4HSPA 3EQLC 4RHRA 2K04A 2XNAC 1IKLA 4FF2A 2G9HD 1DJRD 2F3VA 5EQ0A 4NW2A 1EWHA 5HGTA 3HOYB 5C4XB 3KBGA 1QWYA 2I46A 2C5CA 3GTLB 2YU9B 4HMIA 5KNDA 4WFN3 2X6GA 3L7ZC 2PW5A 3R2TA 1TS3A 4BA1I 3J81L 4HEDA 4RCOA 3J7AV 1SJED 3CU7A 1HRJA 4DGZA 1A3UA 3VR3A 5M9OA 3I91A 5I6YA 3ONAB 1TKWB 1DYQA 1V43A 1TWCB 2NBFA 2XWBB 2XIWA 1GOZA 3HOVB 1JB3A 5C0XG 4MHEA 3VYSA 4C2MB 2EJFC 4ZUJA 4CJ1B 3SK5A 3BYYB 3M3YB 1ONLA 3R8BA 1IYVA 2EVBA 2EY6A 4BY1B 1F9PA 1LACA 2F1MA 2KCCA 2JEAI 1CA5A 2CW0C 3NBIA 5E3FA 1A3TA 2F0OA 2HUGA 2JYOA 5C6AA 3VYUA 3CQZB 4KHVA 4K8JA 2A5HA 1S5CD 1AEXA 1E0BA 4PQXA 3QB3A 5ELCA 1SE4A 4RGOS 4QUFA 3T4AC 2I07B 3DWAA 4IFDI 1PFBA 1I3QB 4H13C 2QKIC 3KLSA 2JE6I 3TMEA 3M7GA 4XYQA 2F0QA 1F2ZA 3K5MA 3HP3A 3QOJA 4QIWB 3Q24A 2A69C 1SNOA 5KRUA 1JOKA 3Q6SA 4IUQA 1QOHA 3UI2A 5FLXE 4DNTB 1BCPD 1TR5A 2O5JC 4XQNA 2FINB 3VR2A 3Q0AA 3NTKA 3MXNA 1Y1VB 1WTPA 2MPMA 2E2JB 1I6VC 3WOFA 4A3GB 5DNFA 2N88A 3KUPA 3MC0B 5CMDA 2F0DA 1HTPA 4RA8A 1GUTA 1GJXA 1BCPC 1Y69U 4H0LC 4G7OC 3S1RB 2A6HD 4RH6A 3DWQA 5K36G 1I4HA 2D62A 1ZYRD 1A3VA 2IWHA 4BA2I 1WD0A 4K5XA 1NSNS 5TSSA 1MBYA 3PUYA 5M5YB 1TS2A 1PTOH 5LHY1 3SK8A 1FD7D 1XXGA 5D14A 3M4YA 3MTSA 4K2KA 2B2YA 1KDBA 4XIGS 1ESFA 4A3KB 3W2DA 4FYDA 1ML0D 2RA4A 2RSNA 2PCFB 2M2LA 2Z8LA 3I3CA 1SFOB 4IALA 1WCMB 4KKSA 4DNRB 2DNEA 2K28A 4HCSA 3PUVA 3P75A 4OGQC 3JAML 1PTOF 4C3HG 1EZ8A 1PRTD 1CK1A 3E0JA 1DM0B 1DOMA 1MD2D 4F87A 1TT2A 1LTGD 1SE3A 2EYPA 1GXDC 4E6IA 1ENAA 4CGYB 1JOOA 2R93B 2LFNA 4J8QA 4NP5A 3OMCA 1UAPA 5I6WA 1ET6A 4ZQ3A 2WKDA 2VB2X 1ZKOA 3A55A 4HAEA 1Q1BA 2F0VA 2A68D 4K5WA 3TP5A 3VR6A 4ZLTF 5C3XA 1C8CA 2IX3A 3HKZB 1I4XA 3LNNA 2PZUA 1KDCA 2BE5D 4B08A 5LL6X 1ILPA 1GHJA 3D4RA 3K5NA 4A93B 1SMYC 1A2TA 3BYTB 4ME5A 4KJNA 2B2VC 3FPPA 3NWSA 1EU3A 5CR3A 4FVMA 1SYGA 1LTRD 1TVXA 1JWMD 1HFGA 1D2BA 2A6EC 4HTHA 3AU7A 3I4NB 1RCVD 5C4HA 1RF2D 2B2WC 2ICEC 3GTOB 4ZKBB 5JJZA 1SDFA 1G8ZD 1HUNA 5EKLA 1SXTA 2DY7A 1ZXTA 4FXKC 2BE5C 1BCPB 1OO9B 2X69A 2ICIA 1IYUA 2F4IA 1SBBB 1EY5A 4CKCA 3H91A 1E2WA 1B44D 4F88A 2RDFA 4XQJA 1EFID 1IW7C 2BA1A 4XT3B 3C46A 3SHLA 4NKLA 4KK7A 2F0EA 5C3EB 2K05A 2EYJA 4R9WA 2SOBA 5KNCA 1RKNA 3KBXA 4DN4M 5FLXL 4IURA 2L0CA 3KLRA 3D3RA 4DA2A 4HCEA 4IUPA 5M3MB 3ND8A 1DZ1A 2B2UC 5NUCA 1WTRA 3DXJC 2B63B 3RZOB 3IFDA 3BDLA 1LTAD 1DOLA 2E76C 5JOBA 4FF3A 3A8JE 1BO0A 5IOCA 4KY7A 1I50B 1LT4D 2F0SA 3I72A 2ZXPA 4TKOB 2VUMB 1V1PA 1RTOA 1EY0A 4ABNA 1C4QA 3S1QB 1PZJD 3OSOA 2L4NA 5KEEA 4O1NA 1D5MC 4EVOA 2R6GA 3GV6A 2EOTA 4YIJA 3MXGA 3ND9A 3TN2A 5EPJA 4K6DA 3D4WA 5G3LD 1VF7A 5E4XA 3J80L 1MI2A 1HFNA 2VXWA 4WRDA 4BY7B 3NTIA 1SYDA 1I4PA 3P1HA 1MSHA 1F9RA 1STYA 2L11A 1PRTB 3HOWB 3QJYA 4HMJA 4K2LA 1D5ZC 2ID0A 3MXPA 3D6CA 5D3IB 4C3IB 3Q22A 1SNMA 1U4RA 1PLFA 4ZKCB 4M1UB 3C3LA 3N6RA 4CJ2C 4QMGA 2N55A 1X3QA 1IL8A 2F0UA 5C4JB 1EYDA 4XXEA 2NN6I 4WJWA 1SJHD 1CHPD 1YNJD 2AWNA 3NK9A 1STHA 1GUWA 4IUTA 3GTKB 4A3JB 4IZ8A 4KMUC 2JA5B 3S2DB 4PNYA 2OEOA 4L6TB 1GUNA 2A74C 3P7JA 4ULLA 3M7NA 5J39A 3OOCA 1OXXK 3BG3A 1D6EC 2AQ3B 2WAQB 2IX0A 1VDZA 1JR0D 4KJOA 3KK7A 1BUVT 2K6AA 5CV6A 2CHBD 1NCVA 2NUCA 2J4XA 1STNA 4RGNA 3MXUA 3C2PA 5KNBA 4A3MB 3FVQA 1GUOA 3OPOA 5C3WA 1SYFA 2EYLA 2KEDA 4QB4A 4RHSA 3IFTA 5IGFA 1BBXC 4KY6A 5A2QE 5DM73 4Q0FA 2RDHA 3H09A 5M5WB 4G7ZC 1EY6A 1Z7TA 2DY8A 2LKVA 2IT1A 5C4ZA 1FYCA 3R3OA 2NVXB 5BN3A 2F0GA 3SK4A 2EYHA 2K5QA 1Y1WB 3L9AX 1E2ZA 3L3OC 5K36H 3BS1A 1J9OA 4WORA 2E2HB 5J1ZA 3TP8A 4ILWA 3J7YW 1F9SA 2PW7A 1NR2A 2G9DA 2JA6B 4LK1C 4X3SA 5IGBA 4M8AA 3FEWX 1TY0A 1U4LA 1DOKA 4JK1C 2EY2A 3BZDB 3AB9A 3EVQA 1Q12A 1Y8OB 2DNCA 4EGVA 2BDNA 1TWGB 2FHTA 4QUCA 3PMFA 4KHZA 5DAUA 5COYA 4EQPA 1FR3A 1AN8A 1A15A 4J1MA 1L0YB 1R4QB 1JWSD 3A7AB 2WKCA 1QILA 1C48A 2SDFA 1HQMC 3R2IA 2JXMB 2Q8RE 1KLUD 1RTNA 5JVH3 3S14B 5JVG3 2MJ8A 1B2TA 4Y7NB 3NPPA 1B9MA 1RHPA 2HCCA 4IFDJ 4A3DB 1I6HB 3OMGA 1KAAA 1AFPA 1EY8A 3GP7A 2CQAA 5F2DA 2AWOA 1H9SA 1EL0A 2XVSA 4QCLA 2L12A 4RGTA 4QF4A 2MHVA 5I4DA 4EQNA 1RDPD 2KOLA 5D3DA 1ENFA 1RODA 4LAAA 2HDLA 1H9RA 1LTID 3HOXB 1HPCA 2XRQD 1DONA 2WACA 3PUWA 3LWUA 2EYFA 1HTLD 2KCNA 2EY5A 4RKBA 4HN7A 1ZEQX 2J7ZA 3K5OA 3RLFA 1O78A 3IAYA 1TWFB 2NVQB 2EY1A 4X3KA 3VR4A 2E2IB 1JOQA 5JEAJ 1CM9A 1V1OA 1STBA 2L1BA 2QCPX 3T56B 2QF7A 2JEBI 1HXYD 4KTAA 5CC4A 2A6HC 3S17B 1FNWA 4IFDG 1AZPA 2EXZA 3MFYA 2K1BA 3T51B 4GZYC 1ZYRC 1TQOA 1BCPF 3MZ5A 2B39A 3EFXD 2B2VA 1CI3M 3MHBA 4RKLA 1S5FD 3VYRA 1B3AA 2QDBA 4F7XA 2AUKA 3MVVA 3OWFA 2O5IC 1HUMA 3V05A 3SEBA 1VCIA 1EY9A 3K7AB 4R8IA 4FXGC 2RVLA 2FMCA 1WD1A 1LT6D 1WVLA 2Z4HA 2K33A 3MFGA 4K6LA 4XYOA 1Q1EA 1CA6A 2KEEA 3K0YA 2B2WA 1TS4A 5FK9C 4ZYSA 3LX0A 1IHZA 4C1NK 1B50A 1NR4A 3QO2A 3IKJA 4U68A 2BOSA 1QJOA 4H7BA 2RSOA 1F9QA 1JC7A 1SNPA 1WTWA 3DHQA 3VA5A 4XQQA 1EZ6A 1PRTC 1PYWD 1WTVA 4ZRZA 4PMWA 3S1NB 1PMRA 2Y0SB 5CBAE 5JEAG 4XTCS 5E1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MWY W;  3DEP A;  3DEO A;  4ZKB B;  2BDN A;  2J7Z A;  4X3U A;  5JJZ A;  5EJW A;  3TN2 A;  1WTQ A;  5EPJ A;  5EKI A;  2FHT A;  2K28 A;  1MGS A;  1SDF A;  3GV3 A;  4QUC A;  4X3K A;  1HUN A;  1KNE A;  2FIN B;  4HCS A;  3I8Z A;  3I91 A;  5COY A;  1EQT A;  1NCV A;  2IL8 A;  1CM9 A;  3ONA B;  1O7Z A;  1A15 A;  3LWE A;  2DY7 A;  1ZXT A;  4X3T A;  1VMC A;  5E4X A;  2L1B A;  1KNA A;  1ICW A;  1NAP A;  1HFN A;  1MI2 A;  1WTP A;  2MPM A;  1DOM A;  4RWS C;  5COR A;  5EPL A;  2VXW A;  1WTO A;  2X69 A;  2XIW A;  1AP0 A;  1PFN A;  2B2Y C;  2KEC A;  1G2T A;  1QG7 A;  5T1I A;  4OIJ A;  2SDF A;  1Q3L A;  1IKM A;  3H91 A;  2FFK B;  4MHE A;  5DNF A;  1MSH A;  2FJ2 A;  1F9R A;  3N52 A;  2FMM A;  2B2U A;  2MGS A;  1M8A A;  2N88 A;  4IUV A;  2L11 A;  3IL8 A;  1U4M A;  1G91 A;  1XX8 A;  2KED A;  2Q8R E;  3I3C A;  4IUU A;  2MP1 A;  1X32 A;  4CJ0 B;  1AZP A;  1RTN A;  1JIC A;  2Q8T A;  3KUP A;  2K1B A;  1RJT A;  4CJ1 B;  5E4W C;  5CMD A;  3GV6 A;  1XYI A;  3D6W A;  1ESR A;  4XT3 B;  1BBX C;  3F2U A;  2MJ8 A;  1B2T A;  1O7Y A;  2KVM A;  1F2L A;  4OIK A;  2CVR A;  1RHP A;  2D9U A;  2HCC A;  4RA8 A;  2K05 A;  1F9P A;  2L9H A;  3FPU B;  4R9W A;  1SAP A;  1B4O A;  2B2V A;  1SSO A;  1CA5 A;  1EIG A;  3KBX A;  4DN4 M;  1B3A A;  3SVM A;  2B2T A;  4IUR A;  2DY8 A;  1EIH A;  4O42 A;  1PDQ A;  1HUM A;  1U4R A;  1PLF A;  2HUG A;  4LMQ D;  5T1G A;  4ZKC B;  1LV9 A;  2H1E A;  4R8I A;  1WTX A;  2RVL A;  1BF4 A;  4HAE A;  2K04 A;  3G7L A;  4HSV A;  1G6Z A;  2JYO A;  4IUP A;  3R93 A;  1WD1 A;  1IKL A;  4RAU C;  4CJ2 C;  1B53 A;  1WVL A;  2N55 A;  1EL0 A;  4ZLT F;  1X3Q A;  1DZ1 A;  1C8C A;  2B2U C;  1CA6 A;  2K03 A;  4UAI A;  1IL8 A;  5EQ0 A;  1WTR A;  1E0B A;  2HDM A;  2KEE A;  2L12 A;  4NW2 A;  2B2W A;  1VMP A;  1J9O A;  1QNK A;  2NWG A;  4XT1 B;  1J8I A;  1HHV A;  1PFM A;  2KUM A;  1QE6 A;  4QUF A;  3IFD A;  4ZK9 B;  2KOL A;  1WD0 A;  1DOL A;  1PFB A;  1ILP A;  5CBE E;  3DM1 A;  5EPK A;  1B50 A;  1NR4 A;  1ROD A;  1S4Z A;  2K01 A;  2NYZ D;  3QO2 A;  2X6L A;  4U68 A;  2HDL A;  2HCI A;  1JE4 A;  2B2V C;  2RSO A;  1F9Q A;  5D14 A;  1MSG A;  1BO0 A;  1F9S A;  1WTW A;  3TZD A;  3MTS A;  4IUT A;  1BNZ A;  2B2T C;  1GUW A;  1NR2 A;  4MN3 A;  4X3S A;  4XDX A;  2JP1 A;  3HP3 A;  1EOT A;  1U4P A;  2X6G A;  1DON A;  2B2Y A;  4ZAI A;  1WTV A;  1RTO A;  3Q6S A;  1G2S A;  1HA6 A;  1U4L A;  2R3Z A;  5AFW A;  1DOK A;  1O80 A;  1TVX A;  4IUQ A;  2NZ1 D;  3UI2 A;  1ML0 D;  2RA4 A;  1HFG A;  2EPB A;  1AZQ A;  1X3P A;  2EE1 A;  5D65 A;  2RSN A;  3P7J A;  5CBA E;  3FDT A;  2M2L A;  2L4N A;  4HED A;  2B2W C;  1HRJ A;  1ILQ A;  2EOT A;  3I90 A; 
#chains in the Genus database with same CATH topology
 3I4N G;  4IJH A;  4BY7 H;  1JJ2 A;  1X3F A;  2YV5 A;  3E5S A;  1LTS D;  1XMO L;  1KNE A;  4NXM Q;  2JJQ A;  1O7Z A;  3LWE A;  4R4O A;  2AUJ D;  4IN3 A;  1KNA A;  3J81 E;  1NAP A;  3TEH B;  4LF8 Q;  4DV6 L;  2OQK A;  5CV7 A;  5COR A;  4KI0 A;  3H94 A;  5IT9 E;  3HOW H;  1AP0 A;  4A3B G;  2TMP A;  1G2T A;  4DR1 L;  4OIJ A;  4KV6 A;  4LF4 L;  1IKM A;  1GUS A;  4GKK Q;  4LF9 Q;  3RN5 A;  1VQJ A;  1GUG A;  2B2U A;  1M8A A;  3EJI A;  2HHH Q;  4V19 0;  2R7D A;  1PXU A;  2B29 A;  2A68 C;  2XRS D;  4C3I H;  3PSI A;  1X32 A;  1H9M A;  4R4I A;  2F0J A;  3PV0 A;  5I2Y A;  2VL6 A;  2OQ0 A;  4TQU S;  2RKS A;  3E6Z X;  2DJF C;  4RFB A;  1H9J A;  4G57 A;  2P5Z X;  4DV1 Q;  1YJN A;  3DWP A;  2D2C C;  4OEM B;  2CVR A;  4A3B B;  4KN7 C;  2Z1C A;  1JJC B;  2JA7 B;  3RLN A;  2F0W A;  2E5L L;  2KHS A;  5ELB A;  4Q5V A;  5C3E G;  2I5H A;  4O42 A;  4DK3 C;  1PDQ A;  5C4J H;  4LMQ D;  1E1O A;  1JCK B;  2H1E A;  1X6O A;  1WTX A;  1LUZ A;  3HZX A;  1T5E A;  3G7L A;  2DGY A;  3HFZ B;  3R93 A;  1WOC A;  4AQY L;  4DR4 L;  1IBK Q;  4MTN A;  4K0K L;  2NVT B;  5I9O A;  2OT2 A;  3TRZ A;  4JBJ A;  4A3J H;  3GTK H;  4AIM A;  3HOU G;  2LS0 1;  1XTC D;  2YYZ A;  5IGC A;  1QE6 A;  3J7A F;  1XJV A;  5DM6 3;  2JA5 H;  4OO1 I;  3S2D H;  1G51 A;  1R4P B;  3STB D;  2RBM A;  5I9P A;  3AMU A;  4JI4 Q;  4GOP A;  2Q2I A;  4K14 A;  1EUJ A;  4DV0 L;  4CHT B;  5LMN Q;  1M4V A;  2RCN A;  4XDX A;  1EOT A;  1U4P A;  1M90 C;  1E3P A;  3HOU B;  5CV5 A;  1LO5 D;  4GLA C;  1CZG A;  2B8F A;  5IP9 G;  3HOZ G;  2VUM G;  3MXN B;  3OIQ A;  3BVZ A;  1QUQ B;  2ENB A;  1HCZ A;  4IQZ A;  1T5X D;  2E74 C;  4P73 A;  5J22 A;  1U5K A;  3H15 A;  3UE1 A;  3CRK C;  1HZC A;  5JJL A;  1WTQ A;  4A3M H;  3URY A;  4LFC L;  1EQT A;  4DK0 A;  3HOZ B;  3Q23 A;  1A62 A;  2A73 B;  4OHJ A;  3HGB A;  5M5W H;  1CHQ D;  3H0G G;  3I4M B;  4BY7 G;  1I94 Q;  1B9N A;  2FJ2 A;  3N52 A;  2FMM A;  3TBI B;  2UUB Q;  2PPB C;  3IL8 A;  3SR1 A;  2F0L A;  1XMQ L;  5M3F G;  1VQG A;  4U67 3;  2JA8 B;  3LGJ A;  1SYC A;  1X3E A;  3SXH A;  3MEH A;  2F0K A;  1Y8N B;  3TZU A;  2E75 C;  2NVX H;  2AHO B;  4OIK A;  4L5T A;  3HOW G;  4CKE A;  3TP6 A;  2I5L X;  1B4O A;  4TRD A;  1MIU A;  1VQ4 A;  1Y1W H;  3H0G B;  1EIG A;  3OW7 A;  1F2M A;  4C3I G;  2C9O A;  1X55 A;  2E2H H;  5M3F B;  1NNX A;  3CKI B;  3NBH A;  2D5D A;  1EY7 A;  1B53 A;  4DV3 L;  1II3 A;  1F77 A;  1HNZ Q;  2BDO A;  1ICF B;  3M85 A;  4WJ3 M;  2K03 A;  1A6X A;  1D1I A;  2HIV A;  4OL7 A;  1L1O A;  1HHV A;  1N33 L;  1CUK A;  3K7U C;  5C0X I;  2JA6 H;  4NMZ A;  2F0T A;  1CZW A;  1Y14 B;  3NSW A;  4LW1 A;  5LMN W;  1BKB A;  2AQ2 B;  1GKH A;  5IP7 G;  1JE4 A;  1PZI D;  3WDN A;  5IOD A;  1K83 B;  3BDC A;  3TZD A;  1PH8 A;  4C1N I;  1TWG H;  4A3J G;  4LF7 Q;  1UE6 A;  5AFW A;  3GTM B;  1DCZ A;  2EPB A;  1STG A;  2PZW A;  3C1E A;  3BDO A;  2HQL A;  1QVG A;  2ZXR A;  2Q2U A;  3T1H L;  1IBL L;  4KKT A;  2R7Z B;  1VQ5 A;  2Z4I A;  2HIX A;  3I90 A;  1SNC A;  3DEO A;  3KF8 B;  2ZJR A;  5EJW A;  1ENC A;  2SEB D;  2WAQ G;  4X65 Q;  3MA2 B;  2ZTC A;  2NN6 H;  1K73 C;  3W3A A;  4A3L G;  1D8L A;  5C0X J;  2I5M X;  3K81 C;  4KHP Q;  1YBY A;  3ITP A;  4BXX H;  1ICW A;  4JC0 A;  1TWA B;  3DLL A;  1YNN D;  3S14 H;  3AYH B;  1QZH A;  4Y7N H;  5BR8 Q;  3NHH A;  1Q3L A;  3E9H A;  4UY8 C;  2PO4 A;  2FFK B;  2VQE Q;  4A3D H;  4A3M G;  1VQL A;  4IUN A;  2MGS A;  3KLW A;  1I6H H;  1N36 Q;  4UP9 A;  1U4M A;  1G91 A;  3PUZ A;  1MJC A;  1WTH A;  2K50 A;  1RD9 D;  1PH2 A;  3JAM E;  3TDQ A;  3HKS A;  2RQX A;  4F8M A;  3D6W A;  2KJX A;  3FMC A;  2G5D A;  3F2U A;  1E2V A;  2LXJ A;  4CKB A;  2EDG A;  3GQB A;  4K8I A;  3J7Z C;  1YIT A;  4LFB Q;  4HJ7 A;  2KVM A;  3U4Z A;  2N8N A;  1D1K A;  3D31 A;  5KIX A;  2L9H A;  3A8I E;  3BVG A;  1VQH A;  1U9R A;  2J0T D;  1EYA A;  2PNR C;  4P71 A;  3OHX C;  5G3L F;  3QIA A;  5C5L A;  2PYK A;  3SVM A;  3K57 A;  5FLM H;  2F0M A;  3CME A;  1YNJ C;  1F2Y A;  3KYH C;  1LV9 A;  1S5B D;  4MIU A;  4JYA Q;  2WB1 B;  1T9H A;  4JI7 L;  2PZT A;  3OTO L;  4UP8 A;  4DKA C;  1BBU A;  1CQV A;  1Q90 A;  5DEH A;  1HNW Q;  2VNU D;  3FKI B;  3K58 A;  2K5D A;  3RMH A;  2IY5 B;  1YNN C;  2O4X A;  3HOX H;  1AE2 A;  2KUM A;  1SYE A;  4DAY A;  1SRU A;  4I7A A;  2VY3 A;  3P20 A;  5IT9 L;  4PZ6 A;  1JQY D;  2QIL A;  4K5V A;  2CW0 D;  5CBE E;  5IYC G;  4B3S L;  4UPA A;  1S4Z A;  3S9W A;  1W6K A;  4CDF C;  3S16 B;  1BDO A;  4DV2 L;  3A56 A;  2NVY B;  3X3M A;  5ELE A;  1BNZ A;  2B2T C;  3SK6 A;  1J5E Q;  4R4C A;  3EA6 A;  1TWF H;  2NVQ H;  1HA6 A;  1G2S A;  4X66 L;  2E2I H;  3A0J A;  2I0Q A;  1SNQ A;  1AZQ A;  1B70 B;  1BVS A;  4ALP A;  3V2T A;  4GLX A;  2B8G A;  2ZJP A;  1ILQ A;  2D0O A;  3KLS X;  2WII B;  1KDA A;  3TP7 A;  3SDZ A;  4WJ4 A;  1BQQ T;  1LT3 D;  4AYB B;  2Y0S E;  3I8Z A;  3S17 H;  5M5X B;  3F2D A;  4X3T A;  1VMC A;  5JJK A;  2F03 A;  2A69 D;  5C44 G;  3TS0 A;  3CCS A;  4ME3 A;  3BVM A;  1KLG D;  1ET9 A;  5EKK A;  3T13 A;  1Z9F A;  3D4D A;  3IRB A;  1BOS A;  2BCO A;  3VYT A;  1XX8 A;  1YEZ A;  5CYU A;  2OF1 A;  3I2Z A;  2NN6 G;  1MJE A;  1RJT A;  3GTQ B;  4YHH Q;  4IFD H;  1XYI A;  1ESR A;  3K7A H;  5C44 B;  4BXX G;  1O7Y A;  3O13 A;  3QOL A;  3CCL A;  2KA7 A;  3NTH A;  1VQD A;  2WV6 D;  1LT5 D;  3H6M A;  1SSO A;  3CMA A;  1AH9 A;  3NQT A;  1WJJ A;  1OXU A;  4A3D G;  1GD7 A;  1EIH A;  3GTP B;  2UXC L;  1K8O A;  2F0H A;  4DNI A;  2N3S A;  4DAP A;  4DAV A;  3DMU A;  1YHB A;  3Q8D A;  4DU9 A;  1JJG A;  4IPC A;  3CD6 A;  3GO5 A;  3HG9 A;  2M00 A;  4UAI A;  2WP8 J;  4C3J G;  5KYI A;  4I65 A;  5FKA C;  1QNK A;  1V1P B;  1Z6H A;  2F0F A;  1PV4 A;  5IY0 A;  5A35 A;  2GVB A;  5FLM G;  3HRZ C;  2RDG A;  4G4K A;  1PTO D;  4LFA L;  4DV6 Q;  4GN5 A;  3S1N H;  1SND A;  1TU2 B;  3K5L A;  4DR1 Q;  2K32 A;  4PMC A;  4LF4 Q;  2JSO A;  3W1B A;  1XWE A;  4X64 L;  3L2P A;  2R92 G;  1YNX A;  1CFM A;  2EYO A;  3CRL C;  3AFQ A;  4N9T A;  4C3J B;  1R9T B;  3MAQ A;  1D5X C;  5FO8 B;  1I4G A;  1S3O A;  1NMG A;  5D65 A;  4IPH A;  3TSS A;  3V96 A;  3RZD B;  4DXG A;  3J80 c;  2ZM6 L;  2EYM A;  3QWN A;  5JEA H;  2E5L Q;  3CCM A;  3MWY W;  3S1M B;  4TSS A;  2R92 B;  3CCU A;  1VQB A;  3H3V C;  1XPU A;  1NUC A;  1MGS A;  1K0S A;  2ZXO A;  4FF4 A;  1TXY A;  1CKM A;  2E2D C;  1TY2 A;  4A3I G;  1YJ9 A;  4AQY Q;  1VF5 C;  2O2L D;  1WTO A;  4DR4 Q;  4OEL B;  2IPK D;  4K0K Q;  2ZTE A;  3VR5 A;  2L55 A;  2R61 A;  3W5O A;  1PTO C;  2KEC A;  5I2X A;  4DR3 L;  1JT8 A;  3NXW A;  4GKJ L;  2RF4 A;  4QGU A;  2JA7 H;  4A3B H;  2YTY A;  1EQV A;  1UEA B;  4P2C B;  4N9P A;  1GHK A;  4H44 C;  1PH6 A;  2NZH A;  1HZB A;  3I56 A;  4DR5 L;  3H3V H;  5E4W C;  3M4O B;  5EAY A;  4DV0 Q;  4FNF A;  3HEJ A;  4A3I B;  2IHE A;  3CW2 C;  3J80 E;  2HD3 A;  2NTS A;  4L8J A;  3PIP 3;  2TSS A;  2F3I A;  4EQO A;  3FPU B;  4FXD A;  2GA4 B;  2NVT H;  4J6H A;  3GTJ B;  3SE0 A;  2CH4 A;  4KD3 A;  1HZ9 A;  2UUA L;  3RD4 A;  3GTG B;  1JB7 A;  4HSV A;  1FGU A;  2QEJ C;  4S3S A;  1I4R A;  5LL6 S;  1RL2 A;  3CHB D;  4GN3 B;  4JOI C;  4XT1 B;  2NWG A;  4FP5 D;  4LFC Q;  4MTK A;  1PFM A;  5IGE A;  1EEI D;  3HOU H;  4L63 B;  3DM1 A;  4ZUI A;  1EYG A;  3J81 i;  2SNM A;  4ID6 A;  3PF5 A;  4L5Q A;  1LLR D;  3CCR A;  1PH3 A;  3RUZ A;  3I4L A;  1W6J A;  4MN3 A;  1UWV A;  3WWV A;  1IBM L;  1EY4 A;  2VS1 A;  1EOV A;  2K75 A;  3K0X A;  1FNV A;  5FOB B;  1XMQ Q;  2HT1 A;  1O80 A;  1XNQ L;  3CC7 A;  4BBR G;  3U9O A;  4N8F A;  1X3P A;  2PMZ E;  1BR9 A;  5IP9 H;  3FDT A;  4HID A;  3HOZ H;  4DXF A;  3KF8 A;  2Y0S G;  4OWT B;  1EU4 A;  2KQ3 A;  1SMY D;  5HUR A;  3J81 c;  4DV7 L;  4DF7 A;  3I7F A;  2OXP A;  1HH2 P;  3GV3 A;  4IPG A;  4C3H B;  3I4M H;  1GO3 E;  5FO9 B;  4JPB W;  4G7H C;  4X6A H;  1YHQ A;  5A2Q L;  4BBR B;  1Q8K A;  4NB3 A;  1VQ6 A;  5EBD A;  2JA8 H;  3PIO 3;  1UUP A;  1JE5 A;  2PNH A;  1S5E D;  2B2Y C;  2SNS A;  5CGK A;  4Z9C B;  4OX9 Q;  2A6E D;  4BWG B;  1XPR A;  3X3N A;  1Q8I A;  3PF4 A;  3VDY A;  2EJM A;  3NP8 A;  5IGD A;  2LY7 A;  4IUV A;  3CXC A;  3BZC A;  1JWU D;  3H0G H;  5ELD A;  1QCB D;  1JIC A;  1FL0 A;  1VQF A;  2CQO A;  1SYB A;  1KD1 C;  4B3M L;  4FO2 A;  5M3F H;  2MUY A;  2LMC B;  4JG2 A;  2UXD L;  1TII D;  2D9U A;  1K8M A;  1W3S A;  1CQF A;  1LTB D;  2MFI A;  1SAP A;  3ER0 A;  2ATW A;  2JA7 G;  1JOR A;  2F3W A;  3ERQ A;  1VQA A;  2IHF A;  2PI2 E;  1FNU A;  5T1G A;  4DUY L;  4DAM A;  3PUX A;  1LTT D;  3KF6 B;  3D8G A;  1DD2 A;  3U50 C;  3S15 B;  1STA A;  1M1K C;  1HA5 A;  4A3E B;  1IW7 D;  3T1H Q;  1IBL Q;  4RAU C;  4I7Z C;  2K7V A;  3NQI A;  1AE3 A;  1K8A C;  5EGT A;  2L5T A;  4HR7 B;  1K83 H;  5GAE C;  3PO2 G;  4OON A;  1VMP A;  4DV5 L;  1J8I A;  4PMB A;  1EEF D;  3FRP B;  1LTL A;  2K52 A;  1SEB D;  2PQE A;  1K28 A;  4PV1 C;  5EPK A;  2WB1 E;  2K01 A;  5C5M A;  2NYZ D;  3UDF A;  1HR0 L;  3NWT A;  2HCI A;  3GTM H;  1PRT F;  1AW7 A;  3I73 A;  5KYL A;  5IP7 H;  4KN4 C;  4V0B A;  1N9W A;  2R7Z H;  2V1C C;  1C9O A;  3PO2 B;  1EYC A;  1UNS A;  3KOJ A;  2KHJ A;  4JI0 L;  3K59 A;  2H4O A;  3ERO A;  4CBV A;  1PTO B;  2NZO A;  1TS5 A;  1H9K A;  2EE1 A;  5EBC A;  3OW2 A;  1TWA H;  2F0N A;  3VA7 A;  3J7A 5;  1DXM A;  1Z47 A;  1UE5 A;  1OXV A;  3DEP A;  5BN4 A;  1EIY B;  4X3U A;  1QNU A;  5EKI A;  4OO1 H;  1H95 A;  2YTV A;  3GD7 A;  3S2H B;  3HS0 C;  1WFQ A;  4FF1 A;  4IOA A;  2ALY B;  4B9X A;  4A3L H;  4BS9 A;  1IZ6 A;  3BJU A;  2CKZ B;  3OTO Q;  5EPL A;  3CPW A;  1KAB A;  1O7L A;  2AMC B;  2XN9 C;  2Q2H A;  2IX1 A;  1PFN A;  4C56 C;  1QG7 A;  5CV8 A;  1FJG L;  1WI5 A;  4AYB E;  1FGB D;  4P75 A;  4JBW A;  4JI6 L;  4NDX A;  5AJ3 L;  1IXR A;  3I4M G;  1SE2 A;  4IUU A;  2MP1 A;  1V9P A;  2EIF A;  4DK1 A;  1B1Z A;  4UDU C;  4EQ5 A;  1KXL A;  4DV2 Q;  3EBE A;  4KLK A;  2JA8 G;  1CT1 D;  1H9S B;  5CV4 A;  1F2L A;  4YY3 Q;  3A7L A;  5IIF A;  3OWE B;  2Q8I B;  4EX5 A;  1CTM A;  3A54 A;  2EJG C;  5JPN C;  4POF A;  2DN8 A;  2IW3 A;  3FKI H;  3STB C;  3T53 B;  3PO3 G;  5GAG C;  4X66 Q;  1PZK D;  5JAV A;  2HQE A;  1VQO A;  3JC6 6;  3EN2 A;  3C1F A;  1BF4 A;  2AQ1 B;  1KQS A;  5GRO A;  1G6Z A;  3NEM A;  3S24 A;  5FJ8 G;  4KY5 A;  3S16 H;  1EIF A;  2NVY H;  1V8Q A;  2V4D A;  3E3X A;  5FO7 B;  1CKO A;  2HDM A;  1LAB A;  3M4Q A;  4BBS G;  1BXT A;  1QB5 D;  3PO3 B;  4ZK9 B;  1Q86 C;  3ZJY C;  2ASB A;  5IGG A;  5ELF A;  2X6L A;  2XTI A;  4QIW E;  2EZV A;  2F0P A;  4R8N A;  5IYC H;  3NE5 B;  4TVA B;  2M9V A;  2K5W A;  1PA6 A;  1MSG A;  1OXT A;  4JI3 Q;  2Z6K C;  2BA0 A;  2Q2T A;  4RG1 A;  2F0I A;  5JPM C;  3TS2 A;  2JP1 A;  1Y8P B;  4Y52 H;  4R4T A;  1PHJ A;  4BBS B;  3U9S A;  4DR2 Q;  1G29 1;  4ZAI A;  1A2U A;  4ODG A;  4RCN A;  3OIP A;  4A3F B;  2NB0 A;  2R3Z A;  4KKU A;  5CV9 A;  3JAM i;  4KD4 A;  2NZ1 D;  3G6E A;  3ZYY X;  2CCZ A;  2XSC A;  5M5X H;  4DUZ L;  2MO0 A;  4QQB X;  1STE A;  4B9W A;  4GNX B;  2NTT A;  3SGI A;  4DFA A;  4RGM A;  2IJ0 A;  1XTD A;  3DUZ A;  5C0X H;  2PMZ B;  3K6O A;  2R7Z G;  3T16 A;  3TRE A;  2UXC Q;  1OXS C;  3NUC A;  2IL8 A;  3QG1 A;  3T1Y Q;  3GTQ H;  1TWH B;  1UE1 A;  4RWS C;  1S5D D;  1I4Q A;  2ZT9 C;  3JAM c;  5C44 H;  1W2B A;  5ISR A;  5T1I A;  1HQR D;  3FHW A;  1KTK A;  3G6J B;  2D0P A;  3G4S A;  4JI5 L;  3I4O A;  1VQN A;  4OO1 G;  1EWC A;  3I70 A;  5BN5 A;  2QA4 A;  4CJ0 B;  4LJZ C;  2Q8T A;  4LFA Q;  3A5U A;  1LYL A;  4GN4 B;  3GTP H;  1K9M C;  2JQO A;  2XWJ B;  5JJI A;  1L0X B;  1SE8 A;  2VB3 X;  5K5P A;  4DR7 L;  2UXB L;  4X64 Q;  2WIN B;  1NE3 A;  5KGU A;  2K5N A;  5C4X G;  2B2T A;  3WOE A;  3A8K E;  1E22 A;  4HSP A;  4LNQ A;  3EQL C;  4RHR A;  4DV1 L;  2ZJQ A;  2GVA A;  2K04 A;  4L5S A;  2XNA C;  3CAM A;  1PH4 A;  1IKL A;  2ZM6 Q;  4FF2 A;  3A74 A;  2G9H D;  1DJR D;  2F3V A;  2WB1 G;  5EQ0 A;  4NW2 A;  1EWH A;  1E24 A;  3FKI G;  5HGT A;  3HOY B;  5C4X B;  4C3J H;  1R9T H;  3AEV A;  5H1S E;  3KBG A;  1QWY A;  2I46 A;  4JV5 L;  1IBK L;  4DR3 Q;  2F52 A;  2C5C A;  5DLQ E;  3GTL B;  4GKJ Q;  3RZD H;  2YU9 B;  4HMI A;  5KND A;  4WFN 3;  2X6G A;  2UU9 L;  2R92 H;  3L7Z C;  3S1M H;  4IJL A;  2PW5 A;  3R2T A;  1TS3 A;  4JI4 L;  4BA1 I;  3J81 L;  2C35 B;  2CWP A;  4HED A;  3KDF A;  4HJ5 A;  4RCO A;  2F4V L;  1SJE D;  3CU7 A;  3J7A V;  1HRJ A;  4JCV E;  3HOV G;  4DGZ A;  1A3U A;  3VR3 A;  5M9O A;  1SN8 A;  3I91 A;  2UUA Q;  5I6Y A;  3ONA B;  1TKW B;  3AFP A;  1DYQ A;  4AYB G;  1V43 A;  1TWC B;  2NBF A;  2XWB B;  1VQ9 A;  3M4O H;  2XIW A;  4A3I H;  1GOZ A;  4P74 A;  3HOV B;  1JB3 A;  2B3G A;  4MHE A;  5C0X G;  3BU2 A;  3VYS A;  4C2M B;  3CCJ A;  2EJF C;  3ICE A;  3GTJ H;  4ZUJ A;  4CJ1 B;  3SK5 A;  3BYY B;  3M3Y B;  1ONL A;  3R8B A;  3GTG H;  1IYV A;  2EVB A;  2EY6 A;  1HNX L;  4BY1 B;  1F9P A;  1LAC A;  2F1M A;  2KCC A;  2JEA I;  1IBM Q;  1CA5 A;  2CW0 C;  3NBI A;  4HJA A;  1C0A A;  2OTL A;  5E3F A;  1XNQ Q;  1A3T A;  2F0O A;  1A63 A;  2HUG A;  4ZCK A;  3OYY A;  2JYO A;  5FLX c;  3UE0 A;  5C6A A;  3VYU A;  3CQZ B;  4KHV A;  4K8J A;  4DV7 Q;  2A5H A;  1VQM A;  1K3R A;  1S5C D;  1AEX A;  1SLJ A;  1E0B A;  4PQX A;  3QB3 A;  5ELC A;  1SE4 A;  4RGO S;  3E0E A;  4QUF A;  3T4A C;  2I07 B;  3DWA A;  4IFD I;  1PFB A;  1I3Q B;  1S40 A;  4H13 C;  4JW0 A;  2QKI C;  3KLS A;  4JI8 L;  2EQS A;  2JE6 I;  5J3B A;  3TME A;  3M7G A;  4XYQ A;  2F0Q A;  2E8G A;  1F2Z A;  3NEN A;  3K5M A;  3HP3 A;  3QOJ A;  4QIW B;  3Q24 A;  2A69 C;  1SNO A;  5KRU A;  1JOK A;  3Q6S A;  4IUQ A;  1QOH A;  4C3H H;  1XMO Q;  3UI2 A;  4R4Q A;  1C7Y A;  1DGS A;  4B3M Q;  3CCV A;  5FLX E;  2UXD Q;  4DNT B;  1JMC A;  4BBR H;  3J80 i;  1BCP D;  1VQI A;  1YZ6 A;  1TR5 A;  4A3G G;  2O5J C;  1PYS B;  2EXD A;  4XQN A;  2Z0S A;  1O7I A;  2FIN B;  3VR2 A;  4DUY Q;  3Q0A A;  3NTK A;  3MXN A;  1Y1V B;  2DUD A;  1QUQ A;  1WTP A;  2MPM A;  4OWW B;  2E2J B;  1I6V C;  3WOF A;  3MEF A;  4A3G B;  4IPD A;  3G71 A;  5DNF A;  1NBW A;  2N88 A;  2K5H A;  4A76 A;  1E7Z A;  1G6P A;  4JOI A;  2OTJ A;  3KUP A;  3NBH B;  3MC0 B;  4CDD C;  5CMD A;  2F0D A;  5BR8 L;  4PZ7 A;  1HTP A;  3S15 H;  4O0A A;  4A3E H;  4RA8 A;  1GVP A;  4CDE C;  4YCU A;  1WYD A;  1GUT A;  1GJX A;  3CC2 A;  4JI0 Q;  1BCP C;  1Y69 U;  4H0L C;  1X56 A;  4G7O C;  5GQO A;  1ASZ A;  2RCF A;  1N32 L;  3ULJ A;  3S1R B;  2A6H D;  4RH6 A;  3CCQ A;  1KC8 C;  3DWQ A;  2CFM A;  5K36 G;  1I4H A;  2D62 A;  1L0W A;  1Q81 C;  1ZYR D;  1KHI A;  4L5R C;  1A3V A;  2IWH A;  1A8V A;  4BA2 I;  3F2C A;  3PO2 H;  1WD0 A;  4K5X A;  3CC4 A;  5HGQ A;  1NSN S;  5TSS A;  1MBY A;  3PUY A;  5M5Y B;  1TS2 A;  1PTO H;  3FP9 A;  5LHY 1;  3PIP A;  2K5V A;  3SK8 A;  2VQF L;  1FD7 D;  2A8V A;  1XXG A;  5D14 A;  3M4Y A;  1FJG Q;  3MTS A;  1WCM G;  4JI6 Q;  4K2K A;  2B2Y A;  1KDB A;  4XIG S;  1ESF A;  4JI1 L;  2OWO A;  2R7F A;  4A3K B;  3W2D A;  4FYD A;  3CPF A;  1ML0 D;  2RA4 A;  2RSN A;  3S2H H;  4DV4 L;  2PCF B;  2M2L A;  2Z8L A;  4RMF A;  3I3C A;  1SFO B;  4GS3 A;  4IAL A;  1WCM B;  4KKS A;  4DNR B;  5IWA L;  2DNE A;  2K28 A;  4POG A;  1CSP A;  4HCS A;  1PYB A;  3PUV A;  3P75 A;  4OGQ C;  3JAM L;  1PTO F;  4C3H G;  1EZ8 A;  4HJ8 A;  1PRT D;  1CK1 A;  2FXQ A;  1B3Q A;  3E0J A;  1DM0 B;  1DOM A;  3B6Y A;  4APV A;  1MD2 D;  4QY7 A;  4F87 A;  1TT2 A;  1LTG D;  2PQA B;  2QW7 A;  4X62 L;  1SE3 A;  2AKW B;  2EYP A;  1GXD C;  4E6I A;  4PZ8 A;  1ENA A;  4CGY B;  4JI2 L;  4YWL A;  1JOO A;  2R93 B;  2LFN A;  4DV3 Q;  4J8Q A;  2L15 A;  4NP5 A;  3OMC A;  1UAP A;  5I6W A;  1ET6 A;  4ZQ3 A;  2QDL A;  5IYB G;  5LMU L;  2KEN A;  2VB2 X;  2WKD A;  1ZKO A;  3A55 A;  1N33 Q;  3GDE A;  4UP7 A;  3PO3 H;  2JN4 A;  2N49 A;  4GNX C;  1K0R A;  3F1Z A;  4HAE A;  1Q1B A;  2PI2 A;  2F0V A;  2A68 D;  4MNO A;  2OCE A;  4K5W A;  3TP5 A;  3VR6 A;  4ZLT F;  5C3X A;  1C8C A;  2IX3 A;  3HKZ B;  1IL2 A;  1UEB A;  4A3E G;  1V1Q A;  5FJ8 H;  1I4X A;  3LNN A;  2PZU A;  4B3R L;  1KDC A;  2BE5 D;  4B08 A;  5LL6 X;  4BBS H;  1ILP A;  1GHJ A;  3D4R A;  3K5N A;  4A3F H;  1SMY C;  1A2T A;  4A93 B;  3BYT B;  4ME5 A;  4KJN A;  2B2V C;  3FPP A;  3NWS A;  3L0O A;  4YCW A;  4HIM A;  1VQ8 A;  4JI5 Q;  3RNU A;  1EU3 A;  5IYD H;  5CR3 A;  4FVM A;  5IE8 A;  1SYG A;  1LTR D;  1PFS A;  4LUZ A;  1TVX A;  2WAQ E;  1JWM D;  1HFG A;  1D2B A;  2A6E C;  4HTH A;  4DR7 Q;  3AU7 A;  1QVC A;  3I4N B;  2UXB Q;  1RCV D;  3RLO A;  5C4H A;  1RF2 D;  4LF6 L;  2B2W C;  1TWH H;  4LF5 L;  2ICE C;  3GTO B;  1CKN B;  4ZKB B;  5JJZ A;  1UE7 A;  1SR3 A;  1SDF A;  1G8Z D;  1HUN A;  5EKL A;  1SXT A;  2DY7 A;  1ZXT A;  4FXK C;  2BE5 C;  1BCP B;  1KIX A;  1HZA A;  1OO9 B;  2ICI A;  2X69 A;  3K8A A;  1IYU A;  2F4I A;  1SBB B;  1EY5 A;  4CKC A;  3H91 A;  1B44 D;  1E2W A;  4F88 A;  2RDF A;  4XQJ A;  1EFI D;  1IW7 C;  4A75 A;  2BA1 A;  2Z6B A;  4PG3 A;  4JV5 Q;  1KL9 A;  4XT3 B;  4DR6 L;  5M3M G;  3W1G A;  3C46 A;  2MO1 A;  3SHL A;  4NKL A;  4KK7 A;  2F0E A;  5C3E B;  1U0L A;  2K05 A;  4JI7 Q;  2EYJ A;  4R9W A;  2UU9 Q;  1N34 L;  2SOB A;  5KNC A;  1MKH A;  2B63 G;  1RKN A;  3KBX A;  4DN4 M;  5FLX L;  2K14 A;  2Z6K A;  4IUR A;  1PH1 A;  2L0C A;  3KLR A;  5C4X H;  1Q82 C;  3HOY H;  1B8A A;  3ULP A;  2H5X A;  3D3R A;  4DA2 A;  3RR5 A;  4HCE A;  4IUP A;  5M3M B;  4B3S Q;  2F4V Q;  1NJI C;  1PVO A;  2KCM A;  2N78 A;  3ND8 A;  1DZ1 A;  2B2U C;  4B3T L;  3GTL H;  5NUC A;  1WTR A;  1VQC A;  2YU9 H;  3DXJ C;  2RHS B;  2B63 B;  3RZO B;  3IFD A;  3BDL A;  4YWK A;  1LTA D;  1DOL A;  3M4P A;  2CH4 W;  2E76 C;  2BH8 A;  2CWA A;  1YJW A;  2LXK A;  5JOB A;  4FF3 A;  3A8J E;  4IOC A;  3PQI A;  1BO0 A;  5IOC A;  4KY7 A;  1I50 B;  1LT4 D;  2F0S A;  3I72 A;  2Z9H A;  2ZXP A;  4TKO B;  2VUM B;  1V1P A;  1RTO A;  1EY0 A;  4ABN A;  1C4Q A;  4GLV B;  4A3F G;  1PZJ D;  3OSO A;  3S1Q B;  1HNX Q;  2L4N A;  3G48 A;  4NXN L;  4O1N A;  1TWC H;  5KEE A;  1D5M C;  2R6G A;  3GV6 A;  4EVO A;  2EOT A;  1PH5 A;  1NTG A;  4YIJ A;  3MXG A;  3ND9 A;  3TN2 A;  4YCV A;  3HOV H;  5EPJ A;  4K6D A;  5IYD G;  4GOP C;  3D4W A;  3AQQ A;  5G3L D;  2MQH A;  1VF7 A;  4C2M H;  5E4X A;  3J80 L;  1MI2 A;  1HFN A;  1IYJ B;  2RHQ B;  1I5F A;  2VXW A;  3M3Y H;  4WRD A;  4BY7 B;  3NTI A;  1SYD A;  1I4P A;  3P1H A;  4BY1 H;  1MSH A;  1F9R A;  1A0I A;  1STY A;  2L11 A;  1XNR L;  2UUC L;  1PRT B;  3HOW B;  4JI8 Q;  4OX9 L;  3QJY A;  4HMJ A;  4K2L A;  1D5Z C;  2ID0 A;  3CQZ H;  3MXP A;  3D6C A;  4MZ9 A;  5D3I B;  1QVF A;  4C3I B;  3Q22 A;  3M9B A;  1S72 A;  1SNM A;  5E7N A;  1U4R A;  1PLF A;  4ZKC B;  3UDG A;  4NXM L;  3CF5 A;  4M1U B;  5GAD C;  3C3L A;  3N6R A;  1I3Q H;  4UHV A;  4CJ2 C;  4YWM A;  4QMG A;  4LF8 L;  2N55 A;  1X3Q A;  4OXP A;  1KRS A;  3KFU A;  1IL8 A;  2F0U A;  3A5Z B;  4J15 A;  4GKK L;  5C4J B;  1P8L A;  2JA5 G;  4LF9 L;  1EYD A;  4XXE A;  2HHH L;  4H02 A;  3HOY G;  2NN6 I;  4WJW A;  1SJH D;  1CHP D;  1YNJ D;  2AWN A;  3NK9 A;  1STH A;  1GUW A;  4LUV A;  4IUT A;  3GTK B;  4A3J B;  4HIK A;  4IZ8 A;  4KMU C;  2JA5 B;  3S2D B;  4PNY A;  2OEO A;  2KCT A;  4L6T B;  1GUN A;  2A74 C;  3P7J A;  4ULL A;  3M7N A;  5J39 A;  1Y1V H;  3OOC A;  1L1O C;  1OXX K;  3BG3 A;  1D6E C;  2AQ3 B;  2E2J H;  2WAQ B;  2IX0 A;  1VDZ A;  1JR0 D;  4A3G H;  4KJO A;  3KK7 A;  1N32 Q;  1BUV T;  2K6A A;  5CV6 A;  5GAH C;  2CHB D;  1NCV A;  2NUC A;  2J4X A;  1STN A;  4RGN A;  1B7Y B;  2PQA A;  3MXU A;  3C2P A;  4DR5 Q;  1E1T A;  5KNB A;  1P16 A;  4A3M B;  3FVQ A;  5LMN L;  3J81 j;  1GUO A;  3CP0 A;  3OPO A;  5C3W A;  1SYF A;  2EYL A;  1N8R C;  2KED A;  4QB4 A;  1X3G A;  4RHS A;  2A19 A;  1SMX A;  3IFT A;  5IGF A;  1BBX C;  2VQF Q;  4KY6 A;  5A2Q E;  5DM7 3;  3S1R H;  4Q0F A;  2BH2 A;  1Q46 A;  1K8G A;  4A3C H;  2RDH A;  5ELO A;  3H09 A;  5M5W B;  4G7Z C;  1Y1W G;  1EY6 A;  1X65 A;  1J6Q A;  1Z7T A;  4JI1 Q;  4BY1 G;  1EWI A;  1VS0 A;  2DY8 A;  2LKV A;  2IT1 A;  5C4Z A;  1FYC A;  3R3O A;  4DV4 Q;  2NVX B;  5BN3 A;  4YY3 L;  2ES2 A;  3I55 A;  2F0G A;  5M5Y H;  3KJO A;  3SK4 A;  2EYH A;  2K5Q A;  2LSS A;  1Y1W B;  3L9A X;  2JA6 G;  1E2Z A;  3L3O C;  1CSQ A;  2YTX A;  5IWA Q;  5K36 H;  2QGQ A;  3BS1 A;  1J9O A;  1PH7 A;  1I94 L;  4WOR A;  2E2H B;  3D0F A;  2UUB L;  5J1Z A;  3F8T A;  3KF6 A;  1SRO A;  4AH6 A;  4A3K H;  1NMF A;  3HKZ E;  3TP8 A;  4ILW A;  4GOP B;  3J7Y W;  1F9S A;  2PW7 A;  1OTC A;  1YIJ A;  1NR2 A;  2G9D A;  3E9I A;  4X62 Q;  4LK1 C;  4X3S A;  2JA6 B;  5IGB A;  1SFO H;  1KAW A;  4M8A A;  1FVI A;  1WCM H;  3FEW X;  1TY0 A;  1U4L A;  1DOK A;  4CDC C;  4JK1 C;  3ULL A;  2EY2 A;  3BZD B;  1LM0 A;  2GN5 A;  4JI2 Q;  4A4I A;  4JI3 L;  1CKN A;  3AB9 A;  2XGT A;  1YVC A;  2JK8 A;  3EVQ A;  1Q12 A;  1Y8O B;  2DNC A;  4DK6 C;  4EGV A;  2BDN A;  1HNZ L;  1TWG B;  4DR2 L;  2K4K A;  3PCO B;  4HIO A;  2FHT A;  4OWX B;  5LMU Q;  4QUC A;  3PMF A;  4KHZ A;  4O2D A;  5DAU A;  1D7Q A;  3U4V A;  5COY A;  4EQP A;  2KBN A;  1FR3 A;  1AN8 A;  1A15 A;  4N8X 1;  5ELN A;  4J1M A;  1L0Y B;  1R4Q B;  1JWS D;  3A7A B;  2WKC A;  1Y1V G;  1QIL A;  1C48 A;  2SDF A;  1HQM C;  2R93 H;  3R2I A;  4B3R Q;  3KJP A;  2JXM B;  2Q8R E;  2VW9 A;  1KLU D;  3T1Y L;  1K3B C;  1RTN A;  3NEL A;  5JVH 3;  1KRT A;  4LF7 L;  4QJF A;  3S14 B;  5JVG 3;  2MJ8 A;  1B2T A;  4Y7N B;  1PH9 A;  3NPP A;  1B9M A;  1RHP A;  2HCC A;  1VQ7 A;  4JBM A;  4A3D B;  2JA9 A;  4IFD J;  3PGZ A;  1I6H B;  2ZTD A;  1GM5 A;  4LWC A;  3OMG A;  4X65 L;  4DV5 Q;  3CCE A;  5IYB H;  2KHI A;  1KAA A;  1AFP A;  1EY8 A;  4LF6 Q;  3GP7 A;  4KHP L;  2CQA A;  5F2D A;  4A93 H;  1EQR A;  4LF5 Q;  2AWO A;  1HR0 Q;  1H9S A;  3ERS X;  2XVS A;  4A3C G;  1EL0 A;  4QCL A;  3HOX G;  4NPS A;  2L12 A;  4RGT A;  3EIV A;  4QF4 A;  2MHV A;  4DPG A;  5I4D A;  4EQN A;  1YI2 A;  1L2F A;  1RDP D;  2VQE L;  2KOL A;  5D3D A;  4HJ9 A;  1ENF A;  4JBK A;  1N36 L;  3DM3 A;  1L1O B;  1BBW A;  1ROD A;  1VQP A;  4LAA A;  2HDL A;  1H9R A;  4FDB A;  3I4N H;  4LFB L;  3TQY A;  4IO9 A;  1EFW A;  1LTI D;  3HOX B;  1HPC A;  2XRQ D;  3GTO H;  1DON A;  2WAC A;  3PUW A;  3LWU A;  3F2B A;  1VQE A;  4P72 A;  4DR6 Q;  2EYF A;  1HTL D;  3BZK A;  2KCN A;  4A3K G;  2EY5 A;  3H3V I;  1RIP A;  4JYA L;  4RKB A;  1N34 Q;  4HN7 A;  1ZEQ X;  2J7Z A;  1HNW L;  3K5O A;  3RLF A;  1O78 A;  3IAY A;  1MHW C;  1TWF B;  2NVQ B;  2EY1 A;  4X3K A;  3VR4 A;  2E2I B;  1JOQ A;  5JEA J;  1CM9 A;  3UDI A;  1V1O A;  5HY6 A;  5AJ3 Q;  1STB A;  2L1B A;  2QCP X;  3T56 B;  4R1J A;  2QF7 A;  2JEB I;  4GNX A;  4B3T Q;  3K80 C;  1HXY D;  4KTA A;  5CC4 A;  5C3E H;  1YHA A;  2A6H C;  3UDX A;  3S17 B;  1FNW A;  4IFD G;  1AZP A;  1J5E L;  1VQK A;  2EXZ A;  3MFY A;  2K1B A;  3T51 B;  4GZY C;  1ZYR C;  1TQO A;  1BCP F;  3U58 A;  2WFW A;  3MZ5 A;  2B39 A;  3EFX D;  5M3M H;  2B2V A;  1CI3 M;  3MHB A;  4RKL A;  1S5F D;  3VYR A;  2R93 G;  1B3A A;  2QDB A;  4F7X A;  2AUK A;  3MVV A;  3OWF A;  2O5I C;  1HUM A;  1HR0 W;  2B63 H;  3V05 A;  3SEB A;  1VCI A;  5L37 A;  3RZO H;  1EY9 A;  3K7A B;  4R8I A;  4FXG C;  2RVL A;  1X54 A;  2FMC A;  4NXN Q;  1WD1 A;  1LT6 D;  1WVL A;  2Z4H A;  1NY4 A;  2K33 A;  3MFG A;  4K6L A;  1Q1E A;  4XYO A;  1QZG A;  1CA6 A;  2KEE A;  3K0Y A;  2B2W A;  1TS4 A;  2QEX A;  3HKZ G;  5FK9 C;  4ZYS A;  1I50 H;  4JVZ A;  3LX0 A;  1IHZ A;  2DJG C;  2VUM H;  4C1N K;  1HJP A;  4DAY B;  1B50 A;  1NR4 A;  3QO2 A;  3IKJ A;  4U68 A;  4YHH L;  1ASY A;  2BOS A;  1EQQ A;  3QR8 A;  3KDF B;  1QJO A;  4H7B A;  4DUZ Q;  3PIO A;  3S1Q H;  4A93 G;  2RSO A;  1F9Q A;  5IT9 c;  1JC7 A;  4QL5 A;  1SNP A;  4LUO A;  1WTW A;  2MNA A;  3DHQ A;  3VA5 A;  4XQQ A;  1X9N A;  2A1A A;  1EZ6 A;  1XNR Q;  1PRT C;  3RN2 A;  1PYW D;  1WTV A;  2VZA A;  2UUC Q;  1XPO A;  4ZRZ A;  4PMW A;  3S1N B;  1PMR A;  2Y0S B;  1Q7Y C;  5CBA E;  5JEA G;  4XTC S;  5E1F A; 
#chains in the Genus database with same CATH homology
 3E5S A;  1LTS D;  1KNE A;  1O7Z A;  3LWE A;  2AUJ D;  4IN3 A;  1KNA A;  3J81 E;  1NAP A;  5CV7 A;  5COR A;  4KI0 A;  3H94 A;  5IT9 E;  1AP0 A;  2TMP A;  1G2T A;  4OIJ A;  4KV6 A;  1IKM A;  1GUS A;  1GUG A;  2B2U A;  1M8A A;  3EJI A;  4V19 0;  1PXU A;  2A68 C;  2XRS D;  1X32 A;  1H9M A;  2F0J A;  3PV0 A;  5I2Y A;  4TQU S;  2RKS A;  3E6Z X;  4RFB A;  1H9J A;  4G57 A;  3DWP A;  2D2C C;  2CVR A;  4A3B B;  4KN7 C;  2Z1C A;  2JA7 B;  2F0W A;  2KHS A;  5ELB A;  4Q5V A;  4O42 A;  1PDQ A;  4LMQ D;  1JCK B;  2H1E A;  1WTX A;  3HZX A;  1T5E A;  3G7L A;  3R93 A;  2NVT B;  5I9O A;  2OT2 A;  2LS0 1;  1XTC D;  2YYZ A;  5IGC A;  1QE6 A;  3J7A F;  5DM6 3;  4OO1 I;  1R4P B;  2RBM A;  5I9P A;  3AMU A;  4K14 A;  4CHT B;  1M4V A;  4XDX A;  1EOT A;  1U4P A;  3HOU B;  5CV5 A;  1LO5 D;  1CZG A;  2B8F A;  3OIQ A;  3BVZ A;  2ENB A;  1HCZ A;  4IQZ A;  1T5X D;  2E74 C;  5J22 A;  3CRK C;  1WTQ A;  3URY A;  1EQT A;  4DK0 A;  3HOZ B;  3Q23 A;  2A73 B;  4OHJ A;  3HGB A;  1CHQ D;  3I4M B;  1B9N A;  2FJ2 A;  3N52 A;  2FMM A;  3TBI B;  2PPB C;  3IL8 A;  3SR1 A;  2F0L A;  4U67 3;  2JA8 B;  1SYC A;  3SXH A;  3MEH A;  2F0K A;  1Y8N B;  3TZU A;  2E75 C;  4OIK A;  4CKE A;  3TP6 A;  1B4O A;  4TRD A;  3H0G B;  1EIG A;  3OW7 A;  1F2M A;  4C3I G;  2C9O A;  5M3F B;  3CKI B;  3NBH A;  2D5D A;  1EY7 A;  1B53 A;  1II3 A;  1F77 A;  2BDO A;  3M85 A;  2K03 A;  1A6X A;  1D1I A;  4OL7 A;  1HHV A;  5C0X I;  4NMZ A;  2F0T A;  1CZW A;  3NSW A;  2AQ2 B;  1JE4 A;  1PZI D;  3WDN A;  5IOD A;  1K83 B;  3BDC A;  3TZD A;  4C1N I;  5AFW A;  3GTM B;  1DCZ A;  2EPB A;  1STG A;  2PZW A;  3C1E A;  3BDO A;  2ZXR A;  2R7Z B;  4KKT A;  2Z4I A;  3I90 A;  1SNC A;  3DEO A;  5EJW A;  1ENC A;  2SEB D;  3MA2 B;  2NN6 H;  3W3A A;  5C0X J;  3ITP A;  1ICW A;  1TWA B;  1YNN D;  3NHH A;  1Q3L A;  2PO4 A;  2FFK B;  4IUN A;  2MGS A;  1U4M A;  1G91 A;  3PUZ A;  1RD9 D;  3JAM E;  3TDQ A;  2RQX A;  4F8M A;  3D6W A;  2KJX A;  3FMC A;  3F2U A;  1E2V A;  4CKB A;  2EDG A;  3GQB A;  4K8I A;  2KVM A;  1D1K A;  3D31 A;  5KIX A;  2L9H A;  3A8I E;  3BVG A;  1U9R A;  2J0T D;  1EYA A;  2PNR C;  3OHX C;  5G3L F;  3QIA A;  5C5L A;  2PYK A;  3SVM A;  3K57 A;  2F0M A;  1YNJ C;  1F2Y A;  1LV9 A;  1S5B D;  4MIU A;  2WB1 B;  2PZT A;  1CQV A;  1Q90 A;  5DEH A;  2VNU D;  3FKI B;  3K58 A;  2K5D A;  3RMH A;  1YNN C;  2O4X A;  2KUM A;  1SYE A;  4DAY A;  3P20 A;  5IT9 L;  1JQY D;  2QIL A;  4K5V A;  2CW0 D;  5CBE E;  1S4Z A;  3S9W A;  1W6K A;  3S16 B;  1BDO A;  3A56 A;  2NVY B;  3X3M A;  5ELE A;  1BNZ A;  2B2T C;  3SK6 A;  3EA6 A;  1HA6 A;  1G2S A;  1SNQ A;  1AZQ A;  3V2T A;  2B8G A;  1ILQ A;  3KLS X;  2WII B;  1KDA A;  3TP7 A;  3SDZ A;  1BQQ T;  1LT3 D;  4AYB B;  3I8Z A;  5M5X B;  4X3T A;  1VMC A;  2F03 A;  2A69 D;  3BVM A;  1KLG D;  1ET9 A;  5EKK A;  3T13 A;  3D4D A;  1BOS A;  2BCO A;  3VYT A;  1XX8 A;  5CYU A;  2OF1 A;  2NN6 G;  1RJT A;  3GTQ B;  4IFD H;  1XYI A;  1ESR A;  5C44 B;  1O7Y A;  3O13 A;  3QOL A;  2KA7 A;  3NTH A;  2WV6 D;  1LT5 D;  3H6M A;  1SSO A;  3NQT A;  1OXU A;  1EIH A;  3GTP B;  1K8O A;  2F0H A;  4DAP A;  4DAV A;  3DMU A;  4DU9 A;  3GO5 A;  3HG9 A;  2M00 A;  4UAI A;  4C3J G;  2WP8 J;  5KYI A;  4I65 A;  5FKA C;  1QNK A;  1V1P B;  1Z6H A;  2F0F A;  5A35 A;  3HRZ C;  2RDG A;  4G4K A;  1PTO D;  1SND A;  1TU2 B;  3K5L A;  2K32 A;  4PMC A;  2JSO A;  1XWE A;  3CRL C;  1CFM A;  2EYO A;  4N9T A;  4C3J B;  1R9T B;  3MAQ A;  1D5X C;  5FO8 B;  1I4G A;  5D65 A;  3TSS A;  3V96 A;  3RZD B;  4DXG A;  2EYM A;  3QWN A;  5JEA H;  3MWY W;  3S1M B;  4TSS A;  2R92 B;  3H3V C;  1NUC A;  1MGS A;  2ZXO A;  4FF4 A;  2E2D C;  1TY2 A;  1VF5 C;  2O2L D;  1WTO A;  2IPK D;  3VR5 A;  2L55 A;  2R61 A;  1PTO C;  2KEC A;  5I2X A;  3NXW A;  1EQV A;  1UEA B;  4P2C B;  4N9P A;  1GHK A;  4H44 C;  5E4W C;  3M4O B;  4FNF A;  3HEJ A;  4A3I B;  3J80 E;  2NTS A;  4L8J A;  3PIP 3;  2TSS A;  4EQO A;  4FXD A;  3FPU B;  2GA4 B;  4J6H A;  3GTJ B;  3SE0 A;  4KD3 A;  3RD4 A;  3GTG B;  4HSV A;  2QEJ C;  4S3S A;  1I4R A;  5LL6 S;  3CHB D;  4XT1 B;  2NWG A;  4FP5 D;  1PFM A;  5IGE A;  1EEI D;  4L63 B;  3DM1 A;  4ZUI A;  2SNM A;  4ID6 A;  1LLR D;  3RUZ A;  3I4L A;  1W6J A;  4MN3 A;  1EY4 A;  1FNV A;  5FOB B;  1O80 A;  3U9O A;  1X3P A;  1BR9 A;  3FDT A;  4DXF A;  3KF8 A;  1EU4 A;  2KQ3 A;  1SMY D;  5HUR A;  4DF7 A;  2OXP A;  3GV3 A;  4C3H B;  5FO9 B;  4G7H C;  5A2Q L;  4BBR B;  5EBD A;  3PIO 3;  1UUP A;  1S5E D;  2B2Y C;  2SNS A;  5CGK A;  4Z9C B;  2A6E D;  4BWG B;  3X3N A;  1Q8I A;  2EJM A;  3NP8 A;  5IGD A;  2LY7 A;  4IUV A;  1JWU D;  5ELD A;  1QCB D;  1JIC A;  1SYB A;  4FO2 A;  2MUY A;  2LMC B;  1TII D;  2D9U A;  1K8M A;  1CQF A;  1LTB D;  1SAP A;  1JOR A;  2F3W A;  3ERQ A;  1FNU A;  5T1G A;  3PUX A;  1LTT D;  3D8G A;  1DD2 A;  3S15 B;  1STA A;  1HA5 A;  4A3E B;  1IW7 D;  4RAU C;  4I7Z C;  2K7V A;  3NQI A;  5EGT A;  2L5T A;  4HR7 B;  1VMP A;  1J8I A;  4PMB A;  1EEF D;  3FRP B;  1SEB D;  2PQE A;  4PV1 C;  5EPK A;  2K01 A;  5C5M A;  2NYZ D;  3NWT A;  2HCI A;  1PRT F;  1AW7 A;  3I73 A;  5KYL A;  4KN4 C;  4V0B A;  3PO2 B;  1EYC A;  1UNS A;  3K59 A;  2H4O A;  3ERO A;  4CBV A;  1PTO B;  1TS5 A;  1H9K A;  2EE1 A;  5EBC A;  2F0N A;  3VA7 A;  1DXM A;  1Z47 A;  1OXV A;  3DEP A;  5BN4 A;  4X3U A;  1QNU A;  5EKI A;  4OO1 H;  3GD7 A;  3S2H B;  3HS0 C;  4FF1 A;  4B9X A;  4BS9 A;  5EPL A;  1KAB A;  1O7L A;  2XN9 C;  2IX1 A;  1PFN A;  4C56 C;  1QG7 A;  5CV8 A;  1FGB D;  4JBW A;  4NDX A;  1SE2 A;  4IUU A;  2MP1 A;  4DK1 A;  1B1Z A;  4UDU C;  1CT1 D;  1H9S B;  5CV4 A;  1F2L A;  3A7L A;  5IIF A;  3OWE B;  2Q8I B;  1CTM A;  3A54 A;  2EJG C;  5JPN C;  2DN8 A;  2IW3 A;  3T53 B;  1PZK D;  5JAV A;  2HQE A;  3C1F A;  1BF4 A;  2AQ1 B;  1G6Z A;  4KY5 A;  1V8Q A;  2V4D A;  5FO7 B;  2HDM A;  1LAB A;  1BXT A;  1QB5 D;  3PO3 B;  4ZK9 B;  5IGG A;  5ELF A;  2X6L A;  2EZV A;  2F0P A;  4R8N A;  3NE5 B;  2M9V A;  2K5W A;  1MSG A;  1OXT A;  2BA0 A;  2F0I A;  5JPM C;  2JP1 A;  1Y8P B;  4BBS B;  3U9S A;  1G29 1;  4ZAI A;  1A2U A;  4ODG A;  4RCN A;  3OIP A;  4A3F B;  2NB0 A;  2R3Z A;  4KKU A;  5CV9 A;  4KD4 A;  2NZ1 D;  3ZYY X;  2XSC A;  1STE A;  4B9W A;  2NTT A;  4DFA A;  4RGM A;  2IJ0 A;  3DUZ A;  5C0X H;  2PMZ B;  3K6O A;  3T16 A;  1OXS C;  3NUC A;  2IL8 A;  3QG1 A;  1TWH B;  4RWS C;  1S5D D;  1I4Q A;  2ZT9 C;  5ISR A;  5T1I A;  1HQR D;  1KTK A;  3G6J B;  4OO1 G;  1EWC A;  3I70 A;  5BN5 A;  4CJ0 B;  4LJZ C;  2Q8T A;  2XWJ B;  1L0X B;  2VB3 X;  5K5P A;  2WIN B;  5KGU A;  2B2T A;  3WOE A;  3A8K E;  4HSP A;  3EQL C;  4RHR A;  2K04 A;  2XNA C;  1IKL A;  4FF2 A;  2G9H D;  1DJR D;  2F3V A;  5EQ0 A;  4NW2 A;  1EWH A;  5HGT A;  3HOY B;  5C4X B;  3KBG A;  1QWY A;  2I46 A;  2C5C A;  3GTL B;  2YU9 B;  4HMI A;  5KND A;  4WFN 3;  2X6G A;  3L7Z C;  2PW5 A;  3R2T A;  1TS3 A;  4BA1 I;  3J81 L;  4HED A;  4RCO A;  3J7A V;  1SJE D;  3CU7 A;  1HRJ A;  4DGZ A;  1A3U A;  3VR3 A;  5M9O A;  3I91 A;  5I6Y A;  3ONA B;  1TKW B;  1DYQ A;  1V43 A;  1TWC B;  2NBF A;  2XWB B;  2XIW A;  1GOZ A;  3HOV B;  1JB3 A;  5C0X G;  4MHE A;  3VYS A;  4C2M B;  2EJF C;  4ZUJ A;  4CJ1 B;  3SK5 A;  3BYY B;  3M3Y B;  1ONL A;  3R8B A;  1IYV A;  2EVB A;  2EY6 A;  4BY1 B;  1F9P A;  1LAC A;  2F1M A;  2KCC A;  2JEA I;  1CA5 A;  2CW0 C;  3NBI A;  5E3F A;  1A3T A;  2F0O A;  2HUG A;  2JYO A;  5C6A A;  3VYU A;  3CQZ B;  4KHV A;  4K8J A;  2A5H A;  1S5C D;  1AEX A;  1E0B A;  4PQX A;  3QB3 A;  5ELC A;  1SE4 A;  4RGO S;  4QUF A;  3T4A C;  2I07 B;  3DWA A;  4IFD I;  1PFB A;  1I3Q B;  4H13 C;  2QKI C;  3KLS A;  2JE6 I;  3TME A;  3M7G A;  4XYQ A;  2F0Q A;  1F2Z A;  3K5M A;  3HP3 A;  3QOJ A;  4QIW B;  3Q24 A;  2A69 C;  1SNO A;  5KRU A;  1JOK A;  3Q6S A;  4IUQ A;  1QOH A;  3UI2 A;  5FLX E;  4DNT B;  1BCP D;  1TR5 A;  2O5J C;  4XQN A;  2FIN B;  3VR2 A;  3Q0A A;  3NTK A;  3MXN A;  1Y1V B;  1WTP A;  2MPM A;  2E2J B;  1I6V C;  3WOF A;  4A3G B;  5DNF A;  2N88 A;  3KUP A;  3MC0 B;  5CMD A;  2F0D A;  1HTP A;  4RA8 A;  1GUT A;  1GJX A;  1BCP C;  1Y69 U;  4H0L C;  4G7O C;  3S1R B;  2A6H D;  4RH6 A;  3DWQ A;  5K36 G;  1I4H A;  2D62 A;  1ZYR D;  1A3V A;  2IWH A;  4BA2 I;  1WD0 A;  4K5X A;  1NSN S;  5TSS A;  1MBY A;  3PUY A;  5M5Y B;  1TS2 A;  1PTO H;  5LHY 1;  3SK8 A;  1FD7 D;  1XXG A;  5D14 A;  3M4Y A;  3MTS A;  4K2K A;  2B2Y A;  1KDB A;  4XIG S;  1ESF A;  4A3K B;  3W2D A;  4FYD A;  1ML0 D;  2RA4 A;  2RSN A;  2PCF B;  2M2L A;  2Z8L A;  3I3C A;  1SFO B;  4IAL A;  1WCM B;  4KKS A;  4DNR B;  2DNE A;  2K28 A;  4HCS A;  3PUV A;  3P75 A;  4OGQ C;  3JAM L;  1PTO F;  4C3H G;  1EZ8 A;  1PRT D;  1CK1 A;  3E0J A;  1DM0 B;  1DOM A;  1MD2 D;  4F87 A;  1TT2 A;  1LTG D;  1SE3 A;  2EYP A;  1GXD C;  4E6I A;  1ENA A;  4CGY B;  1JOO A;  2R93 B;  2LFN A;  4J8Q A;  4NP5 A;  3OMC A;  1UAP A;  5I6W A;  1ET6 A;  4ZQ3 A;  2WKD A;  2VB2 X;  1ZKO A;  3A55 A;  4HAE A;  1Q1B A;  2F0V A;  2A68 D;  4K5W A;  3TP5 A;  3VR6 A;  4ZLT F;  5C3X A;  1C8C A;  2IX3 A;  3HKZ B;  1I4X A;  3LNN A;  2PZU A;  1KDC A;  2BE5 D;  4B08 A;  5LL6 X;  1ILP A;  1GHJ A;  3D4R A;  3K5N A;  4A93 B;  1SMY C;  1A2T A;  3BYT B;  4ME5 A;  4KJN A;  2B2V C;  3FPP A;  3NWS A;  1EU3 A;  5CR3 A;  4FVM A;  1SYG A;  1LTR D;  1TVX A;  1JWM D;  1HFG A;  1D2B A;  2A6E C;  4HTH A;  3AU7 A;  3I4N B;  1RCV D;  5C4H A;  1RF2 D;  2B2W C;  2ICE C;  3GTO B;  4ZKB B;  5JJZ A;  1SDF A;  1G8Z D;  1HUN A;  5EKL A;  1SXT A;  2DY7 A;  1ZXT A;  4FXK C;  2BE5 C;  1BCP B;  1OO9 B;  2X69 A;  2ICI A;  1IYU A;  2F4I A;  1SBB B;  1EY5 A;  4CKC A;  3H91 A;  1E2W A;  1B44 D;  4F88 A;  2RDF A;  4XQJ A;  1EFI D;  1IW7 C;  2BA1 A;  4XT3 B;  3C46 A;  3SHL A;  4NKL A;  4KK7 A;  2F0E A;  5C3E B;  2K05 A;  2EYJ A;  4R9W A;  2SOB A;  5KNC A;  1RKN A;  3KBX A;  4DN4 M;  5FLX L;  4IUR A;  2L0C A;  3KLR A;  3D3R A;  4DA2 A;  4HCE A;  4IUP A;  5M3M B;  3ND8 A;  1DZ1 A;  2B2U C;  5NUC A;  1WTR A;  3DXJ C;  2B63 B;  3RZO B;  3IFD A;  3BDL A;  1LTA D;  1DOL A;  2E76 C;  5JOB A;  4FF3 A;  3A8J E;  1BO0 A;  5IOC A;  4KY7 A;  1I50 B;  1LT4 D;  2F0S A;  3I72 A;  2ZXP A;  4TKO B;  2VUM B;  1V1P A;  1RTO A;  1EY0 A;  4ABN A;  1C4Q A;  3S1Q B;  1PZJ D;  3OSO A;  2L4N A;  5KEE A;  4O1N A;  1D5M C;  4EVO A;  2R6G A;  3GV6 A;  2EOT A;  4YIJ A;  3MXG A;  3ND9 A;  3TN2 A;  5EPJ A;  4K6D A;  3D4W A;  5G3L D;  1VF7 A;  5E4X A;  3J80 L;  1MI2 A;  1HFN A;  2VXW A;  4WRD A;  4BY7 B;  3NTI A;  1SYD A;  1I4P A;  3P1H A;  1MSH A;  1F9R A;  1STY A;  2L11 A;  1PRT B;  3HOW B;  3QJY A;  4HMJ A;  4K2L A;  1D5Z C;  2ID0 A;  3MXP A;  3D6C A;  5D3I B;  4C3I B;  3Q22 A;  1SNM A;  1U4R A;  1PLF A;  4ZKC B;  4M1U B;  3C3L A;  3N6R A;  4CJ2 C;  4QMG A;  2N55 A;  1X3Q A;  1IL8 A;  2F0U A;  5C4J B;  1EYD A;  4XXE A;  2NN6 I;  4WJW A;  1SJH D;  1CHP D;  1YNJ D;  2AWN A;  3NK9 A;  1STH A;  1GUW A;  4IUT A;  3GTK B;  4A3J B;  4IZ8 A;  4KMU C;  2JA5 B;  3S2D B;  4PNY A;  2OEO A;  4L6T B;  1GUN A;  2A74 C;  3P7J A;  4ULL A;  3M7N A;  5J39 A;  3OOC A;  1OXX K;  3BG3 A;  1D6E C;  2AQ3 B;  2WAQ B;  2IX0 A;  1VDZ A;  1JR0 D;  4KJO A;  3KK7 A;  1BUV T;  2K6A A;  5CV6 A;  2CHB D;  1NCV A;  2NUC A;  2J4X A;  1STN A;  4RGN A;  3MXU A;  3C2P A;  5KNB A;  4A3M B;  3FVQ A;  1GUO A;  3OPO A;  5C3W A;  1SYF A;  2EYL A;  2KED A;  4QB4 A;  4RHS A;  3IFT A;  5IGF A;  1BBX C;  4KY6 A;  5A2Q E;  5DM7 3;  4Q0F A;  2RDH A;  3H09 A;  5M5W B;  4G7Z C;  1EY6 A;  1Z7T A;  2DY8 A;  2LKV A;  2IT1 A;  5C4Z A;  1FYC A;  3R3O A;  2NVX B;  5BN3 A;  2F0G A;  3SK4 A;  2EYH A;  2K5Q A;  1Y1W B;  3L9A X;  1E2Z A;  3L3O C;  5K36 H;  3BS1 A;  1J9O A;  4WOR A;  2E2H B;  5J1Z A;  3TP8 A;  4ILW A;  3J7Y W;  1F9S A;  2PW7 A;  1NR2 A;  2G9D A;  2JA6 B;  4LK1 C;  4X3S A;  5IGB A;  4M8A A;  3FEW X;  1TY0 A;  1U4L A;  1DOK A;  4JK1 C;  2EY2 A;  3BZD B;  3AB9 A;  3EVQ A;  1Q12 A;  1Y8O B;  2DNC A;  4EGV A;  2BDN A;  1TWG B;  2FHT A;  4QUC A;  3PMF A;  4KHZ A;  5DAU A;  5COY A;  4EQP A;  1FR3 A;  1AN8 A;  1A15 A;  4J1M A;  1L0Y B;  1R4Q B;  1JWS D;  3A7A B;  2WKC A;  1QIL A;  1C48 A;  2SDF A;  1HQM C;  3R2I A;  2JXM B;  2Q8R E;  1KLU D;  1RTN A;  5JVH 3;  3S14 B;  5JVG 3;  2MJ8 A;  1B2T A;  4Y7N B;  3NPP A;  1B9M A;  1RHP A;  2HCC A;  4IFD J;  4A3D B;  1I6H B;  3OMG A;  1KAA A;  1AFP A;  1EY8 A;  3GP7 A;  2CQA A;  5F2D A;  2AWO A;  1H9S A;  1EL0 A;  2XVS A;  4QCL A;  2L12 A;  4RGT A;  4QF4 A;  2MHV A;  5I4D A;  4EQN A;  1RDP D;  2KOL A;  5D3D A;  1ENF A;  1ROD A;  4LAA A;  2HDL A;  1H9R A;  1LTI D;  3HOX B;  1HPC A;  2XRQ D;  1DON A;  2WAC A;  3PUW A;  3LWU A;  2EYF A;  1HTL D;  2KCN A;  2EY5 A;  4RKB A;  4HN7 A;  1ZEQ X;  2J7Z A;  3K5O A;  3RLF A;  1O78 A;  3IAY A;  1TWF B;  2NVQ B;  2EY1 A;  4X3K A;  3VR4 A;  2E2I B;  1JOQ A;  5JEA J;  1CM9 A;  1V1O A;  1STB A;  2L1B A;  2QCP X;  3T56 B;  2QF7 A;  2JEB I;  1HXY D;  4KTA A;  5CC4 A;  2A6H C;  3S17 B;  1FNW A;  4IFD G;  1AZP A;  2EXZ A;  3MFY A;  2K1B A;  3T51 B;  4GZY C;  1ZYR C;  1TQO A;  1BCP F;  3MZ5 A;  2B39 A;  3EFX D;  2B2V A;  1CI3 M;  3MHB A;  4RKL A;  1S5F D;  3VYR A;  1B3A A;  2QDB A;  4F7X A;  2AUK A;  3MVV A;  3OWF A;  2O5I C;  1HUM A;  3V05 A;  3SEB A;  1VCI A;  1EY9 A;  3K7A B;  4R8I A;  4FXG C;  2RVL A;  2FMC A;  1WD1 A;  1LT6 D;  1WVL A;  2Z4H A;  2K33 A;  3MFG A;  4K6L A;  4XYO A;  1Q1E A;  1CA6 A;  2KEE A;  3K0Y A;  2B2W A;  1TS4 A;  5FK9 C;  4ZYS A;  3LX0 A;  1IHZ A;  4C1N K;  1B50 A;  1NR4 A;  3QO2 A;  3IKJ A;  4U68 A;  2BOS A;  1QJO A;  4H7B A;  2RSO A;  1F9Q A;  1JC7 A;  1SNP A;  1WTW A;  3DHQ A;  3VA5 A;  4XQQ A;  1EZ6 A;  1PRT C;  1PYW D;  1WTV A;  4ZRZ A;  4PMW A;  3S1N B;  1PMR A;  2Y0S B;  5CBA E;  5JEA G;  4XTC S;  5E1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...