1RODA

Chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPASPIVKKIIEKMLNSDKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of a chimeric interleukin-8-melanoma-growth-stimulatory-activity protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
molecule keywords CHIMERIC PROTEIN OF INTERLEUKIN 8 AND HUMAN MELANOMA GROWTH
total genus 10
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rodA00
2L1BA 2X69A 1CM9A 2EOTA 2DY7A 5D14A 4ZAIA 1NCVA 1HRJA 1PLFA 1MSHA 5D65A 4X3UA 1BF4A 3G7LA 1VMCA 2KUMA 2B2UC 1BBXC 1HUMA 1WTOA 1PDQA 4XDXA 1EOTA 2KEEA 2MJ8A 4ZLTF 1MI2A 2FINB 4IUTA 4R8IA 1RHPA 2MPMA 2X6LA 1PFMA 1LV9A 2D9UA 2X6GA 3KUPA 2M2LA 3I91A 4IUUA 1RTOA 1J8IA 2JYOA 1B50A 1O7YA 1WTRA 2SDFA 3TN2A 2NWGA 2IL8A 2K05A 1HA6A 4DN4M 1B2TA 2VXWA 1ILQA 1WD0A 2B2YA 4UAIA 1QG7A 1F9SA 1U4LA 4RAUC 1J9OA 1ICWA 5COYA 1PFBA 1DOMA 3LWEA 1PFNA 4XT3B 1IKMA 2Q8TA 2HCCA 5EPLA 1KNEA 1EQTA 1U4PA 1SAPA 1C8CA 1WTQA 1WTPA 1EIHA 2R3ZA 1KNAA 2HDLA 4OIJA 5DNFA 5CBAE 4XT1B 1ILPA 5JJZA 2HUGA 2MP1A 4HSVA 2B2UA 1Q3LA 1XX8A 1QNKA 4CJ2C 1WTVA 1AZPA 3IL8A 4X3TA 1WVLA 1B53A 3DEPA 1M8AA 4MN3A 4NW2A 5T1IA 4ZKCB 5CMDA 1HFNA 1G2SA 5E4XA 1WTXA 1G6ZA 3UI2A 1AZQA 2H1EA 3Q6SA 4HCSA 4IUQA 2XIWA 1BO0A 3P7JA 2RVLA 4MHEA 2JP1A 1S4ZA 2EE1A 1F9RA 1DZ1A 4HAEA 2L12A 4QUFA 2FJ2A 3IFDA 1NR2A 4RWSC 1G2TA 2K04A 1HHVA 3QO2A 1VMPA 1QE6A 2K03A 5EQ0A 2KOLA 2HCIA 1ESRA 3I8ZA 1A15A 2BDNA 3F2UA 1X3PA 3TZDA 1HUNA 3N52A 3GV3A 3ONAB 1TVXA 3DM1A 5T1GA 1G91A 1HFGA 1RODA 1CA6A 2KVMA 1U4RA 1MSGA 2B2WC 1E0BA 1X3QA 2EPBA 1MGSA 4ZKBB 1WTWA 1X32A 1O80A 1B3AA 1SSOA 4CJ1B 3KBXA 2B2WA 1O7ZA 3R93A 2B2YC 5AFWA 1RTNA 2N88A 2Q8RE 5CORA 1JE4A 2NYZD 3H91A 5EPJA 3MWYW 3SVMA 3MTSA 1CA5A 1GUWA 2B2VA 3GV6A 5CBEE 2L4NA 2B2TA 1F2LA 2KEDA 1DONA 2J7ZA 2KECA 2L9HA 4O42A 4R9WA 2K1BA 2B2TC 2L11A 2N55A 3I3CA 2K01A 2FMMA 1F9QA 3HP3A 1JICA 1DOKA 3FPUB 4IUPA 4U68A 1DOLA 1XYIA 4RA8A 4ZK9B 1WD1A 4QUCA 3D6WA 3FDTA 2DY8A 1NAPA 4HEDA 4IUVA 4LMQD 4OIKA 5EKIA 2MGSA 1RJTA 2B2VC 1BNZA 4IURA 4X3SA 2RSNA 5E4WC 2RA4A 2RSOA 4CJ0B 1F9PA 2K28A 4X3KA 1ML0D 1SDFA 1AP0A 1U4MA 2HDMA 2NZ1D 3DEOA 5EPKA 1EL0A 1EIGA 2FFKB 1IL8A 1B4OA 3I90A 2FHTA 1ZXTA 5EJWA 1NR4A 1IKLA 2CVRA
chains in the Genus database with same CATH superfamily
2L1BA 1KTKA 5HURA 1PTOF 1LTLA 1VMCA 2DGYA 1ESFA 1PDQA 3OTOL 2FINB 3M4OH 3SHLA 2WINB 4HIDA 4RKLA 1I6HH 1NUCA 4L5RC 3MXNA 4L5SA 4JI4L 2DUDA 3GDEA 3KOJA 5I6YA 1HA6A 5DM73 1B2TA 1X6OA 4HR7B 1XJVA 2B2YA 1HR0Q 5IWAQ 1JJGA 1CKNB 4IPHA 4P74A 5COYA 3HOYB 2IPKD 5C5LA 4ODGA 3RR5A 1KLGD 1TWCB 4N8X1 5EPLA 1DXMA 1EIHA 1KDCA 4IJLA 3H6MA 3AU7A 3BDLA 5IOCA 1EOVA 1RCVD 2Q2TA 4CJ2C 3Q0AA 1IBKL 5C4JB 1EU4A 1L2FA 2MHVA 1RD9D 4XQQA 1WTXA 1L0XB 2EDGA 2JP1A 1B7YB 1SE8A 1Y14B 4R8NA 2CH4A 2K5WA 2A8VA 1FNUA 2F0UA 1VQ7A 4IN3A 2NVTB 2ZJQA 1EYAA 4TKOB 4LF7L 3NP8A 1ESRA 4C3IB 3SXHA 3TSSA 4A3MB 2OWOA 1X3PA 1JE5A 4PMCA 4DPGA 1AN8A 3TS2A 1VQHA 4K6LA 1O78A 5IP7G 1CA6A 1RODA 2A6EC 3JAMc 3DXJC 2K14A 2FMCA 1X56A 2NVQH 2AQ2B 5G3LF 2B2WA 2K5QA 4IOCA 4K0KL 2Q8RE 3MWYW 1FVIA 1DCZA 2DJFC 4R4OA 3I2ZA 4H0LC 1C9OA 3M85A 3HOUB 2B2TA 5HGQA 2L9HA 2Z6BA 2Z9HA 2JK8A 4KKUA 4RGNA 3K5NA 4DU9A 4BY1B 2KA7A 1K8OA 3T1HQ 2PZTA 4HMIA 5EAYA 4P71A 1BCPC 2MO0A 3D6WA 3EIVA 4LF8L 4J1MA 4EGVA 3QB3A 1TKWB 4HJAA 1JB3A 1K0RA 3GTJH 3K8AA 3OOCA 4J8QA 2BA1A 1TWFH 2WFWA 2JSOA 3KLRA 3I90A 3CC4A 4AYBB 1IKLA 2CVRA 4QUFA 1MJEA 1CM9A 1SYFA 4GNXB 4PQXA 1HQRD 3I72A 3DM3A 1JOKA 1S3OA 3F2BA 4DGZA 4FXGC 1GUNA 2Y0SB 1STBA 4B3TQ 1RTOA 3S14B 2K05A 4ZYSA 4RFBA 2AUJD 2QA4A 1WD0A 1P8LA 3RD4A 2A6HD 3A8IE 4A3MH 3CAMA 3UDIA 3I55A 2Z6KA 4JI2Q 1EZ6A 3EN2A 1VQLA 3VYSA 2KQ3A 4XT1B 1EY7A 4DV6Q 1MD2D 2PW5A 2SNSA 4JI5L 3NQTA 5IT9L 3FEWX 4K5XA 1HA5A 4DXGA 4G7OC 4JBWA 4MN3A 1PXUA 1ENFA 3M9BA 4IALA 3HOXH 1QVGA 1BDOA 3RZDB 3PIP3 5IP9G 4A3IB 2A73B 2QW7A 2DN8A 1EZ8A 3F2DA 1G2TA 4A3DH 1V43A 3SR1A 3L9AX 4ZCKA 2RCNA 3BG3A 3G71A 1CSPA 4AH6A 3N52A 4A3GH 5KYLA 1PRTD 4JI8Q 5C3WA 1X3QA 2QF7A 1B9NA 3X3MA 2OF1A 2F0VA 1NMGA 5JVH3 1CSQA 4GZYC 3TEHB 1O7ZA 5LMNW 5C3XA 3L0OA 1CQVA 2RDGA 1X65A 3CU7A 1QJOA 2G9HD 2Z6KC 1SNDA 2IT1A 2J7ZA 5FLXE 3CCEA 3P75A 2C5CA 4R9WA 3S1NH 4LFAQ 1G8ZD 1VQDA 1Y1WH 3UE1A 1UAPA 4CGYB 1I4HA 3GTKB 4LNQA 1WCMG 2RKSA 3PF5A 3MVVA 1GUOA 5JVG3 4DV2Q 1FL0A 2MGSA 1X54A 1B8AA 2J4XA 2A6HC 1BNZA 5E4WC 2F0GA 5IGBA 3HKZE 4OX9Q 2A1AA 2I5LX 5M5WB 4RGMA 2TSSA 4DV6L 1A0IA 4QMGA 2WACA 1TY0A 3T13A 1H9MA 4CDDC 3PCOB 4B3SL 3NTIA 4A3FG 4BA2I 3Q24A 2CW0D 4LUVA 1E22A 4KN7C 1MI2A 4DV5L 5C4XB 2HD3A 4YHHL 1C0AA 5D3DA 1SYDA 4OWWB 1RL2A 4IUUA 5NUCA 3W1GA 3EROA 4B3TL 3S15H 5I2XA 4XXEA 4BY1H 2AWNA 1ILQA 3NBHA 5C3EG 1EY5A 2ZTEA 1M1KC 1XPRA 2VL6A 1PFNA 4GS3A 1H9KA 3BDCA 1B70B 5EBCA 1KNAA 4A3IG 2XWBB 4UPAA 3E0JA 2MP1A 3PF4A 4MTKA 4MTNA 4TQUS 2F0KA 4BWGB 1CZWA 4XQNA 4DK3C 1PH5A 4PNYA 1A2TA 3R2IA 4BBSB 3HOWB 1G6PA 4ZKCB 2PYKA 4A3CH 1SNMA 3H3VC 2XIWA 2Z1CA 4MHEA 1G291 3BDOA 4V190 4GLVB 1JJ2A 2G5DA 4QL5A 1CQFA 4RGOS 1K3RA 1Y1VG 1I3QH 1QE6A 2K03A 5EGTA 2KOLA 3NUCA 3J7YW 3ULPA 3LWUA 4IFDJ 5ELFA 2F3WA 1LT5D 1HFGA 2B2WC 3CP0A 3GTJB 3C1FA 4ZKBB 1QWYA 3FP9A 1B3AA 1SSOA 3J81E 1VQOA 1PV4A 1HZCA 4XYQA 4BXXH 2PO4A 2GA4B 2PQAB 3U9OA 4DV0L 2D0OA 3QG1A 1WJJA 2B3GA 1SE2A 4BBRB 1EQRA 2VNUD 3S1NB 2HT1A 4Y52H 2E2HB 1YNXA 3ERQA 4F8MA 5C4HA 1JICA 4DR1L 2JEBI 4JPBW 1YNND 2LY7A 1V1QA 4CKEA 3CD6A 4B3MQ 1R4PB 1ZYRD 4X3SA 4DR7L 5M5YB 2AHOB 2RA4A 4LF4L 3HKSA 4DR4Q 1BQQT 5ELNA 2YTYA 1PTOH 3HRZC 1A62A 4GOPA 4DA2A 1VQGA 3S9WA 1PFSA 3T1YQ 1QVFA 4UDUC 3BYTB 3CPFA 1LV9A 1SNOA 4FP5D 5JEAG 3H0GB 4LW1A 1K8AC 3CXCA 1N33L 3HS0C 5A35A 2L0CA 3G6EA 1S5CD 1P16A 1IBKQ 5IT9c 2KJXA 4UAIA 4K6DA 1QG7A 2BH8A 3C46A 1B9MA 1JWMD 2VQFQ 3KF6A 4X62Q 5DAUA 4A3LH 1H9JA 4DUYL 2LSSA 2E2JB 1VQCA 3ER0A 2ALYB 1YIJA 1WVLA 3OIPA 3BVMA 1R4QB 3PUWA 2OCEA 2YTXA 2F1MA 1PMRA 2H1EA 4JI8L 3T16A 5IT9E 1K83H 1LT4D 4P2CB 3K5MA 1PZJD 4JI6L 2YU9H 4JI1L 3GO5A 3IFDA 4RWSC 1Q81C 5IYBH 1ICFB 3JAML 3HZXA 3DHQA 3ONAB 5JJLA 4LF4Q 4X64Q 1A3VA 3DLLA 4DR6Q 1HXYD 1DD2A 4DR7Q 1E0BA 1GXDC 2EXDA 3A55A 1LUZA 1F2YA 1W6KA 4A3IH 3IFTA 4A3BB 2N88A 3A5UA 3H91A 3CCMA 3VR3A 1TWHB 3D8GA 3A5ZB 5KRUA 4LF9L 3CCUA 2L11A 3K6OA 4ULLA 2V4DA 5J1ZA 1SMYD 3G6JB 2Q2IA 4A3CG 2UUBQ 3IKJA 1DOKA 4U68A 2CH4W 4GNXA 4RG1A 1A3TA 3W3AA 3J7AV 3S1QH 3N6RA 4DR2L 1VQ9A 2YV5A 5M5XH 4DR6L 2VY3A 3PUYA 3SGIA 2O5JC 1FD7D 1PYBA 3JC66 3UDXA 1TT2A 4C1NK 4UP7A 4BY7B 1B3QA 5CYUA 1RIPA 4JOIC 2C9OA 1NCVA 2OXPA 1MSHA 1RF2D 4JI1Q 3WDNA 3OWFA 3AB9A 4A3JG 2R6GA 1XXGA 2MJ8A 4R8IA 1YJ9A 2F0SA 3K5LA 2SEBD 5M3MH 3AFPA 4HJ5A 2PNHA 2SOBA 4A3KH 1ASYA 4WJ3M 4NMZA 3I4OA 3EJIA 2I5MX 4NXMQ 1U4LA 1VQ6A 4DNIA 2RBMA 4EQ5A 3ICEA 1GHJA 1TR5A 1H9RA 5E7NA 5DNFA 2IHEA 2E2JH 4A3JH 2HQEA 1AE3A 2N49A 3A54A 3PO2B 3IL8A 1X3GA 1DYQA 2CQOA 5CMDA 3J80E 4DV3Q 4YHHQ 4HCSA 4IUQA 2E74C 5K5PA 5KNBA 5GAEC 3UDGA 3V05A 4JOIA 3B6YA 2FJ2A 4HTHA 2UU9Q 4E6IA 4A93H 3CCQA 4LWCA 3QJYA 4M1UB 4R4TA 5IYDG 1WOCA 1PVOA 3M7NA 2Z0SA 3NWSA 1JCKB 3S16B 1I4RA 2GVAA 3P20A 4A3MG 1VQPA 3FHWA 1ONLA 2OT2A 1CKOA 3F2CA 2B2YC 2F0QA 5IGFA 4DR1Q 1CHPD 3I4MH 4N9PA 1JB7A 2KEDA 3K58A 3KF6B 4KHPQ 4A3EG 1IBMQ 4DR5L 3CC7A 2B39A 5LHY1 1XNQL 5IGDA 1PHJA 2B63G 3BZDB 1YHAA 4HEDA 4A3FH 4ME3A 5IYBG 4A3KG 5CV8A 4A3DG 3I4MG 1E2ZA 1EIGA 2A74C 3HOYG 1IL8A 1O7IA 3RZOB 1D6EC 5EJWA 4C2MH 1I50H 3S17H 3NWTA 2CHBD 5D14A 4KLKA 2R7ZH 5J39A 4A3KB 3T53B 1PLFA 3GTMB 1BF4A 3MXGA 3G7LA 3U9SA 5FJ8G 5LMUQ 3A74A 1WTOA 2HIVA 2Z4IA 5J22A 1DGSA 3OHXC 1JQYD 3RMHA 1ZYRC 1HPCA 1EWCA 2D9UA 4A3GB 2JA5H 1J8IA 3A0JA 1CTMA 3PQIA 4DXFA 2XGTA 1R9TH 2JEAI 1RKNA 2XTIA 4L63B 1VQAA 1PH3A 2XNAC 5C44B 1ICWA 1KLUD 2VB3X 5DM63 1VQNA 3QOJA 4L5QA 3S1QB 1KD1C 4C1NI 5L37A 1IW7C 3M3YH 5JJZA 3C1EA 2N8NA 4H13C 1XX8A 1YNJD 2ID0A 1C4QA 1PYSB 1SR3A 3OIQA 3SK5A 2UUCL 1VQ4A 4JI3Q 2KCTA 2PI2E 5FO7B 2IY5B 3M3YB 1E1OA 1GO3E 3MEHA 3CMAA 4K14A 2AMCB 1W6JA 1PRTF 3J81i 1BUVT 3ND9A 4NB3A 4LUZA 2K04A 1A63A 1VMPA 5G3LD 3I8ZA 3TZDA 1HUNA 1GVPA 3DM1A 5ELEA 2PMZB 4C2MB 3S17B 2EPBA 5LL6X 5CV9A 1FJGL 3HOZH 4GKKL 4JI7Q 3K81C 3MEFA 4WFN3 5M5WH 4LF8Q 4NPSA 3AMUA 2L15A 2NN6H 3MTSA 3S2HH 4DUYQ 1FGBD 3PIOA 4Z9CB 3AQQA 3HFZB 2F03A 4R4CA 4B3RQ 1F9QA 1GUGA 2BDOA 4K8JA 5M5XB 2ASBA 1UUPA 3HP3A 2UUAQ 4KKSA 3G48A 3BZKA 3TQYA 3CCSA 3PIO3 2WKDA 3GQBA 1XMQL 2RSOA 1F9PA 1OXSC 1Y8NB 3J7A5 1BKBA 3MA2B 4RCNA 1UNSA 1XNRQ 4F87A 4X6AH 1EYCA 1CI3M 2A68C 2LKVA 2F0WA 3TREA 4CDCC 5AJ3Q 1HRJA 2M00A 2F4IA 2PCFB 1PH4A 4QQBX 4JC0A 1QVCA 2B8FA 1EOTA 2E8GA 2I07B 3W5OA 2X6LA 1K28A 3NXWA 5IIFA 2D62A 2RCFA 2NBFA 5BN3A 1LTTD 1F9SA 3OW2A 5IGCA 4A3EB 4A3BG 1CFMA 4IUNA 1LTSD 3KLSX 4RMFA 1SAPA 3W2DA 1YITA 1VQFA 3PGZA 2DNCA 1IYJB 3DMUA 3DUZA 1K8GA 1NE3A 4G7ZC 1NY4A 1VQ5A 2ZM6Q 1O7LA 1ENAA 1EEFD 1N34Q 3VR2A 1G6ZA 4ME5A 2F0NA 1B1ZA 1HNWQ 1LT6D 1TU2B 3M4PA 1U5KA 3OTOQ 4R4IA 1CKNA 1NJIC 1F2ZA 1F9RA 2SNMA 3FVQA 3HOVG 4PZ6A 4OXPA 1CHQD 3J80i 1SNQA 2F0HA 1DJRD 5FLMG 1I4XA 1C48A 4WJWA 2O4XA 1HNZQ 3T4AC 2YYZA 2XRSD 1G91A 1IBLL 4YCVA 3MAQA 2F3IA 3E0EA 1E1TA 2F0LA 2JJQA 2JA9A 3KBXA 3D6CA 3RZDH 1STAA 4DV1L 1Q7YC 3PIPA 4KV6A 1RDPD 5CBEE 3Q23A 2WB1B 2O5IC 2EYHA 2HIXA 1NNXA 4IZ8A 2K1BA 2QILA 4IPCA 3U50C 5IYDH 4AYBG 2F0DA 2F0FA 1DOLA 2K50A 2RHSB 1XYIA 3GP7A 1CKMA 4FVMA 3VYTA 5FO9B 3CCLA 3C2PA 3E3XA 5IGGA 4X3KA 2ZXRA 4QB4A 2NZ1D 1MJCA 5EPKA 2PZWA 5CR3A 3K7AB 4BBRH 4IFDH 1NR4A 2UUBL 4HIMA 4HMJA 3PV0A 4G7HC 3R3OA 2QKIC 4KMUC 1Q1EA 1EUJA 1V9PA 1BBXC 5C4XH 1HTLD 5IODA 3D4WA 1OTCA 4L5TA 1PFMA 5D3IB 4NKLA 1TQOA 2R61A 4GLAC 1O7YA 1YJNA 2NWGA 2JA7G 2VXWA 3E9HA 3H0GG 3S1MB 4BBRG 1TWFB 1BBWA 3GTQB 2MUYA 3TZUA 3PO3H 2E2IB 4CKCA 4DR3L 4JCVE 5LMNQ 3T56B 1C8CA 2ZTCA 2HDLA 4QCLA 1BBUA 5CBAE 4A3JB 1H95A 1LLRD 1GJXA 1W3SA 3CPWA 2I46A 4HCEA 5FO8B 2R93G 4X3TA 1VF7A 3PO3B 1XTDA 1G2SA 5C0XJ 1N34L 3A8JE 1ZKOA 2AQ3B 4AYBE 4HN7A 3KBGA 2XRQD 1AH9A 1J6QA 1I6HB 2KHJA 1TS5A 1OXTA 1IBML 3M4OB 4JYAL 2N78A 1HZAA 5M3MG 3SK8A 3VR5A 2AUKA 3RLFA 3QR8A 2JA7H 2R93H 4PMWA 1QUQB 1Y69U 1KRSA 2EYJA 2ES2A 3MFGA 1BCPB 3BZCA 1MSGA 1YJWA 1PZKD 4ZUJA 3ULJA 1X32A 4AIMA 3T1YL 4EQOA 5CORA 4BXXG 3ND8A 4KHVA 3K0XA 1NMFA 4GN5A 4KI0A 4O42A 2LMCB 2K01A 4YWKA 1OXXK 1LT3D 1GD7A 4X66Q 1J5EQ 4I7ZC 3SEBA 1XMQQ 5DEHA 3EA6A 4IUVA 4DV3L 2B2VC 1D5ZC 1Z47A 1K83B 2E5LL 1T5EA 2PZUA 1AP0A 1U4MA 2NN6G 2UXDQ 4H02A 1XPOA 4FDBA 4G57A 1LM0A 4XIGS 2H4OA 4ZQ3A 5LMNL 1STEA 1TS4A 1V1OA 5M3FH 1YVCA 3ITPA 3AFQA 4OELB 2E2IH 4HJ8A 2MPMA 1NTGA 1V8QA 2X6GA 3NE5B 5C3EB 4GKKQ 1XTCD 2JYOA 3TP5A 1HNXL 1IHZA 1EY6A 3J7ZC 1Q8KA 3MXUA 3RZOH 5CGKA 4ID6A 3HOWH 5BN5A 3CW2C 1SMYC 3BYYB 3LWEA 3TS0A 3R2TA 3TMEA 3IAYA 4A3FB 5FJ8H 5JJIA 4FF2A 4OEMB 2PQAA 3VR6A 2B8GA 4CKBA 1X3EA 3KF8A 1AZPA 1AW7A 4A93G 1HNWL 3DEPA 3OW7A 1EWHA 4C56C 1SFOH 1AZQA 1LTBD 4A4IA 3S2DB 2OTLA 3TDQA 1TS2A 4KY5A 3T51B 5M3FG 2F52A 1EYGA 2NVQB 3BS1A 3HOZG 1BCPF 3QO2A 3HG9A 2H5XA 3E5SA 3STBC 2JA5G 3HKZG 1SJED 4X65Q 3WOEA 2KHIA 1A15A 1HJPA 2BDNA 3GTLH 3S14H 2CWPA 2EJFC 1U0LA 1WI5A 4JVZA 5F2DA 2NVTH 1XPUA 2QGQA 2E76C 2EYFA 3HKZB 3OMCA 2JA5B 5C6AA 4IO9A 3HOZB 3RUZA 3ZYYX 1IBLQ 1PH8A 2UXBL 1IL2A 4AQYQ 1YI2A 4LF5Q 5C44G 2QCPX 4DAYA 1I50B 1HNZL 1JWSD 1VQBA 5AJ3L 2PMZE 4DK6C 4JYAQ 1G51A 2K4KA 2I0QA 1CUKA 1E24A 3PUZA 1Y1WB 3GTGB 1AE2A 3CRKC 4J15A 4DNRB 5K36G 2JE6I 3FPUB 1WD1A 2WP8J 2K5DA 2K5NA 3D4DA 2DY8A 1Y1VB 1VS0A 1TWCH 4DAVA 1K3BC 2F4VL 2ZM6L 4JV5L 5C0XH 2IHFA 5IP9H 2RF4A 1SDFA 3Q8DA 2JA7B 3LX0A 4BBSH 4JBMA 4ABNA 2EY2A 3A7LA 4PMBA 4OL7A 4DR5Q 3QOLA 3R8BA 1D2BA 1AFPA 5ELBA 4OHJA 4EQNA 1TY2A 4H44C 5KYIA 2B2UC 3CMEA 5JPNC 2B63B 1K0SA 1S5ED 1TXYA 1Z9FA 1RHPA 3NENA 4K5WA 3TP6A 1TWGH 1OO9B 1L1OA 1SYBA 4JI7L 1Q82C 1VF5C 1I4PA 3TP8A 4XYOA 4C3IH 4JI0Q 3FMCA 2QDLA 1JOOA 3SK4A 4FF4A 1T9HA 2Z8LA 4OONA 4M8AA 1QCBD 2P5ZX 3BVGA 1CZGA 2Y0SE 1KNEA 3K80C 2JQOA 3HOXB 1HZ9A 4OIJA 2EYMA 3KDFA 1I5FA 1ILPA 2EYOA 3GTQH 4ZRZA 5C0XG 1QNKA 2DJGC 3S1MH 3PO2H 3V2TA 2YTVA 3NELA 2BE5D 2D0PA 1LTAD 1NSNS 4HSPA 1IXRA 5KGUA 2A19A 1R9TB 1BO0A 2RVLA 2QEJC 4LF6L 1EFID 4RGTA 3K59A 5H1SE 4B3RL 4JBJA 1YHQA 4HIOA 3U4VA 2HCIA 1BR9A 4DV0Q 4DAPA 1JT8A 3HOUG 4YCUA 5BN4A 2KVMA 1B44D 3V96A 1SMXA 1YZ6A 1HTPA 5C3EH 5ELDA 1O80A 2K5HA 5J3BA 1GUTA 1ET6A 1K73C 1N8RC 4FF3A 5LMUL 3A56A 4YY3L 1V1PA 3WOFA 4YY3Q 1SYGA 5CV6A 1ASZA 4EX5A 4IUPA 2Q8IB 5IE8A 4RA8A 4K0KQ 4OO1I 4O1NA 3BU2A 2Y0SG 1HNXQ 3VA5A 1RJTA 4IURA 4POFA 1PTOD 1EY4A 3C3LA 5JOBA 4DAMA 2HDMA 2RHQB 3DEOA 1XNQQ 1MBYA 1I6VC 4X66L 2FHTA 2ENBA 3IRBA 2J0TD 1PH1A 2AQ1B 2LXJA 3X3NA 3I4LA 1PH9A 4ZAIA 4KHPL 2IW3A 2EXZA 2KUMA 3BJUA 1HUMA 1JC7A 3CCVA 4OO1G 2BA0A 1MIUA 1KXLA 1SE3A 2M2LA 3QWNA 4B08A 3I91A 4POGA 1IYUA 1PTOB 1SE4A 1WYDA 3JAMi 2D5DA 1H9SA 1PH2A 2UXCL 4QY7A 2EY5A 2KHSA 4N9TA 3GTGH 4BY1G 1J5EL 2R93B 5A2QE 4DV4L 1KRTA 1F2MA 2Q8TA 2HCCA 4F88A 3CCRA 4A76A 4C3JB 2MFIA 5TSSA 4CHTB 1D1KA 2CQAA 2IJ0A 1QILA 3U4ZA 1HR0L 2NVYH 3J80L 1SBBB 1XWEA 1HFNA 4GN4B 3VYUA 3ULLA 1PH7A 4TVAB 3GD7A 1YNNC 2WIIB 2JXMB 3I7FA 1STHA 4HAEA 2L12A 3SE0A 5IGEA 1EY9A 1GKHA 5M9OA 2EYPA 3KJPA 5EQ0A 3KJOA 4NDXA 3CKIB 5LL6S 4DR3Q 4GLXA 4H7BA 2KCCA 2EYLA 4OWTB 4B9WA 4NXML 2WAQE 3STBD 4C3HG 2PQEA 1HZBA 1PRTB 1HCZA 4KHZA 4K5VA 1TIID 5CV7A 3RN5A 4DUZL 2Z4HA 1OXUA 4B9XA 1QNUA 3O13A 3RNUA 4LUOA 3CC2A 3CCJA 3M7GA 3WWVA 3SDZA 5JPMC 3GTPH 1KL9A 2HQLA 2L4NA 5IP7H 1QB5D 4TSSA 2UU9L 2I5HA 4KY7A 1I4GA 4GNXC 1IZ6A 1SROA 4DV4Q 5M5YH 2EQSA 3P1HA 4QUCA 2YU9B 3VDYA 2NVXH 1N9WA 2KCNA 3EVQA 4QJFA 1X3FA 2KBNA 4Q5VA 1VQIA 1E2WA 4JI5Q 5C44H 1Y1WG 1W2BA 2ZXPA 5BR8Q 1Q12A 3KK7A 2R92H 4LFBL 2VQEQ 4LFBQ 5K36H 1D5XC 2JA8G 2L55A 2RQXA 1D1IA 3NSWA 5C0XI 3FKIG 4XDXA 2GN5A 4UP9A 4OGQC 4A75A 1II3A 1SFOB 1B50A 1S40A 4GOPB 4CBVA 1XMOL 2IX0A 4BBSG 2WAQG 4LFCL 4KD3A 1IYVA 2LS01 1SLJA 1J9OA 2A5HA 3I56A 1WTQA 2R3ZA 5EKLA 3FKIH 4LAAA 1EEID 3A7AB 4EQPA 4GOPC 2EY1A 4LFCQ 4BY7H 3L7ZC 4QIWB 3S24A 1M8AA 2R92G 2QDBA 1KAWA 3P7JA 1S4ZA 5ELCA 2PPBC 2MO1A 2VUMB 1EY0A 1A3UA 1KQSA 3GTMH 3URYA 1SYCA 2XSCA 1FGUA 2WV6D 4DKAC 2F0TA 3KDFB 5FK9C 3SK6A 1Q8IA 2PNRC 1PH6A 1VQ8A 3F2UA 1QOHA 3H3VH 4I7AA 4LF6Q 3S16H 1QZHA 3K0YA 3H3VI 4YIJA 4KTAA 1JMCA 1U4RA 4QF4A 3CQZB 1GHKA 2DNEA 1N33Q 3EFXD 4CJ1B 2PI2A 5FOBB 1K8MA 1TS3A 5EBDA 1RTNA 2NYZD 5EPJA 2B63H 1WCMB 3GV6A 4LF7Q 5JEAJ 3VR4A 3I4NB 2ICIA 4MNOA 2D2CC 1SNPA 5E3FA 5FLXL 1JR0D 1CK1A 2NZOA 1PYWD 2NTTA 2EVBA 3E9IA 1Q86C 2R7ZG 1FNVA 4P72A 1KHIA 3HOXG 4DFAA 4Y7NB 1EL0A 3KF8B 4NP5A 4X62L 1LO5D 4LFAL 1STYA 3RLNA 3LGJA 1VQEA 1S72A 3KLWA 4C3JG 3J81c 2G9DA 4P75A 4APVA 3K57A 4A3GG 1Z6HA 3KUPA 4DF7A 3G4SA 2F4VQ 2F3VA 2IX1A 1D5MC 2OTJA 2F0IA 2A68D 2R7FA 1AEXA 2NUCA 1UE7A 1FR3A 2UUAL 4RH6A 3JAME 1DOMA 1SJHD 1STNA 4IFDI 1FYCA 1EQTA 4A3DB 2VUMG 1L0WA 3FKIB 3BVZA 3HOVH 2CKZB 3J7AF 2A6ED 2FXQA 1WTVA 1SNCA 4IJHA 2K75A 5T1IA 1K9MC 4B3ML 3I4NH 1EIFA 1EYDA 1LTGD 2MNAA 3Q6SA 3CF5A 3OMGA 1EIYB 1I4QA 4JW0A 2BE5C 4DV7L 5KNDA 2EJGC 2EJMA 1DZ1A 5GADC 1SXTA 4L8JA 4OWXB 4IFDG 5ELOA 1HHVA 1NR2A 3CQZH 5KIXA 3L3OC 2E2HH 5E1FA 4R1JA 5A2QL 3GTOH 2MQHA 4R4QA 5BR8L 2EY6A 4XQJA 4DV7Q 3NBIA 4PZ7A 1JWUD 2HHHQ 1UEAB 4HJ9A 1SEBD 3HGBA 2M9VA 4UP8A 4DV5Q 5M3FB 2WKCA 3H15A 3MFYA 4KJNA 4KN4C 2Q2UA 3Q22A 4KK7A 2BCOA 3PO3G 4YCWA 2N55A 4N8FA 1BVSA 3MHBA 4PV1C 4GKJQ 4CDFC 3U58A 2VW9A 4MZ9A 1A2UA 3GTPB 2OQKA 1GOZA 5I9OA 5CV5A 1KAAA 4DV2L 1V1PB 3MC0B 2RDFA 2C35B 4RCOA 3KFUA 2K28A 1ML0D 4U673 2EIFA 3OPOA 5DLQE 3OSOA 3HOUH 2KENA 4C3IG 3MXPA 1KABA 1EY8A 4X3UA 1A6XA 4TRDA 2UXDL 3NHHA 4ZLTF 4A3BH 4IUTA 5CV4A 3W1BA 5GAGC 1EQQA 3MXNB 3DWPA 1WTRA 4L6TB 3ZJYC 1NBWA 1KIXA 2CCZA 1KDAA 1S5BD 4S3SA 3PO2G 4K2KA 1VQKA 4XT3B 4HJ7A 5JEAH 1U4PA 3VYRA 4MIUA 1XNRL 3E6ZX 3J80c 2F0EA 1LTRD 1UWVA 2B2UA 1UE6A 4DR4L 4AQYL 3QIAA 4ILWA 3DWAA 1N36L 3F1ZA 5C4JH 4BA1I 1B53A 1GM5A 2A69C 1EU3A 2Q2HA 2CW0C 3GTOB 1N36Q 2LFNA 5EKKA 4LJZC 2NN6I 4UHVA 3HOYH 1BXTA 1TWAB 2F0OA 1PZID 3PSIA 1YBYA 4JI2L 4QGUA 4F7XA 4WJ4A 4JK1C 4KD4A 3K7AH 2BOSA 4BY7G 3GV3A 1TVXA 1Z7TA 3NK9A 1ENCA 4P73A 1HH2P 5T1GA 4JV5Q 2F0PA 3EBEA 4V0BA 1MGSA 2ATWA 1WTWA 5M3MB 2K7VA 1UE5A 4DNTB 3AYHB 5AFWA 2VUMH 3K7UC 3HOVB 3UDFA 1CA5A 2XN9C 3AEVA 3OWEB 2AWOA 4DK0A 3HOWG 1S5DD 1YNJC 4A3LG 3I3CA 2FMMA 1LYLA 1S5FD 3K5OA 1KC8C 1A8VA 1IW7D 2NTSA 3F8TA 3S2HB 4LF5L 2WB1E 2V1CC 4XTCS 1XMOQ 2IWHA 2UXBQ 5GQOA 2IX3A 3J81L 4LMQD 4K8IA 5EKIA 2JA8H 2RSNA 5CC4A 2NZHA 2HHHL 4CJ0B 3RLOA 3ERSX 2FFKB 3FPPA 4X65L 4ZK9B 5KNCA 4C3HH 1Q46A 4GKJL 2X69A 1WCMH 4DK1A 1JORA 2DY7A 4WORA 1I3QB 4LF9Q 5FKAC 4YWLA 1UEBA 2KEEA 1MHWC 1TWAH 1PA6A 1M90C 3J81j 1VQMA 4YWMA 2E5LQ 3NPPA 1QZGA 2GVBA 2K33A 3NQIA 5KEEA 2SDFA 3TN2A 2UUCQ 1M4VA 4GN3B 4DN4M 1E3PA 4O0AA 3VA7A 3I73A 1I94L 4G4KA 1IKMA 4B3SQ 1FNWA 3NTKA 2N3SA 1CT1D 1WTPA 3D0FA 2JA6B 2F0MA 3PMFA 5I4DA 5IY0A 5JJKA 4KKTA 1LACA 4DV1Q 2XVSA 1MKHA 2TMPA 4JI0L 1SN8A 4NW2A 2ZJRA 4OX9L 4DUZQ 4IQZA 4ZUIA 3D3RA 4KJOA 3KYHC 4X64L 1WFQA 1Q90A 2EE1A 3M4YA 2WB1G 5C4ZA 4FNFA 1SYEA 1PTOC 4DAYB 4OO1H 4O2DA 2XWJB 1E7ZA 3M4QA 2VQFL 2B29A 3S1RB 3H94A 5IYCH 4PZ8A 3S15B 1E2VA 4I65A 1BCPD 1Y1VH 3H0GH 1KDBA 4IOAA 3R93A 1JE4A 1VQJA 2B2VA 1DONA 2KECA 1STGA 3CHBD 3A8KE 2K6AA 4UY8C 1N32L 2NVYB 3I4MB 2VZAA 1YHBA 1LABA 3TP7A 4NXNL 3UE0A 3EQLC 2UXCQ 4K2LA 5FLXc 4OIKA 4C3JH 1L1OB 5I2YA 1Y8OB 4A3EH 2EZVA 3NTHA 3NBHB 5JAVA 2ZJPA 2ZT9C 4NXNQ 2F0JA 5GAHC 1Y8PB 3FRPB 1ZXTA 1EFWA 3MZ5A 1EQVA 1OXVA 1N32Q 2EOTA 5ISRA 4A93B 1TWGB 3PUXA 5D65A 1JJCB 1U9RA 4JBKA 1L1OC 5IWAL 2NB0A 4BS9A 5C4XG 3S2DH 2NVXB 3D31A 4JI4Q 4J6HA 2IL8A 2ICEC 4QIWE 3CRLC 3S1RH 1LTID 4RAUC 2QEXA 1EWIA 1PFBA 5GROA 1TWHH 4Q0FA 3I4NG 2JA8B 5I9PA 1VCIA 2LXKA 1SRUA 4RHRA 4ALPA 4JG2A 1PRTC 2HUGA 4HSVA 1D8LA 2O2LD 1Q3LA 2L5TA 2ZXOA 2VS1A 1YEZA 2K32A 5IYCG 4DR2Q 3OYYA 1FJGQ 1F77A 5E4XA 1X55A 3UI2A 4CDEC 2JA6H 1JOQA 2OQ0A 4FXDA 2CWAA 3H09A 2E2DC 3T1HL 3L2PA 4FYDA 2OEOA 3HEJA 2E75C 4IPDA 1H9SB 2CFMA 2R7ZB 1UE1A 1Q1BA 3DWQA 2KCMA 5C5MA 2BH2A 4HIKA 3D4RA 1I94Q 5HGTA 1HQMC 1BOSA 3GTLB 5HY6A 4KY6A 1X9NA 1DM0B 2K5VA 4PG3A 1VDZA 2JN4A 2R92B 3TBIB 3RN2A 2JA6G 3TRZA 2R7DA 5FLMH 4JI3L 4LK1C 4Y7NH 4RKBA 2RDHA 3I70A 4FF1A 1ZEQX 1QUQA 3SVMA 4WRDA 1GUWA 4IPGA 4C3HB 1F2LA 5I6WA 3PUVA 2AKWB 3LNNA 1HR0W 2VQEL 2B2TC 2K52A 2WAQB 4JI6Q 4FO2A 1D7QA 1GUSA 3KLSA 1ET9A 3FDTA 1T5XD 1NAPA 1L0YB 4FXKC 2ZTDA 2A69D 4RHSA 1C7YA 1WTHA 3GTKH 1B4OA 3NEMA 4EVOA 2PW7A 2VB2X
chains in the Genus database with same CATH topology
2L1BA 1KTKA 5HURA 1PTOF 1VMCA 1ESFA 1PDQA 2FINB 3SHLA 2WINB 4RKLA 1NUCA 3MXNA 1HA6A 5I6YA 5DM73 1B2TA 4HR7B 2B2YA 5COYA 3HOYB 2IPKD 5C5LA 4ODGA 1KLGD 1TWCB 5EPLA 1DXMA 1EIHA 1KDCA 3H6MA 3AU7A 3BDLA 5IOCA 1RCVD 4CJ2C 3Q0AA 5C4JB 1EU4A 2MHVA 1RD9D 4XQQA 1WTXA 1L0XB 2EDGA 2JP1A 4R8NA 2K5WA 1FNUA 2F0UA 4IN3A 2NVTB 1EYAA 4TKOB 3NP8A 1ESRA 4C3IB 3SXHA 3TSSA 4A3MB 1X3PA 4PMCA 1AN8A 4K6LA 1O78A 1CA6A 1RODA 2A6EC 3DXJC 2FMCA 2AQ2B 5G3LF 2B2WA 2K5QA 2Q8RE 3MWYW 1DCZA 4H0LC 3HOUB 3M85A 2B2TA 2L9HA 4KKUA 4RGNA 3K5NA 4DU9A 4BY1B 2KA7A 1K8OA 2PZTA 4HMIA 1BCPC 3D6WA 4J1MA 4EGVA 3QB3A 1TKWB 1JB3A 3OOCA 4J8QA 2BA1A 2JSOA 3KLRA 3I90A 4AYBB 4QUFA 1IKLA 2CVRA 1CM9A 1SYFA 4PQXA 1HQRD 3I72A 1JOKA 4DGZA 4FXGC 1GUNA 2Y0SB 1STBA 1RTOA 3S14B 2K05A 4ZYSA 4RFBA 2AUJD 1WD0A 3RD4A 2A6HD 3A8IE 1EZ6A 3VYSA 2KQ3A 4XT1B 1EY7A 1MD2D 2PW5A 2SNSA 3NQTA 5IT9L 3FEWX 4K5XA 1HA5A 4DXGA 4G7OC 4JBWA 4MN3A 1PXUA 1ENFA 4IALA 1BDOA 3RZDB 3PIP3 4A3IB 2A73B 2DN8A 1EZ8A 1G2TA 1V43A 3SR1A 3L9AX 3BG3A 3N52A 5KYLA 1PRTD 5C3WA 1X3QA 2QF7A 1B9NA 3X3MA 2OF1A 2F0VA 5JVH3 4GZYC 1O7ZA 5C3XA 1CQVA 2RDGA 3CU7A 1QJOA 2G9HD 1SNDA 2IT1A 2J7ZA 5FLXE 3P75A 2C5CA 4R9WA 1G8ZD 1UAPA 4CGYB 1I4HA 3GTKB 2RKSA 3MVVA 1GUOA 5JVG3 2MGSA 2J4XA 1BNZA 2A6HC 5E4WC 2F0GA 5IGBA 5M5WB 4RGMA 2TSSA 4QMGA 2WACA 1TY0A 3T13A 1H9MA 3NTIA 4BA2I 3Q24A 2CW0D 4KN7C 1MI2A 5C4XB 5D3DA 1SYDA 4IUUA 5NUCA 3EROA 5I2XA 4XXEA 2AWNA 1ILQA 3NBHA 1EY5A 1PFNA 1H9KA 3BDCA 5EBCA 1KNAA 2XWBB 3E0JA 2MP1A 4TQUS 2F0KA 4BWGB 1CZWA 4XQNA 4PNYA 1A2TA 3R2IA 4BBSB 3HOWB 4ZKCB 2PYKA 1SNMA 3H3VC 2XIWA 2Z1CA 4MHEA 1G291 4V190 3BDOA 1CQFA 4RGOS 1QE6A 2K03A 5EGTA 2KOLA 3NUCA 3J7YW 3LWUA 4IFDJ 5ELFA 2F3WA 1LT5D 1HFGA 2B2WC 3GTJB 3C1FA 4ZKBB 1QWYA 1B3AA 1SSOA 3J81E 4XYQA 2PO4A 2GA4B 3U9OA 3QG1A 1SE2A 4BBRB 2VNUD 3S1NB 2E2HB 3ERQA 4F8MA 5C4HA 1JICA 2JEBI 1YNND 2LY7A 4CKEA 1R4PB 1ZYRD 4X3SA 5M5YB 2RA4A 1BQQT 1PTOH 3HRZC 4DA2A 3S9WA 4UDUC 3BYTB 5JEAG 1LV9A 1SNOA 4FP5D 3H0GB 3HS0C 5A35A 2L0CA 1S5CD 2KJXA 4UAIA 4K6DA 1QG7A 3C46A 1B9MA 1JWMD 5DAUA 1H9JA 2E2JB 1WVLA 3OIPA 3BVMA 1R4QB 3PUWA 2F1MA 1PMRA 2H1EA 3T16A 5IT9E 1LT4D 4P2CB 3K5MA 1PZJD 3GO5A 3IFDA 4RWSC 3JAML 3HZXA 3DHQA 3ONAB 1A3VA 1HXYD 1DD2A 1E0BA 1GXDC 3A55A 1F2YA 1W6KA 3IFTA 4A3BB 2N88A 3H91A 3VR3A 1TWHB 3D8GA 5KRUA 2L11A 3K6OA 4ULLA 2V4DA 5J1ZA 1SMYD 3G6JB 3IKJA 1DOKA 4U68A 1A3TA 3W3AA 3J7AV 3N6RA 3PUYA 2O5JC 1FD7D 1TT2A 4C1NK 4BY7B 5CYUA 2C9OA 1NCVA 2OXPA 1MSHA 1RF2D 3WDNA 3OWFA 3AB9A 2R6GA 1XXGA 2MJ8A 4R8IA 2F0SA 3K5LA 2SEBD 2SOBA 4NMZA 3EJIA 1U4LA 2RBMA 1GHJA 1TR5A 1H9RA 5DNFA 2HQEA 3A54A 3PO2B 3IL8A 1DYQA 5CMDA 3J80E 4HCSA 4IUQA 2E74C 5K5PA 5KNBA 3V05A 2FJ2A 4HTHA 4E6IA 3QJYA 4M1UB 3M7NA 3NWSA 1JCKB 3S16B 1I4RA 3P20A 1ONLA 2OT2A 2B2YC 2F0QA 5IGFA 1CHPD 4N9PA 2KEDA 3K58A 2B39A 5LHY1 5IGDA 3BZDB 4HEDA 5CV8A 1E2ZA 1EIGA 2A74C 1IL8A 3RZOB 1D6EC 5EJWA 3NWTA 2CHBD 5D14A 5J39A 4A3KB 3T53B 1PLFA 3GTMB 1BF4A 3MXGA 3G7LA 3U9SA 1WTOA 2Z4IA 5J22A 3OHXC 1JQYD 3RMHA 1ZYRC 1HPCA 1EWCA 2D9UA 4A3GB 1J8IA 1CTMA 4DXFA 2JEAI 1RKNA 4L63B 2XNAC 5C44B 1ICWA 1KLUD 2VB3X 5DM63 3QOJA 3S1QB 4C1NI 1IW7C 5JJZA 3C1EA 4H13C 1XX8A 1YNJD 2ID0A 1C4QA 3OIQA 3SK5A 5FO7B 3M3YB 3MEHA 4K14A 1W6JA 1PRTF 1BUVT 3ND9A 2K04A 1VMPA 5G3LD 3I8ZA 3TZDA 1HUNA 3DM1A 5ELEA 2PMZB 4C2MB 3S17B 2EPBA 5LL6X 5CV9A 4WFN3 3AMUA 2NN6H 3MTSA 1FGBD 4Z9CB 2F03A 1F9QA 1GUGA 2BDOA 4K8JA 5M5XB 1UUPA 3HP3A 4KKSA 3PIO3 2WKDA 3GQBA 2RSOA 1F9PA 1OXSC 1Y8NB 3MA2B 4RCNA 1UNSA 4F87A 1EYCA 1CI3M 2A68C 2LKVA 2F0WA 1HRJA 2M00A 2F4IA 2PCFB 2B8FA 1EOTA 2I07B 2X6LA 3NXWA 5IIFA 2D62A 2NBFA 5BN3A 1LTTD 1F9SA 5IGCA 4A3EB 1CFMA 1LTSD 4IUNA 3KLSX 1SAPA 3W2DA 2DNCA 3DMUA 3DUZA 4G7ZC 1O7LA 1ENAA 1EEFD 3VR2A 1G6ZA 4ME5A 2F0NA 1B1ZA 1LT6D 1TU2B 1F2ZA 1F9RA 2SNMA 3FVQA 1CHQD 1SNQA 2F0HA 1DJRD 1I4XA 1C48A 4WJWA 2O4XA 3T4AC 2YYZA 2XRSD 1G91A 3MAQA 2F0LA 3KBXA 3D6CA 1STAA 4KV6A 1RDPD 5CBEE 3Q23A 2WB1B 2O5IC 2EYHA 4IZ8A 2K1BA 2QILA 2F0DA 2F0FA 1DOLA 1XYIA 3GP7A 4FVMA 3VYTA 5FO9B 3C2PA 5IGGA 4X3KA 2ZXRA 4QB4A 2NZ1D 5EPKA 2PZWA 5CR3A 3K7AB 4IFDH 1NR4A 4HMJA 3PV0A 4G7HC 3R3OA 2QKIC 4KMUC 1Q1EA 1BBXC 1HTLD 5IODA 3D4WA 1PFMA 5D3IB 4NKLA 1TQOA 2R61A 1O7YA 2NWGA 2VXWA 3S1MB 1TWFB 3GTQB 2MUYA 3TZUA 2E2IB 4CKCA 3T56B 1C8CA 4QCLA 2HDLA 5CBAE 4A3JB 1LLRD 1GJXA 2I46A 4HCEA 5FO8B 4X3TA 1VF7A 3PO3B 1G2SA 5C0XJ 3A8JE 1ZKOA 2AQ3B 4HN7A 3KBGA 2XRQD 1I6HB 1TS5A 1OXTA 3M4OB 3SK8A 3VR5A 2AUKA 3RLFA 4PMWA 1Y69U 2EYJA 3MFGA 1BCPB 1MSGA 1PZKD 4ZUJA 1X32A 4EQOA 5CORA 3ND8A 4KHVA 4KI0A 4O42A 2LMCB 2K01A 1OXXK 1LT3D 4I7ZC 3SEBA 5DEHA 3EA6A 4IUVA 2B2VC 1D5ZC 1Z47A 1K83B 1T5EA 2PZUA 1AP0A 1U4MA 2NN6G 4G57A 4XIGS 2H4OA 4ZQ3A 1STEA 1TS4A 1V1OA 3ITPA 2MPMA 1V8QA 2X6GA 3NE5B 5C3EB 1XTCD 2JYOA 3TP5A 1IHZA 1EY6A 3MXUA 5CGKA 4ID6A 5BN5A 1SMYC 3BYYB 3LWEA 3R2TA 3TMEA 3IAYA 4A3FB 4FF2A 3VR6A 2B8GA 4CKBA 3KF8A 1AZPA 1AW7A 3DEPA 3OW7A 1EWHA 4C56C 1AZQA 1LTBD 3S2DB 3TDQA 1TS2A 4KY5A 3T51B 2NVQB 3BS1A 1BCPF 3QO2A 3HG9A 3E5SA 1SJED 3WOEA 1A15A 2BDNA 2EJFC 5F2DA 2E76C 2EYFA 3HKZB 3OMCA 2JA5B 5C6AA 3HOZB 3RUZA 3ZYYX 2QCPX 4DAYA 1I50B 1JWSD 3PUZA 1Y1WB 3GTGB 5K36G 3CRKC 4DNRB 2JE6I 3FPUB 1WD1A 2WP8J 2K5DA 3D4DA 2DY8A 1Y1VB 4DAVA 5C0XH 1SDFA 2JA7B 3LX0A 4ABNA 2EY2A 3A7LA 4PMBA 4OL7A 1D2BA 3QOLA 3R8BA 1AFPA 5ELBA 4OHJA 4EQNA 1TY2A 4H44C 5KYIA 2B2UC 5JPNC 2B63B 1S5ED 1RHPA 4K5WA 3TP6A 1OO9B 1SYBA 1VF5C 1I4PA 3TP8A 4XYOA 3FMCA 4FF4A 1JOOA 3SK4A 2Z8LA 4M8AA 1QCBD 3BVGA 1CZGA 1KNEA 3HOXB 4OIJA 2EYMA 1ILPA 2EYOA 4ZRZA 5C0XG 1QNKA 3V2TA 2BE5D 1LTAD 1NSNS 4HSPA 5KGUA 1R9TB 1BO0A 2RVLA 2QEJC 1EFID 4RGTA 3K59A 2HCIA 1BR9A 4DAPA 5BN4A 2KVMA 1B44D 3V96A 1HTPA 5ELDA 1O80A 1GUTA 1ET6A 4FF3A 3A56A 1V1PA 3WOFA 1SYGA 5CV6A 4IUPA 2Q8IB 4RA8A 4OO1I 4O1NA 3VA5A 1RJTA 4IURA 1PTOD 1EY4A 3C3LA 5JOBA 2HDMA 3DEOA 1MBYA 1I6VC 2FHTA 2ENBA 2J0TD 2AQ1B 3X3NA 3I4LA 4ZAIA 2IW3A 2EXZA 2KUMA 1HUMA 1JC7A 4OO1G 2BA0A 1SE3A 2M2LA 3QWNA 4B08A 3I91A 1IYUA 1PTOB 1SE4A 2D5DA 1H9SA 2EY5A 2KHSA 4N9TA 2R93B 5A2QE 1F2MA 2Q8TA 2HCCA 4F88A 4C3JB 5TSSA 4CHTB 1D1KA 2CQAA 2IJ0A 1QILA 3J80L 1SBBB 1XWEA 1HFNA 3VYUA 3GD7A 1YNNC 2WIIB 2JXMB 1STHA 4HAEA 2L12A 3SE0A 5IGEA 1EY9A 5M9OA 2EYPA 5EQ0A 4NDXA 3CKIB 5LL6S 4H7BA 2KCCA 2EYLA 4B9WA 4C3HG 2PQEA 1PRTB 1HCZA 4KHZA 4K5VA 1TIID 5CV7A 2Z4HA 1OXUA 4B9XA 1QNUA 3O13A 3M7GA 3SDZA 5JPMC 2L4NA 1QB5D 4TSSA 4KY7A 1I4GA 3P1HA 4QUCA 2YU9B 2KCNA 3EVQA 4Q5VA 1E2WA 2ZXPA 1Q12A 3KK7A 5K36H 1D5XC 2L55A 2RQXA 1D1IA 3NSWA 5C0XI 4XDXA 4OGQC 1II3A 1SFOB 1B50A 4CBVA 2IX0A 4KD3A 1IYVA 2LS01 1J9OA 2A5HA 1WTQA 2R3ZA 5EKLA 4LAAA 1EEID 3A7AB 4EQPA 2EY1A 3L7ZC 4QIWB 1M8AA 2QDBA 3P7JA 1S4ZA 5ELCA 2PPBC 2VUMB 1EY0A 1A3UA 3URYA 1SYCA 2XSCA 2WV6D 2F0TA 5FK9C 3SK6A 1Q8IA 2PNRC 3F2UA 1QOHA 3K0YA 4YIJA 4KTAA 1U4RA 4QF4A 3CQZB 1GHKA 2DNEA 3EFXD 4CJ1B 5FOBB 1K8MA 1TS3A 5EBDA 1RTNA 2NYZD 5EPJA 1WCMB 3GV6A 5JEAJ 3VR4A 3I4NB 2ICIA 2D2CC 1SNPA 5E3FA 5FLXL 1JR0D 1CK1A 1PYWD 2NTTA 2EVBA 1FNVA 4DFAA 4Y7NB 1EL0A 4NP5A 1LO5D 1STYA 4C3JG 2G9DA 3K57A 1Z6HA 3KUPA 4DF7A 2F3VA 2IX1A 1D5MC 2F0IA 2A68D 1AEXA 2NUCA 1FR3A 4RH6A 3JAME 1DOMA 1SJHD 1STNA 4IFDI 1FYCA 1EQTA 4A3DB 3FKIB 3BVZA 3J7AF 2A6ED 1WTVA 1SNCA 5T1IA 1EYDA 1LTGD 3Q6SA 3OMGA 1I4QA 2BE5C 5KNDA 2EJGC 2EJMA 1DZ1A 1SXTA 4L8JA 4IFDG 1HHVA 1NR2A 5KIXA 3L3OC 5E1FA 5A2QL 2EY6A 4XQJA 3NBIA 1JWUD 1UEAB 1SEBD 3HGBA 2M9VA 5M3FB 2WKCA 3MFYA 4KJNA 4KN4C 3Q22A 4KK7A 2BCOA 2N55A 3MHBA 4PV1C 1A2UA 3GTPB 1GOZA 5I9OA 5CV5A 1KAAA 1V1PB 3MC0B 2RDFA 4RCOA 2K28A 1ML0D 4U673 3OPOA 3OSOA 4C3IG 3MXPA 1KABA 1EY8A 4X3UA 1A6XA 4TRDA 3NHHA 4ZLTF 4IUTA 5CV4A 3DWPA 1WTRA 4L6TB 1KDAA 1S5BD 4S3SA 4K2KA 4XT3B 5JEAH 1U4PA 3VYRA 4MIUA 3E6ZX 2F0EA 1LTRD 2B2UA 3QIAA 4ILWA 3DWAA 4BA1I 1B53A 2A69C 1EU3A 2CW0C 3GTOB 2LFNA 5EKKA 4LJZC 2NN6I 1BXTA 1TWAB 2F0OA 1PZID 4F7XA 4JK1C 4KD4A 2BOSA 3GV3A 1TVXA 1Z7TA 3NK9A 1ENCA 5T1GA 2F0PA 4V0BA 1MGSA 1WTWA 5M3MB 2K7VA 3HOVB 4DNTB 5AFWA 1CA5A 2XN9C 3OWEB 2AWOA 4DK0A 1S5DD 1YNJC 3I3CA 2FMMA 1S5FD 3K5OA 3S2HB 1IW7D 2NTSA 4XTCS 2IWHA 2IX3A 3J81L 4LMQD 4K8IA 5EKIA 2RSNA 5CC4A 4CJ0B 2FFKB 3FPPA 4ZK9B 5KNCA 2X69A 4DK1A 1JORA 2DY7A 4WORA 1I3QB 5FKAC 2KEEA 3NPPA 2K33A 3NQIA 5KEEA 2SDFA 3TN2A 1M4VA 4DN4M 3VA7A 3I73A 4G4KA 1IKMA 1FNWA 3NTKA 1CT1D 1WTPA 2JA6B 2F0MA 3PMFA 5I4DA 4KKTA 1LACA 2XVSA 2TMPA 4NW2A 4IQZA 4ZUIA 3D3RA 4KJOA 1Q90A 5C4ZA 2EE1A 3M4YA 4FNFA 1SYEA 1PTOC 4OO1H 2XWJB 3S1RB 3H94A 3S15B 1E2VA 4I65A 1BCPD 1KDBA 3R93A 1JE4A 2B2VA 1DONA 2KECA 1STGA 3CHBD 3A8KE 2K6AA 2NVYB 3I4MB 1LABA 3TP7A 3EQLC 4K2LA 4OIKA 5I2YA 1Y8OB 2EZVA 3NTHA 5JAVA 2ZT9C 2F0JA 1Y8PB 3FRPB 1ZXTA 3MZ5A 1EQVA 1OXVA 2EOTA 5ISRA 4A93B 1TWGB 3PUXA 5D65A 1U9RA 2NB0A 4BS9A 2NVXB 3D31A 4J6HA 2IL8A 2ICEC 3CRLC 1LTID 4RAUC 1PFBA 4Q0FA 2JA8B 5I9PA 1VCIA 4RHRA 1PRTC 2HUGA 4HSVA 2O2LD 1Q3LA 2L5TA 2ZXOA 2K32A 1F77A 5E4XA 3UI2A 1JOQA 4FXDA 3H09A 2E2DC 4FYDA 2OEOA 3HEJA 2E75C 1H9SB 2R7ZB 1Q1BA 3DWQA 5C5MA 3D4RA 5HGTA 1HQMC 1BOSA 3GTLB 4KY6A 1DM0B 1VDZA 2R92B 3TBIB 4LK1C 4RKBA 4FF1A 2RDHA 3I70A 1ZEQX 3SVMA 4WRDA 1GUWA 4C3HB 1F2LA 5I6WA 3PUVA 3LNNA 2B2TC 2WAQB 4FO2A 1GUSA 3KLSA 1ET9A 3FDTA 1T5XD 1NAPA 1L0YB 4FXKC 2A69D 4RHSA 1B4OA 4EVOA 2PW7A 2VB2X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1B A;  2X69 A;  1CM9 A;  2EOT A;  2DY7 A;  5D14 A;  4ZAI A;  1NCV A;  1HRJ A;  1PLF A;  1MSH A;  5D65 A;  4X3U A;  1BF4 A;  3G7L A;  1VMC A;  2KUM A;  2B2U C;  1BBX C;  1HUM A;  1WTO A;  1PDQ A;  4XDX A;  1EOT A;  2KEE A;  2MJ8 A;  4ZLT F;  1MI2 A;  2FIN B;  4IUT A;  4R8I A;  1RHP A;  2MPM A;  2X6L A;  1PFM A;  1LV9 A;  2D9U A;  2X6G A;  3KUP A;  2M2L A;  3I91 A;  4IUU A;  1RTO A;  1J8I A;  2JYO A;  1B50 A;  1O7Y A;  1WTR A;  2SDF A;  3TN2 A;  2NWG A;  2IL8 A;  2K05 A;  1HA6 A;  4DN4 M;  1B2T A;  2VXW A;  1ILQ A;  1WD0 A;  2B2Y A;  4UAI A;  1QG7 A;  1F9S A;  1U4L A;  4RAU C;  1J9O A;  1ICW A;  5COY A;  1PFB A;  1DOM A;  3LWE A;  1PFN A;  4XT3 B;  1IKM A;  2Q8T A;  2HCC A;  5EPL A;  1KNE A;  1EQT A;  1U4P A;  1SAP A;  1C8C A;  1WTQ A;  1WTP A;  1EIH A;  2R3Z A;  1KNA A;  2HDL A;  4OIJ A;  5DNF A;  5CBA E;  4XT1 B;  1ILP A;  5JJZ A;  2HUG A;  2MP1 A;  4HSV A;  2B2U A;  1Q3L A;  1XX8 A;  1QNK A;  4CJ2 C;  1WTV A;  1AZP A;  3IL8 A;  4X3T A;  1WVL A;  1B53 A;  3DEP A;  1M8A A;  4MN3 A;  4NW2 A;  5T1I A;  4ZKC B;  5CMD A;  1HFN A;  1G2S A;  5E4X A;  1WTX A;  1G6Z A;  3UI2 A;  1AZQ A;  2H1E A;  3Q6S A;  4HCS A;  4IUQ A;  2XIW A;  1BO0 A;  3P7J A;  2RVL A;  4MHE A;  2JP1 A;  1S4Z A;  2EE1 A;  1F9R A;  1DZ1 A;  4HAE A;  2L12 A;  4QUF A;  2FJ2 A;  3IFD A;  1NR2 A;  4RWS C;  1G2T A;  2K04 A;  1HHV A;  3QO2 A;  1VMP A;  1QE6 A;  2K03 A;  5EQ0 A;  2KOL A;  2HCI A;  1ESR A;  3I8Z A;  1A15 A;  2BDN A;  3F2U A;  1X3P A;  3TZD A;  1HUN A;  3N52 A;  3GV3 A;  3ONA B;  1TVX A;  3DM1 A;  5T1G A;  1G91 A;  1HFG A;  1ROD A;  1CA6 A;  2KVM A;  1U4R A;  1MSG A;  2B2W C;  1E0B A;  1X3Q A;  2EPB A;  1MGS A;  4ZKB B;  1WTW A;  1X32 A;  1O80 A;  1B3A A;  1SSO A;  4CJ1 B;  3KBX A;  2B2W A;  1O7Z A;  3R93 A;  2B2Y C;  5AFW A;  1RTN A;  2N88 A;  2Q8R E;  5COR A;  1JE4 A;  2NYZ D;  3H91 A;  5EPJ A;  3MWY W;  3SVM A;  3MTS A;  1CA5 A;  1GUW A;  2B2V A;  3GV6 A;  5CBE E;  2L4N A;  2B2T A;  1F2L A;  2KED A;  1DON A;  2J7Z A;  2KEC A;  2L9H A;  4O42 A;  4R9W A;  2K1B A;  2B2T C;  2L11 A;  2N55 A;  3I3C A;  2K01 A;  2FMM A;  1F9Q A;  3HP3 A;  1JIC A;  1DOK A;  3FPU B;  4IUP A;  4U68 A;  1DOL A;  1XYI A;  4RA8 A;  4ZK9 B;  1WD1 A;  4QUC A;  3D6W A;  3FDT A;  2DY8 A;  1NAP A;  4HED A;  4IUV A;  4LMQ D;  4OIK A;  5EKI A;  2MGS A;  1RJT A;  2B2V C;  1BNZ A;  4IUR A;  4X3S A;  2RSN A;  5E4W C;  2RA4 A;  2RSO A;  4CJ0 B;  1F9P A;  2K28 A;  4X3K A;  1ML0 D;  1SDF A;  1AP0 A;  1U4M A;  2HDM A;  2NZ1 D;  3DEO A;  5EPK A;  1EL0 A;  1EIG A;  2FFK B;  1IL8 A;  1B4O A;  3I90 A;  2FHT A;  1ZXT A;  5EJW A;  1NR4 A;  1IKL A;  2CVR A; 
#chains in the Genus database with same CATH topology
 2L1B A;  1KTK A;  5HUR A;  1PTO F;  1LTL A;  1VMC A;  2DGY A;  1ESF A;  1PDQ A;  3OTO L;  2FIN B;  3M4O H;  3SHL A;  2WIN B;  4HID A;  4RKL A;  1I6H H;  1NUC A;  4L5R C;  3MXN A;  4L5S A;  4JI4 L;  2DUD A;  3GDE A;  3KOJ A;  5I6Y A;  1HA6 A;  5DM7 3;  1B2T A;  1X6O A;  4HR7 B;  1XJV A;  2B2Y A;  1HR0 Q;  5IWA Q;  1JJG A;  1CKN B;  4IPH A;  4P74 A;  5COY A;  3HOY B;  2IPK D;  5C5L A;  4ODG A;  3RR5 A;  1KLG D;  1TWC B;  4N8X 1;  5EPL A;  1DXM A;  1EIH A;  1KDC A;  4IJL A;  3H6M A;  3AU7 A;  3BDL A;  5IOC A;  1EOV A;  1RCV D;  2Q2T A;  4CJ2 C;  3Q0A A;  1IBK L;  5C4J B;  1EU4 A;  1L2F A;  2MHV A;  1RD9 D;  4XQQ A;  1WTX A;  1L0X B;  2EDG A;  2JP1 A;  1B7Y B;  1SE8 A;  1Y14 B;  4R8N A;  2CH4 A;  2K5W A;  2A8V A;  1FNU A;  2F0U A;  1VQ7 A;  4IN3 A;  2NVT B;  2ZJQ A;  1EYA A;  4TKO B;  4LF7 L;  3NP8 A;  1ESR A;  4C3I B;  3SXH A;  3TSS A;  4A3M B;  2OWO A;  1X3P A;  1JE5 A;  4PMC A;  4DPG A;  1AN8 A;  3TS2 A;  1VQH A;  4K6L A;  1O78 A;  5IP7 G;  1CA6 A;  1ROD A;  2A6E C;  3JAM c;  3DXJ C;  2K14 A;  2FMC A;  1X56 A;  2NVQ H;  2AQ2 B;  5G3L F;  2B2W A;  2K5Q A;  4IOC A;  4K0K L;  2Q8R E;  3MWY W;  1FVI A;  1DCZ A;  2DJF C;  4R4O A;  3I2Z A;  4H0L C;  1C9O A;  3M85 A;  3HOU B;  2B2T A;  5HGQ A;  2L9H A;  2Z6B A;  2Z9H A;  2JK8 A;  4KKU A;  4RGN A;  3K5N A;  4DU9 A;  4BY1 B;  2KA7 A;  1K8O A;  3T1H Q;  2PZT A;  4HMI A;  5EAY A;  4P71 A;  1BCP C;  2MO0 A;  3D6W A;  3EIV A;  4LF8 L;  4J1M A;  4EGV A;  3QB3 A;  1TKW B;  4HJA A;  1JB3 A;  1K0R A;  3GTJ H;  3K8A A;  3OOC A;  4J8Q A;  2BA1 A;  1TWF H;  2WFW A;  2JSO A;  3KLR A;  3I90 A;  3CC4 A;  4AYB B;  1IKL A;  2CVR A;  4QUF A;  1MJE A;  1CM9 A;  1SYF A;  4GNX B;  4PQX A;  1HQR D;  3I72 A;  3DM3 A;  1JOK A;  1S3O A;  3F2B A;  4DGZ A;  4FXG C;  1GUN A;  2Y0S B;  1STB A;  4B3T Q;  1RTO A;  3S14 B;  2K05 A;  4ZYS A;  4RFB A;  2AUJ D;  2QA4 A;  1WD0 A;  1P8L A;  3RD4 A;  2A6H D;  3A8I E;  4A3M H;  3CAM A;  3UDI A;  3I55 A;  2Z6K A;  4JI2 Q;  1EZ6 A;  3EN2 A;  1VQL A;  3VYS A;  2KQ3 A;  4XT1 B;  1EY7 A;  4DV6 Q;  1MD2 D;  2PW5 A;  2SNS A;  4JI5 L;  3NQT A;  5IT9 L;  3FEW X;  4K5X A;  1HA5 A;  4DXG A;  4G7O C;  4JBW A;  4MN3 A;  1PXU A;  1ENF A;  3M9B A;  4IAL A;  3HOX H;  1QVG A;  1BDO A;  3RZD B;  3PIP 3;  5IP9 G;  4A3I B;  2A73 B;  2QW7 A;  2DN8 A;  1EZ8 A;  3F2D A;  1G2T A;  4A3D H;  1V43 A;  3SR1 A;  3L9A X;  4ZCK A;  2RCN A;  3BG3 A;  3G71 A;  1CSP A;  4AH6 A;  3N52 A;  4A3G H;  5KYL A;  1PRT D;  4JI8 Q;  5C3W A;  1X3Q A;  2QF7 A;  1B9N A;  3X3M A;  2OF1 A;  2F0V A;  1NMG A;  5JVH 3;  1CSQ A;  4GZY C;  3TEH B;  1O7Z A;  5LMN W;  5C3X A;  3L0O A;  1CQV A;  2RDG A;  1X65 A;  3CU7 A;  1QJO A;  2G9H D;  2Z6K C;  1SND A;  2IT1 A;  2J7Z A;  5FLX E;  3CCE A;  3P75 A;  2C5C A;  4R9W A;  3S1N H;  4LFA Q;  1G8Z D;  1VQD A;  1Y1W H;  3UE1 A;  1UAP A;  4CGY B;  1I4H A;  3GTK B;  4LNQ A;  1WCM G;  2RKS A;  3PF5 A;  3MVV A;  1GUO A;  5JVG 3;  4DV2 Q;  1FL0 A;  2MGS A;  1X54 A;  1B8A A;  2J4X A;  2A6H C;  1BNZ A;  5E4W C;  2F0G A;  5IGB A;  3HKZ E;  4OX9 Q;  2A1A A;  2I5L X;  5M5W B;  4RGM A;  2TSS A;  4DV6 L;  1A0I A;  4QMG A;  2WAC A;  1TY0 A;  3T13 A;  1H9M A;  4CDD C;  3PCO B;  4B3S L;  3NTI A;  4A3F G;  4BA2 I;  3Q24 A;  2CW0 D;  4LUV A;  1E22 A;  4KN7 C;  1MI2 A;  4DV5 L;  5C4X B;  2HD3 A;  4YHH L;  1C0A A;  5D3D A;  1SYD A;  4OWW B;  1RL2 A;  4IUU A;  5NUC A;  3W1G A;  3ERO A;  4B3T L;  3S15 H;  5I2X A;  4XXE A;  4BY1 H;  2AWN A;  1ILQ A;  3NBH A;  5C3E G;  1EY5 A;  2ZTE A;  1M1K C;  1XPR A;  2VL6 A;  1PFN A;  4GS3 A;  1H9K A;  3BDC A;  1B70 B;  5EBC A;  1KNA A;  4A3I G;  2XWB B;  4UPA A;  3E0J A;  2MP1 A;  3PF4 A;  4MTK A;  4MTN A;  4TQU S;  2F0K A;  4BWG B;  1CZW A;  4XQN A;  4DK3 C;  1PH5 A;  4PNY A;  1A2T A;  3R2I A;  4BBS B;  3HOW B;  1G6P A;  4ZKC B;  2PYK A;  4A3C H;  1SNM A;  3H3V C;  2XIW A;  2Z1C A;  4MHE A;  1G29 1;  3BDO A;  4V19 0;  4GLV B;  1JJ2 A;  2G5D A;  4QL5 A;  1CQF A;  4RGO S;  1K3R A;  1Y1V G;  1I3Q H;  1QE6 A;  2K03 A;  5EGT A;  2KOL A;  3NUC A;  3J7Y W;  3ULP A;  3LWU A;  4IFD J;  5ELF A;  2F3W A;  1LT5 D;  1HFG A;  2B2W C;  3CP0 A;  3GTJ B;  3C1F A;  4ZKB B;  1QWY A;  3FP9 A;  1B3A A;  1SSO A;  3J81 E;  1VQO A;  1PV4 A;  1HZC A;  4XYQ A;  4BXX H;  2PO4 A;  2GA4 B;  2PQA B;  3U9O A;  4DV0 L;  2D0O A;  3QG1 A;  1WJJ A;  2B3G A;  1SE2 A;  4BBR B;  1EQR A;  2VNU D;  3S1N B;  2HT1 A;  4Y52 H;  2E2H B;  1YNX A;  3ERQ A;  4F8M A;  5C4H A;  1JIC A;  4DR1 L;  2JEB I;  4JPB W;  1YNN D;  2LY7 A;  1V1Q A;  4CKE A;  3CD6 A;  4B3M Q;  1R4P B;  1ZYR D;  4X3S A;  4DR7 L;  5M5Y B;  2AHO B;  2RA4 A;  4LF4 L;  3HKS A;  4DR4 Q;  1BQQ T;  5ELN A;  2YTY A;  1PTO H;  3HRZ C;  1A62 A;  4GOP A;  4DA2 A;  1VQG A;  3S9W A;  1PFS A;  3T1Y Q;  1QVF A;  4UDU C;  3BYT B;  3CPF A;  1LV9 A;  1SNO A;  4FP5 D;  5JEA G;  3H0G B;  4LW1 A;  1K8A C;  3CXC A;  1N33 L;  3HS0 C;  5A35 A;  2L0C A;  3G6E A;  1S5C D;  1P16 A;  1IBK Q;  5IT9 c;  2KJX A;  4UAI A;  4K6D A;  1QG7 A;  2BH8 A;  3C46 A;  1B9M A;  1JWM D;  2VQF Q;  3KF6 A;  4X62 Q;  5DAU A;  4A3L H;  1H9J A;  4DUY L;  2LSS A;  2E2J B;  1VQC A;  3ER0 A;  2ALY B;  1YIJ A;  1WVL A;  3OIP A;  3BVM A;  1R4Q B;  3PUW A;  2OCE A;  2YTX A;  2F1M A;  1PMR A;  2H1E A;  4JI8 L;  3T16 A;  5IT9 E;  1K83 H;  1LT4 D;  4P2C B;  3K5M A;  1PZJ D;  4JI6 L;  2YU9 H;  4JI1 L;  3GO5 A;  3IFD A;  4RWS C;  1Q81 C;  5IYB H;  1ICF B;  3JAM L;  3HZX A;  3DHQ A;  3ONA B;  5JJL A;  4LF4 Q;  4X64 Q;  1A3V A;  3DLL A;  4DR6 Q;  1HXY D;  1DD2 A;  4DR7 Q;  1E0B A;  1GXD C;  2EXD A;  3A55 A;  1LUZ A;  1F2Y A;  1W6K A;  4A3I H;  3IFT A;  4A3B B;  2N88 A;  3A5U A;  3H91 A;  3CCM A;  3VR3 A;  1TWH B;  3D8G A;  3A5Z B;  5KRU A;  4LF9 L;  3CCU A;  2L11 A;  3K6O A;  4ULL A;  2V4D A;  5J1Z A;  1SMY D;  3G6J B;  2Q2I A;  4A3C G;  2UUB Q;  3IKJ A;  1DOK A;  4U68 A;  2CH4 W;  4GNX A;  4RG1 A;  1A3T A;  3W3A A;  3J7A V;  3S1Q H;  3N6R A;  4DR2 L;  1VQ9 A;  2YV5 A;  5M5X H;  4DR6 L;  2VY3 A;  3PUY A;  3SGI A;  2O5J C;  1FD7 D;  1PYB A;  3JC6 6;  3UDX A;  1TT2 A;  4C1N K;  4UP7 A;  4BY7 B;  1B3Q A;  5CYU A;  1RIP A;  4JOI C;  2C9O A;  1NCV A;  2OXP A;  1MSH A;  1RF2 D;  4JI1 Q;  3WDN A;  3OWF A;  3AB9 A;  4A3J G;  2R6G A;  1XXG A;  2MJ8 A;  4R8I A;  1YJ9 A;  2F0S A;  3K5L A;  2SEB D;  5M3M H;  3AFP A;  4HJ5 A;  2PNH A;  2SOB A;  4A3K H;  1ASY A;  4WJ3 M;  4NMZ A;  3I4O A;  3EJI A;  2I5M X;  4NXM Q;  1U4L A;  1VQ6 A;  4DNI A;  2RBM A;  4EQ5 A;  3ICE A;  1GHJ A;  1TR5 A;  1H9R A;  5E7N A;  5DNF A;  2IHE A;  2E2J H;  4A3J H;  2HQE A;  1AE3 A;  2N49 A;  3A54 A;  3PO2 B;  3IL8 A;  1X3G A;  1DYQ A;  2CQO A;  5CMD A;  3J80 E;  4DV3 Q;  4YHH Q;  4HCS A;  4IUQ A;  2E74 C;  5K5P A;  5KNB A;  5GAE C;  3UDG A;  3V05 A;  4JOI A;  3B6Y A;  2FJ2 A;  4HTH A;  2UU9 Q;  4E6I A;  4A93 H;  3CCQ A;  4LWC A;  3QJY A;  4M1U B;  4R4T A;  5IYD G;  1WOC A;  1PVO A;  3M7N A;  2Z0S A;  3NWS A;  1JCK B;  3S16 B;  1I4R A;  2GVA A;  3P20 A;  4A3M G;  1VQP A;  3FHW A;  1ONL A;  2OT2 A;  1CKO A;  3F2C A;  2B2Y C;  2F0Q A;  5IGF A;  4DR1 Q;  1CHP D;  3I4M H;  4N9P A;  1JB7 A;  2KED A;  3K58 A;  3KF6 B;  4KHP Q;  4A3E G;  1IBM Q;  4DR5 L;  3CC7 A;  2B39 A;  5LHY 1;  1XNQ L;  5IGD A;  1PHJ A;  2B63 G;  3BZD B;  1YHA A;  4HED A;  4A3F H;  4ME3 A;  5IYB G;  4A3K G;  5CV8 A;  4A3D G;  3I4M G;  1E2Z A;  1EIG A;  2A74 C;  3HOY G;  1IL8 A;  1O7I A;  3RZO B;  1D6E C;  5EJW A;  4C2M H;  1I50 H;  3S17 H;  3NWT A;  2CHB D;  5D14 A;  4KLK A;  2R7Z H;  5J39 A;  4A3K B;  3T53 B;  1PLF A;  3GTM B;  1BF4 A;  3MXG A;  3G7L A;  3U9S A;  5FJ8 G;  5LMU Q;  3A74 A;  1WTO A;  2HIV A;  2Z4I A;  5J22 A;  1DGS A;  3OHX C;  1JQY D;  3RMH A;  1ZYR C;  1HPC A;  1EWC A;  2D9U A;  4A3G B;  2JA5 H;  1J8I A;  3A0J A;  1CTM A;  3PQI A;  4DXF A;  2XGT A;  1R9T H;  2JEA I;  1RKN A;  2XTI A;  4L63 B;  1VQA A;  1PH3 A;  2XNA C;  5C44 B;  1ICW A;  1KLU D;  2VB3 X;  5DM6 3;  1VQN A;  3QOJ A;  4L5Q A;  3S1Q B;  1KD1 C;  4C1N I;  5L37 A;  1IW7 C;  3M3Y H;  5JJZ A;  3C1E A;  2N8N A;  4H13 C;  1XX8 A;  1YNJ D;  2ID0 A;  1C4Q A;  1PYS B;  1SR3 A;  3OIQ A;  3SK5 A;  2UUC L;  1VQ4 A;  4JI3 Q;  2KCT A;  2PI2 E;  5FO7 B;  2IY5 B;  3M3Y B;  1E1O A;  1GO3 E;  3MEH A;  3CMA A;  4K14 A;  2AMC B;  1W6J A;  1PRT F;  3J81 i;  1BUV T;  3ND9 A;  4NB3 A;  4LUZ A;  2K04 A;  1A63 A;  1VMP A;  5G3L D;  3I8Z A;  3TZD A;  1HUN A;  1GVP A;  3DM1 A;  5ELE A;  2PMZ B;  4C2M B;  3S17 B;  2EPB A;  5LL6 X;  5CV9 A;  1FJG L;  3HOZ H;  4GKK L;  4JI7 Q;  3K81 C;  3MEF A;  4WFN 3;  5M5W H;  4LF8 Q;  4NPS A;  3AMU A;  2L15 A;  2NN6 H;  3MTS A;  3S2H H;  4DUY Q;  1FGB D;  3PIO A;  4Z9C B;  3AQQ A;  3HFZ B;  2F03 A;  4R4C A;  4B3R Q;  1F9Q A;  1GUG A;  2BDO A;  4K8J A;  5M5X B;  2ASB A;  1UUP A;  3HP3 A;  2UUA Q;  4KKS A;  3G48 A;  3BZK A;  3TQY A;  3CCS A;  3PIO 3;  2WKD A;  3GQB A;  1XMQ L;  2RSO A;  1F9P A;  1OXS C;  1Y8N B;  3J7A 5;  1BKB A;  3MA2 B;  4RCN A;  1UNS A;  1XNR Q;  4F87 A;  4X6A H;  1EYC A;  1CI3 M;  2A68 C;  2LKV A;  2F0W A;  3TRE A;  4CDC C;  5AJ3 Q;  1HRJ A;  2M00 A;  2F4I A;  2PCF B;  1PH4 A;  4QQB X;  4JC0 A;  1QVC A;  2B8F A;  1EOT A;  2E8G A;  2I07 B;  3W5O A;  2X6L A;  1K28 A;  3NXW A;  5IIF A;  2D62 A;  2RCF A;  2NBF A;  5BN3 A;  1LTT D;  1F9S A;  3OW2 A;  5IGC A;  4A3E B;  4A3B G;  1CFM A;  4IUN A;  1LTS D;  3KLS X;  4RMF A;  1SAP A;  3W2D A;  1YIT A;  1VQF A;  3PGZ A;  2DNC A;  1IYJ B;  3DMU A;  3DUZ A;  1K8G A;  1NE3 A;  4G7Z C;  1NY4 A;  1VQ5 A;  2ZM6 Q;  1O7L A;  1ENA A;  1EEF D;  1N34 Q;  3VR2 A;  1G6Z A;  4ME5 A;  2F0N A;  1B1Z A;  1HNW Q;  1LT6 D;  1TU2 B;  3M4P A;  1U5K A;  3OTO Q;  4R4I A;  1CKN A;  1NJI C;  1F2Z A;  1F9R A;  2SNM A;  3FVQ A;  3HOV G;  4PZ6 A;  4OXP A;  1CHQ D;  3J80 i;  1SNQ A;  2F0H A;  1DJR D;  5FLM G;  1I4X A;  1C48 A;  4WJW A;  2O4X A;  1HNZ Q;  3T4A C;  2YYZ A;  2XRS D;  1G91 A;  1IBL L;  4YCV A;  3MAQ A;  2F3I A;  3E0E A;  1E1T A;  2F0L A;  2JJQ A;  2JA9 A;  3KBX A;  3D6C A;  3RZD H;  1STA A;  4DV1 L;  1Q7Y C;  3PIP A;  4KV6 A;  1RDP D;  5CBE E;  3Q23 A;  2WB1 B;  2O5I C;  2EYH A;  2HIX A;  1NNX A;  4IZ8 A;  2K1B A;  2QIL A;  4IPC A;  3U50 C;  5IYD H;  4AYB G;  2F0D A;  2F0F A;  1DOL A;  2K50 A;  2RHS B;  1XYI A;  3GP7 A;  1CKM A;  4FVM A;  3VYT A;  5FO9 B;  3CCL A;  3C2P A;  3E3X A;  5IGG A;  4X3K A;  2ZXR A;  4QB4 A;  2NZ1 D;  1MJC A;  5EPK A;  2PZW A;  5CR3 A;  3K7A B;  4BBR H;  4IFD H;  1NR4 A;  2UUB L;  4HIM A;  4HMJ A;  3PV0 A;  4G7H C;  3R3O A;  2QKI C;  4KMU C;  1Q1E A;  1EUJ A;  1V9P A;  1BBX C;  5C4X H;  1HTL D;  5IOD A;  3D4W A;  1OTC A;  4L5T A;  1PFM A;  5D3I B;  4NKL A;  1TQO A;  2R61 A;  4GLA C;  1O7Y A;  1YJN A;  2NWG A;  2JA7 G;  2VXW A;  3E9H A;  3H0G G;  3S1M B;  4BBR G;  1TWF B;  1BBW A;  3GTQ B;  2MUY A;  3TZU A;  3PO3 H;  2E2I B;  4CKC A;  4DR3 L;  4JCV E;  5LMN Q;  3T56 B;  1C8C A;  2ZTC A;  2HDL A;  4QCL A;  1BBU A;  5CBA E;  4A3J B;  1H95 A;  1LLR D;  1GJX A;  1W3S A;  3CPW A;  2I46 A;  4HCE A;  5FO8 B;  2R93 G;  4X3T A;  1VF7 A;  3PO3 B;  1XTD A;  1G2S A;  5C0X J;  1N34 L;  3A8J E;  1ZKO A;  2AQ3 B;  4AYB E;  4HN7 A;  3KBG A;  2XRQ D;  1AH9 A;  1J6Q A;  1I6H B;  2KHJ A;  1TS5 A;  1OXT A;  1IBM L;  3M4O B;  4JYA L;  2N78 A;  1HZA A;  5M3M G;  3SK8 A;  3VR5 A;  2AUK A;  3RLF A;  3QR8 A;  2JA7 H;  2R93 H;  4PMW A;  1QUQ B;  1Y69 U;  1KRS A;  2EYJ A;  2ES2 A;  3MFG A;  1BCP B;  3BZC A;  1MSG A;  1YJW A;  1PZK D;  4ZUJ A;  3ULJ A;  1X32 A;  4AIM A;  3T1Y L;  4EQO A;  5COR A;  4BXX G;  3ND8 A;  4KHV A;  3K0X A;  1NMF A;  4GN5 A;  4KI0 A;  4O42 A;  2LMC B;  2K01 A;  4YWK A;  1OXX K;  1LT3 D;  1GD7 A;  4X66 Q;  1J5E Q;  4I7Z C;  3SEB A;  1XMQ Q;  5DEH A;  3EA6 A;  4IUV A;  4DV3 L;  2B2V C;  1D5Z C;  1Z47 A;  1K83 B;  2E5L L;  1T5E A;  2PZU A;  1AP0 A;  1U4M A;  2NN6 G;  2UXD Q;  4H02 A;  1XPO A;  4FDB A;  4G57 A;  1LM0 A;  4XIG S;  2H4O A;  4ZQ3 A;  5LMN L;  1STE A;  1TS4 A;  1V1O A;  5M3F H;  1YVC A;  3ITP A;  3AFQ A;  4OEL B;  2E2I H;  4HJ8 A;  2MPM A;  1NTG A;  1V8Q A;  2X6G A;  3NE5 B;  5C3E B;  4GKK Q;  1XTC D;  2JYO A;  3TP5 A;  1HNX L;  1IHZ A;  1EY6 A;  3J7Z C;  1Q8K A;  3MXU A;  3RZO H;  5CGK A;  4ID6 A;  3HOW H;  5BN5 A;  3CW2 C;  1SMY C;  3BYY B;  3LWE A;  3TS0 A;  3R2T A;  3TME A;  3IAY A;  4A3F B;  5FJ8 H;  5JJI A;  4FF2 A;  4OEM B;  2PQA A;  3VR6 A;  2B8G A;  4CKB A;  1X3E A;  3KF8 A;  1AZP A;  1AW7 A;  4A93 G;  1HNW L;  3DEP A;  3OW7 A;  1EWH A;  4C56 C;  1SFO H;  1AZQ A;  1LTB D;  4A4I A;  3S2D B;  2OTL A;  3TDQ A;  1TS2 A;  4KY5 A;  3T51 B;  5M3F G;  2F52 A;  1EYG A;  2NVQ B;  3BS1 A;  3HOZ G;  1BCP F;  3QO2 A;  3HG9 A;  2H5X A;  3E5S A;  3STB C;  2JA5 G;  3HKZ G;  1SJE D;  4X65 Q;  3WOE A;  2KHI A;  1A15 A;  1HJP A;  2BDN A;  3GTL H;  3S14 H;  2CWP A;  2EJF C;  1U0L A;  1WI5 A;  4JVZ A;  5F2D A;  2NVT H;  1XPU A;  2QGQ A;  2E76 C;  2EYF A;  3HKZ B;  3OMC A;  2JA5 B;  5C6A A;  4IO9 A;  3HOZ B;  3RUZ A;  3ZYY X;  1IBL Q;  1PH8 A;  2UXB L;  1IL2 A;  4AQY Q;  1YI2 A;  4LF5 Q;  5C44 G;  2QCP X;  4DAY A;  1I50 B;  1HNZ L;  1JWS D;  1VQB A;  5AJ3 L;  2PMZ E;  4DK6 C;  4JYA Q;  1G51 A;  2K4K A;  2I0Q A;  1CUK A;  1E24 A;  3PUZ A;  1Y1W B;  3GTG B;  1AE2 A;  3CRK C;  4J15 A;  4DNR B;  5K36 G;  2JE6 I;  3FPU B;  1WD1 A;  2WP8 J;  2K5D A;  2K5N A;  3D4D A;  2DY8 A;  1Y1V B;  1VS0 A;  1TWC H;  4DAV A;  1K3B C;  2F4V L;  2ZM6 L;  4JV5 L;  5C0X H;  2IHF A;  5IP9 H;  2RF4 A;  1SDF A;  3Q8D A;  2JA7 B;  3LX0 A;  4BBS H;  4JBM A;  4ABN A;  2EY2 A;  3A7L A;  4PMB A;  4OL7 A;  4DR5 Q;  3QOL A;  3R8B A;  1D2B A;  1AFP A;  5ELB A;  4OHJ A;  4EQN A;  1TY2 A;  4H44 C;  5KYI A;  2B2U C;  3CME A;  5JPN C;  2B63 B;  1K0S A;  1S5E D;  1TXY A;  1Z9F A;  1RHP A;  3NEN A;  4K5W A;  3TP6 A;  1TWG H;  1OO9 B;  1L1O A;  1SYB A;  4JI7 L;  1Q82 C;  1VF5 C;  1I4P A;  3TP8 A;  4XYO A;  4C3I H;  4JI0 Q;  3FMC A;  2QDL A;  1JOO A;  3SK4 A;  4FF4 A;  1T9H A;  2Z8L A;  4OON A;  4M8A A;  1QCB D;  2P5Z X;  3BVG A;  1CZG A;  2Y0S E;  1KNE A;  3K80 C;  2JQO A;  3HOX B;  1HZ9 A;  4OIJ A;  2EYM A;  3KDF A;  1I5F A;  1ILP A;  2EYO A;  3GTQ H;  4ZRZ A;  5C0X G;  1QNK A;  2DJG C;  3S1M H;  3PO2 H;  3V2T A;  2YTV A;  3NEL A;  2BE5 D;  2D0P A;  1LTA D;  1NSN S;  4HSP A;  1IXR A;  5KGU A;  2A19 A;  1R9T B;  1BO0 A;  2RVL A;  2QEJ C;  4LF6 L;  1EFI D;  4RGT A;  3K59 A;  5H1S E;  4B3R L;  4JBJ A;  1YHQ A;  4HIO A;  3U4V A;  2HCI A;  1BR9 A;  4DV0 Q;  4DAP A;  1JT8 A;  3HOU G;  4YCU A;  5BN4 A;  2KVM A;  1B44 D;  3V96 A;  1SMX A;  1YZ6 A;  1HTP A;  5C3E H;  5ELD A;  1O80 A;  2K5H A;  5J3B A;  1GUT A;  1ET6 A;  1K73 C;  1N8R C;  4FF3 A;  5LMU L;  3A56 A;  4YY3 L;  1V1P A;  3WOF A;  4YY3 Q;  1SYG A;  5CV6 A;  1ASZ A;  4EX5 A;  4IUP A;  2Q8I B;  5IE8 A;  4RA8 A;  4K0K Q;  4OO1 I;  4O1N A;  3BU2 A;  2Y0S G;  1HNX Q;  3VA5 A;  1RJT A;  4IUR A;  4POF A;  1PTO D;  1EY4 A;  3C3L A;  5JOB A;  4DAM A;  2HDM A;  2RHQ B;  3DEO A;  1XNQ Q;  1MBY A;  1I6V C;  4X66 L;  2FHT A;  2ENB A;  3IRB A;  2J0T D;  1PH1 A;  2AQ1 B;  2LXJ A;  3X3N A;  3I4L A;  1PH9 A;  4ZAI A;  4KHP L;  2IW3 A;  2EXZ A;  2KUM A;  3BJU A;  1HUM A;  1JC7 A;  3CCV A;  4OO1 G;  2BA0 A;  1MIU A;  1KXL A;  1SE3 A;  2M2L A;  3QWN A;  4B08 A;  3I91 A;  4POG A;  1IYU A;  1PTO B;  1SE4 A;  1WYD A;  3JAM i;  2D5D A;  1H9S A;  1PH2 A;  2UXC L;  4QY7 A;  2EY5 A;  2KHS A;  4N9T A;  3GTG H;  4BY1 G;  1J5E L;  2R93 B;  5A2Q E;  4DV4 L;  1KRT A;  1F2M A;  2Q8T A;  2HCC A;  4F88 A;  3CCR A;  4A76 A;  4C3J B;  2MFI A;  5TSS A;  4CHT B;  1D1K A;  2CQA A;  2IJ0 A;  1QIL A;  3U4Z A;  1HR0 L;  2NVY H;  3J80 L;  1SBB B;  1XWE A;  1HFN A;  4GN4 B;  3VYU A;  3ULL A;  1PH7 A;  4TVA B;  3GD7 A;  1YNN C;  2WII B;  2JXM B;  3I7F A;  1STH A;  4HAE A;  2L12 A;  3SE0 A;  5IGE A;  1EY9 A;  1GKH A;  5M9O A;  2EYP A;  3KJP A;  5EQ0 A;  3KJO A;  4NDX A;  3CKI B;  5LL6 S;  4DR3 Q;  4GLX A;  4H7B A;  2KCC A;  2EYL A;  4OWT B;  4B9W A;  4NXM L;  2WAQ E;  3STB D;  4C3H G;  2PQE A;  1HZB A;  1PRT B;  1HCZ A;  4KHZ A;  4K5V A;  1TII D;  5CV7 A;  3RN5 A;  4DUZ L;  2Z4H A;  1OXU A;  4B9X A;  1QNU A;  3O13 A;  3RNU A;  4LUO A;  3CC2 A;  3CCJ A;  3M7G A;  3WWV A;  3SDZ A;  5JPM C;  3GTP H;  1KL9 A;  2HQL A;  2L4N A;  5IP7 H;  1QB5 D;  4TSS A;  2UU9 L;  2I5H A;  4KY7 A;  1I4G A;  4GNX C;  1IZ6 A;  1SRO A;  4DV4 Q;  5M5Y H;  2EQS A;  3P1H A;  4QUC A;  2YU9 B;  3VDY A;  2NVX H;  1N9W A;  2KCN A;  3EVQ A;  4QJF A;  1X3F A;  2KBN A;  4Q5V A;  1VQI A;  1E2W A;  4JI5 Q;  5C44 H;  1Y1W G;  1W2B A;  2ZXP A;  5BR8 Q;  1Q12 A;  3KK7 A;  2R92 H;  4LFB L;  2VQE Q;  4LFB Q;  5K36 H;  1D5X C;  2JA8 G;  2L55 A;  2RQX A;  1D1I A;  3NSW A;  5C0X I;  3FKI G;  4XDX A;  2GN5 A;  4UP9 A;  4OGQ C;  4A75 A;  1II3 A;  1SFO B;  1B50 A;  1S40 A;  4GOP B;  4CBV A;  1XMO L;  2IX0 A;  4BBS G;  2WAQ G;  4LFC L;  4KD3 A;  1IYV A;  2LS0 1;  1SLJ A;  1J9O A;  2A5H A;  3I56 A;  1WTQ A;  2R3Z A;  5EKL A;  3FKI H;  4LAA A;  1EEI D;  3A7A B;  4EQP A;  4GOP C;  2EY1 A;  4LFC Q;  4BY7 H;  3L7Z C;  4QIW B;  3S24 A;  1M8A A;  2R92 G;  2QDB A;  1KAW A;  3P7J A;  1S4Z A;  5ELC A;  2PPB C;  2MO1 A;  2VUM B;  1EY0 A;  1A3U A;  1KQS A;  3GTM H;  3URY A;  1SYC A;  2XSC A;  1FGU A;  2WV6 D;  4DKA C;  2F0T A;  3KDF B;  5FK9 C;  3SK6 A;  1Q8I A;  2PNR C;  1PH6 A;  1VQ8 A;  3F2U A;  1QOH A;  3H3V H;  4I7A A;  4LF6 Q;  3S16 H;  1QZH A;  3K0Y A;  3H3V I;  4YIJ A;  4KTA A;  1JMC A;  1U4R A;  4QF4 A;  3CQZ B;  1GHK A;  2DNE A;  1N33 Q;  3EFX D;  4CJ1 B;  2PI2 A;  5FOB B;  1K8M A;  1TS3 A;  5EBD A;  1RTN A;  2NYZ D;  5EPJ A;  2B63 H;  1WCM B;  3GV6 A;  4LF7 Q;  5JEA J;  3VR4 A;  3I4N B;  2ICI A;  4MNO A;  2D2C C;  1SNP A;  5E3F A;  5FLX L;  1JR0 D;  1CK1 A;  2NZO A;  1PYW D;  2NTT A;  2EVB A;  3E9I A;  1Q86 C;  2R7Z G;  1FNV A;  4P72 A;  1KHI A;  3HOX G;  4DFA A;  4Y7N B;  1EL0 A;  3KF8 B;  4NP5 A;  4X62 L;  1LO5 D;  4LFA L;  1STY A;  3RLN A;  3LGJ A;  1VQE A;  1S72 A;  3KLW A;  4C3J G;  3J81 c;  2G9D A;  4P75 A;  4APV A;  3K57 A;  4A3G G;  1Z6H A;  3KUP A;  4DF7 A;  3G4S A;  2F4V Q;  2F3V A;  2IX1 A;  1D5M C;  2OTJ A;  2F0I A;  2A68 D;  2R7F A;  1AEX A;  2NUC A;  1UE7 A;  1FR3 A;  2UUA L;  4RH6 A;  3JAM E;  1DOM A;  1SJH D;  1STN A;  4IFD I;  1FYC A;  1EQT A;  4A3D B;  2VUM G;  1L0W A;  3FKI B;  3BVZ A;  3HOV H;  2CKZ B;  3J7A F;  2A6E D;  2FXQ A;  1WTV A;  1SNC A;  4IJH A;  2K75 A;  5T1I A;  1K9M C;  4B3M L;  3I4N H;  1EIF A;  1EYD A;  1LTG D;  2MNA A;  3Q6S A;  3CF5 A;  3OMG A;  1EIY B;  1I4Q A;  4JW0 A;  2BE5 C;  4DV7 L;  5KND A;  2EJG C;  2EJM A;  1DZ1 A;  5GAD C;  1SXT A;  4L8J A;  4OWX B;  4IFD G;  5ELO A;  1HHV A;  1NR2 A;  3CQZ H;  5KIX A;  3L3O C;  2E2H H;  5E1F A;  4R1J A;  5A2Q L;  3GTO H;  2MQH A;  4R4Q A;  5BR8 L;  2EY6 A;  4XQJ A;  4DV7 Q;  3NBI A;  4PZ7 A;  1JWU D;  2HHH Q;  1UEA B;  4HJ9 A;  1SEB D;  3HGB A;  2M9V A;  4UP8 A;  4DV5 Q;  5M3F B;  2WKC A;  3H15 A;  3MFY A;  4KJN A;  4KN4 C;  2Q2U A;  3Q22 A;  4KK7 A;  2BCO A;  3PO3 G;  4YCW A;  2N55 A;  4N8F A;  1BVS A;  3MHB A;  4PV1 C;  4GKJ Q;  4CDF C;  3U58 A;  2VW9 A;  4MZ9 A;  1A2U A;  3GTP B;  2OQK A;  1GOZ A;  5I9O A;  5CV5 A;  1KAA A;  4DV2 L;  1V1P B;  3MC0 B;  2RDF A;  2C35 B;  4RCO A;  3KFU A;  2K28 A;  1ML0 D;  4U67 3;  2EIF A;  3OPO A;  5DLQ E;  3OSO A;  3HOU H;  2KEN A;  4C3I G;  3MXP A;  1KAB A;  1EY8 A;  4X3U A;  1A6X A;  4TRD A;  2UXD L;  3NHH A;  4ZLT F;  4A3B H;  4IUT A;  5CV4 A;  3W1B A;  5GAG C;  1EQQ A;  3MXN B;  3DWP A;  1WTR A;  4L6T B;  3ZJY C;  1NBW A;  1KIX A;  2CCZ A;  1KDA A;  1S5B D;  4S3S A;  3PO2 G;  4K2K A;  1VQK A;  4XT3 B;  4HJ7 A;  5JEA H;  1U4P A;  3VYR A;  4MIU A;  1XNR L;  3E6Z X;  3J80 c;  2F0E A;  1LTR D;  1UWV A;  2B2U A;  1UE6 A;  4DR4 L;  4AQY L;  3QIA A;  4ILW A;  3DWA A;  1N36 L;  3F1Z A;  5C4J H;  4BA1 I;  1B53 A;  1GM5 A;  2A69 C;  1EU3 A;  2Q2H A;  2CW0 C;  3GTO B;  1N36 Q;  2LFN A;  5EKK A;  4LJZ C;  2NN6 I;  4UHV A;  3HOY H;  1BXT A;  1TWA B;  2F0O A;  1PZI D;  3PSI A;  1YBY A;  4JI2 L;  4QGU A;  4F7X A;  4WJ4 A;  4JK1 C;  4KD4 A;  3K7A H;  2BOS A;  4BY7 G;  3GV3 A;  1TVX A;  1Z7T A;  3NK9 A;  1ENC A;  4P73 A;  1HH2 P;  5T1G A;  4JV5 Q;  2F0P A;  3EBE A;  4V0B A;  1MGS A;  2ATW A;  1WTW A;  5M3M B;  2K7V A;  1UE5 A;  4DNT B;  3AYH B;  5AFW A;  2VUM H;  3K7U C;  3HOV B;  3UDF A;  1CA5 A;  2XN9 C;  3AEV A;  3OWE B;  2AWO A;  4DK0 A;  3HOW G;  1S5D D;  1YNJ C;  4A3L G;  3I3C A;  2FMM A;  1LYL A;  1S5F D;  3K5O A;  1KC8 C;  1A8V A;  1IW7 D;  2NTS A;  3F8T A;  3S2H B;  4LF5 L;  2WB1 E;  2V1C C;  4XTC S;  1XMO Q;  2IWH A;  2UXB Q;  5GQO A;  2IX3 A;  3J81 L;  4LMQ D;  4K8I A;  5EKI A;  2JA8 H;  2RSN A;  5CC4 A;  2NZH A;  2HHH L;  4CJ0 B;  3RLO A;  3ERS X;  2FFK B;  3FPP A;  4X65 L;  4ZK9 B;  5KNC A;  4C3H H;  1Q46 A;  4GKJ L;  2X69 A;  1WCM H;  4DK1 A;  1JOR A;  2DY7 A;  4WOR A;  1I3Q B;  4LF9 Q;  5FKA C;  4YWL A;  1UEB A;  2KEE A;  1MHW C;  1TWA H;  1PA6 A;  1M90 C;  3J81 j;  1VQM A;  4YWM A;  2E5L Q;  3NPP A;  1QZG A;  2GVB A;  2K33 A;  3NQI A;  5KEE A;  2SDF A;  3TN2 A;  2UUC Q;  1M4V A;  4GN3 B;  4DN4 M;  1E3P A;  4O0A A;  3VA7 A;  3I73 A;  1I94 L;  4G4K A;  1IKM A;  4B3S Q;  1FNW A;  3NTK A;  2N3S A;  1CT1 D;  1WTP A;  3D0F A;  2JA6 B;  2F0M A;  3PMF A;  5I4D A;  5IY0 A;  5JJK A;  4KKT A;  1LAC A;  4DV1 Q;  2XVS A;  1MKH A;  2TMP A;  4JI0 L;  1SN8 A;  4NW2 A;  2ZJR A;  4OX9 L;  4DUZ Q;  4IQZ A;  4ZUI A;  3D3R A;  4KJO A;  3KYH C;  4X64 L;  1WFQ A;  1Q90 A;  2EE1 A;  3M4Y A;  2WB1 G;  5C4Z A;  4FNF A;  1SYE A;  1PTO C;  4DAY B;  4OO1 H;  4O2D A;  2XWJ B;  1E7Z A;  3M4Q A;  2VQF L;  2B29 A;  3S1R B;  3H94 A;  5IYC H;  4PZ8 A;  3S15 B;  1E2V A;  4I65 A;  1BCP D;  1Y1V H;  3H0G H;  1KDB A;  4IOA A;  3R93 A;  1JE4 A;  1VQJ A;  2B2V A;  1DON A;  2KEC A;  1STG A;  3CHB D;  3A8K E;  2K6A A;  4UY8 C;  1N32 L;  2NVY B;  3I4M B;  2VZA A;  1YHB A;  1LAB A;  3TP7 A;  4NXN L;  3UE0 A;  3EQL C;  2UXC Q;  4K2L A;  5FLX c;  4OIK A;  4C3J H;  1L1O B;  5I2Y A;  1Y8O B;  4A3E H;  2EZV A;  3NTH A;  3NBH B;  5JAV A;  2ZJP A;  2ZT9 C;  4NXN Q;  2F0J A;  5GAH C;  1Y8P B;  3FRP B;  1ZXT A;  1EFW A;  3MZ5 A;  1EQV A;  1OXV A;  1N32 Q;  2EOT A;  5ISR A;  4A93 B;  1TWG B;  3PUX A;  5D65 A;  1JJC B;  1U9R A;  4JBK A;  1L1O C;  5IWA L;  2NB0 A;  4BS9 A;  5C4X G;  3S2D H;  2NVX B;  3D31 A;  4JI4 Q;  4J6H A;  2IL8 A;  2ICE C;  4QIW E;  3CRL C;  3S1R H;  1LTI D;  4RAU C;  2QEX A;  1EWI A;  1PFB A;  5GRO A;  1TWH H;  4Q0F A;  3I4N G;  2JA8 B;  5I9P A;  1VCI A;  2LXK A;  1SRU A;  4RHR A;  4ALP A;  4JG2 A;  1PRT C;  2HUG A;  4HSV A;  1D8L A;  2O2L D;  1Q3L A;  2L5T A;  2ZXO A;  2VS1 A;  1YEZ A;  2K32 A;  5IYC G;  4DR2 Q;  3OYY A;  1FJG Q;  1F77 A;  5E4X A;  1X55 A;  3UI2 A;  4CDE C;  2JA6 H;  1JOQ A;  2OQ0 A;  4FXD A;  2CWA A;  3H09 A;  2E2D C;  3T1H L;  3L2P A;  4FYD A;  2OEO A;  3HEJ A;  2E75 C;  4IPD A;  1H9S B;  2CFM A;  2R7Z B;  1UE1 A;  1Q1B A;  3DWQ A;  2KCM A;  5C5M A;  2BH2 A;  4HIK A;  3D4R A;  1I94 Q;  5HGT A;  1HQM C;  1BOS A;  3GTL B;  5HY6 A;  4KY6 A;  1X9N A;  1DM0 B;  2K5V A;  4PG3 A;  1VDZ A;  2JN4 A;  2R92 B;  3TBI B;  3RN2 A;  2JA6 G;  3TRZ A;  2R7D A;  5FLM H;  4JI3 L;  4LK1 C;  4Y7N H;  4RKB A;  2RDH A;  3I70 A;  4FF1 A;  1ZEQ X;  1QUQ A;  3SVM A;  4WRD A;  1GUW A;  4IPG A;  4C3H B;  1F2L A;  5I6W A;  3PUV A;  2AKW B;  3LNN A;  1HR0 W;  2VQE L;  2B2T C;  2K52 A;  2WAQ B;  4JI6 Q;  4FO2 A;  1D7Q A;  1GUS A;  3KLS A;  1ET9 A;  3FDT A;  1T5X D;  1NAP A;  1L0Y B;  4FXK C;  2ZTD A;  2A69 D;  4RHS A;  1C7Y A;  1WTH A;  3GTK H;  1B4O A;  3NEM A;  4EVO A;  2PW7 A;  2VB2 X; 
#chains in the Genus database with same CATH homology
 2L1B A;  1KTK A;  5HUR A;  1PTO F;  1VMC A;  1ESF A;  1PDQ A;  2FIN B;  3SHL A;  2WIN B;  4RKL A;  1NUC A;  3MXN A;  1HA6 A;  5I6Y A;  5DM7 3;  1B2T A;  4HR7 B;  2B2Y A;  5COY A;  3HOY B;  2IPK D;  5C5L A;  4ODG A;  1KLG D;  1TWC B;  5EPL A;  1DXM A;  1EIH A;  1KDC A;  3H6M A;  3AU7 A;  3BDL A;  5IOC A;  1RCV D;  4CJ2 C;  3Q0A A;  5C4J B;  1EU4 A;  2MHV A;  1RD9 D;  4XQQ A;  1WTX A;  1L0X B;  2EDG A;  2JP1 A;  4R8N A;  2K5W A;  1FNU A;  2F0U A;  4IN3 A;  2NVT B;  1EYA A;  4TKO B;  3NP8 A;  1ESR A;  4C3I B;  3SXH A;  3TSS A;  4A3M B;  1X3P A;  4PMC A;  1AN8 A;  4K6L A;  1O78 A;  1CA6 A;  1ROD A;  2A6E C;  3DXJ C;  2FMC A;  2AQ2 B;  5G3L F;  2B2W A;  2K5Q A;  2Q8R E;  3MWY W;  1DCZ A;  4H0L C;  3HOU B;  3M85 A;  2B2T A;  2L9H A;  4KKU A;  4RGN A;  3K5N A;  4DU9 A;  4BY1 B;  2KA7 A;  1K8O A;  2PZT A;  4HMI A;  1BCP C;  3D6W A;  4J1M A;  4EGV A;  3QB3 A;  1TKW B;  1JB3 A;  3OOC A;  4J8Q A;  2BA1 A;  2JSO A;  3KLR A;  3I90 A;  4AYB B;  4QUF A;  1IKL A;  2CVR A;  1CM9 A;  1SYF A;  4PQX A;  1HQR D;  3I72 A;  1JOK A;  4DGZ A;  4FXG C;  1GUN A;  2Y0S B;  1STB A;  1RTO A;  3S14 B;  2K05 A;  4ZYS A;  4RFB A;  2AUJ D;  1WD0 A;  3RD4 A;  2A6H D;  3A8I E;  1EZ6 A;  3VYS A;  2KQ3 A;  4XT1 B;  1EY7 A;  1MD2 D;  2PW5 A;  2SNS A;  3NQT A;  5IT9 L;  3FEW X;  4K5X A;  1HA5 A;  4DXG A;  4G7O C;  4JBW A;  4MN3 A;  1PXU A;  1ENF A;  4IAL A;  1BDO A;  3RZD B;  3PIP 3;  4A3I B;  2A73 B;  2DN8 A;  1EZ8 A;  1G2T A;  1V43 A;  3SR1 A;  3L9A X;  3BG3 A;  3N52 A;  5KYL A;  1PRT D;  5C3W A;  1X3Q A;  2QF7 A;  1B9N A;  3X3M A;  2OF1 A;  2F0V A;  5JVH 3;  4GZY C;  1O7Z A;  5C3X A;  1CQV A;  2RDG A;  3CU7 A;  1QJO A;  2G9H D;  1SND A;  2IT1 A;  2J7Z A;  5FLX E;  3P75 A;  2C5C A;  4R9W A;  1G8Z D;  1UAP A;  4CGY B;  1I4H A;  3GTK B;  2RKS A;  3MVV A;  1GUO A;  5JVG 3;  2MGS A;  2J4X A;  1BNZ A;  2A6H C;  5E4W C;  2F0G A;  5IGB A;  5M5W B;  4RGM A;  2TSS A;  4QMG A;  2WAC A;  1TY0 A;  3T13 A;  1H9M A;  3NTI A;  4BA2 I;  3Q24 A;  2CW0 D;  4KN7 C;  1MI2 A;  5C4X B;  5D3D A;  1SYD A;  4IUU A;  5NUC A;  3ERO A;  5I2X A;  4XXE A;  2AWN A;  1ILQ A;  3NBH A;  1EY5 A;  1PFN A;  1H9K A;  3BDC A;  5EBC A;  1KNA A;  2XWB B;  3E0J A;  2MP1 A;  4TQU S;  2F0K A;  4BWG B;  1CZW A;  4XQN A;  4PNY A;  1A2T A;  3R2I A;  4BBS B;  3HOW B;  4ZKC B;  2PYK A;  1SNM A;  3H3V C;  2XIW A;  2Z1C A;  4MHE A;  1G29 1;  4V19 0;  3BDO A;  1CQF A;  4RGO S;  1QE6 A;  2K03 A;  5EGT A;  2KOL A;  3NUC A;  3J7Y W;  3LWU A;  4IFD J;  5ELF A;  2F3W A;  1LT5 D;  1HFG A;  2B2W C;  3GTJ B;  3C1F A;  4ZKB B;  1QWY A;  1B3A A;  1SSO A;  3J81 E;  4XYQ A;  2PO4 A;  2GA4 B;  3U9O A;  3QG1 A;  1SE2 A;  4BBR B;  2VNU D;  3S1N B;  2E2H B;  3ERQ A;  4F8M A;  5C4H A;  1JIC A;  2JEB I;  1YNN D;  2LY7 A;  4CKE A;  1R4P B;  1ZYR D;  4X3S A;  5M5Y B;  2RA4 A;  1BQQ T;  1PTO H;  3HRZ C;  4DA2 A;  3S9W A;  4UDU C;  3BYT B;  5JEA G;  1LV9 A;  1SNO A;  4FP5 D;  3H0G B;  3HS0 C;  5A35 A;  2L0C A;  1S5C D;  2KJX A;  4UAI A;  4K6D A;  1QG7 A;  3C46 A;  1B9M A;  1JWM D;  5DAU A;  1H9J A;  2E2J B;  1WVL A;  3OIP A;  3BVM A;  1R4Q B;  3PUW A;  2F1M A;  1PMR A;  2H1E A;  3T16 A;  5IT9 E;  1LT4 D;  4P2C B;  3K5M A;  1PZJ D;  3GO5 A;  3IFD A;  4RWS C;  3JAM L;  3HZX A;  3DHQ A;  3ONA B;  1A3V A;  1HXY D;  1DD2 A;  1E0B A;  1GXD C;  3A55 A;  1F2Y A;  1W6K A;  3IFT A;  4A3B B;  2N88 A;  3H91 A;  3VR3 A;  1TWH B;  3D8G A;  5KRU A;  2L11 A;  3K6O A;  4ULL A;  2V4D A;  5J1Z A;  1SMY D;  3G6J B;  3IKJ A;  1DOK A;  4U68 A;  1A3T A;  3W3A A;  3J7A V;  3N6R A;  3PUY A;  2O5J C;  1FD7 D;  1TT2 A;  4C1N K;  4BY7 B;  5CYU A;  2C9O A;  1NCV A;  2OXP A;  1MSH A;  1RF2 D;  3WDN A;  3OWF A;  3AB9 A;  2R6G A;  1XXG A;  2MJ8 A;  4R8I A;  2F0S A;  3K5L A;  2SEB D;  2SOB A;  4NMZ A;  3EJI A;  1U4L A;  2RBM A;  1GHJ A;  1TR5 A;  1H9R A;  5DNF A;  2HQE A;  3A54 A;  3PO2 B;  3IL8 A;  1DYQ A;  5CMD A;  3J80 E;  4HCS A;  4IUQ A;  2E74 C;  5K5P A;  5KNB A;  3V05 A;  2FJ2 A;  4HTH A;  4E6I A;  3QJY A;  4M1U B;  3M7N A;  3NWS A;  1JCK B;  3S16 B;  1I4R A;  3P20 A;  1ONL A;  2OT2 A;  2B2Y C;  2F0Q A;  5IGF A;  1CHP D;  4N9P A;  2KED A;  3K58 A;  2B39 A;  5LHY 1;  5IGD A;  3BZD B;  4HED A;  5CV8 A;  1E2Z A;  1EIG A;  2A74 C;  1IL8 A;  3RZO B;  1D6E C;  5EJW A;  3NWT A;  2CHB D;  5D14 A;  5J39 A;  4A3K B;  3T53 B;  1PLF A;  3GTM B;  1BF4 A;  3MXG A;  3G7L A;  3U9S A;  1WTO A;  2Z4I A;  5J22 A;  3OHX C;  1JQY D;  3RMH A;  1ZYR C;  1HPC A;  1EWC A;  2D9U A;  4A3G B;  1J8I A;  1CTM A;  4DXF A;  2JEA I;  1RKN A;  4L63 B;  2XNA C;  5C44 B;  1ICW A;  1KLU D;  2VB3 X;  5DM6 3;  3QOJ A;  3S1Q B;  4C1N I;  1IW7 C;  5JJZ A;  3C1E A;  4H13 C;  1XX8 A;  1YNJ D;  2ID0 A;  1C4Q A;  3OIQ A;  3SK5 A;  5FO7 B;  3M3Y B;  3MEH A;  4K14 A;  1W6J A;  1PRT F;  1BUV T;  3ND9 A;  2K04 A;  1VMP A;  5G3L D;  3I8Z A;  3TZD A;  1HUN A;  3DM1 A;  5ELE A;  2PMZ B;  4C2M B;  3S17 B;  2EPB A;  5LL6 X;  5CV9 A;  4WFN 3;  3AMU A;  2NN6 H;  3MTS A;  1FGB D;  4Z9C B;  2F03 A;  1F9Q A;  1GUG A;  2BDO A;  4K8J A;  5M5X B;  1UUP A;  3HP3 A;  4KKS A;  3PIO 3;  2WKD A;  3GQB A;  2RSO A;  1F9P A;  1OXS C;  1Y8N B;  3MA2 B;  4RCN A;  1UNS A;  4F87 A;  1EYC A;  1CI3 M;  2A68 C;  2LKV A;  2F0W A;  1HRJ A;  2M00 A;  2F4I A;  2PCF B;  2B8F A;  1EOT A;  2I07 B;  2X6L A;  3NXW A;  5IIF A;  2D62 A;  2NBF A;  5BN3 A;  1LTT D;  1F9S A;  5IGC A;  4A3E B;  1CFM A;  1LTS D;  4IUN A;  3KLS X;  1SAP A;  3W2D A;  2DNC A;  3DMU A;  3DUZ A;  4G7Z C;  1O7L A;  1ENA A;  1EEF D;  3VR2 A;  1G6Z A;  4ME5 A;  2F0N A;  1B1Z A;  1LT6 D;  1TU2 B;  1F2Z A;  1F9R A;  2SNM A;  3FVQ A;  1CHQ D;  1SNQ A;  2F0H A;  1DJR D;  1I4X A;  1C48 A;  4WJW A;  2O4X A;  3T4A C;  2YYZ A;  2XRS D;  1G91 A;  3MAQ A;  2F0L A;  3KBX A;  3D6C A;  1STA A;  4KV6 A;  1RDP D;  5CBE E;  3Q23 A;  2WB1 B;  2O5I C;  2EYH A;  4IZ8 A;  2K1B A;  2QIL A;  2F0D A;  2F0F A;  1DOL A;  1XYI A;  3GP7 A;  4FVM A;  3VYT A;  5FO9 B;  3C2P A;  5IGG A;  4X3K A;  2ZXR A;  4QB4 A;  2NZ1 D;  5EPK A;  2PZW A;  5CR3 A;  3K7A B;  4IFD H;  1NR4 A;  4HMJ A;  3PV0 A;  4G7H C;  3R3O A;  2QKI C;  4KMU C;  1Q1E A;  1BBX C;  1HTL D;  5IOD A;  3D4W A;  1PFM A;  5D3I B;  4NKL A;  1TQO A;  2R61 A;  1O7Y A;  2NWG A;  2VXW A;  3S1M B;  1TWF B;  3GTQ B;  2MUY A;  3TZU A;  2E2I B;  4CKC A;  3T56 B;  1C8C A;  4QCL A;  2HDL A;  5CBA E;  4A3J B;  1LLR D;  1GJX A;  2I46 A;  4HCE A;  5FO8 B;  4X3T A;  1VF7 A;  3PO3 B;  1G2S A;  5C0X J;  3A8J E;  1ZKO A;  2AQ3 B;  4HN7 A;  3KBG A;  2XRQ D;  1I6H B;  1TS5 A;  1OXT A;  3M4O B;  3SK8 A;  3VR5 A;  2AUK A;  3RLF A;  4PMW A;  1Y69 U;  2EYJ A;  3MFG A;  1BCP B;  1MSG A;  1PZK D;  4ZUJ A;  1X32 A;  4EQO A;  5COR A;  3ND8 A;  4KHV A;  4KI0 A;  4O42 A;  2LMC B;  2K01 A;  1OXX K;  1LT3 D;  4I7Z C;  3SEB A;  5DEH A;  3EA6 A;  4IUV A;  2B2V C;  1D5Z C;  1Z47 A;  1K83 B;  1T5E A;  2PZU A;  1AP0 A;  1U4M A;  2NN6 G;  4G57 A;  4XIG S;  2H4O A;  4ZQ3 A;  1STE A;  1TS4 A;  1V1O A;  3ITP A;  2MPM A;  1V8Q A;  2X6G A;  3NE5 B;  5C3E B;  1XTC D;  2JYO A;  3TP5 A;  1IHZ A;  1EY6 A;  3MXU A;  5CGK A;  4ID6 A;  5BN5 A;  1SMY C;  3BYY B;  3LWE A;  3R2T A;  3TME A;  3IAY A;  4A3F B;  4FF2 A;  3VR6 A;  2B8G A;  4CKB A;  3KF8 A;  1AZP A;  1AW7 A;  3DEP A;  3OW7 A;  1EWH A;  4C56 C;  1AZQ A;  1LTB D;  3S2D B;  3TDQ A;  1TS2 A;  4KY5 A;  3T51 B;  2NVQ B;  3BS1 A;  1BCP F;  3QO2 A;  3HG9 A;  3E5S A;  1SJE D;  3WOE A;  1A15 A;  2BDN A;  2EJF C;  5F2D A;  2E76 C;  2EYF A;  3HKZ B;  3OMC A;  2JA5 B;  5C6A A;  3HOZ B;  3RUZ A;  3ZYY X;  2QCP X;  4DAY A;  1I50 B;  1JWS D;  3PUZ A;  1Y1W B;  3GTG B;  5K36 G;  3CRK C;  4DNR B;  2JE6 I;  3FPU B;  1WD1 A;  2WP8 J;  2K5D A;  3D4D A;  2DY8 A;  1Y1V B;  4DAV A;  5C0X H;  1SDF A;  2JA7 B;  3LX0 A;  4ABN A;  2EY2 A;  3A7L A;  4PMB A;  4OL7 A;  1D2B A;  3QOL A;  3R8B A;  1AFP A;  5ELB A;  4OHJ A;  4EQN A;  1TY2 A;  4H44 C;  5KYI A;  2B2U C;  5JPN C;  2B63 B;  1S5E D;  1RHP A;  4K5W A;  3TP6 A;  1OO9 B;  1SYB A;  1VF5 C;  1I4P A;  3TP8 A;  4XYO A;  3FMC A;  4FF4 A;  1JOO A;  3SK4 A;  2Z8L A;  4M8A A;  1QCB D;  3BVG A;  1CZG A;  1KNE A;  3HOX B;  4OIJ A;  2EYM A;  1ILP A;  2EYO A;  4ZRZ A;  5C0X G;  1QNK A;  3V2T A;  2BE5 D;  1LTA D;  1NSN S;  4HSP A;  5KGU A;  1R9T B;  1BO0 A;  2RVL A;  2QEJ C;  1EFI D;  4RGT A;  3K59 A;  2HCI A;  1BR9 A;  4DAP A;  5BN4 A;  2KVM A;  1B44 D;  3V96 A;  1HTP A;  5ELD A;  1O80 A;  1GUT A;  1ET6 A;  4FF3 A;  3A56 A;  1V1P A;  3WOF A;  1SYG A;  5CV6 A;  4IUP A;  2Q8I B;  4RA8 A;  4OO1 I;  4O1N A;  3VA5 A;  1RJT A;  4IUR A;  1PTO D;  1EY4 A;  3C3L A;  5JOB A;  2HDM A;  3DEO A;  1MBY A;  1I6V C;  2FHT A;  2ENB A;  2J0T D;  2AQ1 B;  3X3N A;  3I4L A;  4ZAI A;  2IW3 A;  2EXZ A;  2KUM A;  1HUM A;  1JC7 A;  4OO1 G;  2BA0 A;  1SE3 A;  2M2L A;  3QWN A;  4B08 A;  3I91 A;  1IYU A;  1PTO B;  1SE4 A;  2D5D A;  1H9S A;  2EY5 A;  2KHS A;  4N9T A;  2R93 B;  5A2Q E;  1F2M A;  2Q8T A;  2HCC A;  4F88 A;  4C3J B;  5TSS A;  4CHT B;  1D1K A;  2CQA A;  2IJ0 A;  1QIL A;  3J80 L;  1SBB B;  1XWE A;  1HFN A;  3VYU A;  3GD7 A;  1YNN C;  2WII B;  2JXM B;  1STH A;  4HAE A;  2L12 A;  3SE0 A;  5IGE A;  1EY9 A;  5M9O A;  2EYP A;  5EQ0 A;  4NDX A;  3CKI B;  5LL6 S;  4H7B A;  2KCC A;  2EYL A;  4B9W A;  4C3H G;  2PQE A;  1PRT B;  1HCZ A;  4KHZ A;  4K5V A;  1TII D;  5CV7 A;  2Z4H A;  1OXU A;  4B9X A;  1QNU A;  3O13 A;  3M7G A;  3SDZ A;  5JPM C;  2L4N A;  1QB5 D;  4TSS A;  4KY7 A;  1I4G A;  3P1H A;  4QUC A;  2YU9 B;  2KCN A;  3EVQ A;  4Q5V A;  1E2W A;  2ZXP A;  1Q12 A;  3KK7 A;  5K36 H;  1D5X C;  2L55 A;  2RQX A;  1D1I A;  3NSW A;  5C0X I;  4XDX A;  4OGQ C;  1II3 A;  1SFO B;  1B50 A;  4CBV A;  2IX0 A;  4KD3 A;  1IYV A;  2LS0 1;  1J9O A;  2A5H A;  1WTQ A;  2R3Z A;  5EKL A;  4LAA A;  1EEI D;  3A7A B;  4EQP A;  2EY1 A;  3L7Z C;  4QIW B;  1M8A A;  2QDB A;  3P7J A;  1S4Z A;  5ELC A;  2PPB C;  2VUM B;  1EY0 A;  1A3U A;  3URY A;  1SYC A;  2XSC A;  2WV6 D;  2F0T A;  5FK9 C;  3SK6 A;  1Q8I A;  2PNR C;  3F2U A;  1QOH A;  3K0Y A;  4YIJ A;  4KTA A;  1U4R A;  4QF4 A;  3CQZ B;  1GHK A;  2DNE A;  3EFX D;  4CJ1 B;  5FOB B;  1K8M A;  1TS3 A;  5EBD A;  1RTN A;  2NYZ D;  5EPJ A;  1WCM B;  3GV6 A;  5JEA J;  3VR4 A;  3I4N B;  2ICI A;  2D2C C;  1SNP A;  5E3F A;  5FLX L;  1JR0 D;  1CK1 A;  1PYW D;  2NTT A;  2EVB A;  1FNV A;  4DFA A;  4Y7N B;  1EL0 A;  4NP5 A;  1LO5 D;  1STY A;  4C3J G;  2G9D A;  3K57 A;  1Z6H A;  3KUP A;  4DF7 A;  2F3V A;  2IX1 A;  1D5M C;  2F0I A;  2A68 D;  1AEX A;  2NUC A;  1FR3 A;  4RH6 A;  3JAM E;  1DOM A;  1SJH D;  1STN A;  4IFD I;  1FYC A;  1EQT A;  4A3D B;  3FKI B;  3BVZ A;  3J7A F;  2A6E D;  1WTV A;  1SNC A;  5T1I A;  1EYD A;  1LTG D;  3Q6S A;  3OMG A;  1I4Q A;  2BE5 C;  5KND A;  2EJG C;  2EJM A;  1DZ1 A;  1SXT A;  4L8J A;  4IFD G;  1HHV A;  1NR2 A;  5KIX A;  3L3O C;  5E1F A;  5A2Q L;  2EY6 A;  4XQJ A;  3NBI A;  1JWU D;  1UEA B;  1SEB D;  3HGB A;  2M9V A;  5M3F B;  2WKC A;  3MFY A;  4KJN A;  4KN4 C;  3Q22 A;  4KK7 A;  2BCO A;  2N55 A;  3MHB A;  4PV1 C;  1A2U A;  3GTP B;  1GOZ A;  5I9O A;  5CV5 A;  1KAA A;  1V1P B;  3MC0 B;  2RDF A;  4RCO A;  2K28 A;  1ML0 D;  4U67 3;  3OPO A;  3OSO A;  4C3I G;  3MXP A;  1KAB A;  1EY8 A;  4X3U A;  1A6X A;  4TRD A;  3NHH A;  4ZLT F;  4IUT A;  5CV4 A;  3DWP A;  1WTR A;  4L6T B;  1KDA A;  1S5B D;  4S3S A;  4K2K A;  4XT3 B;  5JEA H;  1U4P A;  3VYR A;  4MIU A;  3E6Z X;  2F0E A;  1LTR D;  2B2U A;  3QIA A;  4ILW A;  3DWA A;  4BA1 I;  1B53 A;  2A69 C;  1EU3 A;  2CW0 C;  3GTO B;  2LFN A;  5EKK A;  4LJZ C;  2NN6 I;  1BXT A;  1TWA B;  2F0O A;  1PZI D;  4F7X A;  4JK1 C;  4KD4 A;  2BOS A;  3GV3 A;  1TVX A;  1Z7T A;  3NK9 A;  1ENC A;  5T1G A;  2F0P A;  4V0B A;  1MGS A;  1WTW A;  5M3M B;  2K7V A;  3HOV B;  4DNT B;  5AFW A;  1CA5 A;  2XN9 C;  3OWE B;  2AWO A;  4DK0 A;  1S5D D;  1YNJ C;  3I3C A;  2FMM A;  1S5F D;  3K5O A;  3S2H B;  1IW7 D;  2NTS A;  4XTC S;  2IWH A;  2IX3 A;  3J81 L;  4LMQ D;  4K8I A;  5EKI A;  2RSN A;  5CC4 A;  4CJ0 B;  2FFK B;  3FPP A;  4ZK9 B;  5KNC A;  2X69 A;  4DK1 A;  1JOR A;  2DY7 A;  4WOR A;  1I3Q B;  5FKA C;  2KEE A;  3NPP A;  2K33 A;  3NQI A;  5KEE A;  2SDF A;  3TN2 A;  1M4V A;  4DN4 M;  3VA7 A;  3I73 A;  4G4K A;  1IKM A;  1FNW A;  3NTK A;  1CT1 D;  1WTP A;  2JA6 B;  2F0M A;  3PMF A;  5I4D A;  4KKT A;  1LAC A;  2XVS A;  2TMP A;  4NW2 A;  4IQZ A;  4ZUI A;  3D3R A;  4KJO A;  1Q90 A;  5C4Z A;  2EE1 A;  3M4Y A;  4FNF A;  1SYE A;  1PTO C;  4OO1 H;  2XWJ B;  3S1R B;  3H94 A;  3S15 B;  1E2V A;  4I65 A;  1BCP D;  1KDB A;  3R93 A;  1JE4 A;  2B2V A;  1DON A;  2KEC A;  1STG A;  3CHB D;  3A8K E;  2K6A A;  2NVY B;  3I4M B;  1LAB A;  3TP7 A;  3EQL C;  4K2L A;  4OIK A;  5I2Y A;  1Y8O B;  2EZV A;  3NTH A;  5JAV A;  2ZT9 C;  2F0J A;  1Y8P B;  3FRP B;  1ZXT A;  3MZ5 A;  1EQV A;  1OXV A;  2EOT A;  5ISR A;  4A93 B;  1TWG B;  3PUX A;  5D65 A;  1U9R A;  2NB0 A;  4BS9 A;  2NVX B;  3D31 A;  4J6H A;  2IL8 A;  2ICE C;  3CRL C;  1LTI D;  4RAU C;  1PFB A;  4Q0F A;  2JA8 B;  5I9P A;  1VCI A;  4RHR A;  1PRT C;  2HUG A;  4HSV A;  2O2L D;  1Q3L A;  2L5T A;  2ZXO A;  2K32 A;  1F77 A;  5E4X A;  3UI2 A;  1JOQ A;  4FXD A;  3H09 A;  2E2D C;  4FYD A;  2OEO A;  3HEJ A;  2E75 C;  1H9S B;  2R7Z B;  1Q1B A;  3DWQ A;  5C5M A;  3D4R A;  5HGT A;  1HQM C;  1BOS A;  3GTL B;  4KY6 A;  1DM0 B;  1VDZ A;  2R92 B;  3TBI B;  4LK1 C;  4RKB A;  4FF1 A;  2RDH A;  3I70 A;  1ZEQ X;  3SVM A;  4WRD A;  1GUW A;  4C3H B;  1F2L A;  5I6W A;  3PUV A;  3LNN A;  2B2T C;  2WAQ B;  4FO2 A;  1GUS A;  3KLS A;  1ET9 A;  3FDT A;  1T5X D;  1NAP A;  1L0Y B;  4FXK C;  2A69 D;  4RHS A;  1B4O A;  4EVO A;  2PW7 A;  2VB2 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...