1RODA

Chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPASPIVKKIIEKMLNSDKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of a chimeric interleukin-8-melanoma-growth-stimulatory-activity protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
molecule keywords CHIMERIC PROTEIN OF INTERLEUKIN 8 AND HUMAN MELANOMA GROWTH
total genus 10
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rodA00
1IL8A 1KNEA 2NYZD 1WTOA 2DY8A 2CVRA 4XDXA 2H1EA 1PFMA 2K01A 2NZ1D 2VXWA 2KEEA 1U4RA 2K05A 1WTQA 2KVMA 2K28A 5DNFA 5T1IA 1G6ZA 1NR4A 4RAUC 1O80A 1BBXC 1RJTA 2B2TA 2JP1A 1U4MA 1SSOA 1U4LA 1ILQA 1J9OA 2MP1A 1DOLA 1EQTA 1JE4A 3G7LA 3I90A 4CJ1B 1VMCA 5E4XA 2K03A 2N55A 2Q8RE 5CMDA 4IUVA 2K1BA 2X6LA 3GV3A 2D9UA 4CJ2C 2B2YC 3P7JA 2L11A 5E4WC 2RA4A 4HCSA 1U4PA 2FHTA 1M8AA 1JICA 1MGSA 3Q6SA 1QE6A 1O7ZA 1PFNA 1BO0A 2EPBA 4ZK9B 1HA6A 1XYIA 4ZKCB 4LMQD 2EE1A 5EPKA 1ILPA 2FJ2A 4OIKA 2KEDA 2FFKB 4HAEA 3R93A 2M2LA 3HP3A 1B3AA 1F9SA 1G2SA 3D6WA 2MPMA 3IL8A 4HEDA 1QNKA 5D65A 1F9PA 1AZPA 4IUPA 2HDLA 5AFWA 1NAPA 1X3PA 5JJZA 3SVMA 4IURA 1C8CA 1NR2A 5EKIA 1HUMA 2L4NA 2HCIA 1ESRA 1DZ1A 2MGSA 5EQ0A 3I91A 4UAIA 3FDTA 1PLFA 4RA8A 2HDMA 3I3CA 4IUUA 4IUQA 1KNAA 4X3KA 2L1BA 1QG7A 1WTVA 1O7YA 1ZXTA 1AZQA 2NWGA 1CM9A 3DEPA 2B2TC 1B50A 4XT1B 2KOLA 2DY7A 1EOTA 1RTNA 2FINB 1EIGA 1BF4A 4XT3B 2X6GA 2BDNA 1IKMA 1HFNA 1HUNA 2B2VC 1ICWA 2FMMA 1MSGA 1Q3LA 1WTRA 1F9RA 4NW2A 1RHPA 2XIWA 3GV6A 5CORA 1AP0A 2B2UC 2IL8A 3LWEA 4ZKBB 1RODA 1HHVA 1WTPA 1HRJA 2MJ8A 1HFGA 1E0BA 5CBEE 1IKLA 1PFBA 4ZAIA 3TN2A 1B2TA 3H91A 1B4OA 1LV9A 2HUGA 1DOMA 2HCCA 2JYOA 2RSNA 1DONA 1WTXA 3TZDA 3UI2A 1EL0A 1RTOA 3DM1A 5EPJA 1WVLA 5COYA 1ML0D 5EPLA 1WD1A 1SAPA 1X3QA 2SDFA 4MHEA 3KBXA 3MWYW 2B2UA 3MTSA 4O42A 4R9WA 1WD0A 2X69A 1J8IA 4OIJA 2B2VA 2KECA 5D14A 4DN4M 1PDQA 3I8ZA 3N52A 4MN3A 2EOTA 5CBAE 1G2TA 2L12A 4U68A 3QO2A 1NCVA 1DOKA 4X3SA 2B2WC 3IFDA 2B2YA 3ONAB 1VMPA 1A15A 1X32A 3F2UA 1SDFA 2RSOA 3DEOA 2L9HA 4QUCA 1EIHA 4CJ0B 2R3ZA 1XX8A 4X3UA 4ZLTF 2KUMA 4HSVA 1S4ZA 4R8IA 3FPUB 1G91A 1CA5A 3KUPA 4QUFA 4IUTA 1MI2A 1GUWA 1B53A 1F2LA 2RVLA 1WTWA 5T1GA 1CA6A 2N88A 1BNZA 1F9QA 4RWSC 2K04A 2J7ZA 2B2WA 5EJWA 1MSHA 2Q8TA 4X3TA 1TVXA
chains in the Genus database with same CATH superfamily
2F0FA 1FVIA 3TZUA 3P20A 1B1ZA 5M3FG 3OW7A 3CCQA 4A3DG 1HTLD 2QA4A 1NR4A 5IGBA 2F0PA 4KKTA 3M7NA 5G3LF 3STBC 1U4MA 4R4CA 1LT5D 2VUMB 5J1ZA 3BJUA 2ZT9C 4PZ8A 2Q8RE 4IUVA 1EQRA 1RD9D 3I55A 1I94L 2B2YC 4DR4Q 2NN6H 4F7XA 1STGA 1HQMC 2FXQA 3NENA 4POGA 4C3HG 4DAPA 5EPKA 4YHHL 1HPCA 4DR2Q 1XMOQ 1JOOA 1GJXA 2EYFA 5DEHA 1Q82C 2WIIB 2JA6B 1KRSA 2OQKA 2F1MA 5I2YA 1EY9A 1SMYD 4G7OC 3SVMA 1DZ1A 1D5MC 1BR9A 1JB3A 1QWYA 3I4MB 5FLXc 1AZQA 2XRQD 2GVAA 4HIMA 3MXPA 3F8TA 4BY1B 1Q1EA 4IFDH 3HG9A 4IZ8A 5FLMG 2XTIA 5LL6X 1F2YA 4A3LG 1Y8OB 1Y1WH 5JJIA 4G7ZC 4C3HB 2P5ZX 3FVQA 1DCZA 2EJFC 3S1QB 4XIGS 4L6TB 1N34L 1Q8IA 5LL6S 2BH8A 2VQEQ 1DOMA 1HNWL 5GADC 3ZYYX 4DAVA 1VQGA 3UI2A 2B63H 1PYBA 1WD1A 4BXXG 4DV2L 2X69A 4LUOA 1P8LA 1J8IA 2F03A 4B08A 1EQQA 2F0LA 3MVVA 4AYBB 2E75C 4P72A 3KDFA 1TIID 4FO2A 3TMEA 1O7IA 4JI1L 1S4ZA 3BVMA 1NMFA 4LFAQ 4GOPC 5JPNC 1H95A 1ENCA 1B53A 1ZYRC 4QL5A 2UXBQ 2F0JA 2DGYA 4JW0A 1VQ8A 5E7NA 2Q2HA 3PO3B 1WJJA 1ZKOA 4B3ML 1CKNB 4X66Q 3JAML 3MZ5A 1QVCA 2K28A 5DNFA 2RHSB 4A3CH 4KHVA 3BS1A 4LF8Q 2AMCB 1LTSD 4CJ1B 1PHJA 5IT9L 1D8LA 1SNCA 3K5OA 3J7A5 1HQRD 2D9UA 1RIPA 2OF1A 3T1YL 4Q5VA 3H94A 4LJZC 1BBUA 1I5FA 4N8X1 1JICA 2K33A 1V43A 2E76C 2R93B 4JI4L 1ESFA 3NUCA 1EFID 2EY2A 3KF6B 3OMCA 3U58A 1FNUA 1QUQA 2G9HD 3TSSA 1B9MA 1XNRQ 1X3PA 3K7UC 4C3JH 4OO1I 4JOIC 1TS2A 5L37A 1I4RA 1P16A 1YHBA 3J80c 2JA8B 1E7ZA 2F0TA 1Y1WB 4K6LA 5ELCA 5FO7B 3J80E 1HFNA 3TRZA 1Y1VB 4LF9L 4PG3A 1R4PB 4OONA 1C4QA 3NPPA 4FF2A 3LWEA 2Z6BA 2UU9L 4A3EB 4ZAIA 1SNOA 3RR5A 5C0XH 2PMZB 2B63B 3GTOB 4K8IA 1EQVA 1EIFA 2ZM6L 2O5JC 1ML0D 4A3DH 2B3GA 4TKOB 4DR5L 1X3QA 3GTGB 4JG2A 4F88A 2EY6A 3STBD 2YU9H 3NXWA 4A3GH 1SE3A 4EQPA 4YY3L 4R4TA 5ELEA 4CKEA 2E5LL 4OO1H 3A8IE 2C9OA 1EWIA 3TQYA 3S1RB 4P74A 1SN8A 1EIYB 5JJLA 2NN6I 3KYHC 1B3QA 1PTOD 1VQBA 5FJ8H 1KQSA 1IBMQ 1Y8NB 4HMIA 1LTID 4XTCS 1PH1A 2I5MX 1N32Q 3PO3H 5CC4A 4CDEC 5KNCA 5JPMC 1WTOA 3W1BA 4LAAA 1XJVA 1TWFH 1WCMB 2VXWA 2WAQG 5C3EG 3I56A 4UY8C 1UEAB 1TXYA 1A2UA 2R61A 4CDFC 2NVXH 3VYSA 4C3IH 4WJWA 2B39A 5E4WC 1EYAA 4Z9CB 1M8AA 1HR0W 2NVTB 1PH5A 1U0LA 1DGSA 1PRTC 2PQEA 2EPBA 3C2PA 2G9DA 3D8GA 4YHHQ 4DV5Q 1VQ9A 1TS5A 1IYUA 1SYCA 1VF7A 1D6EC 3RN5A 4A3DB 2A6ED 3JAMc 3MXGA 1Z47A 3T51B 5I6YA 3U4ZA 1F2ZA 1K83H 3W3AA 4OEMB 4GN4B 2WB1E 4DPGA 4L63B 4K0KL 1L0WA 1QVGA 3OWEB 4IUQA 2ICIA 2KCMA 4YWLA 1CZGA 3S2HH 5M5XH 2PZUA 2E2HB 2Z4IA 4LWCA 4HJAA 1B50A 4HN7A 1LACA 2PQAA 3AEVA 1E3PA 3K7AH 2XWBB 4CGYB 4PV1C 4JI5Q 1EEFD 2D0PA 1XXGA 1Q3LA 4DNRB 1HZAA 2Q2IA 3T13A 1RHPA 1UAPA 1SNDA 2IL8A 1RODA 2L15A 3GTQH 4B9XA 3TN2A 3L7ZC 4MTNA 1B2TA 1TWAH 4DV4Q 2K5WA 2MO0A 4F8MA 1L0YB 1UWVA 3DM1A 3K80C 4Y52H 4A93H 4LNQA 3MTSA 1B7YB 1ET6A 4KK7A 5CV9A 2EOTA 3OSOA 4DR3Q 2GA4B 4X3SA 1R9TB 2N3SA 1L0XB 4DK3C 5K36G 1G8ZD 1X3GA 1XPOA 2PPBC 1EY0A 3MXUA 2JQOA 2O5IC 3J7AF 4DKAC 3PF5A 1NSNS 2LMCB 1VDZA 3TREA 4K0KQ 2SNMA 4MTKA 4KD4A 5FK9C 4A3GB 1TWCB 1EY6A 2JEAI 4C2MH 5C3XA 2IJ0A 3W5OA 2NYZD 5IYBH 2OEOA 1T5XD 4XQNA 1LUZA 1HNXL 2YTXA 4RAUC 1QCBD 2XWJB 3A5UA 4LF4L 1VQ4A 1VQCA 3HS0C 2KHSA 3KF6A 4MZ9A 1EU4A 3JAMi 4Y7NH 1JWSD 2EYJA 3NBHA 3TP6A 1PVOA 3CW2C 1IYJB 4DV0L 4EGVA 1CTMA 1V9PA 3P7JA 2JA6G 4C3HH 5EKLA 3D6CA 1AE3A 4KD3A 3Q6SA 3NSWA 2KCNA 1ILPA 2FJ2A 1Q7YC 4RGOS 4X66L 2A6HC 2B8FA 3EA6A 4AQYL 3K57A 4OL7A 3F2DA 5IGCA 1N33Q 2WFWA 2AHOB 3VYTA 1LTRD 1ZYRD 2JA7B 4G7HC 5EKIA 2UU9Q 1ESRA 4X65Q 1VQ7A 3U9OA 1PTOF 2NTTA 5FLMH 1KNAA 1QG7A 3QWNA 1UE5A 3C1FA 1BQQT 2B2TC 1EWHA 3OYYA 3HKZG 1HZCA 1TS3A 3M4OH 1BF4A 1MHWC 2PMZE 4I7AA 2A8VA 1JE5A 4FP5D 3GTQB 1E0BA 5IYCH 3OHXC 3BDCA 4PZ7A 1EWCA 1HXYD 2EZVA 2UUAQ 3H91A 1CKOA 1JOQA 3TZDA 1AN8A 1LT4D 3RD4A 4IPGA 1Y14B 2VQFL 5BR8Q 1ICFB 2ZTEA 4DR1Q 3PO2H 4OIJA 4MNOA 3SHLA 2KECA 4YY3Q 4HJ5A 4A3JH 3MEHA 2OCEA 3QO2A 1SE2A 5I9OA 1TWAB 4B3SQ 1H9JA 1K73C 2IT1A 2ZJRA 3A8JE 2L9HA 4C3IG 3GTMH 4A3BB 1FJGL 4XYOA 4DF7A 3OPOA 5M5YH 2E2IH 4BY7H 3C1EA 1S3OA 4O1NA 3NP8A 2N49A 3NWSA 1IL8A 2QW7A 1QJOA 3FMCA 4HR7B 4GNXA 1Z7TA 5T1IA 3CQZH 3BZDB 1AE2A 2K5NA 2JP1A 3KLWA 1YNXA 4RMFA 2ZJPA 4A3MH 1RF2D 3T53B 3VA7A 1FNWA 3QJYA 4C3IB 2UUAL 3O13A 4DV3L 3D4WA 2LY7A 2K1BA 3BZCA 3EIVA 1XNRL 1GUSA 1V1PA 5KIXA 4H02A 2FHTA 2IX1A 1W6JA 2WINB 3AQQA 2OXPA 1W2BA 4R1JA 3QB3A 2VB2X 3J80L 4QB4A 5IYDG 1PRTF 5KYIA 4HAEA 4GKKQ 2VB3X 4C3JG 2WAQB 3JC66 2K32A 5C3EB 1G291 5D65A 1F9PA 2JA8G 1STBA 3AB9A 3TS2A 2HCIA 4KKSA 3RZDH 2ZXPA 4JI0L 2UXCL 3D4DA 4FXGC 3CMEA 4HIOA 2VS1A 2J4XA 4FF3A 3A7AB 4LFAL 1HA5A 4HJ8A 2Q2UA 2KOLA 3S1RH 1YEZA 4HJ7A 5HGQA 2CH4A 2K14A 3BDOA 2KJXA 2ZTCA 1F77A 5C4HA 1JJ2A 3SK4A 1D5ZC 1AW7A 2BA1A 3HKSA 3FRPB 3ICEA 3S1NB 1AP0A 1I4HA 2MJ8A 4ME3A 1Q90A 1QILA 1PH8A 2RSNA 3I4OA 5EPLA 2A6HD 2IX0A 5GAHC 3L2PA 2E5LQ 3VA5A 1JC7A 4OO1G 3S14H 4A3JB 2YV5A 2E2JH 1G2TA 2K50A 4GLVB 4DV1L 1DOKA 3PGZA 1KC8C 3ONAB 1L1OB 2Z6KC 4TVAB 4QUCA 1Y1WG 4FXKC 5TSSA 1XX8A 4RHSA 1KAAA 3CCMA 3PO3G 2PW7A 4JI0Q 5CYUA 2N88A 1LABA 1N34Q 1E2WA 3S24A 4NKLA 5ELOA 1SJED 4L5SA 3RN2A 4EQ5A 4JK1C 3SEBA 4GKKL 5LMNL 4K5VA 2NZ1D 4KJOA 1C0AA 2K5DA 1G6ZA 4DR5Q 1VQPA 1E1OA 5JEAJ 2UXDQ 2KQ3A 2CQAA 1SSOA 4P2CB 1U4LA 1JE4A 1XWEA 3K5LA 1EFWA 3NBIA 2A69C 2DJFC 3HOUH 3T56B 3G71A 4DV0Q 2CKZB 4LW1A 2JA5H 1SBBB 1PFSA 2A68C 1K28A 4NDXA 4KKUA 1XTDA 1NE3A 2A19A 4DAMA 4DV6Q 3CC4A 4LF5Q 2LS01 1PZJD 1GVPA 5IYCG 1K0RA 2VQFQ 4DAYB 1X9NA 3I70A 5IP9H 3V05A 3PF4A 3R93A 3I4NG 3T1YQ 5C5LA 5IODA 1AZPA 4ALPA 4A3CG 1WI5A 2PO4A 3UDXA 3BU2A 1GUNA 2F0UA 5EQ0A 2I0QA 1OXVA 3GD7A 4NXMQ 3FDTA 2ASBA 2EXDA 4IUUA 2XVSA 4KY7A 1U5KA 4IPDA 1KL9A 4JV5Q 3GTJB 3CD6A 3NHHA 4G4KA 5KYLA 5LMUQ 1M1KC 2R7FA 4WORA 3LGJA 3V96A 2OWOA 2FMMA 1KAWA 1VQEA 4XYQA 3GV6A 1QUQB 5C4ZA 1TU2B 3EBEA 4YCVA 5E3FA 3SGIA 1HNZQ 1BKBA 2M9VA 3R8BA 1VQFA 2RF4A 1RTOA 1VS0A 5EPJA 4FF4A 4GLAC 2A6EC 1EY4A 3LNNA 2WKCA 1JCKB 3U9SA 1AEXA 3PUVA 3NQIA 2O2LD 3HOXB 1PRTD 2BCOA 2CH4W 1D2BA 2NZOA 3IRBA 3VDYA 3P75A 3AMUA 2PNHA 4A3KG 1UE6A 1HZ9A 3VYRA 1IBLL 1CA6A 3S9WA 2PNRC 4ZUIA 2A5HA 2J7ZA 2HHHQ 2Q8TA 1IZ6A 2UUCL 4OWXB 3UE0A 2I46A 2Z9HA 4OWTB 5AJ3Q 1IBML 4HTHA 3SK6A 1Z9FA 4R4OA 1KLGD 2AQ3B 1CQFA 3E5SA 5E4XA 1KTKA 1LT3D 5HY6A 1HNZL 1HZBA 1VQMA 3DWPA 1I4GA 2XN9C 3KJOA 1NJIC 4OWWB 3I73A 3AYHB 3PIP3 1D7QA 1T5EA 2DJGC 2F0QA 4IPCA 2GN5A 3PIPA 4JI2L 1E24A 2XRSD 5KEEA 1CSQA 4DXGA 1W6KA 4PMWA 4DV7Q 4ZKCB 2F3IA 3M85A 4NP5A 4O2DA 2FFKB 1E1TA 3E6ZX 5D3DA 4BWGB 2BE5C 2QCPX 5NUCA 4A3IG 1GD7A 4LF7Q 4K2KA 1N32L 1I6HB 1E2ZA 1BXTA 1K3RA 1NAPA 3S1QH 1C8CA 4BY1G 2ENBA 1J5EL 2E8GA 1Q12A 2AWOA 2EYHA 1QZHA 1K8OA 4RA8A 1PLFA 1PZKD 4A75A 2XNAC 3RMHA 2F0SA 4GZYC 2Z0SA 2EYPA 1LT6D 2L55A 1HR0L 4QF4A 4GKJL 1EOTA 1RL2A 1RTNA 5M3FB 5BN5A 3SE0A 1V1OA 1ICWA 2SNSA 4WFN3 2PW5A 5M9OA 2XIWA 2R92B 1NNXA 2ES2A 3CAMA 4FVMA 3MFGA 2JXMB 1VQAA 3TP5A 1ASYA 1Y69U 2EY5A 3TP7A 4AYBG 1HJPA 1UNSA 4IN3A 3H15A 1I4PA 4JI4Q 4LFBQ 2JN4A 2KHIA 4NXNQ 1SYBA 4DV6L 3S15H 3CF5A 4DR1L 5BR8L 3HOUG 3HKZB 3HOYH 3DEOA 4LUZA 4X3UA 5DM63 1ONLA 4IALA 2VZAA 3KUPA 4GNXC 1JORA 2K5VA 2Y0SB 1EUJA 3RUZA 4QQBX 1STAA 5M3MH 3DWAA 5FLXE 5LMNQ 4DR7Q 2DY8A 3MA2B 3GDEA 3L9AX 4H44C 5IOCA 3CC2A 3PUYA 3PIO3 1PH3A 3F1ZA 3TP8A 2JSOA 3NQTA 4A93G 4JC0A 5GAEC 3Q0AA 4DV7L 4PMBA 3OIQA 3A7LA 1EQTA 3G7LA 1N36L 1SR3A 2R93G 4QGUA 1J5EQ 1Z6HA 3E0EA 4NB3A 1JMCA 4EX5A 5CV8A 4HCSA 3BG3A 1W3SA 3RLOA 4DK0A 1SXTA 1UEBA 1VCIA 1GHJA 5M5XB 4ZK9B 4KJNA 5GAGC 2RHQB 2JA8H 2ZM6Q 4HIDA 4LFCL 4C1NK 3HOWG 5IYBG 5C4XB 4P71A 1VQOA 3HRZC 4J8QA 2ZJQA 2ZXRA 5JJZA 4RGNA 1SE8A 1XNQQ 3K0YA 5CGKA 2K5QA 1CKMA 5HGTA 1N33L 2L1BA 4P73A 1O7YA 4AQYQ 3Q8DA 1EZ6A 4XT1B 2VW9A 2CFMA 1HNXQ 3S17B 2FINB 3BYYB 2JA6H 3CC7A 2HD3A 3HOZG 1HUNA 4UPAA 2B2VC 5EBDA 4A3KH 1MSGA 5C5MA 4AYBE 4GLXA 1HHVA 3KJPA 4RCOA 2HUGA 3MAQA 2WB1G 1UE7A 1XTCD 4LF4Q 3J7ZC 2KA7A 1YHAA 1BDOA 3FKIG 3A54A 2JA9A 3VR3A 5C4XH 1M90C 3RNUA 3HKZE 4L5QA 2F0WA 5I4DA 1A2TA 2C35B 4DXFA 3AFPA 1VMPA 3HOZB 3NK9A 4LF6Q 2N78A 4R8IA 3FPUB 3D31A 5CV7A 4Y7NB 2F0VA 2RVLA 4JI8L 4ID6A 5ELNA 3A55A 5M5YB 3MFYA 2KBNA 4B3SL 2B2WA 3LX0A 3CP0A 1TVXA 4FDBA 1A6XA 1EYDA 4B3MQ 4X62L 4LF9Q 4A3IH 2WAQE 4JI5L 3FEWX 3G6EA 3TEHB 1YJ9A 1H9SB 3HOXG 3D4RA 3FP9A 3OTOL 1HR0Q 4FXDA 3SDZA 4LF5L 1RJTA 2F3WA 2AUKA 1WOCA 2A68D 4RH6A 4A3JG 1BCPB 2IWHA 3K5NA 1I3QH 4KMUC 1TWCH 4EQNA 1D1KA 3ULJA 3I4NB 4CJ2C 4R8NA 1BCPC 2R7ZG 4DK6C 4B3TL 4LF7L 1U4PA 2HQLA 4BBRH 3M4QA 4U673 1SEBD 3A56A 1ET9A 4BY7G 1DXMA 4H13C 4LMQD 3KOJA 5JEAG 2GVBA 2KEDA 1LTAD 3ULPA 2M2LA 1PRTB 2PI2E 1F9SA 2LFNA 4GNXB 1GHKA 4HJ9A 2L4NA 5D3IB 4A3MG 1Y8PB 1WTVA 1YVCA 1EZ8A 3AFQA 4JI7L 2EIFA 2E2DC 1WCMG 3S1MH 2IY5B 1ENFA 2LSSA 3HOYG 3GTLB 2BE5D 3BYTB 2BDNA 4YWKA 1F9RA 1PXUA 1CSPA 3MC0B 1X55A 4KHPQ 1SNPA 4A3IB 1JR0D 1VQJA 2QGQA 3ND8A 4H7BA 4KV6A 4QIWE 1FR3A 2DUDA 1J6QA 1HCZA 5EAYA 1VQLA 3U50C 2JYOA 1V8QA 3UDFA 3S16B 1CQVA 4GS3A 2EJGC 4POFA 4IFDI 5IE8A 2OT2A 4NPSA 5C44B 1WD0A 3H3VI 4X64Q 3EROA 3PO2B 4XQQA 3N52A 4DR7L 1VF5C 4DR6L 1X3FA 3CHBD 1GOZA 4A3GG 2CWAA 4ZYSA 1LO5D 4ZLTF 2F0MA 2OTLA 2AUJD 4JBMA 4UP8A 3HGBA 3CU7A 1VQ6A 3CPWA 4O0AA 5CV4A 4E6IA 1UE1A 3C3LA 2WKDA 3GO5A 3G4SA 3CPFA 2VY3A 2ZXOA 1JWUD 1X6OA 4IQZA 4XDXA 3WOEA 5I6WA 3DLLA 2NB0A 1PFMA 2KEEA 5DLQE 1WTQA 5C4JB 1T9HA 1STYA 3K0XA 4DAYA 2PZTA 3ND9A 2AQ2B 2I5HA 2LXKA 2JA7H 3GV3A 3M4PA 1VQHA 2RA4A 1K9MC 1X54A 1RDPD 4QCLA 1QE6A 1HA6A 5FO8B 4JYAL 3KF8B 4KY5A 2K4KA 2KHJA 1HH2P 2IX3A 4HEDA 4DV4L 1PH9A 1WYDA 4RGTA 3QG1A 1ENAA 5IGDA 2TSSA 4R4IA 3FKIH 1EU3A 2NVQB 2RDGA 5KNDA 4IFDG 5LHY1 1AH9A 2J0TD 1OXSC 4ZUJA 2NVXB 2UXDL 4CKBA 3GTJH 2EY1A 3H0GB 1EIGA 4OELB 5EKKA 5IGFA 2X6GA 3ULLA 5IGEA 1YNJD 1D5XC 2EQSA 2O4XA 2NBFA 1QOHA 1WTRA 1PH7A 4IUNA 1BCPF 4CDDC 5M3MB 5IP9G 3S16H 5GQOA 4TQUS 2XGTA 3OWFA 2OQ0A 4BXXH 3GTMB 1Q46A 4A3BH 4ILWA 1KD1C 1EL0A 3BZKA 4MHEA 2NVYB 3MWYW 1V1QA 1GO3E 3T16A 4C1NI 4JI2Q 1KDAA 5LMNW 4ZCKA 3QOJA 2R7DA 5BN3A 1IBKL 3CCLA 3L3OC 4X6AH 3BVZA 1A3TA 4GOPB 1B8AA 2R7ZH 3KK7A 5M3MG 4KI0A 2PYKA 5A2QL 2RQXA 4A93B 2VQEL 1G6PA 2PI2A 3G48A 4Q0FA 1WTWA 5T1GA 1DM0B 4RWSC 4WJ4A 2IW3A 1JJCB 1L1OC 2ALYB 2MFIA 2ID0A 3VR4A 2K05A 4IFDJ 5IT9c 4DV2Q 3CCUA 5IT9E 4JBWA 4HCEA 4PZ6A 2UUBL 3CMAA 4DU9A 2NVYH 2K03A 4PNYA 1E2VA 3WOFA 1OO9B 3R2IA 3HOWB 1STNA 4A76A 1V1PB 2F0KA 3OIPA 4DNTB 4C3JB 2V1CC 5HURA 4ZRZA 1SYFA 3AU7A 4XQJA 1PFNA 2B8GA 2DN8A 2K52A 1IW7C 2Y0SE 3K6OA 3URYA 5IGGA 1ZEQX 3K5MA 1TS4A 1I4XA 5E1FA 1JQYD 2KCCA 2EYMA 3D6WA 2MPMA 5GROA 2VUMH 1YHQA 3S2DH 3S14B 2HHHL 4DA2A 2F4VL 2HDLA 5AFWA 4IURA 1NTGA 4K8JA 4I65A 4ODGA 2D0OA 4IPHA 3CCEA 1CZWA 1PH4A 4V0BA 3HOZH 2AWNA 1YNJC 5ELDA 1QNUA 3B6YA 4BBSB 1DJRD 2PZWA 4OGQC 2JEBI 4XT3B 2F0IA 3PSIA 3NBHB 1YITA 1Q81C 3UE1A 3GP7A 4ZKBB 4DR4L 3WDNA 1PTOH 5C0XG 1WTPA 1SYDA 2QILA 3EN2A 1GUTA 3NE5B 4MIUA 1VQNA 1B4OA 2HQEA 1LV9A 4DFAA 2Z8LA 1KDCA 3I4MH 5C4XG 1DONA 4GOPA 1IXRA 1JB7A 2QEJC 2XSCA 4RHRA 3GTKB 2HT1A 3M4OB 1WVLA 2Z6KA 3HOUB 2CCZA 1IW7D 1KHIA 3RZOB 5CR3A 4M8AA 4DR3L 1KLUD 1MIUA 1II3A 3J7YW 2R92H 5CBAE 1L2FA 4JPBW 3NEMA 3Q23A 3A74A 4XXEA 1EY5A 2R3ZA 5FJ8G 4YIJA 1KDBA 2K75A 3H3VC 1FL0A 2DNCA 2UUBQ 1G91A 1CA5A 3W1GA 4QUFA 4LF6L 2QDBA 1FNVA 4H0LC 2F4VQ 4B3RQ 1Y1VH 1DYQA 4NMZA 4X3TA 4RCNA 1A8VA 3KLSA 3HOXH 4WRDA 2BA0A 4UP9A 2MNAA 1K83B 3L0OA 2F52A 1A0IA 2K01A 4X64L 2F0GA 2CW0C 2ZTDA 1BBXC 3SR1A 1JWMD 1XPUA 2H5XA 4DUZL 3GTOH 4BY7B 1NMGA 2E2HH 5C0XJ 4KN7C 3PCOB 4EVOA 3C46A 2HIVA 2D2CC 1LYLA 5J39A 1C48A 2CWPA 2L5TA 5JVG3 4J6HA 3D3RA 1STHA 5J22A 3A5ZB 5FO9B 5KGUA 3EVQA 4AIMA 5JEAH 2I07B 1ASZA 4K5XA 1S5ED 1MGSA 3N6RA 5IWAQ 2HIXA 5AJ3L 4DV5L 2MQHA 3T1HL 1VQDA 5C3WA 3G6JB 1U9RA 2MUYA 3I7FA 1PTOC 2UXCQ 3ITPA 3IFTA 4KHPL 3HOVH 1TWFB 4JI1Q 4IJHA 1F2MA 2F0EA 2R93H 1CM9A 1Q8KA 2DY7A 4EQOA 1I50H 4GN5A 1K8MA 5FKAC 4JI3L 2NTSA 4KN4C 1TWGB 3CKIB 3M3YB 1H9RA 2D62A 4B3TQ 3S15B 2B2UC 1C9OA 2DNEA 4DK1A 2WB1B 4HIKA 2RCFA 4L5TA 4YCWA 2QDLA 2EDGA 2BOSA 3NTKA 2HCCA 4RGMA 1WTXA 3GTKH 1K8GA 4ME5A 4L5RC 2F0NA 4A3EG 1GUGA 4RKLA 3RZOH 2YTYA 3KBXA 4O42A 2B2UA 4R9WA 1SRUA 4OX9L 2N8NA 1PYWD 1SNQA 1EY7A 1PTOB 5D14A 3I8ZA 2FMCA 4K14A 2AKWB 2L12A 3IAYA 1NCVA 4HSPA 1LM0A 3V2TA 4I7ZC 2OTJA 1TKWB 4JI7Q 2RSOA 2LKVA 4J1MA 1FJGQ 1LTTD 3Q24A 3F2CA 4IUTA 5IIFA 2V4DA 5ISRA 1BNZA 3S1NH 3R3OA 1PYSB 3E3XA 1O7LA 5F2DA 2EVBA 3OOCA 1IHZA 2CVRA 3KLSX 2A74C 2QKIC 1K8AC 3LWUA 5H1SE 1U4RA 4OX9Q 3ER0A 3H6MA 5A2QE 3K59A 2B2TA 1J9OA 4KLKA 3GTPB 3I90A 1LTLA 4KTAA 4HMJA 5CMDA 1YZ6A 2A69D 3QIAA 5JOBA 1JT8A 4BS9A 3VR2A 1SNMA 1SMXA 4L8JA 3X3NA 1R9TH 1SROA 1MJEA 2JA5G 2BDOA 1BO0A 1WTHA 3OTOQ 3RLFA 2ATWA 1TY2A 4OIKA 4IOCA 2BH2A 4X62Q 3NTIA 4IO9A 3F2BA 4DGZA 1NY4A 1G2SA 1YI2A 1HNWQ 4IUPA 1FGUA 2F0OA 4JVZA 2TMPA 3I4NH 3T4AC 3X3MA 1HUMA 1RKNA 3TBIB 1X56A 1KRTA 4UAIA 2HDMA 4X3KA 5CV5A 1CT1D 1DD2A 1IYVA 2R92G 3DEPA 1RCVD 3CRLC 4JI6Q 1BVSA 3GTPH 4DV1Q 4BBRG 1XMQQ 1PA6A 2JA5B 3DWQA 1EY8A 1KABA 1LTBD 2YU9B 1EYCA 3FHWA 2JJQA 5C0XI 2Q8IB 1JJGA 1Q1BA 1IKLA 2NVTH 2EXZA 1D1IA 2MHVA 2RCNA 3CCVA 1XPRA 3D0FA 1OTCA 1CKNA 3S2HB 1QZGA 1SLJA 3PO2G 3MEFA 4LFCQ 3UDIA 3RLNA 4J15A 1CHQD 4P75A 3VYUA 2Z4HA 1X65A 3OW2A 5C44H 4A3FG 2RDFA 5G3LD 3SXHA 3CCSA 3CCJA 4BBSG 4N9PA 1CUKA 3IFDA 1FGBD 3K58A 4B3RL 1WCMH 5KRUA 1EIHA 2PCFB 1C7YA 4CJ0B 3ERSX 3KDFB 1MKHA 4FF1A 4B9WA 3M4YA 4OXPA 5JAVA 5M5WH 5EGTA 2CW0D 3PUWA 3A0JA 1KNEA 1FYCA 2SEBD 3A8KE 1XMQL 2H1EA 4IOAA 3P1HA 1NBWA 1Q86C 4YCUA 4A3FB 1O80A 1TY0A 5IP7H 4TSSA 3E9IA 5M3FH 1ILQA 2MP1A 1GKHA 1CFMA 3E0JA 1YJWA 2I5LX 1M4VA 4WJ3M 4DV3Q 4A4IA 2PQAB 3J7AV 1H9MA 1A63A 2R6GA 4DR2L 3CRKC 3KBGA 1XMOL 3QOLA 3OMGA 2B29A 1N8RC 2VUMG 2NN6G 4KY6A 3CCRA 3S17H 1QB5D 3HP3A 1B3AA 5M5WB 1I3QB 1PV4A 3I4LA 4ZQ3A 4NXML 1WFQA 4JBJA 3W2DA 4G57A 4A3EH 1UUPA 3H0GG 1OXUA 4C56C 1R4QB 5JJKA 1VQIA 2F0DA 3HEJA 1MD2D 1ZXTA 3BVGA 4RKBA 2JA7G 4GKJQ 1OXTA 3K7AB 1GXDC 5CV6A 1A3VA 3GTLH 1IKMA 1K0SA 1SYEA 4UDUC 3JAME 3I4MG 3KF8A 4JI8Q 2K6AA 4TRDA 3VR5A 5IY0A 1SYGA 3KLRA 2IHFA 1TQOA 2SOBA 3ZJYC 1PMRA 1B44D 3IKJA 3U4VA 2SDFA 1SE4A 5C3EH 2AQ1B 1H9KA 5DM73 2B63G 1I6VC 4S3SA 3TDQA 4DN4M 3J81j 1BUVT 2EYLA 4JI3Q 2B2WC 2VL6A 2B2YA 4APVA 2VNUD 1A15A 1X32A 3F2UA 3M9BA 4OHJA 4QY7A 3QR8A 2L0CA 1GUWA 4X65L 2A73B 3EJIA 1L1OA 1EOVA 5EJWA 2E74C 1SJHD 2WP8J 4K2LA 3DUZA 4A3BG 5C6AA 5EBCA 4DUYQ 1GM5A 3EFXD 2C5CA 4N8FA 1GUOA 3HOVB 4GN3B 5C4JH 3PQIA 1IBLQ 2K5HA 4CDCC 3UDGA 1B70B 1VMCA 2QF7A 4JOIA 2F3VA 3VR6A 4PQXA 2D5DA 2F0HA 2X6LA 1TWGH 3M3YH 1MBYA 2L11A 2KENA 3FKIB 1SFOB 2H4OA 1CK1A 3NTHA 1PH2A 4DUZQ 3T1HQ 1S40A 1O7ZA 3I72A 4AH6A 3ERQA 1BCPD 2EE1A 3CQZB 3J81L 2ICEC 4RG1A 3HZXA 5IWAL 4RFBA 2MO1A 3R2TA 3DHQA 1BOSA 3HOVG 2F4IA 3DM3A 1QNKA 1TR5A 3IL8A 4KHZA 1AFPA 3HOWH 1NR2A 1VQ5A 5FOBB 4FYDA 2MGSA 5KNBA 5J3BA 1YNND 3I3CA 1STEA 1TWHH 4YWMA 3PV0A 4JYAQ 3J81i 1A3UA 3K8AA 1S5BD 2IHEA 3NWTA 3K81C 1HFGA 1SFOH 3TS0A 5CBEE 1N9WA 2G5DA 3PUZA 4PMCA 4N9TA 2R7ZB 3M7GA 5JVH3 4FNFA 4IJLA 4QIWB 2Q2TA 3HFZB 3H3VH 4C2MB 1EYGA 1YJNA 1O78A 1EEID 5IP7G 3KFUA 4MN3A 3I2ZA 1TT2A 4CKCA 4BBRB 1FD7D 1S5DD 4LFBL 3RZDB 1JOKA 5LMUL 1A62A 1CI3M 4UP7A 5BN4A 1PH6A 4A3LH 2Z1CA 1X3EA 1H9SA 1YNNC 2KUMA 4ABNA 4A3MB 1MI2A 4F87A 4A3KB 1F2LA 1NUCA 2RDHA 1MJCA 4R4QA 3NELA 1MSHA 4DUYL 1I6HH 2UUCQ 2A1AA 4LK1C 5I2XA 2LXJA 1YIJA 3DMUA 4V190 2KVMA 2M00A 1BBWA 2NUCA 2UXBL 1YBYA 3MHBA 3S1MB 3H0GH 4M1UB 1DOLA 3MXNB 2N55A 5ELFA 1XNQL 4QJFA 3J81E 5K5PA 4BA2I 2NVQH 1IL2A 5DAUA 2WV6D 1B9NA 4LF8L 1XYIA 2QEXA 1Y1VG 1LLRD 3EQLC 3MXNA 4BY1H 2YYZA 3SK5A 1OXXK 5FLXL 4UHVA 1S5FD 2JE6I 2NZHA 2K7VA 1KIXA 1I4QA 1S5CD 1N36Q 1G51A 3I91A 1QVFA 4ULLA 1CHPD 3Q22A 2NWGA 1LTGD 3HOYB 4K6DA 4CHTB 1IBKQ 2RBMA 1KXLA 4DR6Q 1K3BC 1S72A 2KCTA 1PZID 2EJMA 4NW2A 5CORA 4JCVE 5A35A 3E9HA 1I94Q 1HRJA 4QMGA 2RKSA 1PFBA 1TWHB 1VQKA 3H09A 3PIOA 4LUVA 2JK8A 1E22A 2WACA 3DXJC 3FPPA 3WWVA 2IPKD 5C44G 4CBVA 4A3FH 5ELBA 5I9PA 5COYA 4BBSH 1I50B 1SAPA 2CHBD 1HTPA 2B2VA 4BA1I 3GTGH 3GQBA 1PDQA 2E2JB 3PUXA 4U68A 4NXNL 3BDLA 2CQOA 3PMFA 4JI6L 2EYOA 1SDFA 3SK8A 3CXCA 4JV5L 4HSVA 2YTVA 3J81c 5K36H 2E2IB 3J80i 1SMYC 1F9QA 4DNIA 2K04A 4JBKA 3S2DB 4K5WA 2Y0SG 5IYDH
chains in the Genus database with same CATH topology
2F0FA 3TZUA 3P20A 1B1ZA 3OW7A 1HTLD 1NR4A 5IGBA 2F0PA 4KKTA 3M7NA 5G3LF 1U4MA 1LT5D 2VUMB 5J1ZA 2ZT9C 2Q8RE 4IUVA 1RD9D 2B2YC 2NN6H 4F7XA 1STGA 1HQMC 4C3HG 4DAPA 5EPKA 1HPCA 1JOOA 1GJXA 2EYFA 5DEHA 2WIIB 2JA6B 5I2YA 2F1MA 1EY9A 1SMYD 4G7OC 3SVMA 1DZ1A 1D5MC 1BR9A 1JB3A 1QWYA 3I4MB 1AZQA 2XRQD 3MXPA 4BY1B 1Q1EA 4IFDH 3HG9A 4IZ8A 5LL6X 1F2YA 1Y8OB 4G7ZC 4C3HB 3FVQA 1DCZA 2EJFC 3S1QB 4XIGS 4L6TB 1Q8IA 5LL6S 1DOMA 3ZYYX 4DAVA 3UI2A 1WD1A 2X69A 1J8IA 2F03A 4B08A 2F0LA 3MVVA 4AYBB 2E75C 1TIID 4FO2A 3TMEA 1S4ZA 3BVMA 5JPNC 1ENCA 1B53A 1ZYRC 2F0JA 3PO3B 1ZKOA 3JAML 3MZ5A 5DNFA 2K28A 4KHVA 3BS1A 1LTSD 4CJ1B 5IT9L 1SNCA 3K5OA 1HQRD 2D9UA 2OF1A 4Q5VA 3H94A 4LJZC 1JICA 2K33A 1V43A 2E76C 2R93B 1ESFA 3NUCA 1EFID 2EY2A 3OMCA 1FNUA 2G9HD 3TSSA 1B9MA 1X3PA 4OO1I 1TS2A 1I4RA 2JA8B 2F0TA 1Y1WB 4K6LA 5ELCA 5FO7B 3J80E 1HFNA 1Y1VB 1R4PB 1C4QA 3NPPA 4FF2A 3LWEA 4A3EB 4ZAIA 1SNOA 5C0XH 2PMZB 2B63B 3GTOB 4K8IA 1EQVA 2O5JC 1ML0D 4TKOB 1X3QA 3GTGB 4F88A 2EY6A 3NXWA 1SE3A 4EQPA 5ELEA 4CKEA 4OO1H 3A8IE 2C9OA 3S1RB 2NN6I 1PTOD 1Y8NB 4HMIA 1LTID 4XTCS 5CC4A 5KNCA 5JPMC 1WTOA 4LAAA 1WCMB 2VXWA 1UEAB 1A2UA 2R61A 3VYSA 4WJWA 2B39A 5E4WC 1EYAA 4Z9CB 1M8AA 2NVTB 1PRTC 2PQEA 2EPBA 3C2PA 2G9DA 3D8GA 1TS5A 1IYUA 1SYCA 1VF7A 1D6EC 4A3DB 2A6ED 3MXGA 1Z47A 3T51B 5I6YA 1F2ZA 3W3AA 4L63B 3OWEB 4IUQA 2ICIA 1CZGA 2PZUA 2E2HB 2Z4IA 1B50A 4HN7A 1LACA 4CGYB 2XWBB 4PV1C 1EEFD 1XXGA 1Q3LA 4DNRB 3T13A 1RHPA 1UAPA 1SNDA 2IL8A 1RODA 4B9XA 3TN2A 3L7ZC 1B2TA 2K5WA 4F8MA 1L0YB 3DM1A 3MTSA 1ET6A 4KK7A 5CV9A 2EOTA 3OSOA 2GA4B 4X3SA 1R9TB 1L0XB 5K36G 1G8ZD 2PPBC 1EY0A 3MXUA 2O5IC 3J7AF 1NSNS 2LMCB 1VDZA 2SNMA 4KD4A 5FK9C 4A3GB 1TWCB 1EY6A 2JEAI 5C3XA 2IJ0A 2NYZD 2OEOA 1T5XD 4XQNA 4RAUC 1QCBD 2XWJB 3HS0C 2KHSA 1EU4A 1JWSD 2EYJA 3NBHA 3TP6A 4EGVA 1CTMA 3P7JA 5EKLA 3D6CA 4KD3A 3Q6SA 3NSWA 2KCNA 1ILPA 2FJ2A 4RGOS 2A6HC 2B8FA 3EA6A 3K57A 4OL7A 5IGCA 3VYTA 1LTRD 1ZYRD 2JA7B 4G7HC 5EKIA 1ESRA 3U9OA 1PTOF 2NTTA 1KNAA 1QG7A 3QWNA 3C1FA 1BQQT 2B2TC 1EWHA 1TS3A 1BF4A 4FP5D 3GTQB 1E0BA 3OHXC 3BDCA 1EWCA 1HXYD 2EZVA 3H91A 1JOQA 3TZDA 1AN8A 1LT4D 3RD4A 4OIJA 3SHLA 2KECA 3MEHA 3QO2A 1SE2A 5I9OA 1TWAB 1H9JA 2IT1A 3A8JE 2L9HA 4C3IG 4A3BB 4XYOA 4DF7A 3OPOA 3C1EA 4O1NA 3NP8A 3NWSA 1IL8A 1QJOA 3FMCA 4HR7B 1Z7TA 5T1IA 3BZDB 2JP1A 1RF2D 3T53B 3VA7A 1FNWA 3QJYA 4C3IB 3O13A 3D4WA 2LY7A 2K1BA 1GUSA 1V1PA 5KIXA 2FHTA 2IX1A 1W6JA 2WINB 2OXPA 3QB3A 2VB2X 3J80L 4QB4A 1PRTF 5KYIA 4HAEA 2VB3X 4C3JG 2WAQB 5C3EB 2K32A 1G291 5D65A 1F9PA 1STBA 3AB9A 2HCIA 4KKSA 2ZXPA 3D4DA 4FXGC 2J4XA 4FF3A 3A7AB 1HA5A 2KOLA 3BDOA 2KJXA 1F77A 5C4HA 3SK4A 1D5ZC 1AW7A 2BA1A 3S1NB 3FRPB 1AP0A 1I4HA 2MJ8A 1Q90A 1QILA 2RSNA 5EPLA 2A6HD 2IX0A 3VA5A 1JC7A 4OO1G 4A3JB 1G2TA 1DOKA 3ONAB 4QUCA 4FXKC 5TSSA 1XX8A 4RHSA 1KAAA 2PW7A 5CYUA 2N88A 1LABA 1E2WA 4NKLA 1SJED 4JK1C 3SEBA 4K5VA 2NZ1D 4KJOA 2K5DA 1G6ZA 5JEAJ 2KQ3A 2CQAA 1SSOA 4P2CB 1U4LA 1JE4A 1XWEA 3K5LA 3NBIA 2A69C 3T56B 1SBBB 2A68C 4NDXA 4KKUA 2LS01 1PZJD 3I70A 3V05A 3R93A 5C5LA 5IODA 1AZPA 2PO4A 1GUNA 2F0UA 5EQ0A 1OXVA 3GD7A 3FDTA 4IUUA 2XVSA 4KY7A 3GTJB 3NHHA 4G4KA 5KYLA 4WORA 3V96A 2FMMA 4XYQA 3GV6A 5C4ZA 1TU2B 5E3FA 2M9VA 3R8BA 1RTOA 5EPJA 4FF4A 2A6EC 1EY4A 3LNNA 2WKCA 1JCKB 3U9SA 1AEXA 3PUVA 3NQIA 2O2LD 3HOXB 1PRTD 2BCOA 1D2BA 3P75A 3AMUA 3VYRA 1CA6A 3S9WA 2PNRC 4ZUIA 2A5HA 2J7ZA 2Q8TA 2I46A 4HTHA 3SK6A 1KLGD 2AQ3B 1CQFA 3E5SA 5E4XA 1KTKA 1LT3D 3DWPA 1I4GA 2XN9C 3I73A 3PIP3 1T5EA 2F0QA 2XRSD 5KEEA 4DXGA 1W6KA 4PMWA 4ZKCB 3M85A 4NP5A 2FFKB 3E6ZX 5D3DA 4BWGB 2BE5C 2QCPX 5NUCA 4K2KA 1I6HB 1E2ZA 1BXTA 1NAPA 1C8CA 2ENBA 1Q12A 2AWOA 2EYHA 1K8OA 4RA8A 1PLFA 1PZKD 2XNAC 3RMHA 2F0SA 4GZYC 2EYPA 1LT6D 2L55A 4QF4A 1EOTA 5M3FB 1RTNA 5BN5A 3SE0A 1V1OA 1ICWA 2SNSA 4WFN3 2PW5A 5M9OA 2XIWA 2R92B 4FVMA 3MFGA 2JXMB 3TP5A 1Y69U 2EY5A 3TP7A 1UNSA 4IN3A 1I4PA 1SYBA 3HKZB 3DEOA 4X3UA 5DM63 1ONLA 4IALA 3KUPA 1JORA 2Y0SB 3RUZA 1STAA 3DWAA 5FLXE 2DY8A 3MA2B 4H44C 3L9AX 5IOCA 3PUYA 3PIO3 3TP8A 2JSOA 3NQTA 3Q0AA 4PMBA 3OIQA 3A7LA 1EQTA 3G7LA 1Z6HA 5CV8A 4HCSA 3BG3A 4DK0A 1SXTA 1VCIA 1GHJA 5M5XB 4ZK9B 4KJNA 4C1NK 5C4XB 3HRZC 4J8QA 2ZXRA 5JJZA 4RGNA 3K0YA 5CGKA 2K5QA 5HGTA 2L1BA 1O7YA 1EZ6A 4XT1B 3S17B 2FINB 3BYYB 1HUNA 2B2VC 5EBDA 1MSGA 5C5MA 1HHVA 4RCOA 2HUGA 3MAQA 1XTCD 2KA7A 1BDOA 3A54A 3VR3A 2F0WA 5I4DA 1A2TA 4DXFA 1VMPA 3HOZB 3NK9A 4R8IA 3FPUB 3D31A 5CV7A 4Y7NB 2F0VA 2RVLA 4ID6A 3A55A 5M5YB 3MFYA 2B2WA 3LX0A 1TVXA 1A6XA 1EYDA 3FEWX 1H9SB 3D4RA 4FXDA 3SDZA 1RJTA 2F3WA 2AUKA 2A68D 4RH6A 1BCPB 2IWHA 3K5NA 4KMUC 4EQNA 1D1KA 3I4NB 4CJ2C 4R8NA 1BCPC 1U4PA 4U673 1SEBD 3A56A 1ET9A 1DXMA 4H13C 4LMQD 5JEAG 2KEDA 1LTAD 2M2LA 1PRTB 1F9SA 2LFNA 1GHKA 2L4NA 5D3IB 1Y8PB 1WTVA 1EZ8A 2E2DC 1ENFA 3GTLB 2BE5D 3BYTB 2BDNA 1F9RA 1PXUA 3MC0B 1SNPA 4A3IB 1JR0D 3ND8A 4H7BA 4KV6A 1FR3A 1HCZA 2JYOA 1V8QA 3S16B 1CQVA 2EJGC 4IFDI 2OT2A 1WD0A 5C44B 3EROA 3PO2B 4XQQA 3N52A 1VF5C 3CHBD 1GOZA 4ZYSA 1LO5D 4ZLTF 2F0MA 2AUJD 3HGBA 3CU7A 5CV4A 4E6IA 3C3LA 2WKDA 3GO5A 2ZXOA 1JWUD 5I6WA 4IQZA 4XDXA 3WOEA 2NB0A 1PFMA 2KEEA 1WTQA 5C4JB 1STYA 4DAYA 2PZTA 3ND9A 2AQ2B 3GV3A 2RA4A 1RDPD 4QCLA 1QE6A 1HA6A 5FO8B 4KY5A 2IX3A 4HEDA 4RGTA 3QG1A 1ENAA 5IGDA 2TSSA 1EU3A 2NVQB 2RDGA 5KNDA 4IFDG 5LHY1 2J0TD 1OXSC 4ZUJA 2NVXB 4CKBA 2EY1A 3H0GB 1EIGA 5EKKA 5IGFA 2X6GA 5IGEA 1YNJD 1D5XC 1WTRA 2O4XA 2NBFA 1QOHA 4IUNA 1BCPF 5M3MB 4TQUS 3OWFA 3GTMB 4ILWA 1EL0A 4MHEA 2NVYB 3MWYW 3T16A 4C1NI 1KDAA 3QOJA 5BN3A 3L3OC 3BVZA 1A3TA 3KK7A 4A93B 4KI0A 2PYKA 5A2QL 2RQXA 4Q0FA 1WTWA 5T1GA 1DM0B 4RWSC 2IW3A 2ID0A 3VR4A 2K05A 4IFDJ 5IT9E 4JBWA 4HCEA 4DU9A 2K03A 3WOFA 4PNYA 1E2VA 1OO9B 3R2IA 3HOWB 1STNA 1V1PB 2F0KA 3OIPA 4DNTB 4C3JB 5HURA 4ZRZA 1SYFA 3AU7A 4XQJA 1PFNA 2B8GA 2DN8A 1IW7C 3URYA 5IGGA 3K6OA 1ZEQX 3K5MA 1TS4A 1I4XA 5E1FA 1JQYD 2KCCA 2EYMA 3D6WA 2MPMA 3S14B 4DA2A 2HDLA 5AFWA 4IURA 4K8JA 4I65A 4ODGA 1CZWA 4V0BA 2AWNA 1YNJC 5ELDA 1QNUA 4BBSB 1DJRD 2PZWA 4OGQC 2JEBI 4XT3B 2F0IA 3GP7A 4ZKBB 3WDNA 1PTOH 5C0XG 1WTPA 1SYDA 2QILA 1GUTA 3NE5B 4MIUA 1B4OA 2HQEA 1LV9A 4DFAA 2Z8LA 1KDCA 1DONA 2QEJC 2XSCA 4RHRA 3GTKB 3M4OB 1WVLA 3HOUB 1IW7D 3RZOB 5CR3A 4M8AA 1KLUD 1II3A 3J7YW 5CBAE 3Q23A 4XXEA 1EY5A 2R3ZA 4YIJA 1KDBA 3H3VC 2DNCA 1G91A 1CA5A 4QUFA 2QDBA 1FNVA 4H0LC 1DYQA 4NMZA 4X3TA 4RCNA 3KLSA 4WRDA 2BA0A 1K83B 2K01A 2F0GA 2CW0C 1BBXC 3SR1A 1JWMD 4BY7B 5C0XJ 4KN7C 4EVOA 3C46A 2D2CC 5J39A 1C48A 2L5TA 5JVG3 4J6HA 3D3RA 1STHA 5J22A 5FO9B 5KGUA 3EVQA 5JEAH 2I07B 4K5XA 1S5ED 1MGSA 3N6RA 5C3WA 3G6JB 1U9RA 2MUYA 1PTOC 3ITPA 3IFTA 1TWFB 1F2MA 2F0EA 1CM9A 2DY7A 4EQOA 1K8MA 5FKAC 2NTSA 4KN4C 1TWGB 3CKIB 3M3YB 1H9RA 2D62A 3S15B 2B2UC 2DNEA 4DK1A 2WB1B 2EDGA 2BOSA 3NTKA 2HCCA 4RGMA 1WTXA 4ME5A 2F0NA 1GUGA 4RKLA 4R9WA 3KBXA 4O42A 2B2UA 1PYWD 1SNQA 1EY7A 1PTOB 5D14A 3I8ZA 2FMCA 4K14A 3IAYA 2L12A 1NCVA 4HSPA 3V2TA 4I7ZC 1TKWB 2RSOA 2LKVA 4J1MA 1LTTD 3Q24A 4IUTA 5IIFA 2V4DA 5ISRA 1BNZA 3R3OA 1O7LA 5F2DA 2EVBA 3OOCA 1IHZA 2CVRA 3KLSX 2A74C 2QKIC 3LWUA 1U4RA 3H6MA 5A2QE 3K59A 2B2TA 1J9OA 3GTPB 3I90A 4KTAA 4HMJA 5CMDA 3QIAA 2A69D 5JOBA 4BS9A 3VR2A 1SNMA 4L8JA 3X3NA 2BDOA 1BO0A 3RLFA 1TY2A 4OIKA 3NTIA 4DGZA 1G2SA 4IUPA 2F0OA 2TMPA 3T4AC 3X3MA 1HUMA 1RKNA 3TBIB 4UAIA 2HDMA 4X3KA 5CV5A 1CT1D 1DD2A 1IYVA 3DEPA 1RCVD 3CRLC 2JA5B 3DWQA 1EY8A 1KABA 1LTBD 2YU9B 1EYCA 5C0XI 2Q8IB 1Q1BA 1IKLA 2EXZA 1D1IA 2MHVA 3S2HB 1CHQD 3VYUA 2Z4HA 2RDFA 5G3LD 3SXHA 4N9PA 3IFDA 1FGBD 3K58A 5KRUA 1EIHA 2PCFB 4CJ0B 4FF1A 4B9WA 3M4YA 5JAVA 5EGTA 2CW0D 3PUWA 1KNEA 1FYCA 2SEBD 3A8KE 2H1EA 3P1HA 4A3FB 1O80A 1TY0A 4TSSA 1ILQA 2MP1A 1CFMA 3E0JA 1M4VA 3J7AV 1H9MA 2R6GA 3CRKC 3KBGA 3QOLA 3OMGA 2NN6G 4KY6A 1QB5D 3HP3A 1B3AA 5M5WB 1I3QB 3I4LA 4ZQ3A 3W2DA 4G57A 1UUPA 4C56C 1OXUA 1R4QB 2F0DA 3HEJA 1MD2D 1ZXTA 3BVGA 4RKBA 1OXTA 3K7AB 1GXDC 5CV6A 1A3VA 1IKMA 1SYEA 4UDUC 3JAME 3KF8A 2K6AA 4TRDA 3VR5A 1SYGA 3KLRA 1TQOA 2SOBA 1PMRA 1B44D 3IKJA 2SDFA 1SE4A 2AQ1B 1H9KA 5DM73 1I6VC 4S3SA 3TDQA 4DN4M 1BUVT 2EYLA 2B2WC 2B2YA 2VNUD 1A15A 1X32A 3F2UA 4OHJA 2L0CA 1GUWA 2A73B 3EJIA 5EJWA 2E74C 1SJHD 2WP8J 4K2LA 3DUZA 5C6AA 5EBCA 3EFXD 2C5CA 1GUOA 3HOVB 1VMCA 2QF7A 2F3VA 3VR6A 4PQXA 2D5DA 2F0HA 2X6LA 1MBYA 2L11A 3FKIB 1SFOB 2H4OA 1CK1A 3NTHA 1O7ZA 3I72A 3ERQA 1BCPD 2EE1A 3CQZB 3J81L 2ICEC 3HZXA 4RFBA 3R2TA 3DHQA 1BOSA 2F4IA 3IL8A 1QNKA 1TR5A 4KHZA 1AFPA 1NR2A 5FOBB 4FYDA 2MGSA 5KNBA 1YNND 3I3CA 1STEA 3PV0A 1A3UA 1S5BD 3NWTA 1HFGA 5CBEE 3PUZA 4PMCA 4N9TA 2R7ZB 3M7GA 5JVH3 4FNFA 4QIWB 4C2MB 1O78A 1EEID 4MN3A 1TT2A 4CKCA 4BBRB 1FD7D 1S5DD 3RZDB 1JOKA 1CI3M 5BN4A 2Z1CA 1H9SA 1YNNC 2KUMA 4ABNA 4A3MB 1MI2A 4F87A 4A3KB 1F2LA 1NUCA 2RDHA 1MSHA 4LK1C 5I2XA 3DMUA 4V190 2KVMA 2M00A 2NUCA 3S1MB 3MHBA 4M1UB 1DOLA 2N55A 5ELFA 3J81E 5K5PA 4BA2I 5DAUA 2WV6D 1B9NA 1XYIA 1LLRD 3EQLC 3MXNA 2YYZA 3SK5A 1OXXK 5FLXL 1S5FD 2JE6I 2K7VA 1I4QA 1S5CD 3I91A 4ULLA 1CHPD 3Q22A 2NWGA 1LTGD 3HOYB 4K6DA 4CHTB 2RBMA 1PZID 2EJMA 4NW2A 5CORA 5A35A 1HRJA 4QMGA 2RKSA 1PFBA 1TWHB 3H09A 2WACA 3DXJC 3FPPA 2IPKD 4CBVA 5ELBA 5I9PA 5COYA 1I50B 1SAPA 2CHBD 1HTPA 2B2VA 4BA1I 3GQBA 1PDQA 2E2JB 3PUXA 4U68A 3BDLA 3PMFA 2EYOA 1SDFA 3SK8A 4HSVA 5K36H 2E2IB 1SMYC 1F9QA 2K04A 3S2DB 4K5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL8 A;  1KNE A;  2NYZ D;  1WTO A;  2DY8 A;  2CVR A;  4XDX A;  2H1E A;  1PFM A;  2K01 A;  2NZ1 D;  2VXW A;  2KEE A;  1U4R A;  2K05 A;  1WTQ A;  2KVM A;  2K28 A;  5DNF A;  5T1I A;  1G6Z A;  1NR4 A;  4RAU C;  1O80 A;  1BBX C;  1RJT A;  2B2T A;  2JP1 A;  1U4M A;  1SSO A;  1U4L A;  1ILQ A;  1J9O A;  2MP1 A;  1DOL A;  1EQT A;  1JE4 A;  3G7L A;  3I90 A;  4CJ1 B;  1VMC A;  5E4X A;  2K03 A;  2N55 A;  2Q8R E;  5CMD A;  4IUV A;  2K1B A;  2X6L A;  3GV3 A;  2D9U A;  4CJ2 C;  2B2Y C;  3P7J A;  2L11 A;  5E4W C;  2RA4 A;  4HCS A;  1U4P A;  2FHT A;  1M8A A;  1JIC A;  1MGS A;  3Q6S A;  1QE6 A;  1O7Z A;  1PFN A;  1BO0 A;  2EPB A;  4ZK9 B;  1HA6 A;  1XYI A;  4ZKC B;  4LMQ D;  2EE1 A;  5EPK A;  1ILP A;  2FJ2 A;  4OIK A;  2KED A;  2FFK B;  4HAE A;  3R93 A;  2M2L A;  3HP3 A;  1B3A A;  1F9S A;  1G2S A;  3D6W A;  2MPM A;  3IL8 A;  4HED A;  1QNK A;  5D65 A;  1F9P A;  1AZP A;  4IUP A;  2HDL A;  5AFW A;  1NAP A;  1X3P A;  5JJZ A;  3SVM A;  4IUR A;  1C8C A;  1NR2 A;  5EKI A;  1HUM A;  2L4N A;  2HCI A;  1ESR A;  1DZ1 A;  2MGS A;  5EQ0 A;  3I91 A;  4UAI A;  3FDT A;  1PLF A;  4RA8 A;  2HDM A;  3I3C A;  4IUU A;  4IUQ A;  1KNA A;  4X3K A;  2L1B A;  1QG7 A;  1WTV A;  1O7Y A;  1ZXT A;  1AZQ A;  2NWG A;  1CM9 A;  3DEP A;  2B2T C;  1B50 A;  4XT1 B;  2KOL A;  2DY7 A;  1EOT A;  1RTN A;  2FIN B;  1EIG A;  1BF4 A;  4XT3 B;  2X6G A;  2BDN A;  1IKM A;  1HFN A;  1HUN A;  2B2V C;  1ICW A;  2FMM A;  1MSG A;  1Q3L A;  1WTR A;  1F9R A;  4NW2 A;  1RHP A;  2XIW A;  3GV6 A;  5COR A;  1AP0 A;  2B2U C;  2IL8 A;  3LWE A;  4ZKB B;  1ROD A;  1HHV A;  1WTP A;  1HRJ A;  2MJ8 A;  1HFG A;  1E0B A;  5CBE E;  1IKL A;  1PFB A;  4ZAI A;  3TN2 A;  1B2T A;  3H91 A;  1B4O A;  1LV9 A;  2HUG A;  1DOM A;  2HCC A;  2JYO A;  2RSN A;  1DON A;  1WTX A;  3TZD A;  3UI2 A;  1EL0 A;  1RTO A;  3DM1 A;  5EPJ A;  1WVL A;  5COY A;  1ML0 D;  5EPL A;  1WD1 A;  1SAP A;  1X3Q A;  2SDF A;  4MHE A;  3KBX A;  3MWY W;  2B2U A;  3MTS A;  4O42 A;  4R9W A;  1WD0 A;  2X69 A;  1J8I A;  4OIJ A;  2B2V A;  2KEC A;  5D14 A;  4DN4 M;  1PDQ A;  3I8Z A;  3N52 A;  4MN3 A;  2EOT A;  5CBA E;  1G2T A;  2L12 A;  4U68 A;  3QO2 A;  1NCV A;  1DOK A;  4X3S A;  2B2W C;  3IFD A;  2B2Y A;  3ONA B;  1VMP A;  1A15 A;  1X32 A;  3F2U A;  1SDF A;  2RSO A;  3DEO A;  2L9H A;  4QUC A;  1EIH A;  4CJ0 B;  2R3Z A;  1XX8 A;  4X3U A;  4ZLT F;  2KUM A;  4HSV A;  1S4Z A;  4R8I A;  3FPU B;  1G91 A;  1CA5 A;  3KUP A;  4QUF A;  4IUT A;  1MI2 A;  1GUW A;  1B53 A;  1F2L A;  2RVL A;  1WTW A;  5T1G A;  1CA6 A;  2N88 A;  1BNZ A;  1F9Q A;  4RWS C;  2K04 A;  2J7Z A;  2B2W A;  5EJW A;  1MSH A;  2Q8T A;  4X3T A;  1TVX A; 
#chains in the Genus database with same CATH topology
 2F0F A;  1FVI A;  3TZU A;  3P20 A;  1B1Z A;  5M3F G;  3OW7 A;  3CCQ A;  4A3D G;  1HTL D;  2QA4 A;  1NR4 A;  5IGB A;  2F0P A;  4KKT A;  3M7N A;  5G3L F;  3STB C;  1U4M A;  4R4C A;  1LT5 D;  2VUM B;  5J1Z A;  3BJU A;  2ZT9 C;  4PZ8 A;  2Q8R E;  4IUV A;  1EQR A;  1RD9 D;  3I55 A;  1I94 L;  2B2Y C;  4DR4 Q;  2NN6 H;  4F7X A;  1STG A;  1HQM C;  2FXQ A;  3NEN A;  4POG A;  4C3H G;  4DAP A;  5EPK A;  4YHH L;  1HPC A;  4DR2 Q;  1XMO Q;  1JOO A;  1GJX A;  2EYF A;  5DEH A;  1Q82 C;  2WII B;  2JA6 B;  1KRS A;  2OQK A;  2F1M A;  5I2Y A;  1EY9 A;  1SMY D;  4G7O C;  3SVM A;  1DZ1 A;  1D5M C;  1BR9 A;  1JB3 A;  1QWY A;  3I4M B;  5FLX c;  1AZQ A;  2XRQ D;  2GVA A;  4HIM A;  3MXP A;  3F8T A;  4BY1 B;  1Q1E A;  4IFD H;  3HG9 A;  4IZ8 A;  5FLM G;  2XTI A;  5LL6 X;  1F2Y A;  4A3L G;  1Y8O B;  1Y1W H;  5JJI A;  4G7Z C;  4C3H B;  2P5Z X;  3FVQ A;  1DCZ A;  2EJF C;  3S1Q B;  4XIG S;  4L6T B;  1N34 L;  1Q8I A;  5LL6 S;  2BH8 A;  2VQE Q;  1DOM A;  1HNW L;  5GAD C;  3ZYY X;  4DAV A;  1VQG A;  3UI2 A;  2B63 H;  1PYB A;  1WD1 A;  4BXX G;  4DV2 L;  2X69 A;  4LUO A;  1P8L A;  1J8I A;  2F03 A;  4B08 A;  1EQQ A;  2F0L A;  3MVV A;  4AYB B;  2E75 C;  4P72 A;  3KDF A;  1TII D;  4FO2 A;  3TME A;  1O7I A;  4JI1 L;  1S4Z A;  3BVM A;  1NMF A;  4LFA Q;  4GOP C;  5JPN C;  1H95 A;  1ENC A;  1B53 A;  1ZYR C;  4QL5 A;  2UXB Q;  2F0J A;  2DGY A;  4JW0 A;  1VQ8 A;  5E7N A;  2Q2H A;  3PO3 B;  1WJJ A;  1ZKO A;  4B3M L;  1CKN B;  4X66 Q;  3JAM L;  3MZ5 A;  1QVC A;  2K28 A;  5DNF A;  2RHS B;  4A3C H;  4KHV A;  3BS1 A;  4LF8 Q;  2AMC B;  1LTS D;  4CJ1 B;  1PHJ A;  5IT9 L;  1D8L A;  1SNC A;  3K5O A;  3J7A 5;  1HQR D;  2D9U A;  1RIP A;  2OF1 A;  3T1Y L;  4Q5V A;  3H94 A;  4LJZ C;  1BBU A;  1I5F A;  4N8X 1;  1JIC A;  2K33 A;  1V43 A;  2E76 C;  2R93 B;  4JI4 L;  1ESF A;  3NUC A;  1EFI D;  2EY2 A;  3KF6 B;  3OMC A;  3U58 A;  1FNU A;  1QUQ A;  2G9H D;  3TSS A;  1B9M A;  1XNR Q;  1X3P A;  3K7U C;  4C3J H;  4OO1 I;  4JOI C;  1TS2 A;  5L37 A;  1I4R A;  1P16 A;  1YHB A;  3J80 c;  2JA8 B;  1E7Z A;  2F0T A;  1Y1W B;  4K6L A;  5ELC A;  5FO7 B;  3J80 E;  1HFN A;  3TRZ A;  1Y1V B;  4LF9 L;  4PG3 A;  1R4P B;  4OON A;  1C4Q A;  3NPP A;  4FF2 A;  3LWE A;  2Z6B A;  2UU9 L;  4A3E B;  4ZAI A;  1SNO A;  3RR5 A;  5C0X H;  2PMZ B;  2B63 B;  3GTO B;  4K8I A;  1EQV A;  1EIF A;  2ZM6 L;  2O5J C;  1ML0 D;  4A3D H;  2B3G A;  4TKO B;  4DR5 L;  1X3Q A;  3GTG B;  4JG2 A;  4F88 A;  2EY6 A;  3STB D;  2YU9 H;  3NXW A;  4A3G H;  1SE3 A;  4EQP A;  4YY3 L;  4R4T A;  5ELE A;  4CKE A;  2E5L L;  4OO1 H;  3A8I E;  2C9O A;  1EWI A;  3TQY A;  3S1R B;  4P74 A;  1SN8 A;  1EIY B;  5JJL A;  2NN6 I;  3KYH C;  1B3Q A;  1PTO D;  1VQB A;  5FJ8 H;  1KQS A;  1IBM Q;  1Y8N B;  4HMI A;  1LTI D;  4XTC S;  1PH1 A;  2I5M X;  1N32 Q;  3PO3 H;  5CC4 A;  4CDE C;  5KNC A;  5JPM C;  1WTO A;  3W1B A;  4LAA A;  1XJV A;  1TWF H;  1WCM B;  2VXW A;  2WAQ G;  5C3E G;  3I56 A;  4UY8 C;  1UEA B;  1TXY A;  1A2U A;  2R61 A;  4CDF C;  2NVX H;  3VYS A;  4C3I H;  4WJW A;  2B39 A;  5E4W C;  1EYA A;  4Z9C B;  1M8A A;  1HR0 W;  2NVT B;  1PH5 A;  1U0L A;  1DGS A;  1PRT C;  2PQE A;  2EPB A;  3C2P A;  2G9D A;  3D8G A;  4YHH Q;  4DV5 Q;  1VQ9 A;  1TS5 A;  1IYU A;  1SYC A;  1VF7 A;  1D6E C;  3RN5 A;  4A3D B;  2A6E D;  3JAM c;  3MXG A;  1Z47 A;  3T51 B;  5I6Y A;  3U4Z A;  1F2Z A;  1K83 H;  3W3A A;  4OEM B;  4GN4 B;  2WB1 E;  4DPG A;  4L63 B;  4K0K L;  1L0W A;  1QVG A;  3OWE B;  4IUQ A;  2ICI A;  2KCM A;  4YWL A;  1CZG A;  3S2H H;  5M5X H;  2PZU A;  2E2H B;  2Z4I A;  4LWC A;  4HJA A;  1B50 A;  4HN7 A;  1LAC A;  2PQA A;  3AEV A;  1E3P A;  3K7A H;  2XWB B;  4CGY B;  4PV1 C;  4JI5 Q;  1EEF D;  2D0P A;  1XXG A;  1Q3L A;  4DNR B;  1HZA A;  2Q2I A;  3T13 A;  1RHP A;  1UAP A;  1SND A;  2IL8 A;  1ROD A;  2L15 A;  3GTQ H;  4B9X A;  3TN2 A;  3L7Z C;  4MTN A;  1B2T A;  1TWA H;  4DV4 Q;  2K5W A;  2MO0 A;  4F8M A;  1L0Y B;  1UWV A;  3DM1 A;  3K80 C;  4Y52 H;  4A93 H;  4LNQ A;  3MTS A;  1B7Y B;  1ET6 A;  4KK7 A;  5CV9 A;  2EOT A;  3OSO A;  4DR3 Q;  2GA4 B;  4X3S A;  1R9T B;  2N3S A;  1L0X B;  4DK3 C;  5K36 G;  1G8Z D;  1X3G A;  1XPO A;  2PPB C;  1EY0 A;  3MXU A;  2JQO A;  2O5I C;  3J7A F;  4DKA C;  3PF5 A;  1NSN S;  2LMC B;  1VDZ A;  3TRE A;  4K0K Q;  2SNM A;  4MTK A;  4KD4 A;  5FK9 C;  4A3G B;  1TWC B;  1EY6 A;  2JEA I;  4C2M H;  5C3X A;  2IJ0 A;  3W5O A;  2NYZ D;  5IYB H;  2OEO A;  1T5X D;  4XQN A;  1LUZ A;  1HNX L;  2YTX A;  4RAU C;  1QCB D;  2XWJ B;  3A5U A;  4LF4 L;  1VQ4 A;  1VQC A;  3HS0 C;  2KHS A;  3KF6 A;  4MZ9 A;  1EU4 A;  3JAM i;  4Y7N H;  1JWS D;  2EYJ A;  3NBH A;  3TP6 A;  1PVO A;  3CW2 C;  1IYJ B;  4DV0 L;  4EGV A;  1CTM A;  1V9P A;  3P7J A;  2JA6 G;  4C3H H;  5EKL A;  3D6C A;  1AE3 A;  4KD3 A;  3Q6S A;  3NSW A;  2KCN A;  1ILP A;  2FJ2 A;  1Q7Y C;  4RGO S;  4X66 L;  2A6H C;  2B8F A;  3EA6 A;  4AQY L;  3K57 A;  4OL7 A;  3F2D A;  5IGC A;  1N33 Q;  2WFW A;  2AHO B;  3VYT A;  1LTR D;  1ZYR D;  2JA7 B;  4G7H C;  5EKI A;  2UU9 Q;  1ESR A;  4X65 Q;  1VQ7 A;  3U9O A;  1PTO F;  2NTT A;  5FLM H;  1KNA A;  1QG7 A;  3QWN A;  1UE5 A;  3C1F A;  1BQQ T;  2B2T C;  1EWH A;  3OYY A;  3HKZ G;  1HZC A;  1TS3 A;  3M4O H;  1BF4 A;  1MHW C;  2PMZ E;  4I7A A;  2A8V A;  1JE5 A;  4FP5 D;  3GTQ B;  1E0B A;  5IYC H;  3OHX C;  3BDC A;  4PZ7 A;  1EWC A;  1HXY D;  2EZV A;  2UUA Q;  3H91 A;  1CKO A;  1JOQ A;  3TZD A;  1AN8 A;  1LT4 D;  3RD4 A;  4IPG A;  1Y14 B;  2VQF L;  5BR8 Q;  1ICF B;  2ZTE A;  4DR1 Q;  3PO2 H;  4OIJ A;  4MNO A;  3SHL A;  2KEC A;  4YY3 Q;  4HJ5 A;  4A3J H;  3MEH A;  2OCE A;  3QO2 A;  1SE2 A;  5I9O A;  1TWA B;  4B3S Q;  1H9J A;  1K73 C;  2IT1 A;  2ZJR A;  3A8J E;  2L9H A;  4C3I G;  3GTM H;  4A3B B;  1FJG L;  4XYO A;  4DF7 A;  3OPO A;  5M5Y H;  2E2I H;  4BY7 H;  3C1E A;  1S3O A;  4O1N A;  3NP8 A;  2N49 A;  3NWS A;  1IL8 A;  2QW7 A;  1QJO A;  3FMC A;  4HR7 B;  4GNX A;  1Z7T A;  5T1I A;  3CQZ H;  3BZD B;  1AE2 A;  2K5N A;  2JP1 A;  3KLW A;  1YNX A;  4RMF A;  2ZJP A;  4A3M H;  1RF2 D;  3T53 B;  3VA7 A;  1FNW A;  3QJY A;  4C3I B;  2UUA L;  3O13 A;  4DV3 L;  3D4W A;  2LY7 A;  2K1B A;  3BZC A;  3EIV A;  1XNR L;  1GUS A;  1V1P A;  5KIX A;  4H02 A;  2FHT A;  2IX1 A;  1W6J A;  2WIN B;  3AQQ A;  2OXP A;  1W2B A;  4R1J A;  3QB3 A;  2VB2 X;  3J80 L;  4QB4 A;  5IYD G;  1PRT F;  5KYI A;  4HAE A;  4GKK Q;  2VB3 X;  4C3J G;  2WAQ B;  3JC6 6;  2K32 A;  5C3E B;  1G29 1;  5D65 A;  1F9P A;  2JA8 G;  1STB A;  3AB9 A;  3TS2 A;  2HCI A;  4KKS A;  3RZD H;  2ZXP A;  4JI0 L;  2UXC L;  3D4D A;  4FXG C;  3CME A;  4HIO A;  2VS1 A;  2J4X A;  4FF3 A;  3A7A B;  4LFA L;  1HA5 A;  4HJ8 A;  2Q2U A;  2KOL A;  3S1R H;  1YEZ A;  4HJ7 A;  5HGQ A;  2CH4 A;  2K14 A;  3BDO A;  2KJX A;  2ZTC A;  1F77 A;  5C4H A;  1JJ2 A;  3SK4 A;  1D5Z C;  1AW7 A;  2BA1 A;  3HKS A;  3FRP B;  3ICE A;  3S1N B;  1AP0 A;  1I4H A;  2MJ8 A;  4ME3 A;  1Q90 A;  1QIL A;  1PH8 A;  2RSN A;  3I4O A;  5EPL A;  2A6H D;  2IX0 A;  5GAH C;  3L2P A;  2E5L Q;  3VA5 A;  1JC7 A;  4OO1 G;  3S14 H;  4A3J B;  2YV5 A;  2E2J H;  1G2T A;  2K50 A;  4GLV B;  4DV1 L;  1DOK A;  3PGZ A;  1KC8 C;  3ONA B;  1L1O B;  2Z6K C;  4TVA B;  4QUC A;  1Y1W G;  4FXK C;  5TSS A;  1XX8 A;  4RHS A;  1KAA A;  3CCM A;  3PO3 G;  2PW7 A;  4JI0 Q;  5CYU A;  2N88 A;  1LAB A;  1N34 Q;  1E2W A;  3S24 A;  4NKL A;  5ELO A;  1SJE D;  4L5S A;  3RN2 A;  4EQ5 A;  4JK1 C;  3SEB A;  4GKK L;  5LMN L;  4K5V A;  2NZ1 D;  4KJO A;  1C0A A;  2K5D A;  1G6Z A;  4DR5 Q;  1VQP A;  1E1O A;  5JEA J;  2UXD Q;  2KQ3 A;  2CQA A;  1SSO A;  4P2C B;  1U4L A;  1JE4 A;  1XWE A;  3K5L A;  1EFW A;  3NBI A;  2A69 C;  2DJF C;  3HOU H;  3T56 B;  3G71 A;  4DV0 Q;  2CKZ B;  4LW1 A;  2JA5 H;  1SBB B;  1PFS A;  2A68 C;  1K28 A;  4NDX A;  4KKU A;  1XTD A;  1NE3 A;  2A19 A;  4DAM A;  4DV6 Q;  3CC4 A;  4LF5 Q;  2LS0 1;  1PZJ D;  1GVP A;  5IYC G;  1K0R A;  2VQF Q;  4DAY B;  1X9N A;  3I70 A;  5IP9 H;  3V05 A;  3PF4 A;  3R93 A;  3I4N G;  3T1Y Q;  5C5L A;  5IOD A;  1AZP A;  4ALP A;  4A3C G;  1WI5 A;  2PO4 A;  3UDX A;  3BU2 A;  1GUN A;  2F0U A;  5EQ0 A;  2I0Q A;  1OXV A;  3GD7 A;  4NXM Q;  3FDT A;  2ASB A;  2EXD A;  4IUU A;  2XVS A;  4KY7 A;  1U5K A;  4IPD A;  1KL9 A;  4JV5 Q;  3GTJ B;  3CD6 A;  3NHH A;  4G4K A;  5KYL A;  5LMU Q;  1M1K C;  2R7F A;  4WOR A;  3LGJ A;  3V96 A;  2OWO A;  2FMM A;  1KAW A;  1VQE A;  4XYQ A;  3GV6 A;  1QUQ B;  5C4Z A;  1TU2 B;  3EBE A;  4YCV A;  5E3F A;  3SGI A;  1HNZ Q;  1BKB A;  2M9V A;  3R8B A;  1VQF A;  2RF4 A;  1RTO A;  1VS0 A;  5EPJ A;  4FF4 A;  4GLA C;  2A6E C;  1EY4 A;  3LNN A;  2WKC A;  1JCK B;  3U9S A;  1AEX A;  3PUV A;  3NQI A;  2O2L D;  3HOX B;  1PRT D;  2BCO A;  2CH4 W;  1D2B A;  2NZO A;  3IRB A;  3VDY A;  3P75 A;  3AMU A;  2PNH A;  4A3K G;  1UE6 A;  1HZ9 A;  3VYR A;  1IBL L;  1CA6 A;  3S9W A;  2PNR C;  4ZUI A;  2A5H A;  2J7Z A;  2HHH Q;  2Q8T A;  1IZ6 A;  2UUC L;  4OWX B;  3UE0 A;  2I46 A;  2Z9H A;  4OWT B;  5AJ3 Q;  1IBM L;  4HTH A;  3SK6 A;  1Z9F A;  4R4O A;  1KLG D;  2AQ3 B;  1CQF A;  3E5S A;  5E4X A;  1KTK A;  1LT3 D;  5HY6 A;  1HNZ L;  1HZB A;  1VQM A;  3DWP A;  1I4G A;  2XN9 C;  3KJO A;  1NJI C;  4OWW B;  3I73 A;  3AYH B;  3PIP 3;  1D7Q A;  1T5E A;  2DJG C;  2F0Q A;  4IPC A;  2GN5 A;  3PIP A;  4JI2 L;  1E24 A;  2XRS D;  5KEE A;  1CSQ A;  4DXG A;  1W6K A;  4PMW A;  4DV7 Q;  4ZKC B;  2F3I A;  3M85 A;  4NP5 A;  4O2D A;  2FFK B;  1E1T A;  3E6Z X;  5D3D A;  4BWG B;  2BE5 C;  2QCP X;  5NUC A;  4A3I G;  1GD7 A;  4LF7 Q;  4K2K A;  1N32 L;  1I6H B;  1E2Z A;  1BXT A;  1K3R A;  1NAP A;  3S1Q H;  1C8C A;  4BY1 G;  2ENB A;  1J5E L;  2E8G A;  1Q12 A;  2AWO A;  2EYH A;  1QZH A;  1K8O A;  4RA8 A;  1PLF A;  1PZK D;  4A75 A;  2XNA C;  3RMH A;  2F0S A;  4GZY C;  2Z0S A;  2EYP A;  1LT6 D;  2L55 A;  1HR0 L;  4QF4 A;  4GKJ L;  1EOT A;  1RL2 A;  1RTN A;  5M3F B;  5BN5 A;  3SE0 A;  1V1O A;  1ICW A;  2SNS A;  4WFN 3;  2PW5 A;  5M9O A;  2XIW A;  2R92 B;  1NNX A;  2ES2 A;  3CAM A;  4FVM A;  3MFG A;  2JXM B;  1VQA A;  3TP5 A;  1ASY A;  1Y69 U;  2EY5 A;  3TP7 A;  4AYB G;  1HJP A;  1UNS A;  4IN3 A;  3H15 A;  1I4P A;  4JI4 Q;  4LFB Q;  2JN4 A;  2KHI A;  4NXN Q;  1SYB A;  4DV6 L;  3S15 H;  3CF5 A;  4DR1 L;  5BR8 L;  3HOU G;  3HKZ B;  3HOY H;  3DEO A;  4LUZ A;  4X3U A;  5DM6 3;  1ONL A;  4IAL A;  2VZA A;  3KUP A;  4GNX C;  1JOR A;  2K5V A;  2Y0S B;  1EUJ A;  3RUZ A;  4QQB X;  1STA A;  5M3M H;  3DWA A;  5FLX E;  5LMN Q;  4DR7 Q;  2DY8 A;  3MA2 B;  3GDE A;  3L9A X;  4H44 C;  5IOC A;  3CC2 A;  3PUY A;  3PIO 3;  1PH3 A;  3F1Z A;  3TP8 A;  2JSO A;  3NQT A;  4A93 G;  4JC0 A;  5GAE C;  3Q0A A;  4DV7 L;  4PMB A;  3OIQ A;  3A7L A;  1EQT A;  3G7L A;  1N36 L;  1SR3 A;  2R93 G;  4QGU A;  1J5E Q;  1Z6H A;  3E0E A;  4NB3 A;  1JMC A;  4EX5 A;  5CV8 A;  4HCS A;  3BG3 A;  1W3S A;  3RLO A;  4DK0 A;  1SXT A;  1UEB A;  1VCI A;  1GHJ A;  5M5X B;  4ZK9 B;  4KJN A;  5GAG C;  2RHQ B;  2JA8 H;  2ZM6 Q;  4HID A;  4LFC L;  4C1N K;  3HOW G;  5IYB G;  5C4X B;  4P71 A;  1VQO A;  3HRZ C;  4J8Q A;  2ZJQ A;  2ZXR A;  5JJZ A;  4RGN A;  1SE8 A;  1XNQ Q;  3K0Y A;  5CGK A;  2K5Q A;  1CKM A;  5HGT A;  1N33 L;  2L1B A;  4P73 A;  1O7Y A;  4AQY Q;  3Q8D A;  1EZ6 A;  4XT1 B;  2VW9 A;  2CFM A;  1HNX Q;  3S17 B;  2FIN B;  3BYY B;  2JA6 H;  3CC7 A;  2HD3 A;  3HOZ G;  1HUN A;  4UPA A;  2B2V C;  5EBD A;  4A3K H;  1MSG A;  5C5M A;  4AYB E;  4GLX A;  1HHV A;  3KJP A;  4RCO A;  2HUG A;  3MAQ A;  2WB1 G;  1UE7 A;  1XTC D;  4LF4 Q;  3J7Z C;  2KA7 A;  1YHA A;  1BDO A;  3FKI G;  3A54 A;  2JA9 A;  3VR3 A;  5C4X H;  1M90 C;  3RNU A;  3HKZ E;  4L5Q A;  2F0W A;  5I4D A;  1A2T A;  2C35 B;  4DXF A;  3AFP A;  1VMP A;  3HOZ B;  3NK9 A;  4LF6 Q;  2N78 A;  4R8I A;  3FPU B;  3D31 A;  5CV7 A;  4Y7N B;  2F0V A;  2RVL A;  4JI8 L;  4ID6 A;  5ELN A;  3A55 A;  5M5Y B;  3MFY A;  2KBN A;  4B3S L;  2B2W A;  3LX0 A;  3CP0 A;  1TVX A;  4FDB A;  1A6X A;  1EYD A;  4B3M Q;  4X62 L;  4LF9 Q;  4A3I H;  2WAQ E;  4JI5 L;  3FEW X;  3G6E A;  3TEH B;  1YJ9 A;  1H9S B;  3HOX G;  3D4R A;  3FP9 A;  3OTO L;  1HR0 Q;  4FXD A;  3SDZ A;  4LF5 L;  1RJT A;  2F3W A;  2AUK A;  1WOC A;  2A68 D;  4RH6 A;  4A3J G;  1BCP B;  2IWH A;  3K5N A;  1I3Q H;  4KMU C;  1TWC H;  4EQN A;  1D1K A;  3ULJ A;  3I4N B;  4CJ2 C;  4R8N A;  1BCP C;  2R7Z G;  4DK6 C;  4B3T L;  4LF7 L;  1U4P A;  2HQL A;  4BBR H;  3M4Q A;  4U67 3;  1SEB D;  3A56 A;  1ET9 A;  4BY7 G;  1DXM A;  4H13 C;  4LMQ D;  3KOJ A;  5JEA G;  2GVB A;  2KED A;  1LTA D;  3ULP A;  2M2L A;  1PRT B;  2PI2 E;  1F9S A;  2LFN A;  4GNX B;  1GHK A;  4HJ9 A;  2L4N A;  5D3I B;  4A3M G;  1Y8P B;  1WTV A;  1YVC A;  1EZ8 A;  3AFQ A;  4JI7 L;  2EIF A;  2E2D C;  1WCM G;  3S1M H;  2IY5 B;  1ENF A;  2LSS A;  3HOY G;  3GTL B;  2BE5 D;  3BYT B;  2BDN A;  4YWK A;  1F9R A;  1PXU A;  1CSP A;  3MC0 B;  1X55 A;  4KHP Q;  1SNP A;  4A3I B;  1JR0 D;  1VQJ A;  2QGQ A;  3ND8 A;  4H7B A;  4KV6 A;  4QIW E;  1FR3 A;  2DUD A;  1J6Q A;  1HCZ A;  5EAY A;  1VQL A;  3U50 C;  2JYO A;  1V8Q A;  3UDF A;  3S16 B;  1CQV A;  4GS3 A;  2EJG C;  4POF A;  4IFD I;  5IE8 A;  2OT2 A;  4NPS A;  5C44 B;  1WD0 A;  3H3V I;  4X64 Q;  3ERO A;  3PO2 B;  4XQQ A;  3N52 A;  4DR7 L;  1VF5 C;  4DR6 L;  1X3F A;  3CHB D;  1GOZ A;  4A3G G;  2CWA A;  4ZYS A;  1LO5 D;  4ZLT F;  2F0M A;  2OTL A;  2AUJ D;  4JBM A;  4UP8 A;  3HGB A;  3CU7 A;  1VQ6 A;  3CPW A;  4O0A A;  5CV4 A;  4E6I A;  1UE1 A;  3C3L A;  2WKD A;  3GO5 A;  3G4S A;  3CPF A;  2VY3 A;  2ZXO A;  1JWU D;  1X6O A;  4IQZ A;  4XDX A;  3WOE A;  5I6W A;  3DLL A;  2NB0 A;  1PFM A;  2KEE A;  5DLQ E;  1WTQ A;  5C4J B;  1T9H A;  1STY A;  3K0X A;  4DAY A;  2PZT A;  3ND9 A;  2AQ2 B;  2I5H A;  2LXK A;  2JA7 H;  3GV3 A;  3M4P A;  1VQH A;  2RA4 A;  1K9M C;  1X54 A;  1RDP D;  4QCL A;  1QE6 A;  1HA6 A;  5FO8 B;  4JYA L;  3KF8 B;  4KY5 A;  2K4K A;  2KHJ A;  1HH2 P;  2IX3 A;  4HED A;  4DV4 L;  1PH9 A;  1WYD A;  4RGT A;  3QG1 A;  1ENA A;  5IGD A;  2TSS A;  4R4I A;  3FKI H;  1EU3 A;  2NVQ B;  2RDG A;  5KND A;  4IFD G;  5LHY 1;  1AH9 A;  2J0T D;  1OXS C;  4ZUJ A;  2NVX B;  2UXD L;  4CKB A;  3GTJ H;  2EY1 A;  3H0G B;  1EIG A;  4OEL B;  5EKK A;  5IGF A;  2X6G A;  3ULL A;  5IGE A;  1YNJ D;  1D5X C;  2EQS A;  2O4X A;  2NBF A;  1QOH A;  1WTR A;  1PH7 A;  4IUN A;  1BCP F;  4CDD C;  5M3M B;  5IP9 G;  3S16 H;  5GQO A;  4TQU S;  2XGT A;  3OWF A;  2OQ0 A;  4BXX H;  3GTM B;  1Q46 A;  4A3B H;  4ILW A;  1KD1 C;  1EL0 A;  3BZK A;  4MHE A;  2NVY B;  3MWY W;  1V1Q A;  1GO3 E;  3T16 A;  4C1N I;  4JI2 Q;  1KDA A;  5LMN W;  4ZCK A;  3QOJ A;  2R7D A;  5BN3 A;  1IBK L;  3CCL A;  3L3O C;  4X6A H;  3BVZ A;  1A3T A;  4GOP B;  1B8A A;  2R7Z H;  3KK7 A;  5M3M G;  4KI0 A;  2PYK A;  5A2Q L;  2RQX A;  4A93 B;  2VQE L;  1G6P A;  2PI2 A;  3G48 A;  4Q0F A;  1WTW A;  5T1G A;  1DM0 B;  4RWS C;  4WJ4 A;  2IW3 A;  1JJC B;  1L1O C;  2ALY B;  2MFI A;  2ID0 A;  3VR4 A;  2K05 A;  4IFD J;  5IT9 c;  4DV2 Q;  3CCU A;  5IT9 E;  4JBW A;  4HCE A;  4PZ6 A;  2UUB L;  3CMA A;  4DU9 A;  2NVY H;  2K03 A;  4PNY A;  1E2V A;  3WOF A;  1OO9 B;  3R2I A;  3HOW B;  1STN A;  4A76 A;  1V1P B;  2F0K A;  3OIP A;  4DNT B;  4C3J B;  2V1C C;  5HUR A;  4ZRZ A;  1SYF A;  3AU7 A;  4XQJ A;  1PFN A;  2B8G A;  2DN8 A;  2K52 A;  1IW7 C;  2Y0S E;  3K6O A;  3URY A;  5IGG A;  1ZEQ X;  3K5M A;  1TS4 A;  1I4X A;  5E1F A;  1JQY D;  2KCC A;  2EYM A;  3D6W A;  2MPM A;  5GRO A;  2VUM H;  1YHQ A;  3S2D H;  3S14 B;  2HHH L;  4DA2 A;  2F4V L;  2HDL A;  5AFW A;  4IUR A;  1NTG A;  4K8J A;  4I65 A;  4ODG A;  2D0O A;  4IPH A;  3CCE A;  1CZW A;  1PH4 A;  4V0B A;  3HOZ H;  2AWN A;  1YNJ C;  5ELD A;  1QNU A;  3B6Y A;  4BBS B;  1DJR D;  2PZW A;  4OGQ C;  2JEB I;  4XT3 B;  2F0I A;  3PSI A;  3NBH B;  1YIT A;  1Q81 C;  3UE1 A;  3GP7 A;  4ZKB B;  4DR4 L;  3WDN A;  1PTO H;  5C0X G;  1WTP A;  1SYD A;  2QIL A;  3EN2 A;  1GUT A;  3NE5 B;  4MIU A;  1VQN A;  1B4O A;  2HQE A;  1LV9 A;  4DFA A;  2Z8L A;  1KDC A;  3I4M H;  5C4X G;  1DON A;  4GOP A;  1IXR A;  1JB7 A;  2QEJ C;  2XSC A;  4RHR A;  3GTK B;  2HT1 A;  3M4O B;  1WVL A;  2Z6K A;  3HOU B;  2CCZ A;  1IW7 D;  1KHI A;  3RZO B;  5CR3 A;  4M8A A;  4DR3 L;  1KLU D;  1MIU A;  1II3 A;  3J7Y W;  2R92 H;  5CBA E;  1L2F A;  4JPB W;  3NEM A;  3Q23 A;  3A74 A;  4XXE A;  1EY5 A;  2R3Z A;  5FJ8 G;  4YIJ A;  1KDB A;  2K75 A;  3H3V C;  1FL0 A;  2DNC A;  2UUB Q;  1G91 A;  1CA5 A;  3W1G A;  4QUF A;  4LF6 L;  2QDB A;  1FNV A;  4H0L C;  2F4V Q;  4B3R Q;  1Y1V H;  1DYQ A;  4NMZ A;  4X3T A;  4RCN A;  1A8V A;  3KLS A;  3HOX H;  4WRD A;  2BA0 A;  4UP9 A;  2MNA A;  1K83 B;  3L0O A;  2F52 A;  1A0I A;  2K01 A;  4X64 L;  2F0G A;  2CW0 C;  2ZTD A;  1BBX C;  3SR1 A;  1JWM D;  1XPU A;  2H5X A;  4DUZ L;  3GTO H;  4BY7 B;  1NMG A;  2E2H H;  5C0X J;  4KN7 C;  3PCO B;  4EVO A;  3C46 A;  2HIV A;  2D2C C;  1LYL A;  5J39 A;  1C48 A;  2CWP A;  2L5T A;  5JVG 3;  4J6H A;  3D3R A;  1STH A;  5J22 A;  3A5Z B;  5FO9 B;  5KGU A;  3EVQ A;  4AIM A;  5JEA H;  2I07 B;  1ASZ A;  4K5X A;  1S5E D;  1MGS A;  3N6R A;  5IWA Q;  2HIX A;  5AJ3 L;  4DV5 L;  2MQH A;  3T1H L;  1VQD A;  5C3W A;  3G6J B;  1U9R A;  2MUY A;  3I7F A;  1PTO C;  2UXC Q;  3ITP A;  3IFT A;  4KHP L;  3HOV H;  1TWF B;  4JI1 Q;  4IJH A;  1F2M A;  2F0E A;  2R93 H;  1CM9 A;  1Q8K A;  2DY7 A;  4EQO A;  1I50 H;  4GN5 A;  1K8M A;  5FKA C;  4JI3 L;  2NTS A;  4KN4 C;  1TWG B;  3CKI B;  3M3Y B;  1H9R A;  2D62 A;  4B3T Q;  3S15 B;  2B2U C;  1C9O A;  2DNE A;  4DK1 A;  2WB1 B;  4HIK A;  2RCF A;  4L5T A;  4YCW A;  2QDL A;  2EDG A;  2BOS A;  3NTK A;  2HCC A;  4RGM A;  1WTX A;  3GTK H;  1K8G A;  4ME5 A;  4L5R C;  2F0N A;  4A3E G;  1GUG A;  4RKL A;  3RZO H;  2YTY A;  3KBX A;  4O42 A;  2B2U A;  4R9W A;  1SRU A;  4OX9 L;  2N8N A;  1PYW D;  1SNQ A;  1EY7 A;  1PTO B;  5D14 A;  3I8Z A;  2FMC A;  4K14 A;  2AKW B;  2L12 A;  3IAY A;  1NCV A;  4HSP A;  1LM0 A;  3V2T A;  4I7Z C;  2OTJ A;  1TKW B;  4JI7 Q;  2RSO A;  2LKV A;  4J1M A;  1FJG Q;  1LTT D;  3Q24 A;  3F2C A;  4IUT A;  5IIF A;  2V4D A;  5ISR A;  1BNZ A;  3S1N H;  3R3O A;  1PYS B;  3E3X A;  1O7L A;  5F2D A;  2EVB A;  3OOC A;  1IHZ A;  2CVR A;  3KLS X;  2A74 C;  2QKI C;  1K8A C;  3LWU A;  5H1S E;  1U4R A;  4OX9 Q;  3ER0 A;  3H6M A;  5A2Q E;  3K59 A;  2B2T A;  1J9O A;  4KLK A;  3GTP B;  3I90 A;  1LTL A;  4KTA A;  4HMJ A;  5CMD A;  1YZ6 A;  2A69 D;  3QIA A;  5JOB A;  1JT8 A;  4BS9 A;  3VR2 A;  1SNM A;  1SMX A;  4L8J A;  3X3N A;  1R9T H;  1SRO A;  1MJE A;  2JA5 G;  2BDO A;  1BO0 A;  1WTH A;  3OTO Q;  3RLF A;  2ATW A;  1TY2 A;  4OIK A;  4IOC A;  2BH2 A;  4X62 Q;  3NTI A;  4IO9 A;  3F2B A;  4DGZ A;  1NY4 A;  1G2S A;  1YI2 A;  1HNW Q;  4IUP A;  1FGU A;  2F0O A;  4JVZ A;  2TMP A;  3I4N H;  3T4A C;  3X3M A;  1HUM A;  1RKN A;  3TBI B;  1X56 A;  1KRT A;  4UAI A;  2HDM A;  4X3K A;  5CV5 A;  1CT1 D;  1DD2 A;  1IYV A;  2R92 G;  3DEP A;  1RCV D;  3CRL C;  4JI6 Q;  1BVS A;  3GTP H;  4DV1 Q;  4BBR G;  1XMQ Q;  1PA6 A;  2JA5 B;  3DWQ A;  1EY8 A;  1KAB A;  1LTB D;  2YU9 B;  1EYC A;  3FHW A;  2JJQ A;  5C0X I;  2Q8I B;  1JJG A;  1Q1B A;  1IKL A;  2NVT H;  2EXZ A;  1D1I A;  2MHV A;  2RCN A;  3CCV A;  1XPR A;  3D0F A;  1OTC A;  1CKN A;  3S2H B;  1QZG A;  1SLJ A;  3PO2 G;  3MEF A;  4LFC Q;  3UDI A;  3RLN A;  4J15 A;  1CHQ D;  4P75 A;  3VYU A;  2Z4H A;  1X65 A;  3OW2 A;  5C44 H;  4A3F G;  2RDF A;  5G3L D;  3SXH A;  3CCS A;  3CCJ A;  4BBS G;  4N9P A;  1CUK A;  3IFD A;  1FGB D;  3K58 A;  4B3R L;  1WCM H;  5KRU A;  1EIH A;  2PCF B;  1C7Y A;  4CJ0 B;  3ERS X;  3KDF B;  1MKH A;  4FF1 A;  4B9W A;  3M4Y A;  4OXP A;  5JAV A;  5M5W H;  5EGT A;  2CW0 D;  3PUW A;  3A0J A;  1KNE A;  1FYC A;  2SEB D;  3A8K E;  1XMQ L;  2H1E A;  4IOA A;  3P1H A;  1NBW A;  1Q86 C;  4YCU A;  4A3F B;  1O80 A;  1TY0 A;  5IP7 H;  4TSS A;  3E9I A;  5M3F H;  1ILQ A;  2MP1 A;  1GKH A;  1CFM A;  3E0J A;  1YJW A;  2I5L X;  1M4V A;  4WJ3 M;  4DV3 Q;  4A4I A;  2PQA B;  3J7A V;  1H9M A;  1A63 A;  2R6G A;  4DR2 L;  3CRK C;  3KBG A;  1XMO L;  3QOL A;  3OMG A;  2B29 A;  1N8R C;  2VUM G;  2NN6 G;  4KY6 A;  3CCR A;  3S17 H;  1QB5 D;  3HP3 A;  1B3A A;  5M5W B;  1I3Q B;  1PV4 A;  3I4L A;  4ZQ3 A;  4NXM L;  1WFQ A;  4JBJ A;  3W2D A;  4G57 A;  4A3E H;  1UUP A;  3H0G G;  1OXU A;  4C56 C;  1R4Q B;  5JJK A;  1VQI A;  2F0D A;  3HEJ A;  1MD2 D;  1ZXT A;  3BVG A;  4RKB A;  2JA7 G;  4GKJ Q;  1OXT A;  3K7A B;  1GXD C;  5CV6 A;  1A3V A;  3GTL H;  1IKM A;  1K0S A;  1SYE A;  4UDU C;  3JAM E;  3I4M G;  3KF8 A;  4JI8 Q;  2K6A A;  4TRD A;  3VR5 A;  5IY0 A;  1SYG A;  3KLR A;  2IHF A;  1TQO A;  2SOB A;  3ZJY C;  1PMR A;  1B44 D;  3IKJ A;  3U4V A;  2SDF A;  1SE4 A;  5C3E H;  2AQ1 B;  1H9K A;  5DM7 3;  2B63 G;  1I6V C;  4S3S A;  3TDQ A;  4DN4 M;  3J81 j;  1BUV T;  2EYL A;  4JI3 Q;  2B2W C;  2VL6 A;  2B2Y A;  4APV A;  2VNU D;  1A15 A;  1X32 A;  3F2U A;  3M9B A;  4OHJ A;  4QY7 A;  3QR8 A;  2L0C A;  1GUW A;  4X65 L;  2A73 B;  3EJI A;  1L1O A;  1EOV A;  5EJW A;  2E74 C;  1SJH D;  2WP8 J;  4K2L A;  3DUZ A;  4A3B G;  5C6A A;  5EBC A;  4DUY Q;  1GM5 A;  3EFX D;  2C5C A;  4N8F A;  1GUO A;  3HOV B;  4GN3 B;  5C4J H;  3PQI A;  1IBL Q;  2K5H A;  4CDC C;  3UDG A;  1B70 B;  1VMC A;  2QF7 A;  4JOI A;  2F3V A;  3VR6 A;  4PQX A;  2D5D A;  2F0H A;  2X6L A;  1TWG H;  3M3Y H;  1MBY A;  2L11 A;  2KEN A;  3FKI B;  1SFO B;  2H4O A;  1CK1 A;  3NTH A;  1PH2 A;  4DUZ Q;  3T1H Q;  1S40 A;  1O7Z A;  3I72 A;  4AH6 A;  3ERQ A;  1BCP D;  2EE1 A;  3CQZ B;  3J81 L;  2ICE C;  4RG1 A;  3HZX A;  5IWA L;  4RFB A;  2MO1 A;  3R2T A;  3DHQ A;  1BOS A;  3HOV G;  2F4I A;  3DM3 A;  1QNK A;  1TR5 A;  3IL8 A;  4KHZ A;  1AFP A;  3HOW H;  1NR2 A;  1VQ5 A;  5FOB B;  4FYD A;  2MGS A;  5KNB A;  5J3B A;  1YNN D;  3I3C A;  1STE A;  1TWH H;  4YWM A;  3PV0 A;  4JYA Q;  3J81 i;  1A3U A;  3K8A A;  1S5B D;  2IHE A;  3NWT A;  3K81 C;  1HFG A;  1SFO H;  3TS0 A;  5CBE E;  1N9W A;  2G5D A;  3PUZ A;  4PMC A;  4N9T A;  2R7Z B;  3M7G A;  5JVH 3;  4FNF A;  4IJL A;  4QIW B;  2Q2T A;  3HFZ B;  3H3V H;  4C2M B;  1EYG A;  1YJN A;  1O78 A;  1EEI D;  5IP7 G;  3KFU A;  4MN3 A;  3I2Z A;  1TT2 A;  4CKC A;  4BBR B;  1FD7 D;  1S5D D;  4LFB L;  3RZD B;  1JOK A;  5LMU L;  1A62 A;  1CI3 M;  4UP7 A;  5BN4 A;  1PH6 A;  4A3L H;  2Z1C A;  1X3E A;  1H9S A;  1YNN C;  2KUM A;  4ABN A;  4A3M B;  1MI2 A;  4F87 A;  4A3K B;  1F2L A;  1NUC A;  2RDH A;  1MJC A;  4R4Q A;  3NEL A;  1MSH A;  4DUY L;  1I6H H;  2UUC Q;  2A1A A;  4LK1 C;  5I2X A;  2LXJ A;  1YIJ A;  3DMU A;  4V19 0;  2KVM A;  2M00 A;  1BBW A;  2NUC A;  2UXB L;  1YBY A;  3MHB A;  3S1M B;  3H0G H;  4M1U B;  1DOL A;  3MXN B;  2N55 A;  5ELF A;  1XNQ L;  4QJF A;  3J81 E;  5K5P A;  4BA2 I;  2NVQ H;  1IL2 A;  5DAU A;  2WV6 D;  1B9N A;  4LF8 L;  1XYI A;  2QEX A;  1Y1V G;  1LLR D;  3EQL C;  3MXN A;  4BY1 H;  2YYZ A;  3SK5 A;  1OXX K;  5FLX L;  4UHV A;  1S5F D;  2JE6 I;  2NZH A;  2K7V A;  1KIX A;  1I4Q A;  1S5C D;  1N36 Q;  1G51 A;  3I91 A;  1QVF A;  4ULL A;  1CHP D;  3Q22 A;  2NWG A;  1LTG D;  3HOY B;  4K6D A;  4CHT B;  1IBK Q;  2RBM A;  1KXL A;  4DR6 Q;  1K3B C;  1S72 A;  2KCT A;  1PZI D;  2EJM A;  4NW2 A;  5COR A;  4JCV E;  5A35 A;  3E9H A;  1I94 Q;  1HRJ A;  4QMG A;  2RKS A;  1PFB A;  1TWH B;  1VQK A;  3H09 A;  3PIO A;  4LUV A;  2JK8 A;  1E22 A;  2WAC A;  3DXJ C;  3FPP A;  3WWV A;  2IPK D;  5C44 G;  4CBV A;  4A3F H;  5ELB A;  5I9P A;  5COY A;  4BBS H;  1I50 B;  1SAP A;  2CHB D;  1HTP A;  2B2V A;  4BA1 I;  3GTG H;  3GQB A;  1PDQ A;  2E2J B;  3PUX A;  4U68 A;  4NXN L;  3BDL A;  2CQO A;  3PMF A;  4JI6 L;  2EYO A;  1SDF A;  3SK8 A;  3CXC A;  4JV5 L;  4HSV A;  2YTV A;  3J81 c;  5K36 H;  2E2I B;  3J80 i;  1SMY C;  1F9Q A;  4DNI A;  2K04 A;  4JBK A;  3S2D B;  4K5W A;  2Y0S G;  5IYD H; 
#chains in the Genus database with same CATH homology
 2F0F A;  3TZU A;  3P20 A;  1B1Z A;  3OW7 A;  1HTL D;  1NR4 A;  5IGB A;  2F0P A;  4KKT A;  3M7N A;  5G3L F;  1U4M A;  1LT5 D;  2VUM B;  5J1Z A;  2ZT9 C;  2Q8R E;  4IUV A;  1RD9 D;  2B2Y C;  2NN6 H;  4F7X A;  1STG A;  1HQM C;  4C3H G;  4DAP A;  5EPK A;  1HPC A;  1JOO A;  1GJX A;  2EYF A;  5DEH A;  2WII B;  2JA6 B;  5I2Y A;  2F1M A;  1EY9 A;  1SMY D;  4G7O C;  3SVM A;  1DZ1 A;  1D5M C;  1BR9 A;  1JB3 A;  1QWY A;  3I4M B;  1AZQ A;  2XRQ D;  3MXP A;  4BY1 B;  1Q1E A;  4IFD H;  3HG9 A;  4IZ8 A;  5LL6 X;  1F2Y A;  1Y8O B;  4G7Z C;  4C3H B;  3FVQ A;  1DCZ A;  2EJF C;  3S1Q B;  4XIG S;  4L6T B;  1Q8I A;  5LL6 S;  1DOM A;  3ZYY X;  4DAV A;  3UI2 A;  1WD1 A;  2X69 A;  1J8I A;  2F03 A;  4B08 A;  2F0L A;  3MVV A;  4AYB B;  2E75 C;  1TII D;  4FO2 A;  3TME A;  1S4Z A;  3BVM A;  5JPN C;  1ENC A;  1B53 A;  1ZYR C;  2F0J A;  3PO3 B;  1ZKO A;  3JAM L;  3MZ5 A;  5DNF A;  2K28 A;  4KHV A;  3BS1 A;  1LTS D;  4CJ1 B;  5IT9 L;  1SNC A;  3K5O A;  1HQR D;  2D9U A;  2OF1 A;  4Q5V A;  3H94 A;  4LJZ C;  1JIC A;  2K33 A;  1V43 A;  2E76 C;  2R93 B;  1ESF A;  3NUC A;  1EFI D;  2EY2 A;  3OMC A;  1FNU A;  2G9H D;  3TSS A;  1B9M A;  1X3P A;  4OO1 I;  1TS2 A;  1I4R A;  2JA8 B;  2F0T A;  1Y1W B;  4K6L A;  5ELC A;  5FO7 B;  3J80 E;  1HFN A;  1Y1V B;  1R4P B;  1C4Q A;  3NPP A;  4FF2 A;  3LWE A;  4A3E B;  4ZAI A;  1SNO A;  5C0X H;  2PMZ B;  2B63 B;  3GTO B;  4K8I A;  1EQV A;  2O5J C;  1ML0 D;  4TKO B;  1X3Q A;  3GTG B;  4F88 A;  2EY6 A;  3NXW A;  1SE3 A;  4EQP A;  5ELE A;  4CKE A;  4OO1 H;  3A8I E;  2C9O A;  3S1R B;  2NN6 I;  1PTO D;  1Y8N B;  4HMI A;  1LTI D;  4XTC S;  5CC4 A;  5KNC A;  5JPM C;  1WTO A;  4LAA A;  1WCM B;  2VXW A;  1UEA B;  1A2U A;  2R61 A;  3VYS A;  4WJW A;  2B39 A;  5E4W C;  1EYA A;  4Z9C B;  1M8A A;  2NVT B;  1PRT C;  2PQE A;  2EPB A;  3C2P A;  2G9D A;  3D8G A;  1TS5 A;  1IYU A;  1SYC A;  1VF7 A;  1D6E C;  4A3D B;  2A6E D;  3MXG A;  1Z47 A;  3T51 B;  5I6Y A;  1F2Z A;  3W3A A;  4L63 B;  3OWE B;  4IUQ A;  2ICI A;  1CZG A;  2PZU A;  2E2H B;  2Z4I A;  1B50 A;  4HN7 A;  1LAC A;  4CGY B;  2XWB B;  4PV1 C;  1EEF D;  1XXG A;  1Q3L A;  4DNR B;  3T13 A;  1RHP A;  1UAP A;  1SND A;  2IL8 A;  1ROD A;  4B9X A;  3TN2 A;  3L7Z C;  1B2T A;  2K5W A;  4F8M A;  1L0Y B;  3DM1 A;  3MTS A;  1ET6 A;  4KK7 A;  5CV9 A;  2EOT A;  3OSO A;  2GA4 B;  4X3S A;  1R9T B;  1L0X B;  5K36 G;  1G8Z D;  2PPB C;  1EY0 A;  3MXU A;  2O5I C;  3J7A F;  1NSN S;  2LMC B;  1VDZ A;  2SNM A;  4KD4 A;  5FK9 C;  4A3G B;  1TWC B;  1EY6 A;  2JEA I;  5C3X A;  2IJ0 A;  2NYZ D;  2OEO A;  1T5X D;  4XQN A;  4RAU C;  1QCB D;  2XWJ B;  3HS0 C;  2KHS A;  1EU4 A;  1JWS D;  2EYJ A;  3NBH A;  3TP6 A;  4EGV A;  1CTM A;  3P7J A;  5EKL A;  3D6C A;  4KD3 A;  3Q6S A;  3NSW A;  2KCN A;  1ILP A;  2FJ2 A;  4RGO S;  2A6H C;  2B8F A;  3EA6 A;  3K57 A;  4OL7 A;  5IGC A;  3VYT A;  1LTR D;  1ZYR D;  2JA7 B;  4G7H C;  5EKI A;  1ESR A;  3U9O A;  1PTO F;  2NTT A;  1KNA A;  1QG7 A;  3QWN A;  3C1F A;  1BQQ T;  2B2T C;  1EWH A;  1TS3 A;  1BF4 A;  4FP5 D;  3GTQ B;  1E0B A;  3OHX C;  3BDC A;  1EWC A;  1HXY D;  2EZV A;  3H91 A;  1JOQ A;  3TZD A;  1AN8 A;  1LT4 D;  3RD4 A;  4OIJ A;  3SHL A;  2KEC A;  3MEH A;  3QO2 A;  1SE2 A;  5I9O A;  1TWA B;  1H9J A;  2IT1 A;  3A8J E;  2L9H A;  4C3I G;  4A3B B;  4XYO A;  4DF7 A;  3OPO A;  3C1E A;  4O1N A;  3NP8 A;  3NWS A;  1IL8 A;  1QJO A;  3FMC A;  4HR7 B;  1Z7T A;  5T1I A;  3BZD B;  2JP1 A;  1RF2 D;  3T53 B;  3VA7 A;  1FNW A;  3QJY A;  4C3I B;  3O13 A;  3D4W A;  2LY7 A;  2K1B A;  1GUS A;  1V1P A;  5KIX A;  2FHT A;  2IX1 A;  1W6J A;  2WIN B;  2OXP A;  3QB3 A;  2VB2 X;  3J80 L;  4QB4 A;  1PRT F;  5KYI A;  4HAE A;  2VB3 X;  4C3J G;  2WAQ B;  5C3E B;  2K32 A;  1G29 1;  5D65 A;  1F9P A;  1STB A;  3AB9 A;  2HCI A;  4KKS A;  2ZXP A;  3D4D A;  4FXG C;  2J4X A;  4FF3 A;  3A7A B;  1HA5 A;  2KOL A;  3BDO A;  2KJX A;  1F77 A;  5C4H A;  3SK4 A;  1D5Z C;  1AW7 A;  2BA1 A;  3S1N B;  3FRP B;  1AP0 A;  1I4H A;  2MJ8 A;  1Q90 A;  1QIL A;  2RSN A;  5EPL A;  2A6H D;  2IX0 A;  3VA5 A;  1JC7 A;  4OO1 G;  4A3J B;  1G2T A;  1DOK A;  3ONA B;  4QUC A;  4FXK C;  5TSS A;  1XX8 A;  4RHS A;  1KAA A;  2PW7 A;  5CYU A;  2N88 A;  1LAB A;  1E2W A;  4NKL A;  1SJE D;  4JK1 C;  3SEB A;  4K5V A;  2NZ1 D;  4KJO A;  2K5D A;  1G6Z A;  5JEA J;  2KQ3 A;  2CQA A;  1SSO A;  4P2C B;  1U4L A;  1JE4 A;  1XWE A;  3K5L A;  3NBI A;  2A69 C;  3T56 B;  1SBB B;  2A68 C;  4NDX A;  4KKU A;  2LS0 1;  1PZJ D;  3I70 A;  3V05 A;  3R93 A;  5C5L A;  5IOD A;  1AZP A;  2PO4 A;  1GUN A;  2F0U A;  5EQ0 A;  1OXV A;  3GD7 A;  3FDT A;  4IUU A;  2XVS A;  4KY7 A;  3GTJ B;  3NHH A;  4G4K A;  5KYL A;  4WOR A;  3V96 A;  2FMM A;  4XYQ A;  3GV6 A;  5C4Z A;  1TU2 B;  5E3F A;  2M9V A;  3R8B A;  1RTO A;  5EPJ A;  4FF4 A;  2A6E C;  1EY4 A;  3LNN A;  2WKC A;  1JCK B;  3U9S A;  1AEX A;  3PUV A;  3NQI A;  2O2L D;  3HOX B;  1PRT D;  2BCO A;  1D2B A;  3P75 A;  3AMU A;  3VYR A;  1CA6 A;  3S9W A;  2PNR C;  4ZUI A;  2A5H A;  2J7Z A;  2Q8T A;  2I46 A;  4HTH A;  3SK6 A;  1KLG D;  2AQ3 B;  1CQF A;  3E5S A;  5E4X A;  1KTK A;  1LT3 D;  3DWP A;  1I4G A;  2XN9 C;  3I73 A;  3PIP 3;  1T5E A;  2F0Q A;  2XRS D;  5KEE A;  4DXG A;  1W6K A;  4PMW A;  4ZKC B;  3M85 A;  4NP5 A;  2FFK B;  3E6Z X;  5D3D A;  4BWG B;  2BE5 C;  2QCP X;  5NUC A;  4K2K A;  1I6H B;  1E2Z A;  1BXT A;  1NAP A;  1C8C A;  2ENB A;  1Q12 A;  2AWO A;  2EYH A;  1K8O A;  4RA8 A;  1PLF A;  1PZK D;  2XNA C;  3RMH A;  2F0S A;  4GZY C;  2EYP A;  1LT6 D;  2L55 A;  4QF4 A;  1EOT A;  5M3F B;  1RTN A;  5BN5 A;  3SE0 A;  1V1O A;  1ICW A;  2SNS A;  4WFN 3;  2PW5 A;  5M9O A;  2XIW A;  2R92 B;  4FVM A;  3MFG A;  2JXM B;  3TP5 A;  1Y69 U;  2EY5 A;  3TP7 A;  1UNS A;  4IN3 A;  1I4P A;  1SYB A;  3HKZ B;  3DEO A;  4X3U A;  5DM6 3;  1ONL A;  4IAL A;  3KUP A;  1JOR A;  2Y0S B;  3RUZ A;  1STA A;  3DWA A;  5FLX E;  2DY8 A;  3MA2 B;  4H44 C;  3L9A X;  5IOC A;  3PUY A;  3PIO 3;  3TP8 A;  2JSO A;  3NQT A;  3Q0A A;  4PMB A;  3OIQ A;  3A7L A;  1EQT A;  3G7L A;  1Z6H A;  5CV8 A;  4HCS A;  3BG3 A;  4DK0 A;  1SXT A;  1VCI A;  1GHJ A;  5M5X B;  4ZK9 B;  4KJN A;  4C1N K;  5C4X B;  3HRZ C;  4J8Q A;  2ZXR A;  5JJZ A;  4RGN A;  3K0Y A;  5CGK A;  2K5Q A;  5HGT A;  2L1B A;  1O7Y A;  1EZ6 A;  4XT1 B;  3S17 B;  2FIN B;  3BYY B;  1HUN A;  2B2V C;  5EBD A;  1MSG A;  5C5M A;  1HHV A;  4RCO A;  2HUG A;  3MAQ A;  1XTC D;  2KA7 A;  1BDO A;  3A54 A;  3VR3 A;  2F0W A;  5I4D A;  1A2T A;  4DXF A;  1VMP A;  3HOZ B;  3NK9 A;  4R8I A;  3FPU B;  3D31 A;  5CV7 A;  4Y7N B;  2F0V A;  2RVL A;  4ID6 A;  3A55 A;  5M5Y B;  3MFY A;  2B2W A;  3LX0 A;  1TVX A;  1A6X A;  1EYD A;  3FEW X;  1H9S B;  3D4R A;  4FXD A;  3SDZ A;  1RJT A;  2F3W A;  2AUK A;  2A68 D;  4RH6 A;  1BCP B;  2IWH A;  3K5N A;  4KMU C;  4EQN A;  1D1K A;  3I4N B;  4CJ2 C;  4R8N A;  1BCP C;  1U4P A;  4U67 3;  1SEB D;  3A56 A;  1ET9 A;  1DXM A;  4H13 C;  4LMQ D;  5JEA G;  2KED A;  1LTA D;  2M2L A;  1PRT B;  1F9S A;  2LFN A;  1GHK A;  2L4N A;  5D3I B;  1Y8P B;  1WTV A;  1EZ8 A;  2E2D C;  1ENF A;  3GTL B;  2BE5 D;  3BYT B;  2BDN A;  1F9R A;  1PXU A;  3MC0 B;  1SNP A;  4A3I B;  1JR0 D;  3ND8 A;  4H7B A;  4KV6 A;  1FR3 A;  1HCZ A;  2JYO A;  1V8Q A;  3S16 B;  1CQV A;  2EJG C;  4IFD I;  2OT2 A;  1WD0 A;  5C44 B;  3ERO A;  3PO2 B;  4XQQ A;  3N52 A;  1VF5 C;  3CHB D;  1GOZ A;  4ZYS A;  1LO5 D;  4ZLT F;  2F0M A;  2AUJ D;  3HGB A;  3CU7 A;  5CV4 A;  4E6I A;  3C3L A;  2WKD A;  3GO5 A;  2ZXO A;  1JWU D;  5I6W A;  4IQZ A;  4XDX A;  3WOE A;  2NB0 A;  1PFM A;  2KEE A;  1WTQ A;  5C4J B;  1STY A;  4DAY A;  2PZT A;  3ND9 A;  2AQ2 B;  3GV3 A;  2RA4 A;  1RDP D;  4QCL A;  1QE6 A;  1HA6 A;  5FO8 B;  4KY5 A;  2IX3 A;  4HED A;  4RGT A;  3QG1 A;  1ENA A;  5IGD A;  2TSS A;  1EU3 A;  2NVQ B;  2RDG A;  5KND A;  4IFD G;  5LHY 1;  2J0T D;  1OXS C;  4ZUJ A;  2NVX B;  4CKB A;  2EY1 A;  3H0G B;  1EIG A;  5EKK A;  5IGF A;  2X6G A;  5IGE A;  1YNJ D;  1D5X C;  1WTR A;  2O4X A;  2NBF A;  1QOH A;  4IUN A;  1BCP F;  5M3M B;  4TQU S;  3OWF A;  3GTM B;  4ILW A;  1EL0 A;  4MHE A;  2NVY B;  3MWY W;  3T16 A;  4C1N I;  1KDA A;  3QOJ A;  5BN3 A;  3L3O C;  3BVZ A;  1A3T A;  3KK7 A;  4A93 B;  4KI0 A;  2PYK A;  5A2Q L;  2RQX A;  4Q0F A;  1WTW A;  5T1G A;  1DM0 B;  4RWS C;  2IW3 A;  2ID0 A;  3VR4 A;  2K05 A;  4IFD J;  5IT9 E;  4JBW A;  4HCE A;  4DU9 A;  2K03 A;  3WOF A;  4PNY A;  1E2V A;  1OO9 B;  3R2I A;  3HOW B;  1STN A;  1V1P B;  2F0K A;  3OIP A;  4DNT B;  4C3J B;  5HUR A;  4ZRZ A;  1SYF A;  3AU7 A;  4XQJ A;  1PFN A;  2B8G A;  2DN8 A;  1IW7 C;  3URY A;  5IGG A;  3K6O A;  1ZEQ X;  3K5M A;  1TS4 A;  1I4X A;  5E1F A;  1JQY D;  2KCC A;  2EYM A;  3D6W A;  2MPM A;  3S14 B;  4DA2 A;  2HDL A;  5AFW A;  4IUR A;  4K8J A;  4I65 A;  4ODG A;  1CZW A;  4V0B A;  2AWN A;  1YNJ C;  5ELD A;  1QNU A;  4BBS B;  1DJR D;  2PZW A;  4OGQ C;  2JEB I;  4XT3 B;  2F0I A;  3GP7 A;  4ZKB B;  3WDN A;  1PTO H;  5C0X G;  1WTP A;  1SYD A;  2QIL A;  1GUT A;  3NE5 B;  4MIU A;  1B4O A;  2HQE A;  1LV9 A;  4DFA A;  2Z8L A;  1KDC A;  1DON A;  2QEJ C;  2XSC A;  4RHR A;  3GTK B;  3M4O B;  1WVL A;  3HOU B;  1IW7 D;  3RZO B;  5CR3 A;  4M8A A;  1KLU D;  1II3 A;  3J7Y W;  5CBA E;  3Q23 A;  4XXE A;  1EY5 A;  2R3Z A;  4YIJ A;  1KDB A;  3H3V C;  2DNC A;  1G91 A;  1CA5 A;  4QUF A;  2QDB A;  1FNV A;  4H0L C;  1DYQ A;  4NMZ A;  4X3T A;  4RCN A;  3KLS A;  4WRD A;  2BA0 A;  1K83 B;  2K01 A;  2F0G A;  2CW0 C;  1BBX C;  3SR1 A;  1JWM D;  4BY7 B;  5C0X J;  4KN7 C;  4EVO A;  3C46 A;  2D2C C;  5J39 A;  1C48 A;  2L5T A;  5JVG 3;  4J6H A;  3D3R A;  1STH A;  5J22 A;  5FO9 B;  5KGU A;  3EVQ A;  5JEA H;  2I07 B;  4K5X A;  1S5E D;  1MGS A;  3N6R A;  5C3W A;  3G6J B;  1U9R A;  2MUY A;  1PTO C;  3ITP A;  3IFT A;  1TWF B;  1F2M A;  2F0E A;  1CM9 A;  2DY7 A;  4EQO A;  1K8M A;  5FKA C;  2NTS A;  4KN4 C;  1TWG B;  3CKI B;  3M3Y B;  1H9R A;  2D62 A;  3S15 B;  2B2U C;  2DNE A;  4DK1 A;  2WB1 B;  2EDG A;  2BOS A;  3NTK A;  2HCC A;  4RGM A;  1WTX A;  4ME5 A;  2F0N A;  1GUG A;  4RKL A;  4R9W A;  3KBX A;  4O42 A;  2B2U A;  1PYW D;  1SNQ A;  1EY7 A;  1PTO B;  5D14 A;  3I8Z A;  2FMC A;  4K14 A;  3IAY A;  2L12 A;  1NCV A;  4HSP A;  3V2T A;  4I7Z C;  1TKW B;  2RSO A;  2LKV A;  4J1M A;  1LTT D;  3Q24 A;  4IUT A;  5IIF A;  2V4D A;  5ISR A;  1BNZ A;  3R3O A;  1O7L A;  5F2D A;  2EVB A;  3OOC A;  1IHZ A;  2CVR A;  3KLS X;  2A74 C;  2QKI C;  3LWU A;  1U4R A;  3H6M A;  5A2Q E;  3K59 A;  2B2T A;  1J9O A;  3GTP B;  3I90 A;  4KTA A;  4HMJ A;  5CMD A;  3QIA A;  2A69 D;  5JOB A;  4BS9 A;  3VR2 A;  1SNM A;  4L8J A;  3X3N A;  2BDO A;  1BO0 A;  3RLF A;  1TY2 A;  4OIK A;  3NTI A;  4DGZ A;  1G2S A;  4IUP A;  2F0O A;  2TMP A;  3T4A C;  3X3M A;  1HUM A;  1RKN A;  3TBI B;  4UAI A;  2HDM A;  4X3K A;  5CV5 A;  1CT1 D;  1DD2 A;  1IYV A;  3DEP A;  1RCV D;  3CRL C;  2JA5 B;  3DWQ A;  1EY8 A;  1KAB A;  1LTB D;  2YU9 B;  1EYC A;  5C0X I;  2Q8I B;  1Q1B A;  1IKL A;  2EXZ A;  1D1I A;  2MHV A;  3S2H B;  1CHQ D;  3VYU A;  2Z4H A;  2RDF A;  5G3L D;  3SXH A;  4N9P A;  3IFD A;  1FGB D;  3K58 A;  5KRU A;  1EIH A;  2PCF B;  4CJ0 B;  4FF1 A;  4B9W A;  3M4Y A;  5JAV A;  5EGT A;  2CW0 D;  3PUW A;  1KNE A;  1FYC A;  2SEB D;  3A8K E;  2H1E A;  3P1H A;  4A3F B;  1O80 A;  1TY0 A;  4TSS A;  1ILQ A;  2MP1 A;  1CFM A;  3E0J A;  1M4V A;  3J7A V;  1H9M A;  2R6G A;  3CRK C;  3KBG A;  3QOL A;  3OMG A;  2NN6 G;  4KY6 A;  1QB5 D;  3HP3 A;  1B3A A;  5M5W B;  1I3Q B;  3I4L A;  4ZQ3 A;  3W2D A;  4G57 A;  1UUP A;  4C56 C;  1OXU A;  1R4Q B;  2F0D A;  3HEJ A;  1MD2 D;  1ZXT A;  3BVG A;  4RKB A;  1OXT A;  3K7A B;  1GXD C;  5CV6 A;  1A3V A;  1IKM A;  1SYE A;  4UDU C;  3JAM E;  3KF8 A;  2K6A A;  4TRD A;  3VR5 A;  1SYG A;  3KLR A;  1TQO A;  2SOB A;  1PMR A;  1B44 D;  3IKJ A;  2SDF A;  1SE4 A;  2AQ1 B;  1H9K A;  5DM7 3;  1I6V C;  4S3S A;  3TDQ A;  4DN4 M;  1BUV T;  2EYL A;  2B2W C;  2B2Y A;  2VNU D;  1A15 A;  1X32 A;  3F2U A;  4OHJ A;  2L0C A;  1GUW A;  2A73 B;  3EJI A;  5EJW A;  2E74 C;  1SJH D;  2WP8 J;  4K2L A;  3DUZ A;  5C6A A;  5EBC A;  3EFX D;  2C5C A;  1GUO A;  3HOV B;  1VMC A;  2QF7 A;  2F3V A;  3VR6 A;  4PQX A;  2D5D A;  2F0H A;  2X6L A;  1MBY A;  2L11 A;  3FKI B;  1SFO B;  2H4O A;  1CK1 A;  3NTH A;  1O7Z A;  3I72 A;  3ERQ A;  1BCP D;  2EE1 A;  3CQZ B;  3J81 L;  2ICE C;  3HZX A;  4RFB A;  3R2T A;  3DHQ A;  1BOS A;  2F4I A;  3IL8 A;  1QNK A;  1TR5 A;  4KHZ A;  1AFP A;  1NR2 A;  5FOB B;  4FYD A;  2MGS A;  5KNB A;  1YNN D;  3I3C A;  1STE A;  3PV0 A;  1A3U A;  1S5B D;  3NWT A;  1HFG A;  5CBE E;  3PUZ A;  4PMC A;  4N9T A;  2R7Z B;  3M7G A;  5JVH 3;  4FNF A;  4QIW B;  4C2M B;  1O78 A;  1EEI D;  4MN3 A;  1TT2 A;  4CKC A;  4BBR B;  1FD7 D;  1S5D D;  3RZD B;  1JOK A;  1CI3 M;  5BN4 A;  2Z1C A;  1H9S A;  1YNN C;  2KUM A;  4ABN A;  4A3M B;  1MI2 A;  4F87 A;  4A3K B;  1F2L A;  1NUC A;  2RDH A;  1MSH A;  4LK1 C;  5I2X A;  3DMU A;  4V19 0;  2KVM A;  2M00 A;  2NUC A;  3S1M B;  3MHB A;  4M1U B;  1DOL A;  2N55 A;  5ELF A;  3J81 E;  5K5P A;  4BA2 I;  5DAU A;  2WV6 D;  1B9N A;  1XYI A;  1LLR D;  3EQL C;  3MXN A;  2YYZ A;  3SK5 A;  1OXX K;  5FLX L;  1S5F D;  2JE6 I;  2K7V A;  1I4Q A;  1S5C D;  3I91 A;  4ULL A;  1CHP D;  3Q22 A;  2NWG A;  1LTG D;  3HOY B;  4K6D A;  4CHT B;  2RBM A;  1PZI D;  2EJM A;  4NW2 A;  5COR A;  5A35 A;  1HRJ A;  4QMG A;  2RKS A;  1PFB A;  1TWH B;  3H09 A;  2WAC A;  3DXJ C;  3FPP A;  2IPK D;  4CBV A;  5ELB A;  5I9P A;  5COY A;  1I50 B;  1SAP A;  2CHB D;  1HTP A;  2B2V A;  4BA1 I;  3GQB A;  1PDQ A;  2E2J B;  3PUX A;  4U68 A;  3BDL A;  3PMF A;  2EYO A;  1SDF A;  3SK8 A;  4HSV A;  5K36 H;  2E2I B;  1SMY C;  1F9Q A;  2K04 A;  3S2D B;  4K5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...