1RODA

Chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPASPIVKKIIEKMLNSDKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC PROTEIN OF INTERLEUKIN 8 AND HUMAN MELANOMA GROWTH
publication title Structure and activity of a chimeric interleukin-8-melanoma-growth-stimulatory-activity protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 10
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rodA00
4IUVA 1MSHA 2N88A 3I3CA 2Q8RE 1NR2A 1O80A 2NWGA 1PDQA 3I90A 1XX8A 1MGSA 1C8CA 3QO2A 1WTRA 4R9WA 1E0BA 1U4RA 2RA4A 4IUQA 3G7LA 1EIGA 1BF4A 3MTSA 1KNAA 3KUPA 1GUWA 1NAPA 1NR4A 1VMCA 4RAUC 1X32A 3UI2A 2L12A 4QUCA 2HDMA 3IFDA 4X3TA 3TZDA 1BNZA 3DM1A 4UAIA 4LMQD 5D14A 1WD1A 1EOTA 2DY7A 3GV6A 1WD0A 1WTWA 3F2UA 5JJZA 1U4LA 3GV3A 1JICA 1B50A 5T1GA 1RTNA 4XT1B 1O7YA 1PFBA 1VMPA 1F9PA 1IKLA 1J9OA 1SAPA 2HDLA 1ILPA 2HCIA 2MPMA 2B2WC 5AFWA 1G2SA 1WTVA 2L4NA 1WTQA 1F9SA 1SSOA 2L1BA 3IL8A 1ML0D 2KEDA 4X3SA 5DNFA 5E4WC 1RJTA 1X3PA 1HA6A 1DOLA 4XT3B 4ZKBB 1B3AA 2KUMA 1O7ZA 2RSOA 2MGSA 1EQTA 1X3QA 4ZLTF 1BBXC 1RODA 5EPKA 4IUTA 3H91A 1G91A 4O42A 3D6WA 1CM9A 3DEOA 1U4MA 3MWYW 2JYOA 2B2TA 5EPLA 2K04A 2NYZD 4NW2A 2KEEA 1B53A 4OIKA 1AZQA 1G2TA 3N52A 3LWEA 1LV9A 5CORA 5E4XA 2L11A 1B2TA 4CJ1B 2K01A 1HFGA 3Q6SA 4MHEA 3R93A 4IUPA 1XYIA 1AZPA 5EPJA 1J8IA 2KVMA 2B2VC 4XDXA 4ZK9B 1CA5A 2K05A 2FJ2A 4HEDA 3I91A 2FMMA 3TN2A 1QG7A 2RVLA 2R3ZA 1IL8A 5EJWA 2EPBA 5CBAE 2J7ZA 4ZAIA 2SDFA 2K1BA 1WTOA 2X6GA 1WTXA 1CA6A 4X3UA 2B2UA 4R8IA 1NCVA 2KECA 2N55A 1PFMA 2MJ8A 3SVMA 1Q3LA 2BDNA 1ILQA 5EQ0A 4MN3A 2NZ1D 2FINB 3DEPA 1G6ZA 1DOMA 4IURA 2FFKB 2M2LA 5COYA 3P7JA 2IL8A 2XIWA 3ONAB 1EL0A 2VXWA 1ESRA 1HFNA 1AP0A 1PFNA 2L9HA 2B2YA 2X6LA 1M8AA 4OIJA 2MP1A 2B2WA 2D9UA 1JE4A 2EOTA 1A15A 4HAEA 5EKIA 4U68A 3KBXA 1HHVA 5CBEE 1IKMA 1ZXTA 4IUUA 4QUFA 1SDFA 1ICWA 1RHPA 1WTPA 1BO0A 4RA8A 2K03A 2H1EA 5CMDA 1S4ZA 4CJ0B 1PLFA 1MI2A 3HP3A 4HSVA 2RSNA 4DN4M 4ZKCB 1WVLA 4X3KA 1HRJA 2B2UC 3FPUB 1HUNA 1F9QA 1RTOA 2EE1A 1DOKA 2HUGA 4HCSA 1F9RA 1DZ1A 5D65A 1MSGA 3I8ZA 2CVRA 2FHTA 1U4PA 2K28A 2Q8TA 3FDTA 1QE6A 1F2LA 1DONA 1QNKA 4CJ2C 2JP1A 1TVXA 2HCCA 2X69A 1HUMA 2B2TC 1EIHA 1B4OA 2B2VA 4RWSC 5T1IA 2B2YC 1KNEA 2DY8A 2KOLA
chains in the Genus database with same CATH superfamily
2WV6D 1UWVA 4EQ5A 2Z1CA 1EFID 2NVYB 4R8NA 1D6EC 1D5MC 1RCVD 2ES2A 3G7LA 3PGZA 3BJUA 4RGNA 4A93H 1NR4A 1D1KA 1JJCB 1VMCA 4OGQC 3S16H 3GTPB 3HOYG 2JEBI 4R1JA 5C5MA 2DJFC 3S17B 3HOZG 3K5OA 1PH7A 2Q2UA 3SXHA 4UP9A 2R93G 1NBWA 1E2VA 2O5IC 1SSOA 4RFBA 4DV5L 2C35B 3SK4A 5CV5A 4A3JG 4BY1H 2YU9H 3R8BA 4DV1L 1IYUA 1CM9A 2I5HA 1U4MA 4JI5Q 4PZ8A 4AQYL 4LUVA 2VB2X 3VDYA 3BVMA 1JR0D 1B2TA 4ZYSA 2XGTA 1CA5A 4DUZL 2IHEA 4IOAA 1KD1C 2R3ZA 2J7ZA 3NHHA 1SR3A 1TWFB 1CA6A 4R8IA 3CXCA 4JI4Q 4KD4A 3S1MH 3D0FA 5CV9A 1DOMA 5JJKA 1EY9A 2XIWA 3HZXA 1SYBA 2VXWA 4GS3A 1HQMC 3ICEA 2EOTA 3HOVH 4IUUA 3EN2A 1UE5A 3BU2A 3SDZA 4J15A 4A3BG 2A73B 4R4QA 3FPPA 2OT2A 3S1NB 4ME5A 4LFAQ 5JJIA 2RSNA 2Q8IB 3URYA 2BH8A 4U673 2B2UC 1PFSA 3A8IE 4DR3Q 2KCCA 1Q86C 1K8GA 1S5DD 3UE1A 1I50B 2K28A 3V96A 2A68D 4JI3Q 5JJLA 1E2ZA 2WB1B 1BVSA 5IP7H 2BE5C 1V1PA 5C4JB 1CZWA 3K8AA 1NR2A 4DNTB 2WB1E 1QVGA 4K6DA 1H9JA 1HTPA 2XRSD 5ELCA 1U5KA 5M9OA 1KNAA 3A55A 4A3LH 5C4XB 3ND8A 3PUVA 1Y8OB 1KL9A 4C3IH 2AWNA 2XVSA 3JC66 3F2UA 2LMCB 1O78A 2F3VA 2F3WA 3NENA 1CT1D 1C48A 2MO0A 1IKLA 4DR7Q 2B2WC 1IBMQ 3T51B 1KC8C 3N6RA 3A5UA 3DLLA 1CFMA 1EWCA 4OX9Q 1PYSB 1O7ZA 4YHHL 1X3QA 3H91A 1IHZA 2XWBB 3PO3B 4RHRA 2RQXA 2RBMA 5LMUL 4N8FA 1M90C 1BCPC 5EAYA 4JCVE 5M5WH 1XPRA 2R7ZB 2KENA 1H9SA 4LFBQ 1SE3A 1JCKB 2ZM6Q 4C3HG 2TMPA 1CQFA 2FMMA 3ERSX 2ASBA 4JV5L 3CHBD 1E1OA 2N55A 1OXUA 5C3XA 4MN3A 1SYGA 3F8TA 2NZ1D 4JI7L 4JI0L 2A8VA 1G6ZA 1TR5A 1S5FD 2JA5B 3SK8A 4OO1H 1PZKD 5J3BA 3EVQA 4X64L 1EL0A 1HFNA 4RKLA 1V8QA 2B2YA 3NELA 2Z6BA 1PHJA 1Q1EA 2HIXA 5C0XH 3C2PA 5BN3A 3I4LA 2AWOA 1EYAA 1LT3D 1YNJD 1VDZA 4M1UB 4HSVA 2QDLA 1STBA 4DN4M 1BQQT 2EJMA 3K59A 1HNXL 3RN5A 1ET6A 1AEXA 2EYJA 2IX0A 1I4GA 4YWLA 3SR1A 1RDPD 2F0OA 3PO2G 4BBRH 3HOUG 4DV5Q 3T1YL 4HTHA 4NB3A 3HEJA 3HKSA 4LUZA 2EIFA 4IQZA 4WRDA 2F4IA 3JAML 3PF5A 2E5LL 2DJGC 3RZDB 1JWMD 1A6XA 1SNMA 4DV1Q 1HZCA 3H0GH 3NSWA 1LT5D 3JAMi 4P73A 1PDQA 4AQYQ 4A3IH 1YNND 5C5LA 1LTAD 3I4MB 2G5DA 1NMFA 2R92H 5JOBA 3IAYA 4DUZQ 1X32A 3FVQA 2F0JA 4XQNA 4HCEA 3T16A 2E2HH 4MZ9A 1ENFA 1GUNA 2F0GA 1EIYB 1IYVA 4QY7A 3OW2A 3TRZA 4RGOS 2ZXPA 1KIXA 1EOVA 3QG1A 4RG1A 4CGYB 3J7ZC 4MIUA 3HOXH 2A69D 5E4WC 3CU7A 4IPCA 4AYBE 2PI2A 4DR4Q 2Y0SB 1CKNA 1R9TB 4DNRB 2Z9HA 4DAYB 1A62A 2ZXRA 2UUBL 3OSOA 1M1KC 2JJQA 4GLVB 5M5YH 3KF6A 4HMIA 2JA8B 3T4AC 3H3VH 2PW7A 5E4XA 2B39A 2Y0SE 1V1QA 3TP7A 5JVG3 1J8IA 1XPUA 4KKUA 1OXXK 2D2CC 2F0WA 4GOPB 4JI6L 3TN2A 2KHSA 1A0IA 3OWEB 1X65A 1SNCA 4HJ8A 2SDFA 3S2HH 4X3UA 1XMOL 1SMXA 1MJCA 3EBEA 4BA2I 3K80C 3MEHA 5H1SE 4BY7H 4L5SA 1EQVA 3LGJA 2AQ2B 3VR5A 3PIOA 3KLRA 4GN3B 1B9NA 1EY0A 2XSCA 4H02A 1B7YB 4XQQA 3NPPA 1HXYD 2A1AA 2E2DC 1D8LA 3U9OA 4GNXA 4PZ6A 1UEBA 5G3LF 1PVOA 1PTOH 1TS4A 1Y1WH 2R7DA 3RN2A 1VQIA 1CSQA 3NTKA 5IGFA 5FLMG 1LTRD 4A3MB 1YHAA 3QR8A 2F0FA 4BWGB 3I8ZA 2FHTA 1QE6A 1IW7C 2VUMH 4JC0A 3U50C 4QMGA 1EY8A 4YHHQ 2JA6B 2VZAA 3J81c 4DV6L 1CTMA 5LMUQ 1EY6A 2Q8RE 2WB1G 2WACA 3KDFA 3HS0C 4IFDG 3QO2A 4K8JA 2JK8A 3L9AX 2IT1A 1I6VC 4DV2L 2JE6I 4WORA 4A75A 1Q7YC 2LFNA 1TY0A 3D3RA 1I4XA 3X3MA 2E2IB 3KJOA 3WWVA 2RDFA 4N9TA 4YWMA 4C3JG 1B50A 5C4XG 1XTCD 1VQ9A 4DV7L 5C4ZA 2SEBD 1CKOA 1O7YA 4IPHA 3CMEA 4JI7Q 4JI0Q 3T1HL 2ENBA 5M3FB 1GKHA 5C3WA 3L0OA 4X64Q 1HNZL 3W5OA 1K28A 1FL0A 1C0AA 2MGSA 5BN4A 3NBHA 1HTLD 3D6WA 4LK1C 3HOZB 1W3SA 4A76A 3LWUA 2EYFA 3K7UC 4NW2A 2I46A 3E9HA 5KNCA 4LF5L 4R4CA 1VQFA 2L5TA 4KMUC 5EKLA 1UAPA 4XQJA 1VQKA 1HNXQ 2NN6I 2R7ZG 4FXKC 4JYAL 5IYDG 5FJ8G 3MXNB 4OEMB 4DUYL 4N8X1 4BBSH 3T1YQ 5IT9L 3G71A 4H0LC 1SJED 2E5LQ 2O5JC 1JORA 2A6HD 4KJOA 1ILQA 4O0AA 3NP8A 3DEPA 3J7AF 3D4RA 4KHPL 1TXYA 4A93B 1NE3A 2JA5G 3GQBA 2C5CA 1LYLA 3K7AH 1D1IA 3K0XA 4NXNL 1ENCA 3H15A 1EY4A 2H1EA 1GM5A 3I4OA 5EGTA 3G6EA 2DN8A 1MI2A 3F2CA 4DR1L 1YITA 5ELOA 3KLWA 5HY6A 4C56C 1I5FA 2VS1A 4DK0A 1SFOB 1K9MC 2F0EA 2V4DA 2JP1A 2E8GA 2HCCA 1MBYA 1X3EA 2YU9B 1VF7A 4E6IA 5JVH3 1VQ6A 2LY7A 2PQAA 2KOLA 3K57A 2I5LX 3H3VC 2D5DA 2UUBQ 3RLNA 1FJGL 2JA7B 1QUQB 4RMFA 4UP8A 2K5DA 3P20A 4DA2A 1WTRA 1EQQA 1BF4A 3CRKC 2K52A 2CKZB 1UNSA 3O13A 5D3IB 1UE1A 4JI6Q 4X3TA 3SK5A 4ZUIA 3I4MG 3NUCA 2F0IA 5IODA 4L6TB 4DR2L 2E75C 1XMOQ 3DMUA 3RZOH 4L63B 1VQ4A 3GDEA 4P72A 1QZHA 1ILPA 4Q0FA 1DD2A 1QNUA 2Z4IA 4AYBG 2XTIA 3I56A 2KQ3A 1ASYA 5CV8A 5CGKA 4GNXC 3CCEA 1YNXA 5DAUA 4NPSA 4DV4L 5EPKA 1S5CD 1SLJA 5LL6S 2JYOA 1PTOC 2K04A 2NYZD 2Y0SG 3CRLC 4TVAB 1TWCB 2AQ1B 2NTTA 2F0LA 1ZYRC 3CAMA 1IBKL 2F0QA 4HR7B 4RKBA 5C3EH 2JA8G 3Q8DA 4IPDA 3ULLA 3I91A 3DWPA 4KK7A 1Y1VH 4J1MA 1I4PA 3ZYYX 1WTOA 1E2WA 2B2UA 4JI8L 3K0YA 1B1ZA 3GTKH 3NXWA 4DV6Q 5A2QE 4OWWB 1EY5A 4YY3L 1D2BA 1RIPA 4APVA 4QCLA 5KRUA 1XNRL 2B8GA 1SE8A 1BXTA 2IHFA 1Z6HA 4DV2Q 4HIDA 2MP1A 5HGTA 1VQ7A 2JSOA 3FKIB 4A3CG 3M4YA 2K5NA 5EKIA 4FXDA 3KBXA 3R2IA 4AIMA 3M4OB 3ULPA 1KLUD 2K03A 4LF8L 2F0VA 1WI5A 1QWYA 4Z9CB 1L2FA 2E2JB 3NQTA 5IYBH 4BA1I 4K2LA 4NKLA 1TT2A 2EE1A 3CD6A 3T1HQ 3AQQA 2CH4W 4CJ2C 3NBIA 3WOFA 1HNZQ 1HUMA 3GTGH 4A3MG 2RCFA 4JOIA 3OPOA 1X3GA 3UI2A 3GTJB 2RHSB 3I55A 1MJEA 3MXUA 3BVZA 1O80A 3W1GA 5M5XH 1Q8KA 1CUKA 1XPOA 4GKKL 1UE6A 5GAEC 4LF5Q 5IIFA 1SYEA 1A2UA 1PH9A 4A3KB 3GP7A 3TBIB 4JYAQ 3PUYA 1MKHA 4KHZA 4DUYQ 1BNZA 3GV6A 1BKBA 1I4QA 1X56A 3HOYH 1UUPA 2UXDL 5FLXc 3AB9A 1PH3A 3E3XA 1WCMB 4KHPQ 3L2PA 4X3SA 1ML0D 5E7NA 4OXPA 4XT3B 1B3AA 4EQOA 4B9XA 1VCIA 2F0UA 5M3FG 1SNQA 1S72A 3D31A 4NXNQ 4A3JH 5IGDA 5I4DA 2I0QA 3RUZA 1I94L 2EY1A 1RD9D 3J81L 2ZXOA 4DR1Q 4IUPA 5EPJA 3GTMB 3S15B 3AEVA 5GADC 3S14H 2CW0C 3PIPA 1XNQL 3K5MA 3J81i 2RF4A 5EJWA 3HOWB 1X55A 3STBC 3PIP3 3PSIA 3NE5B 1B44D 4I65A 4B3SQ 5KNBA 4A3IB 3BG3A 1FJGQ 3M3YB 5LMNL 3VYTA 2NVQH 1G291 1GUGA 3BYTB 3IKJA 4JBJA 1VQ8A 2R92B 2K5QA 4Y52H 3I4NH 1U0LA 3L3OC 2WINB 4DXFA 4A93G 1DXMA 1L0YB 1YBYA 3RD4A 4NMZA 1P8LA 4DR2Q 3P75A 3J81j 1WOCA 1SROA 1N8RC 4WFN3 3CQZB 4A3BH 1JB7A 2Q8TA 1U4PA 1F2LA 4ZRZA 1E7ZA 4OELB 1H9RA 5FKAC 5I6WA 2K5WA 4DV0Q 3KOJA 1GUOA 4DV4Q 2OEOA 3A8JE 1KNEA 5M5YB 3TEHB 1IBLL 1U9RA 5IGGA 4DXGA 3EQLC 3T53B 5JEAJ 4A3GB 3S1RB 4IN3A 4OWTB 5DEHA 1IBKQ 4DK6C 1EU4A 2JEAI 1L1OB 2JA7G 3TP6A 4QUCA 3IFDA 4PMWA 4R4IA 4LMQD 2Z8LA 1WTHA 2UXCL 1R4QB 1U4LA 3Q0AA 4JI8Q 2VNUD 5ELEA 3J80c 3OIQA 4QB4A 5AJ3L 2HDLA 4YY3Q 2L4NA 3CCUA 1PH8A 5GAHC 1EYGA 1CHQD 1STAA 4C3JB 4KN7C 1J6QA 2B2TA 1B3QA 1QCBD 4I7ZC 1EU3A 1GD7A 4AH6A 1HZ9A 2LXKA 5CORA 3OMGA 4LF8Q 3UDXA 4R4OA 3MHBA 1F2YA 4XDXA 4ZK9B 1N9WA 4JOIC 2YTXA 3BDOA 1Z47A 3MAQA 2EJFC 2RVLA 1SRUA 2B63H 4DV3L 1UEAB 3CP0A 4GKJL 4C3HH 1EWHA 2KECA 2NVTB 3MA2B 1GJXA 4FXGC 4K5XA 1BBWA 4K6LA 1PXUA 5IP7G 5G3LD 1I3QB 2OQ0A 2Z0SA 1KLGD 4GKKQ 1AP0A 2QF7A 2AHOB 1VQLA 3MFYA 2A68C 2NBFA 3S1QH 3WOEA 4U68A 4IJHA 4K0KL 1WFQA 3DXJC 4C2MH 5C44H 1Y8PB 3FKIG 1JQYD 2NZHA 1PLFA 4Y7NH 2UXDQ 2CFMA 3AFPA 3T13A 4HCSA 3B6YA 1DZ1A 2NVXH 2KJXA 4JI1L 2OCEA 4ZQ3A 1SNDA 2VQFL 2K33A 2K5VA 4LF9L 4PQXA 3OIPA 5EBDA 2DY8A 3PO2H 3HOUH 1TWHH 2F52A 3GTQH 4OO1I 1TS2A 3MXPA 2ZJPA 3CW2C 1LO5D 2BOSA 4FF3A 1E0BA 1I94Q 2HHHL 5C0XI 1SBBB 4KJNA 3S9WA 1TWGH 1IZ6A 1E24A 4RGMA 3UE0A 1XNQQ 3TZDA 1S5BD 2L55A 2LSSA 4UAIA 2R61A 1WD1A 5D14A 1KDCA 5BR8L 3QB3A 2NVYH 3GV3A 4A3KG 4KN4C 3K6OA 1HZAA 1ZEQX 4JK1C 2N3SA 4KTAA 1EUJA 1NTGA 5LMNQ 2L1BA 2FMCA 2RSOA 2F0KA 5IGCA 1PH2A 3S17H 3K7AB 3E0EA 1WCMG 4TQUS 4HSPA 3S2DH 1G2TA 1LV9A 4AYBB 2CWPA 2LS01 3E0JA 2GVAA 2KVMA 2M00A 4LF4L 3GTLB 1TKWB 1PH5A 3R2TA 1I6HB 3BS1A 1KDAA 2PMZB 2PQAB 1KAAA 3FEWX 3NTIA 4QIWB 1PH6A 5CBAE 3G6JB 5IYCH 1FGBD 4BS9A 2X6GA 1YI2A 4X66L 4CKCA 4FF4A 2L0CA 2MNAA 1SYCA 5CYUA 4NXML 1IBLQ 1YNJC 3HOWG 5KNDA 2PMZE 5A35A 4QIWE 1WYDA 3ULJA 1NJIC 2WKDA 2L9HA 4PV1C 1NSNS 3RNUA 1LM0A 4A3IG 2K5HA 4O2DA 1M8AA 5HURA 4PNYA 1TWFH 5I9PA 5FLXL 2EYOA 1BCPF 3M7GA 3VR4A 1II3A 5CC4A 1SEBD 2R92G 3H3VI 1BO0A 1PH4A 2UXCQ 2RDHA 4G57A 3T56B 1S5ED 1D7QA 5AJ3Q 2QEJC 1YNNC 1FD7D 1A2TA 1P16A 1TWAH 1L0WA 3M85A 5FLMH 1B70B 2B2TC 1AFPA 2CHBD 4RWSC 1LTGD 3S1NH 2QCPX 1G8ZD 2G9DA 3MVVA 4UY8C 3IRBA 4NP5A 1PV4A 2N88A 4MTKA 3JAME 3CC4A 1K83B 1I50H 2K7VA 2EZVA 1F2ZA 4YWKA 1S3OA 2GA4B 3MTSA 2A69C 4A3GG 4IFDH 2F0NA 2F3IA 3EFXD 3KYHC 4EVOA 1C7YA 5I2YA 4JBKA 4X62L 5C4JH 5ELFA 3D4DA 4GKJQ 4J6HA 3VA7A 2O2LD 1KXLA 3F2BA 4A3DB 3PV0A 1F9PA 4K2KA 1HA5A 4JI2L 1Q81C 5C4XH 1G2SA 1WTQA 4K5VA 2MO1A 1LTBD 3K5NA 1BBXC 1G91A 4IUTA 4BXXH 5I9OA 3W3AA 4GN4B 4UHVA 1HR0W 1DJRD 2PZUA 3MWYW 4KD3A 3PUXA 2KEEA 4OIKA 3SGIA 4JV5Q 3LWEA 3KF8B 4G4KA 4EQPA 3C3LA 2F0DA 3GO5A 5CR3A 2IJ0A 1VQAA 2EJGC 3PO3H 3CCMA 1SMYD 4JI1Q 1GVPA 1IL8A 2VQFQ 1VQGA 2R7ZH 5LL6X 5IYDH 3GTOB 4LF9Q 2N49A 1VQDA 5C0XJ 2RKSA 3NWSA 2IWHA 2KCTA 2NB0A 3HFZB 5K5PA 1BCPB 4LF7L 3ONAB 4A3FB 1MIUA 1PFNA 2PZWA 4YCVA 4DR5L 4A3EH 3PF4A 1A8VA 2HHHQ 3J80L 1OXVA 3TMEA 1Y8NB 1Q1BA 1ENAA 2Q2HA 4X6AH 1ONLA 3A74A 3J80i 3I7FA 1WTPA 2JA5H 5BR8Q 2KCNA 1EIFA 1K8OA 5M3MH 3P1HA 1RTOA 2F0TA 1VQCA 5FO8B 2QDBA 1JT8A 1KAWA 2WIIB 1KRSA 4DK3C 5FO7B 1HCZA 1CQVA 3S16B 2ATWA 4MTNA 2AUKA 4PG3A 4L5QA 1MGSA 2WKCA 5J22A 1NY4A 1PRTD 4IUQA 2NN6G 4TRDA 3S14B 1EIGA 2KA7A 3PCOB 2NZOA 4LF4Q 4FF2A 1GUWA 1NUCA 4C1NI 3CCSA 3RZDH 2AQ3B 4IO9A 2ZJRA 1XXGA 4XYOA 4LJZC 3HGBA 2EXZA 4G7HC 1YEZA 3VR3A 4BY1B 3BDLA 4X66Q 2HQLA 1OXTA 2Z4HA 3I4MH 1C4QA 4NXMQ 2CQAA 2BCOA 3TP5A 1E3PA 1M4VA 4PZ7A 3CC7A 5DNFA 3PUZA 2KEDA 5TSSA 4HJ5A 1HH2P 3I4NB 1DYQA 4P74A 5NUCA 5EPLA 2A6HC 3ND9A 4IJLA 1LABA 1BOSA 2A6ED 1Q90A 3S1MB 2J0TD 4MHEA 3C46A 2F0PA 1SNPA 1R9TH 4ID6A 2RCNA 1Z7TA 5CV4A 2NTSA 4DAYA 2PCFB 3KBGA 2K1BA 1PMRA 1X9NA 2JA8H 3J7AV 1AW7A 5FK9C 3AFQA 3AMUA 3A56A 3NQIA 3BVGA 4FNFA 1JOOA 3HOVB 5IT9E 2KCMA 2FFKB 2M2LA 2XN9C 2SNMA 1ASZA 5KEEA 4X65L 3SHLA 4GOPA 5J39A 2D9UA 2QKIC 2L15A 4HAEA 1K0RA 3RLOA 4X62Q 3D6CA 1ZXTA 3E9IA 1LACA 1V1PB 4POGA 3HRZC 3M4QA 5IP9G 3FPUB 3CCJA 2HUGA 2OTJA 2F0MA 4JI2Q 1PZJD 4HJAA 1X3FA 1QNKA 2ZTEA 4QJFA 2WAQB 1EIHA 1MD2D 2EY5A 1B4OA 3Q23A 1HPCA 1R4PB 4IUVA 4C3IB 5D3DA 4A3MH 2NWGA 3VR2A 3I90A 4FDBA 1PH1A 2R7FA 2WAQE 1VQNA 3TSSA 3A7LA 1U4RA 5JEAG 1TS3A 1A63A 3RR5A 4DV7Q 2JA6H 2EVBA 2B63B 3L7ZC 3EA6A 3MEFA 2EQSA 2ZTDA 3DM1A 3KLSX 1WD0A 2ZJQA 1K73C 2GVBA 5T1GA 1RTNA 3HKZB 4DFAA 5GQOA 4JW0A 1SAPA 2HCIA 3I73A 1H9SB 5M5WB 1H9MA 1IL2A 4LWCA 2K50A 2B29A 1KQSA 2E2IH 3LX0A 4IZ8A 3K5LA 4LF7Q 3VR6A 1DOLA 4DR5Q 2KUMA 3DUZA 4A3DG 2MFIA 1EQTA 4LUOA 3HKZE 4CBVA 2EY2A 2SOBA 4XTCS 5C44B 4FP5D 4TSSA 1G6PA 2K6AA 4PMBA 5M3FH 2ID0A 4ME3A 2L11A 1HFGA 3R93A 2NVXB 1PRTF 3TS2A 4RH6A 2VB3X 2HD3A 3A54A 1SE4A 5IYBG 4HEDA 4EQNA 3HOZH 2QGQA 4P2CB 4ZAIA 3CCQA 4WJ3M 4KY7A 4L5RC 2R93H 1VF5C 2ZM6L 5J1ZA 3C1EA 4IUNA 1QVFA 3P7JA 1E22A 3E6ZX 3UDGA 3VA5A 1B8AA 3MXNA 1FVIA 1TWGB 1PTOF 1GUSA 2MQHA 4DPGA 4A3FG 1PYBA 4BBRB 4FYDA 2IX1A 2B3GA 2OWOA 3U58A 3H0GB 4HIOA 4LNQA 3AYHB 4LAAA 5K36G 1T5XD 4DAPA 4IPGA 4DR6L 4KHVA 3IFTA 3S2DB 1MSHA 2EDGA 2Q2IA 2K32A 3NWTA 2CWAA 2E2HB 5BN5A 3OWFA 1SFOH 4ODGA 1GHJA 2RA4A 4R4TA 2F4VL 4G7OC 1YZ6A 2DGYA 4DAVA 4LF6L 1JWUD 1LTTD 1V1OA 3HOXB 2MUYA 2D0OA 2L12A 1CKNB 2BE5D 5LMNW 4OHJA 2DY7A 2EYLA 2JA7H 2LKVA 1GXDC 4F88A 1VQ5A 4QL5A 3DHQA 3KF6B 2ICEC 1QUQA 4LW1A 1PFBA 3OYYA 5CV6A 1VMPA 1SJHD 1JWSD 4FO2A 1J9OA 2PI2E 3TZUA 4GOPC 2MPMA 4DNIA 4BY1G 2F1MA 4EX5A 1F9SA 4RGTA 3IL8A 1BBUA 2UUCL 1DM0B 1RJTA 3CPWA 3WDNA 4X65Q 5IOCA 4ZLTF 2AMCB 1PZID 4J8QA 4RHSA 2BA1A 3I4NG 4B08A 1PRTB 1AZQA 2A19A 3CKIB 3N52A 3S2HB 2HIVA 4DR4L 3D8GA 1JMCA 4CJ1B 4BY7B 3Q6SA 1EFWA 1TWAB 4PMCA 2WFWA 4O1NA 1FYCA 1XWEA 3EROA 4DF7A 3J81E 3M4PA 2LXJA 1QVCA 4CDFC 2EPBA 3Q22A 2BH2A 1XNRQ 3G4SA 4GNXB 4B3ML 1TWCH 1BCPD 1BR9A 1Q3LA 2VW9A 1FR3A 3MXGA 3OHXC 2FINB 2PNRC 3F1ZA 4YCUA 1PTOB 2IL8A 2PYKA 5IE8A 1Y1WB 1QB5D 1STHA 1ESRA 3QJYA 3HOVG 2X6LA 1K0SA 2N8NA 3A7AB 1I4RA 1NNXA 1JE4A 2EYMA 3MFGA 1J5EL 1EY7A 5JAVA 5CBEE 2VUMB 2KHIA 3BZKA 2YV5A 1SDFA 5IT9c 1XMQL 1S4ZA 4CHTB 4CJ0B 3KDFB 3SK6A 1YJWA 4X3KA 4B3TL 1VQMA 1CKMA 1FNVA 3FKIH 3A0JA 2CVRA 3TDQA 3PUWA 2OF1A 4QQBX 4K8IA 3U4ZA 1Q8IA 5KIXA 3M4OH 2B2VA 1XJVA 1SYDA 5KGUA 1GHKA 3NTHA 2E2JH 1N33L 1JJ2A 1JB3A 2WAQG 4JPBW 1IYJB 5CV7A 4A3LG 5I6YA 3G48A 4DAMA 5IGEA 1S40A 2UUAL 4RCOA 5GAGC 4C3IG 3CF5A 4YCWA 3VYRA 2A74C 5DM73 3GTJH 2PPBC 3OW7A 3NBHB 3QIAA 2WP8J 3CC2A 5JJZA 2AUJD 2IX3A 1W2BA 1Z9FA 2XWJB 2B63G 1HNWL 1RF2D 4XT1B 1AE2A 4H13C 1ET9A 4B9WA 3J7A5 1JC7A 2BA0A 4A3KH 4A3EB 1KTKA 4HIKA 3A8KE 1K8MA 5FOBB 1KHIA 1X3PA 3KK7A 3HKZG 3ER0A 1BUVT 2HQEA 1F2MA 3K58A 4V0BA 1LTID 4BBSB 1HQRD 3RMHA 2QEXA 2F03A 4G7ZC 5FO9B 1WCMH 5M3MB 2J4XA 3H94A 5C44G 1AZPA 5DM63 2ALYB 2K05A 2DNEA 2YTVA 2FJ2A 3M9BA 4YIJA 2CH4A 3X3NA 5F2DA 2FXQA 3OMCA 4POFA 2XNAC 4DR6Q 1EYCA 4GN5A 3GTPH 3BDCA 4OO1G 3Q24A 2NUCA 3GTMH 3S15H 1HJPA 3QOLA 5C0XG 4KKTA 3CPFA 1FGUA 3HOWH 2F4VQ 4LF6Q 1A15A 3OTOL 1JOQA 2JQOA 4JVZA 1IKMA 3MC0B 2G9HD 3A5ZB 4OWXB 4FF1A 3M3YH 2AKWB 1YJ9A 4ZKCB 3K81C 4BBRG 2UU9L 1JJGA 2PNHA 3DWQA 3I2ZA 4LFCL 4HJ9A 5D65A 3KLSA 2IY5B 5IGBA 1DONA 3SE0A 5E3FA 3H0GG 2UUCQ 2MHVA 1ZKOA 3HG9A 1YIJA 3KJPA 5C4HA 2ICIA 1H9KA 3CQZH 3V05A 5C6AA 4Q5VA 4KLKA 4XYQA 1QILA 1YJNA 2YYZA 3RZOB 1IW7D 2F0HA 1N34L 3KUPA 1I4HA 2DNCA 1NAPA 4JBWA 1VS0A 1VQPA 1FNWA 4WJ4A 4L5TA 1EOTA 2I5MX 4A3GH 1KRTA 5KYIA 3HOXG 3S1RH 4B3MQ 4CDDC 1RL2A 5ISRA 5IYCG 4IALA 5E1FA 1UE7A 4CKBA 2VQEL 4UPAA 3LNNA 5AFWA 5JPMC 1CZGA 4TKOB 1L1OA 5L37A 4GLAC 1SNOA 1T9HA 1TQOA 5C3EB 1K3BC 1KDBA 1RODA 3TP8A 4CKEA 1T5EA 1J5EQ 3GD7A 4O42A 4I7AA 1Y1VB 5IWAL 2R6GA 2D62A 3FHWA 3PIO3 2JA9A 1XTDA 4DV3Q 1XMQQ 1N36L 3VYSA 2F0SA 3GTKB 4IFDI 1GUTA 2V1CC 4KKSA 4B3TQ 2B2VC 2JN4A 1VQBA 4OONA 4A4IA 4NDXA 4C3JH 1EYDA 1QG7A 1STNA 4BY7G 1CI3M 2QILA 2QA4A 3CCVA 2PO4A 1YHQA 1K3RA 1HR0L 1C9OA 2BDNA 2O4XA 1SE2A 1Y14B 1B9MA 1N33Q 4IURA 4OL7A 1AN8A 4K0KQ 5COYA 2N78A 2UUAQ 2UXBL 4FVMA 1E1TA 1EZ6A 2EY6A 3UDFA 1FNUA 1N32L 3ZJYC 2NVTH 1NMGA 1Y1WG 3BZDB 4CDEC 3GTGB 5FLXE 1YHBA 1I3QH 2VY3A 3CCRA 4CDCC 2EYHA 4F7XA 1HNWQ 1WVLA 2VUMG 3S24A 5FJ8H 1DGSA 4MNOA 2M9VA 3U9SA 4ZUJA 1F9RA 5M5XB 3AU7A 4KY5A 3FDTA 2K75A 1JOKA 4ALPA 1Q82C 1CK1A 1VQOA 2B2YC 3FRPB 5EBCA 2Z6KA 4QF4A 4BXXG 1EQRA 1IXRA 5GROA 4ILWA 1STEA 2ZTCA 4B3RL 1QJOA 1YVCA 2JXMB 4RCNA 1C8CA 3R3OA 2KBNA 4KV6A 4GZYC 3HOYB 2IW3A 3M7NA 1GOZA 2KHJA 4HIMA 1L0XB 1SYFA 4ABNA 4RAUC 1STYA 2HDMA 2IPKD 2YTYA 2NN6H 1BDOA 3PO3G 2OXPA 1EEID 2R93B 3C1FA 1WTWA 3KFUA 2OTLA 2SNSA 1V9PA 3H6MA 1VQHA 5EKKA 1X6OA 4A3JB 1CHPD 4KI0A 2TSSA 5IY0A 1Q46A 1EEFD 2P5ZX 2E76C 1OXSC 4QGUA 1SMYC 2Q2TA 2H5XA 4A3EG 3OTOQ 1W6JA 1LT6D 1EWIA 2B8FA 1H95A 4P75A 2PW5A 1D5XC 2K01A 1ESFA 2UU9Q 3PQIA 4BBSG 2GN5A 4LFCQ 5M3MG 1LUZA 4F8MA 2NVQB 4KY6A 4IOCA 5A2QL 1EZ8A 1PTOD 1PA6A 3EJIA 1NCVA 4L8JA 1G51A 2MJ8A 3SVMA 1KABA 1STGA 4DGZA 1ZYRD 3NK9A 5ELNA 3GTLH 1I6HH 1V43A 3I72A 4GLXA 4A3BB 4B3SL 4OIJA 1A3UA 1SXTA 4H44C 1N34Q 5DLQE 3UDIA 4JI5L 3J80E 3OOCA 4DKAC 2CCZA 3J7YW 1ICWA 5CMDA 3I70A 2K4KA 3DWAA 1L1OC 1X54A 1O7IA 4JG2A 1TIID 4H7BA 2VQEQ 5HGQA 1PRTC 5LHY1 4UDUC 1TVXA 3BZCA 5IP9H 5KYLA 4DK1A 1AH9A 2C9OA 3TREA 4JI4L 4HMJA 1F77A 4IFDJ 3I3CA 2PQEA 1OO9B 4K14A 3PMFA 1XX8A 5IWAQ 4DV0L 1N36Q 4R9WA 4A3CH 3NEMA 2QW7A 2RDGA 2ZT9C 1TU2B 4EGVA 2PZTA 5JEAH 3CCLA 1AE3A 4UP7A 3FMCA 1LT4D 1K83H 3V2TA 4F87A 1JICA 2RHQB 4ZCKA 4LFAL 2CQOA 4XXEA 1HR0Q 3MZ5A 4M8AA 1VQEA 4DR3L 4DU9A 3QWNA 2A6EC 3E5SA 2XRQD 1WTVA 1GO3E 5ELBA 4JI3L 1JE5A 2UXBQ 1HA6A 4ZKBB 2BDOA 1TY2A 4C1NK 1A3VA 1N32Q 2EXDA 2D0PA 1VQJA 3DEOA 1ICFB 4A3DH 5I2XA 5C3EG 1B53A 4C3HB 1WJJA 4V190 1CSPA 2A5HA 3U4VA 3JAMc 4K5WA 3TQYA 1XYIA 1K8AC 3F2DA 1TS5A 3D4WA 1Y1VG 1PYWD 1Q12A 1QOHA 3VYUA 2H4OA 2K14A 2Z6KC 1WTXA 3S1QB 4WJWA 4XIGS 1PFMA 3SEBA 3CMAA 5EQ0A 5ELDA 1LTSD 4JBMA 3KF8A 1Y69U 4C2MB 2OQKA 2EYPA 4DR7L 1HZBA 1IBML 3W2DA 4B3RQ 1DCZA 1MHWC 4OX9L 4Y7NB 2I07B 2CW0D 4ULLA 3H09A 2B2WA 1D5ZC 3RLFA 3GTOH 3STBD 1HHVA 1W6KA 4HN7A 1A3TA 2VL6A 1RKNA 4HJ7A 2JA6G 3DM3A 3ERQA 4QUFA 2DUDA 1RHPA 3ITPA 4RA8A 3FP9A 4P71A 1O7LA 5JPNC 4A3FH 3PO2B 3HP3A 4LFBL 3HOUB 1TWHB 3GTQB 2E74C 1QZGA 1HRJA 3BYYB 3EIVA 1LTLA 3QOJA 1F9QA 1HUNA 1DOKA 4N9PA 1MSGA 3W1BA 2HT1A 3TS0A 2X69A 4S3SA 1OTCA 5K36H 1LLRD 5T1IA 1SN8A
chains in the Genus database with same CATH topology
2WV6D 2Z1CA 1EFID 2NVYB 4R8NA 1D6EC 1D5MC 1RCVD 3G7LA 4RGNA 1NR4A 1D1KA 1VMCA 4OGQC 3GTPB 2JEBI 5C5MA 3S17B 3K5OA 3SXHA 1E2VA 2O5IC 1SSOA 4RFBA 3SK4A 5CV5A 3R8BA 1IYUA 1CM9A 1U4MA 2VB2X 3BVMA 1JR0D 1B2TA 4ZYSA 1CA5A 2R3ZA 2J7ZA 3NHHA 1TWFB 1CA6A 4R8IA 4KD4A 5CV9A 1DOMA 1EY9A 2XIWA 3HZXA 1SYBA 2VXWA 1HQMC 2EOTA 4IUUA 3SDZA 2A73B 3FPPA 2OT2A 3S1NB 4ME5A 2RSNA 2Q8IB 3URYA 4U673 2B2UC 3A8IE 2KCCA 1S5DD 1I50B 2K28A 3V96A 2A68D 1E2ZA 2WB1B 2BE5C 1V1PA 5C4JB 1CZWA 1NR2A 4DNTB 4K6DA 1H9JA 1HTPA 2XRSD 5ELCA 5M9OA 1KNAA 3A55A 5C4XB 3ND8A 3PUVA 1Y8OB 2AWNA 2XVSA 3F2UA 2LMCB 1O78A 2F3VA 2F3WA 1CT1D 1C48A 1IKLA 2B2WC 3T51B 3N6RA 1CFMA 1EWCA 1O7ZA 1X3QA 3H91A 1IHZA 2XWBB 3PO3B 4RHRA 2RQXA 2RBMA 1BCPC 2R7ZB 1H9SA 1SE3A 1JCKB 4C3HG 2TMPA 1CQFA 2FMMA 3CHBD 2N55A 1OXUA 5C3XA 4MN3A 1SYGA 2NZ1D 1G6ZA 1TR5A 1S5FD 2JA5B 3SK8A 4OO1H 1PZKD 3EVQA 1EL0A 1HFNA 4RKLA 1V8QA 2B2YA 1Q1EA 5C0XH 3C2PA 5BN3A 3I4LA 2AWOA 1EYAA 1LT3D 1YNJD 1VDZA 4M1UB 4HSVA 4DN4M 1STBA 1BQQT 2EJMA 3K59A 1ET6A 1AEXA 3SR1A 2EYJA 1I4GA 2IX0A 1RDPD 2F0OA 4HTHA 4WRDA 3HEJA 3JAML 4IQZA 2F4IA 3RZDB 1JWMD 1A6XA 1SNMA 3NSWA 1LT5D 1PDQA 1YNND 5C5LA 1LTAD 3I4MB 5JOBA 3IAYA 1X32A 3FVQA 2F0JA 4XQNA 4HCEA 3T16A 1ENFA 1GUNA 2F0GA 1IYVA 4RGOS 2ZXPA 3QG1A 4CGYB 4MIUA 2A69D 5E4WC 3CU7A 2Y0SB 1R9TB 4DNRB 2ZXRA 3OSOA 4HMIA 2JA8B 3T4AC 2PW7A 5E4XA 2B39A 3TP7A 5JVG3 1J8IA 4KKUA 1OXXK 2D2CC 2F0WA 3TN2A 2KHSA 3OWEB 1SNCA 2SDFA 4X3UA 4BA2I 3MEHA 1EQVA 2AQ2B 3VR5A 3KLRA 1B9NA 1EY0A 2XSCA 4XQQA 3NPPA 1HXYD 2E2DC 3U9OA 5G3LF 1PTOH 1TS4A 5IGFA 3NTKA 1LTRD 4A3MB 2F0FA 4BWGB 3I8ZA 2FHTA 1QE6A 1IW7C 4QMGA 1EY8A 2JA6B 1CTMA 1EY6A 2Q8RE 2WACA 3HS0C 4IFDG 3QO2A 4K8JA 3L9AX 2IT1A 1I6VC 2JE6I 4WORA 2LFNA 1TY0A 3D3RA 1I4XA 3X3MA 2E2IB 2RDFA 4N9TA 4C3JG 1B50A 1XTCD 5C4ZA 2SEBD 1O7YA 2ENBA 5M3FB 5C3WA 2MGSA 5BN4A 3NBHA 1HTLD 3D6WA 4LK1C 3HOZB 3LWUA 2EYFA 4NW2A 2I46A 5KNCA 2L5TA 4KMUC 5EKLA 1UAPA 4XQJA 2NN6I 4FXKC 5IT9L 4H0LC 1SJED 2O5JC 1JORA 2A6HD 4KJOA 1ILQA 3NP8A 3DEPA 3J7AF 3D4RA 4A93B 3GQBA 2C5CA 1D1IA 1ENCA 1EY4A 2H1EA 5EGTA 2DN8A 1MI2A 4C56C 4DK0A 1SFOB 2F0EA 2V4DA 2JP1A 2HCCA 1MBYA 2YU9B 1VF7A 4E6IA 5JVH3 2LY7A 2KOLA 3K57A 3H3VC 2D5DA 2JA7B 2K5DA 3P20A 4DA2A 1WTRA 1BF4A 3CRKC 3O13A 1UNSA 5D3IB 4X3TA 3SK5A 4ZUIA 3NUCA 2F0IA 5IODA 4L6TB 2E75C 3DMUA 4L63B 1ILPA 4Q0FA 1DD2A 1QNUA 2Z4IA 2KQ3A 5CV8A 5CGKA 5DAUA 5EPKA 1S5CD 5LL6S 2JYOA 1PTOC 2K04A 2NYZD 3CRLC 1TWCB 2AQ1B 2NTTA 2F0LA 1ZYRC 2F0QA 4HR7B 4RKBA 3I91A 3DWPA 4KK7A 4J1MA 1I4PA 3ZYYX 1WTOA 1E2WA 2B2UA 3K0YA 1B1ZA 3NXWA 5A2QE 1EY5A 1D2BA 4QCLA 5KRUA 2B8GA 1BXTA 1Z6HA 2MP1A 5HGTA 2JSOA 3FKIB 3M4YA 5EKIA 4FXDA 3KBXA 3R2IA 3M4OB 1KLUD 2K03A 2F0VA 1QWYA 4Z9CB 2E2JB 3NQTA 4BA1I 4K2LA 4NKLA 1TT2A 2EE1A 4CJ2C 3NBIA 3WOFA 1HUMA 3OPOA 3UI2A 3GTJB 3MXUA 3BVZA 1O80A 5IIFA 1SYEA 1A2UA 4A3KB 3GP7A 3TBIB 3PUYA 4KHZA 1BNZA 3GV6A 1I4QA 1UUPA 3AB9A 1WCMB 4X3SA 1ML0D 4XT3B 1B3AA 4EQOA 4B9XA 1VCIA 2F0UA 1SNQA 3D31A 5IGDA 5I4DA 3RUZA 2EY1A 1RD9D 3J81L 2ZXOA 4IUPA 5EPJA 3GTMB 3S15B 2CW0C 3K5MA 5EJWA 3HOWB 3PIP3 3NE5B 1B44D 4I65A 5KNBA 4A3IB 3BG3A 3M3YB 3VYTA 1G291 1GUGA 3BYTB 3IKJA 2R92B 2K5QA 3L3OC 2WINB 4DXFA 1DXMA 1L0YB 3RD4A 4NMZA 3P75A 4WFN3 3CQZB 2Q8TA 1U4PA 1F2LA 4ZRZA 1H9RA 5FKAC 5I6WA 2K5WA 1GUOA 2OEOA 3A8JE 1KNEA 5M5YB 1U9RA 5IGGA 4DXGA 3EQLC 3T53B 5JEAJ 4A3GB 3S1RB 4IN3A 5DEHA 1EU4A 2JEAI 3TP6A 4QUCA 3IFDA 4PMWA 4LMQD 2Z8LA 1R4QB 1U4LA 3Q0AA 2VNUD 5ELEA 3OIQA 4QB4A 2HDLA 2L4NA 1CHQD 1STAA 4C3JB 4KN7C 2B2TA 1QCBD 4I7ZC 1EU3A 5CORA 3OMGA 3MHBA 1F2YA 4XDXA 4ZK9B 3BDOA 1Z47A 3MAQA 2EJFC 2RVLA 1UEAB 1EWHA 2KECA 2NVTB 3MA2B 1GJXA 4FXGC 4K5XA 4K6LA 1PXUA 5G3LD 1I3QB 1KLGD 1AP0A 2QF7A 3MFYA 2A68C 2NBFA 3WOEA 4U68A 3DXJC 1Y8PB 1JQYD 1PLFA 3T13A 4HCSA 1DZ1A 2KJXA 4ZQ3A 1SNDA 2K33A 4PQXA 3OIPA 5EBDA 2DY8A 4OO1I 1TS2A 3MXPA 1LO5D 2BOSA 4FF3A 1E0BA 5C0XI 1SBBB 4KJNA 3S9WA 4RGMA 3TZDA 1S5BD 2L55A 4UAIA 2R61A 1WD1A 5D14A 1KDCA 3QB3A 3GV3A 4KN4C 3K6OA 1ZEQX 4JK1C 4KTAA 2L1BA 2FMCA 2RSOA 2F0KA 5IGCA 3K7AB 4TQUS 4HSPA 1G2TA 1LV9A 4AYBB 2LS01 3E0JA 2KVMA 2M00A 3GTLB 1TKWB 1I6HB 3R2TA 3BS1A 1KDAA 2PMZB 1KAAA 3FEWX 3NTIA 4QIWB 5CBAE 3G6JB 1FGBD 4BS9A 2X6GA 4CKCA 4FF4A 2L0CA 1SYCA 5CYUA 1YNJC 5KNDA 5A35A 2WKDA 2L9HA 4PV1C 1NSNS 1M8AA 5HURA 4PNYA 5I9PA 5FLXL 2EYOA 1BCPF 3M7GA 3VR4A 1II3A 5CC4A 1SEBD 1BO0A 2RDHA 4G57A 3T56B 1S5ED 2QEJC 1YNNC 1FD7D 1A2TA 3M85A 2B2TC 1AFPA 2CHBD 4RWSC 1LTGD 2QCPX 1G8ZD 2G9DA 3MVVA 4NP5A 2N88A 3JAME 1K83B 2K7VA 2EZVA 1F2ZA 2GA4B 3MTSA 2A69C 4IFDH 2F0NA 3EFXD 4EVOA 5I2YA 5ELFA 3D4DA 4J6HA 3VA7A 2O2LD 4A3DB 3PV0A 1F9PA 4K2KA 1HA5A 1G2SA 1WTQA 4K5VA 1LTBD 3K5NA 1BBXC 1G91A 4IUTA 5I9OA 3W3AA 1DJRD 2PZUA 3MWYW 4KD3A 3PUXA 2KEEA 4OIKA 3LWEA 4G4KA 4EQPA 3C3LA 2F0DA 3GO5A 5CR3A 2IJ0A 2EJGC 1SMYD 1IL8A 5LL6X 3GTOB 5C0XJ 2RKSA 3NWSA 2IWHA 2NB0A 5K5PA 1BCPB 3ONAB 4A3FB 1PFNA 2PZWA 3J80L 1OXVA 3TMEA 1Y8NB 1Q1BA 1ENAA 1ONLA 1WTPA 2KCNA 1K8OA 3P1HA 1RTOA 2F0TA 5FO8B 2QDBA 2WIIB 5FO7B 1HCZA 1CQVA 3S16B 2AUKA 1MGSA 2WKCA 5J22A 1PRTD 4IUQA 2NN6G 4TRDA 3S14B 1EIGA 2KA7A 4FF2A 1GUWA 1NUCA 4C1NI 2AQ3B 1XXGA 4XYOA 4LJZC 3HGBA 2EXZA 4G7HC 3VR3A 4BY1B 3BDLA 1OXTA 2Z4HA 1C4QA 2CQAA 2BCOA 3TP5A 1M4VA 5DNFA 3PUZA 2KEDA 5TSSA 3I4NB 1DYQA 5NUCA 5EPLA 2A6HC 3ND9A 1LABA 1BOSA 2A6ED 1Q90A 3S1MB 2J0TD 4MHEA 3C46A 2F0PA 1SNPA 4ID6A 1Z7TA 5CV4A 2NTSA 4DAYA 2PCFB 3KBGA 2K1BA 1PMRA 3J7AV 1AW7A 5FK9C 3AMUA 3A56A 3NQIA 3BVGA 4FNFA 1JOOA 3HOVB 5IT9E 2FFKB 2M2LA 2XN9C 2SNMA 5KEEA 3SHLA 5J39A 2D9UA 2QKIC 4HAEA 3D6CA 1ZXTA 1LACA 1V1PB 3HRZC 3FPUB 2HUGA 2F0MA 1PZJD 1QNKA 2WAQB 1EIHA 1MD2D 2EY5A 1B4OA 3Q23A 1HPCA 1R4PB 4IUVA 4C3IB 5D3DA 2NWGA 3VR2A 3I90A 3TSSA 3A7LA 1U4RA 5JEAG 1TS3A 2EVBA 2B63B 3L7ZC 3EA6A 3DM1A 3KLSX 1WD0A 5T1GA 1RTNA 3HKZB 4DFAA 1SAPA 2HCIA 3I73A 1H9SB 5M5WB 1H9MA 3LX0A 4IZ8A 3K5LA 3VR6A 1DOLA 2KUMA 3DUZA 1EQTA 4CBVA 2EY2A 2SOBA 4XTCS 5C44B 4FP5D 4TSSA 2K6AA 4PMBA 2ID0A 2L11A 1HFGA 3R93A 2NVXB 1PRTF 4RH6A 2VB3X 3A54A 1SE4A 4HEDA 4EQNA 4P2CB 4ZAIA 4KY7A 1VF5C 5J1ZA 3C1EA 4IUNA 3P7JA 3E6ZX 3VA5A 3MXNA 1TWGB 1PTOF 1GUSA 4BBRB 4FYDA 2IX1A 3H0GB 4LAAA 5K36G 1T5XD 4DAPA 4KHVA 3IFTA 3S2DB 1MSHA 2EDGA 2K32A 3NWTA 2E2HB 5BN5A 3OWFA 4ODGA 1GHJA 2RA4A 4G7OC 4DAVA 1JWUD 1LTTD 1V1OA 3HOXB 2MUYA 2L12A 2BE5D 4OHJA 2DY7A 2EYLA 2LKVA 1GXDC 4F88A 3DHQA 2ICEC 1PFBA 5CV6A 1VMPA 1SJHD 1JWSD 4FO2A 1J9OA 3TZUA 2MPMA 2F1MA 1F9SA 4RGTA 3IL8A 1DM0B 1RJTA 3WDNA 5IOCA 4ZLTF 1PZID 4J8QA 4RHSA 2BA1A 4B08A 1PRTB 1AZQA 3CKIB 3N52A 3S2HB 3D8GA 4CJ1B 4BY7B 3Q6SA 1TWAB 4PMCA 4O1NA 1FYCA 1XWEA 4DF7A 3EROA 3J81E 3Q22A 2EPBA 1BCPD 1BR9A 1Q3LA 1FR3A 3MXGA 3OHXC 2FINB 2PNRC 1PTOB 2IL8A 2PYKA 1Y1WB 1QB5D 1STHA 1ESRA 3QJYA 2X6LA 3A7AB 1I4RA 1JE4A 2EYMA 3MFGA 1EY7A 5JAVA 5CBEE 2VUMB 1SDFA 1S4ZA 4CHTB 4CJ0B 3SK6A 4X3KA 1FNVA 2CVRA 3TDQA 3PUWA 2OF1A 4K8IA 1Q8IA 5KIXA 2B2VA 1SYDA 5KGUA 1GHKA 3NTHA 1JB3A 5CV7A 5I6YA 5IGEA 4RCOA 4C3IG 3VYRA 2A74C 5DM73 2PPBC 3OW7A 3QIAA 2WP8J 5JJZA 2AUJD 2IX3A 2XWJB 1RF2D 4XT1B 4H13C 1ET9A 4B9WA 1JC7A 2BA0A 4A3EB 1KTKA 3A8KE 1K8MA 5FOBB 1X3PA 3KK7A 1BUVT 2HQEA 1F2MA 3K58A 4V0BA 1LTID 4BBSB 1HQRD 3RMHA 2F03A 4G7ZC 5FO9B 5M3MB 2J4XA 3H94A 1AZPA 5DM63 2K05A 2DNEA 4YIJA 2FJ2A 3X3NA 5F2DA 3OMCA 2XNAC 1EYCA 3BDCA 4OO1G 3Q24A 2NUCA 3QOLA 5C0XG 4KKTA 1A15A 1JOQA 1IKMA 3MC0B 2G9HD 4FF1A 4ZKCB 3DWQA 5D65A 3KLSA 5IGBA 1DONA 3SE0A 5E3FA 2MHVA 1ZKOA 3HG9A 5C4HA 2ICIA 1H9KA 3V05A 5C6AA 4Q5VA 4XYQA 1QILA 2YYZA 3RZOB 1IW7D 2F0HA 3KUPA 1I4HA 2DNCA 1NAPA 4JBWA 1FNWA 1EOTA 5KYIA 5ISRA 4IALA 5E1FA 4CKBA 3LNNA 5AFWA 5JPMC 1CZGA 4TKOB 1SNOA 1TQOA 5C3EB 1KDBA 1RODA 3TP8A 4CKEA 1T5EA 3GD7A 4O42A 1Y1VB 2R6GA 2D62A 3PIO3 3VYSA 2F0SA 3GTKB 4IFDI 1GUTA 4KKSA 2B2VC 4NDXA 1EYDA 1QG7A 1STNA 1CI3M 2QILA 2PO4A 2BDNA 2O4XA 1SE2A 1B9MA 4IURA 4OL7A 1AN8A 5COYA 4FVMA 1EZ6A 2EY6A 1FNUA 3BZDB 3GTGB 5FLXE 2EYHA 4F7XA 1WVLA 3U9SA 2M9VA 4ZUJA 1F9RA 5M5XB 3AU7A 4KY5A 3FDTA 1JOKA 1CK1A 2B2YC 3FRPB 5EBCA 4QF4A 4ILWA 1STEA 1QJOA 2JXMB 4RCNA 1C8CA 3R3OA 4KV6A 4GZYC 3HOYB 2IW3A 3M7NA 1GOZA 1L0XB 1SYFA 4ABNA 4RAUC 1STYA 2HDMA 2IPKD 2NN6H 1BDOA 2OXPA 1EEID 2R93B 3C1FA 1WTWA 2SNSA 3H6MA 5EKKA 4A3JB 1CHPD 4KI0A 2TSSA 1EEFD 2E76C 1OXSC 1SMYC 1W6JA 1LT6D 2B8FA 2PW5A 1D5XC 2K01A 1ESFA 4F8MA 2NVQB 4KY6A 5A2QL 1EZ8A 1PTOD 3EJIA 1NCVA 4L8JA 2MJ8A 3SVMA 1KABA 1STGA 4DGZA 1ZYRD 3NK9A 1V43A 3I72A 4A3BB 4OIJA 1SXTA 1A3UA 4H44C 3J80E 3OOCA 3J7YW 1ICWA 5CMDA 3I70A 3DWAA 1TIID 4H7BA 1PRTC 5LHY1 4UDUC 1TVXA 5KYLA 4DK1A 2C9OA 4HMJA 1F77A 4IFDJ 3I3CA 2PQEA 1OO9B 4K14A 3PMFA 1XX8A 4R9WA 2RDGA 2ZT9C 1TU2B 4EGVA 2PZTA 5JEAH 3FMCA 1LT4D 3V2TA 4F87A 1JICA 4XXEA 3MZ5A 4M8AA 4DU9A 3QWNA 2A6EC 3E5SA 2XRQD 1WTVA 5ELBA 1HA6A 4ZKBB 2BDOA 1TY2A 4C1NK 1A3VA 3DEOA 5I2XA 1B53A 4C3HB 4V190 2A5HA 4K5WA 1XYIA 1TS5A 3D4WA 1PYWD 1Q12A 1QOHA 3VYUA 2H4OA 1WTXA 3S1QB 4WJWA 4XIGS 1PFMA 3SEBA 5EQ0A 5ELDA 1LTSD 3KF8A 1Y69U 4C2MB 2EYPA 3W2DA 1DCZA 4Y7NB 2I07B 2CW0D 4ULLA 3H09A 2B2WA 1D5ZC 3RLFA 1HHVA 1W6KA 4HN7A 1A3TA 1RKNA 3ERQA 4QUFA 1RHPA 3ITPA 4RA8A 1O7LA 5JPNC 3PO2B 3HP3A 3HOUB 1TWHB 3GTQB 2E74C 1HRJA 3BYYB 1HUNA 3QOJA 1F9QA 1DOKA 4N9PA 1MSGA 2X69A 4S3SA 5K36H 1LLRD 5T1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUV A;  1MSH A;  2N88 A;  3I3C A;  2Q8R E;  1NR2 A;  1O80 A;  2NWG A;  1PDQ A;  3I90 A;  1XX8 A;  1MGS A;  1C8C A;  3QO2 A;  1WTR A;  4R9W A;  1E0B A;  1U4R A;  2RA4 A;  4IUQ A;  3G7L A;  1EIG A;  1BF4 A;  3MTS A;  1KNA A;  3KUP A;  1GUW A;  1NAP A;  1NR4 A;  1VMC A;  4RAU C;  1X32 A;  3UI2 A;  2L12 A;  4QUC A;  2HDM A;  3IFD A;  4X3T A;  3TZD A;  1BNZ A;  3DM1 A;  4UAI A;  4LMQ D;  5D14 A;  1WD1 A;  1EOT A;  2DY7 A;  3GV6 A;  1WD0 A;  1WTW A;  3F2U A;  5JJZ A;  1U4L A;  3GV3 A;  1JIC A;  1B50 A;  5T1G A;  1RTN A;  4XT1 B;  1O7Y A;  1PFB A;  1VMP A;  1F9P A;  1IKL A;  1J9O A;  1SAP A;  2HDL A;  1ILP A;  2HCI A;  2MPM A;  2B2W C;  5AFW A;  1G2S A;  1WTV A;  2L4N A;  1WTQ A;  1F9S A;  1SSO A;  2L1B A;  3IL8 A;  1ML0 D;  2KED A;  4X3S A;  5DNF A;  5E4W C;  1RJT A;  1X3P A;  1HA6 A;  1DOL A;  4XT3 B;  4ZKB B;  1B3A A;  2KUM A;  1O7Z A;  2RSO A;  2MGS A;  1EQT A;  1X3Q A;  4ZLT F;  1BBX C;  1ROD A;  5EPK A;  4IUT A;  3H91 A;  1G91 A;  4O42 A;  3D6W A;  1CM9 A;  3DEO A;  1U4M A;  3MWY W;  2JYO A;  2B2T A;  5EPL A;  2K04 A;  2NYZ D;  4NW2 A;  2KEE A;  1B53 A;  4OIK A;  1AZQ A;  1G2T A;  3N52 A;  3LWE A;  1LV9 A;  5COR A;  5E4X A;  2L11 A;  1B2T A;  4CJ1 B;  2K01 A;  1HFG A;  3Q6S A;  4MHE A;  3R93 A;  4IUP A;  1XYI A;  1AZP A;  5EPJ A;  1J8I A;  2KVM A;  2B2V C;  4XDX A;  4ZK9 B;  1CA5 A;  2K05 A;  2FJ2 A;  4HED A;  3I91 A;  2FMM A;  3TN2 A;  1QG7 A;  2RVL A;  2R3Z A;  1IL8 A;  5EJW A;  2EPB A;  5CBA E;  2J7Z A;  4ZAI A;  2SDF A;  2K1B A;  1WTO A;  2X6G A;  1WTX A;  1CA6 A;  4X3U A;  2B2U A;  4R8I A;  1NCV A;  2KEC A;  2N55 A;  1PFM A;  2MJ8 A;  3SVM A;  1Q3L A;  2BDN A;  1ILQ A;  5EQ0 A;  4MN3 A;  2NZ1 D;  2FIN B;  3DEP A;  1G6Z A;  1DOM A;  4IUR A;  2FFK B;  2M2L A;  5COY A;  3P7J A;  2IL8 A;  2XIW A;  3ONA B;  1EL0 A;  2VXW A;  1ESR A;  1HFN A;  1AP0 A;  1PFN A;  2L9H A;  2B2Y A;  2X6L A;  1M8A A;  4OIJ A;  2MP1 A;  2B2W A;  2D9U A;  1JE4 A;  2EOT A;  1A15 A;  4HAE A;  5EKI A;  4U68 A;  3KBX A;  1HHV A;  5CBE E;  1IKM A;  1ZXT A;  4IUU A;  4QUF A;  1SDF A;  1ICW A;  1RHP A;  1WTP A;  1BO0 A;  4RA8 A;  2K03 A;  2H1E A;  5CMD A;  1S4Z A;  4CJ0 B;  1PLF A;  1MI2 A;  3HP3 A;  4HSV A;  2RSN A;  4DN4 M;  4ZKC B;  1WVL A;  4X3K A;  1HRJ A;  2B2U C;  3FPU B;  1HUN A;  1F9Q A;  1RTO A;  2EE1 A;  1DOK A;  2HUG A;  4HCS A;  1F9R A;  1DZ1 A;  5D65 A;  1MSG A;  3I8Z A;  2CVR A;  2FHT A;  1U4P A;  2K28 A;  2Q8T A;  3FDT A;  1QE6 A;  1F2L A;  1DON A;  1QNK A;  4CJ2 C;  2JP1 A;  1TVX A;  2HCC A;  2X69 A;  1HUM A;  2B2T C;  1EIH A;  1B4O A;  2B2V A;  4RWS C;  5T1I A;  2B2Y C;  1KNE A;  2DY8 A;  2KOL A; 
#chains in the Genus database with same CATH topology
 2WV6 D;  1UWV A;  4EQ5 A;  2Z1C A;  1EFI D;  2NVY B;  4R8N A;  1D6E C;  1D5M C;  1RCV D;  2ES2 A;  3G7L A;  3PGZ A;  3BJU A;  4RGN A;  4A93 H;  1NR4 A;  1D1K A;  1JJC B;  1VMC A;  4OGQ C;  3S16 H;  3GTP B;  3HOY G;  2JEB I;  4R1J A;  5C5M A;  2DJF C;  3S17 B;  3HOZ G;  3K5O A;  1PH7 A;  2Q2U A;  3SXH A;  4UP9 A;  2R93 G;  1NBW A;  1E2V A;  2O5I C;  1SSO A;  4RFB A;  4DV5 L;  2C35 B;  3SK4 A;  5CV5 A;  4A3J G;  4BY1 H;  2YU9 H;  3R8B A;  4DV1 L;  1IYU A;  1CM9 A;  2I5H A;  1U4M A;  4JI5 Q;  4PZ8 A;  4AQY L;  4LUV A;  2VB2 X;  3VDY A;  3BVM A;  1JR0 D;  1B2T A;  4ZYS A;  2XGT A;  1CA5 A;  4DUZ L;  2IHE A;  4IOA A;  1KD1 C;  2R3Z A;  2J7Z A;  3NHH A;  1SR3 A;  1TWF B;  1CA6 A;  4R8I A;  3CXC A;  4JI4 Q;  4KD4 A;  3S1M H;  3D0F A;  5CV9 A;  1DOM A;  5JJK A;  1EY9 A;  2XIW A;  3HZX A;  1SYB A;  2VXW A;  4GS3 A;  1HQM C;  3ICE A;  2EOT A;  3HOV H;  4IUU A;  3EN2 A;  1UE5 A;  3BU2 A;  3SDZ A;  4J15 A;  4A3B G;  2A73 B;  4R4Q A;  3FPP A;  2OT2 A;  3S1N B;  4ME5 A;  4LFA Q;  5JJI A;  2RSN A;  2Q8I B;  3URY A;  2BH8 A;  4U67 3;  2B2U C;  1PFS A;  3A8I E;  4DR3 Q;  2KCC A;  1Q86 C;  1K8G A;  1S5D D;  3UE1 A;  1I50 B;  2K28 A;  3V96 A;  2A68 D;  4JI3 Q;  5JJL A;  1E2Z A;  2WB1 B;  1BVS A;  5IP7 H;  2BE5 C;  1V1P A;  5C4J B;  1CZW A;  3K8A A;  1NR2 A;  4DNT B;  2WB1 E;  1QVG A;  4K6D A;  1H9J A;  1HTP A;  2XRS D;  5ELC A;  1U5K A;  5M9O A;  1KNA A;  3A55 A;  4A3L H;  5C4X B;  3ND8 A;  3PUV A;  1Y8O B;  1KL9 A;  4C3I H;  2AWN A;  2XVS A;  3JC6 6;  3F2U A;  2LMC B;  1O78 A;  2F3V A;  2F3W A;  3NEN A;  1CT1 D;  1C48 A;  2MO0 A;  1IKL A;  4DR7 Q;  2B2W C;  1IBM Q;  3T51 B;  1KC8 C;  3N6R A;  3A5U A;  3DLL A;  1CFM A;  1EWC A;  4OX9 Q;  1PYS B;  1O7Z A;  4YHH L;  1X3Q A;  3H91 A;  1IHZ A;  2XWB B;  3PO3 B;  4RHR A;  2RQX A;  2RBM A;  5LMU L;  4N8F A;  1M90 C;  1BCP C;  5EAY A;  4JCV E;  5M5W H;  1XPR A;  2R7Z B;  2KEN A;  1H9S A;  4LFB Q;  1SE3 A;  1JCK B;  2ZM6 Q;  4C3H G;  2TMP A;  1CQF A;  2FMM A;  3ERS X;  2ASB A;  4JV5 L;  3CHB D;  1E1O A;  2N55 A;  1OXU A;  5C3X A;  4MN3 A;  1SYG A;  3F8T A;  2NZ1 D;  4JI7 L;  4JI0 L;  2A8V A;  1G6Z A;  1TR5 A;  1S5F D;  2JA5 B;  3SK8 A;  4OO1 H;  1PZK D;  5J3B A;  3EVQ A;  4X64 L;  1EL0 A;  1HFN A;  4RKL A;  1V8Q A;  2B2Y A;  3NEL A;  2Z6B A;  1PHJ A;  1Q1E A;  2HIX A;  5C0X H;  3C2P A;  5BN3 A;  3I4L A;  2AWO A;  1EYA A;  1LT3 D;  1YNJ D;  1VDZ A;  4M1U B;  4HSV A;  2QDL A;  1STB A;  4DN4 M;  1BQQ T;  2EJM A;  3K59 A;  1HNX L;  3RN5 A;  1ET6 A;  1AEX A;  2EYJ A;  2IX0 A;  1I4G A;  4YWL A;  3SR1 A;  1RDP D;  2F0O A;  3PO2 G;  4BBR H;  3HOU G;  4DV5 Q;  3T1Y L;  4HTH A;  4NB3 A;  3HEJ A;  3HKS A;  4LUZ A;  2EIF A;  4IQZ A;  4WRD A;  2F4I A;  3JAM L;  3PF5 A;  2E5L L;  2DJG C;  3RZD B;  1JWM D;  1A6X A;  1SNM A;  4DV1 Q;  1HZC A;  3H0G H;  3NSW A;  1LT5 D;  3JAM i;  4P73 A;  1PDQ A;  4AQY Q;  4A3I H;  1YNN D;  5C5L A;  1LTA D;  3I4M B;  2G5D A;  1NMF A;  2R92 H;  5JOB A;  3IAY A;  4DUZ Q;  1X32 A;  3FVQ A;  2F0J A;  4XQN A;  4HCE A;  3T16 A;  2E2H H;  4MZ9 A;  1ENF A;  1GUN A;  2F0G A;  1EIY B;  1IYV A;  4QY7 A;  3OW2 A;  3TRZ A;  4RGO S;  2ZXP A;  1KIX A;  1EOV A;  3QG1 A;  4RG1 A;  4CGY B;  3J7Z C;  4MIU A;  3HOX H;  2A69 D;  5E4W C;  3CU7 A;  4IPC A;  4AYB E;  2PI2 A;  4DR4 Q;  2Y0S B;  1CKN A;  1R9T B;  4DNR B;  2Z9H A;  4DAY B;  1A62 A;  2ZXR A;  2UUB L;  3OSO A;  1M1K C;  2JJQ A;  4GLV B;  5M5Y H;  3KF6 A;  4HMI A;  2JA8 B;  3T4A C;  3H3V H;  2PW7 A;  5E4X A;  2B39 A;  2Y0S E;  1V1Q A;  3TP7 A;  5JVG 3;  1J8I A;  1XPU A;  4KKU A;  1OXX K;  2D2C C;  2F0W A;  4GOP B;  4JI6 L;  3TN2 A;  2KHS A;  1A0I A;  3OWE B;  1X65 A;  1SNC A;  4HJ8 A;  2SDF A;  3S2H H;  4X3U A;  1XMO L;  1SMX A;  1MJC A;  3EBE A;  4BA2 I;  3K80 C;  3MEH A;  5H1S E;  4BY7 H;  4L5S A;  1EQV A;  3LGJ A;  2AQ2 B;  3VR5 A;  3PIO A;  3KLR A;  4GN3 B;  1B9N A;  1EY0 A;  2XSC A;  4H02 A;  1B7Y B;  4XQQ A;  3NPP A;  1HXY D;  2A1A A;  2E2D C;  1D8L A;  3U9O A;  4GNX A;  4PZ6 A;  1UEB A;  5G3L F;  1PVO A;  1PTO H;  1TS4 A;  1Y1W H;  2R7D A;  3RN2 A;  1VQI A;  1CSQ A;  3NTK A;  5IGF A;  5FLM G;  1LTR D;  4A3M B;  1YHA A;  3QR8 A;  2F0F A;  4BWG B;  3I8Z A;  2FHT A;  1QE6 A;  1IW7 C;  2VUM H;  4JC0 A;  3U50 C;  4QMG A;  1EY8 A;  4YHH Q;  2JA6 B;  2VZA A;  3J81 c;  4DV6 L;  1CTM A;  5LMU Q;  1EY6 A;  2Q8R E;  2WB1 G;  2WAC A;  3KDF A;  3HS0 C;  4IFD G;  3QO2 A;  4K8J A;  2JK8 A;  3L9A X;  2IT1 A;  1I6V C;  4DV2 L;  2JE6 I;  4WOR A;  4A75 A;  1Q7Y C;  2LFN A;  1TY0 A;  3D3R A;  1I4X A;  3X3M A;  2E2I B;  3KJO A;  3WWV A;  2RDF A;  4N9T A;  4YWM A;  4C3J G;  1B50 A;  5C4X G;  1XTC D;  1VQ9 A;  4DV7 L;  5C4Z A;  2SEB D;  1CKO A;  1O7Y A;  4IPH A;  3CME A;  4JI7 Q;  4JI0 Q;  3T1H L;  2ENB A;  5M3F B;  1GKH A;  5C3W A;  3L0O A;  4X64 Q;  1HNZ L;  3W5O A;  1K28 A;  1FL0 A;  1C0A A;  2MGS A;  5BN4 A;  3NBH A;  1HTL D;  3D6W A;  4LK1 C;  3HOZ B;  1W3S A;  4A76 A;  3LWU A;  2EYF A;  3K7U C;  4NW2 A;  2I46 A;  3E9H A;  5KNC A;  4LF5 L;  4R4C A;  1VQF A;  2L5T A;  4KMU C;  5EKL A;  1UAP A;  4XQJ A;  1VQK A;  1HNX Q;  2NN6 I;  2R7Z G;  4FXK C;  4JYA L;  5IYD G;  5FJ8 G;  3MXN B;  4OEM B;  4DUY L;  4N8X 1;  4BBS H;  3T1Y Q;  5IT9 L;  3G71 A;  4H0L C;  1SJE D;  2E5L Q;  2O5J C;  1JOR A;  2A6H D;  4KJO A;  1ILQ A;  4O0A A;  3NP8 A;  3DEP A;  3J7A F;  3D4R A;  4KHP L;  1TXY A;  4A93 B;  1NE3 A;  2JA5 G;  3GQB A;  2C5C A;  1LYL A;  3K7A H;  1D1I A;  3K0X A;  4NXN L;  1ENC A;  3H15 A;  1EY4 A;  2H1E A;  1GM5 A;  3I4O A;  5EGT A;  3G6E A;  2DN8 A;  1MI2 A;  3F2C A;  4DR1 L;  1YIT A;  5ELO A;  3KLW A;  5HY6 A;  4C56 C;  1I5F A;  2VS1 A;  4DK0 A;  1SFO B;  1K9M C;  2F0E A;  2V4D A;  2JP1 A;  2E8G A;  2HCC A;  1MBY A;  1X3E A;  2YU9 B;  1VF7 A;  4E6I A;  5JVH 3;  1VQ6 A;  2LY7 A;  2PQA A;  2KOL A;  3K57 A;  2I5L X;  3H3V C;  2D5D A;  2UUB Q;  3RLN A;  1FJG L;  2JA7 B;  1QUQ B;  4RMF A;  4UP8 A;  2K5D A;  3P20 A;  4DA2 A;  1WTR A;  1EQQ A;  1BF4 A;  3CRK C;  2K52 A;  2CKZ B;  1UNS A;  3O13 A;  5D3I B;  1UE1 A;  4JI6 Q;  4X3T A;  3SK5 A;  4ZUI A;  3I4M G;  3NUC A;  2F0I A;  5IOD A;  4L6T B;  4DR2 L;  2E75 C;  1XMO Q;  3DMU A;  3RZO H;  4L63 B;  1VQ4 A;  3GDE A;  4P72 A;  1QZH A;  1ILP A;  4Q0F A;  1DD2 A;  1QNU A;  2Z4I A;  4AYB G;  2XTI A;  3I56 A;  2KQ3 A;  1ASY A;  5CV8 A;  5CGK A;  4GNX C;  3CCE A;  1YNX A;  5DAU A;  4NPS A;  4DV4 L;  5EPK A;  1S5C D;  1SLJ A;  5LL6 S;  2JYO A;  1PTO C;  2K04 A;  2NYZ D;  2Y0S G;  3CRL C;  4TVA B;  1TWC B;  2AQ1 B;  2NTT A;  2F0L A;  1ZYR C;  3CAM A;  1IBK L;  2F0Q A;  4HR7 B;  4RKB A;  5C3E H;  2JA8 G;  3Q8D A;  4IPD A;  3ULL A;  3I91 A;  3DWP A;  4KK7 A;  1Y1V H;  4J1M A;  1I4P A;  3ZYY X;  1WTO A;  1E2W A;  2B2U A;  4JI8 L;  3K0Y A;  1B1Z A;  3GTK H;  3NXW A;  4DV6 Q;  5A2Q E;  4OWW B;  1EY5 A;  4YY3 L;  1D2B A;  1RIP A;  4APV A;  4QCL A;  5KRU A;  1XNR L;  2B8G A;  1SE8 A;  1BXT A;  2IHF A;  1Z6H A;  4DV2 Q;  4HID A;  2MP1 A;  5HGT A;  1VQ7 A;  2JSO A;  3FKI B;  4A3C G;  3M4Y A;  2K5N A;  5EKI A;  4FXD A;  3KBX A;  3R2I A;  4AIM A;  3M4O B;  3ULP A;  1KLU D;  2K03 A;  4LF8 L;  2F0V A;  1WI5 A;  1QWY A;  4Z9C B;  1L2F A;  2E2J B;  3NQT A;  5IYB H;  4BA1 I;  4K2L A;  4NKL A;  1TT2 A;  2EE1 A;  3CD6 A;  3T1H Q;  3AQQ A;  2CH4 W;  4CJ2 C;  3NBI A;  3WOF A;  1HNZ Q;  1HUM A;  3GTG H;  4A3M G;  2RCF A;  4JOI A;  3OPO A;  1X3G A;  3UI2 A;  3GTJ B;  2RHS B;  3I55 A;  1MJE A;  3MXU A;  3BVZ A;  1O80 A;  3W1G A;  5M5X H;  1Q8K A;  1CUK A;  1XPO A;  4GKK L;  1UE6 A;  5GAE C;  4LF5 Q;  5IIF A;  1SYE A;  1A2U A;  1PH9 A;  4A3K B;  3GP7 A;  3TBI B;  4JYA Q;  3PUY A;  1MKH A;  4KHZ A;  4DUY Q;  1BNZ A;  3GV6 A;  1BKB A;  1I4Q A;  1X56 A;  3HOY H;  1UUP A;  2UXD L;  5FLX c;  3AB9 A;  1PH3 A;  3E3X A;  1WCM B;  4KHP Q;  3L2P A;  4X3S A;  1ML0 D;  5E7N A;  4OXP A;  4XT3 B;  1B3A A;  4EQO A;  4B9X A;  1VCI A;  2F0U A;  5M3F G;  1SNQ A;  1S72 A;  3D31 A;  4NXN Q;  4A3J H;  5IGD A;  5I4D A;  2I0Q A;  3RUZ A;  1I94 L;  2EY1 A;  1RD9 D;  3J81 L;  2ZXO A;  4DR1 Q;  4IUP A;  5EPJ A;  3GTM B;  3S15 B;  3AEV A;  5GAD C;  3S14 H;  2CW0 C;  3PIP A;  1XNQ L;  3K5M A;  3J81 i;  2RF4 A;  5EJW A;  3HOW B;  1X55 A;  3STB C;  3PIP 3;  3PSI A;  3NE5 B;  1B44 D;  4I65 A;  4B3S Q;  5KNB A;  4A3I B;  3BG3 A;  1FJG Q;  3M3Y B;  5LMN L;  3VYT A;  2NVQ H;  1G29 1;  1GUG A;  3BYT B;  3IKJ A;  4JBJ A;  1VQ8 A;  2R92 B;  2K5Q A;  4Y52 H;  3I4N H;  1U0L A;  3L3O C;  2WIN B;  4DXF A;  4A93 G;  1DXM A;  1L0Y B;  1YBY A;  3RD4 A;  4NMZ A;  1P8L A;  4DR2 Q;  3P75 A;  3J81 j;  1WOC A;  1SRO A;  1N8R C;  4WFN 3;  3CQZ B;  4A3B H;  1JB7 A;  2Q8T A;  1U4P A;  1F2L A;  4ZRZ A;  1E7Z A;  4OEL B;  1H9R A;  5FKA C;  5I6W A;  2K5W A;  4DV0 Q;  3KOJ A;  1GUO A;  4DV4 Q;  2OEO A;  3A8J E;  1KNE A;  5M5Y B;  3TEH B;  1IBL L;  1U9R A;  5IGG A;  4DXG A;  3EQL C;  3T53 B;  5JEA J;  4A3G B;  3S1R B;  4IN3 A;  4OWT B;  5DEH A;  1IBK Q;  4DK6 C;  1EU4 A;  2JEA I;  1L1O B;  2JA7 G;  3TP6 A;  4QUC A;  3IFD A;  4PMW A;  4R4I A;  4LMQ D;  2Z8L A;  1WTH A;  2UXC L;  1R4Q B;  1U4L A;  3Q0A A;  4JI8 Q;  2VNU D;  5ELE A;  3J80 c;  3OIQ A;  4QB4 A;  5AJ3 L;  2HDL A;  4YY3 Q;  2L4N A;  3CCU A;  1PH8 A;  5GAH C;  1EYG A;  1CHQ D;  1STA A;  4C3J B;  4KN7 C;  1J6Q A;  2B2T A;  1B3Q A;  1QCB D;  4I7Z C;  1EU3 A;  1GD7 A;  4AH6 A;  1HZ9 A;  2LXK A;  5COR A;  3OMG A;  4LF8 Q;  3UDX A;  4R4O A;  3MHB A;  1F2Y A;  4XDX A;  4ZK9 B;  1N9W A;  4JOI C;  2YTX A;  3BDO A;  1Z47 A;  3MAQ A;  2EJF C;  2RVL A;  1SRU A;  2B63 H;  4DV3 L;  1UEA B;  3CP0 A;  4GKJ L;  4C3H H;  1EWH A;  2KEC A;  2NVT B;  3MA2 B;  1GJX A;  4FXG C;  4K5X A;  1BBW A;  4K6L A;  1PXU A;  5IP7 G;  5G3L D;  1I3Q B;  2OQ0 A;  2Z0S A;  1KLG D;  4GKK Q;  1AP0 A;  2QF7 A;  2AHO B;  1VQL A;  3MFY A;  2A68 C;  2NBF A;  3S1Q H;  3WOE A;  4U68 A;  4IJH A;  4K0K L;  1WFQ A;  3DXJ C;  4C2M H;  5C44 H;  1Y8P B;  3FKI G;  1JQY D;  2NZH A;  1PLF A;  4Y7N H;  2UXD Q;  2CFM A;  3AFP A;  3T13 A;  4HCS A;  3B6Y A;  1DZ1 A;  2NVX H;  2KJX A;  4JI1 L;  2OCE A;  4ZQ3 A;  1SND A;  2VQF L;  2K33 A;  2K5V A;  4LF9 L;  4PQX A;  3OIP A;  5EBD A;  2DY8 A;  3PO2 H;  3HOU H;  1TWH H;  2F52 A;  3GTQ H;  4OO1 I;  1TS2 A;  3MXP A;  2ZJP A;  3CW2 C;  1LO5 D;  2BOS A;  4FF3 A;  1E0B A;  1I94 Q;  2HHH L;  5C0X I;  1SBB B;  4KJN A;  3S9W A;  1TWG H;  1IZ6 A;  1E24 A;  4RGM A;  3UE0 A;  1XNQ Q;  3TZD A;  1S5B D;  2L55 A;  2LSS A;  4UAI A;  2R61 A;  1WD1 A;  5D14 A;  1KDC A;  5BR8 L;  3QB3 A;  2NVY H;  3GV3 A;  4A3K G;  4KN4 C;  3K6O A;  1HZA A;  1ZEQ X;  4JK1 C;  2N3S A;  4KTA A;  1EUJ A;  1NTG A;  5LMN Q;  2L1B A;  2FMC A;  2RSO A;  2F0K A;  5IGC A;  1PH2 A;  3S17 H;  3K7A B;  3E0E A;  1WCM G;  4TQU S;  4HSP A;  3S2D H;  1G2T A;  1LV9 A;  4AYB B;  2CWP A;  2LS0 1;  3E0J A;  2GVA A;  2KVM A;  2M00 A;  4LF4 L;  3GTL B;  1TKW B;  1PH5 A;  3R2T A;  1I6H B;  3BS1 A;  1KDA A;  2PMZ B;  2PQA B;  1KAA A;  3FEW X;  3NTI A;  4QIW B;  1PH6 A;  5CBA E;  3G6J B;  5IYC H;  1FGB D;  4BS9 A;  2X6G A;  1YI2 A;  4X66 L;  4CKC A;  4FF4 A;  2L0C A;  2MNA A;  1SYC A;  5CYU A;  4NXM L;  1IBL Q;  1YNJ C;  3HOW G;  5KND A;  2PMZ E;  5A35 A;  4QIW E;  1WYD A;  3ULJ A;  1NJI C;  2WKD A;  2L9H A;  4PV1 C;  1NSN S;  3RNU A;  1LM0 A;  4A3I G;  2K5H A;  4O2D A;  1M8A A;  5HUR A;  4PNY A;  1TWF H;  5I9P A;  5FLX L;  2EYO A;  1BCP F;  3M7G A;  3VR4 A;  1II3 A;  5CC4 A;  1SEB D;  2R92 G;  3H3V I;  1BO0 A;  1PH4 A;  2UXC Q;  2RDH A;  4G57 A;  3T56 B;  1S5E D;  1D7Q A;  5AJ3 Q;  2QEJ C;  1YNN C;  1FD7 D;  1A2T A;  1P16 A;  1TWA H;  1L0W A;  3M85 A;  5FLM H;  1B70 B;  2B2T C;  1AFP A;  2CHB D;  4RWS C;  1LTG D;  3S1N H;  2QCP X;  1G8Z D;  2G9D A;  3MVV A;  4UY8 C;  3IRB A;  4NP5 A;  1PV4 A;  2N88 A;  4MTK A;  3JAM E;  3CC4 A;  1K83 B;  1I50 H;  2K7V A;  2EZV A;  1F2Z A;  4YWK A;  1S3O A;  2GA4 B;  3MTS A;  2A69 C;  4A3G G;  4IFD H;  2F0N A;  2F3I A;  3EFX D;  3KYH C;  4EVO A;  1C7Y A;  5I2Y A;  4JBK A;  4X62 L;  5C4J H;  5ELF A;  3D4D A;  4GKJ Q;  4J6H A;  3VA7 A;  2O2L D;  1KXL A;  3F2B A;  4A3D B;  3PV0 A;  1F9P A;  4K2K A;  1HA5 A;  4JI2 L;  1Q81 C;  5C4X H;  1G2S A;  1WTQ A;  4K5V A;  2MO1 A;  1LTB D;  3K5N A;  1BBX C;  1G91 A;  4IUT A;  4BXX H;  5I9O A;  3W3A A;  4GN4 B;  4UHV A;  1HR0 W;  1DJR D;  2PZU A;  3MWY W;  4KD3 A;  3PUX A;  2KEE A;  4OIK A;  3SGI A;  4JV5 Q;  3LWE A;  3KF8 B;  4G4K A;  4EQP A;  3C3L A;  2F0D A;  3GO5 A;  5CR3 A;  2IJ0 A;  1VQA A;  2EJG C;  3PO3 H;  3CCM A;  1SMY D;  4JI1 Q;  1GVP A;  1IL8 A;  2VQF Q;  1VQG A;  2R7Z H;  5LL6 X;  5IYD H;  3GTO B;  4LF9 Q;  2N49 A;  1VQD A;  5C0X J;  2RKS A;  3NWS A;  2IWH A;  2KCT A;  2NB0 A;  3HFZ B;  5K5P A;  1BCP B;  4LF7 L;  3ONA B;  4A3F B;  1MIU A;  1PFN A;  2PZW A;  4YCV A;  4DR5 L;  4A3E H;  3PF4 A;  1A8V A;  2HHH Q;  3J80 L;  1OXV A;  3TME A;  1Y8N B;  1Q1B A;  1ENA A;  2Q2H A;  4X6A H;  1ONL A;  3A74 A;  3J80 i;  3I7F A;  1WTP A;  2JA5 H;  5BR8 Q;  2KCN A;  1EIF A;  1K8O A;  5M3M H;  3P1H A;  1RTO A;  2F0T A;  1VQC A;  5FO8 B;  2QDB A;  1JT8 A;  1KAW A;  2WII B;  1KRS A;  4DK3 C;  5FO7 B;  1HCZ A;  1CQV A;  3S16 B;  2ATW A;  4MTN A;  2AUK A;  4PG3 A;  4L5Q A;  1MGS A;  2WKC A;  5J22 A;  1NY4 A;  1PRT D;  4IUQ A;  2NN6 G;  4TRD A;  3S14 B;  1EIG A;  2KA7 A;  3PCO B;  2NZO A;  4LF4 Q;  4FF2 A;  1GUW A;  1NUC A;  4C1N I;  3CCS A;  3RZD H;  2AQ3 B;  4IO9 A;  2ZJR A;  1XXG A;  4XYO A;  4LJZ C;  3HGB A;  2EXZ A;  4G7H C;  1YEZ A;  3VR3 A;  4BY1 B;  3BDL A;  4X66 Q;  2HQL A;  1OXT A;  2Z4H A;  3I4M H;  1C4Q A;  4NXM Q;  2CQA A;  2BCO A;  3TP5 A;  1E3P A;  1M4V A;  4PZ7 A;  3CC7 A;  5DNF A;  3PUZ A;  2KED A;  5TSS A;  4HJ5 A;  1HH2 P;  3I4N B;  1DYQ A;  4P74 A;  5NUC A;  5EPL A;  2A6H C;  3ND9 A;  4IJL A;  1LAB A;  1BOS A;  2A6E D;  1Q90 A;  3S1M B;  2J0T D;  4MHE A;  3C46 A;  2F0P A;  1SNP A;  1R9T H;  4ID6 A;  2RCN A;  1Z7T A;  5CV4 A;  2NTS A;  4DAY A;  2PCF B;  3KBG A;  2K1B A;  1PMR A;  1X9N A;  2JA8 H;  3J7A V;  1AW7 A;  5FK9 C;  3AFQ A;  3AMU A;  3A56 A;  3NQI A;  3BVG A;  4FNF A;  1JOO A;  3HOV B;  5IT9 E;  2KCM A;  2FFK B;  2M2L A;  2XN9 C;  2SNM A;  1ASZ A;  5KEE A;  4X65 L;  3SHL A;  4GOP A;  5J39 A;  2D9U A;  2QKI C;  2L15 A;  4HAE A;  1K0R A;  3RLO A;  4X62 Q;  3D6C A;  1ZXT A;  3E9I A;  1LAC A;  1V1P B;  4POG A;  3HRZ C;  3M4Q A;  5IP9 G;  3FPU B;  3CCJ A;  2HUG A;  2OTJ A;  2F0M A;  4JI2 Q;  1PZJ D;  4HJA A;  1X3F A;  1QNK A;  2ZTE A;  4QJF A;  2WAQ B;  1EIH A;  1MD2 D;  2EY5 A;  1B4O A;  3Q23 A;  1HPC A;  1R4P B;  4IUV A;  4C3I B;  5D3D A;  4A3M H;  2NWG A;  3VR2 A;  3I90 A;  4FDB A;  1PH1 A;  2R7F A;  2WAQ E;  1VQN A;  3TSS A;  3A7L A;  1U4R A;  5JEA G;  1TS3 A;  1A63 A;  3RR5 A;  4DV7 Q;  2JA6 H;  2EVB A;  2B63 B;  3L7Z C;  3EA6 A;  3MEF A;  2EQS A;  2ZTD A;  3DM1 A;  3KLS X;  1WD0 A;  2ZJQ A;  1K73 C;  2GVB A;  5T1G A;  1RTN A;  3HKZ B;  4DFA A;  5GQO A;  4JW0 A;  1SAP A;  2HCI A;  3I73 A;  1H9S B;  5M5W B;  1H9M A;  1IL2 A;  4LWC A;  2K50 A;  2B29 A;  1KQS A;  2E2I H;  3LX0 A;  4IZ8 A;  3K5L A;  4LF7 Q;  3VR6 A;  1DOL A;  4DR5 Q;  2KUM A;  3DUZ A;  4A3D G;  2MFI A;  1EQT A;  4LUO A;  3HKZ E;  4CBV A;  2EY2 A;  2SOB A;  4XTC S;  5C44 B;  4FP5 D;  4TSS A;  1G6P A;  2K6A A;  4PMB A;  5M3F H;  2ID0 A;  4ME3 A;  2L11 A;  1HFG A;  3R93 A;  2NVX B;  1PRT F;  3TS2 A;  4RH6 A;  2VB3 X;  2HD3 A;  3A54 A;  1SE4 A;  5IYB G;  4HED A;  4EQN A;  3HOZ H;  2QGQ A;  4P2C B;  4ZAI A;  3CCQ A;  4WJ3 M;  4KY7 A;  4L5R C;  2R93 H;  1VF5 C;  2ZM6 L;  5J1Z A;  3C1E A;  4IUN A;  1QVF A;  3P7J A;  1E22 A;  3E6Z X;  3UDG A;  3VA5 A;  1B8A A;  3MXN A;  1FVI A;  1TWG B;  1PTO F;  1GUS A;  2MQH A;  4DPG A;  4A3F G;  1PYB A;  4BBR B;  4FYD A;  2IX1 A;  2B3G A;  2OWO A;  3U58 A;  3H0G B;  4HIO A;  4LNQ A;  3AYH B;  4LAA A;  5K36 G;  1T5X D;  4DAP A;  4IPG A;  4DR6 L;  4KHV A;  3IFT A;  3S2D B;  1MSH A;  2EDG A;  2Q2I A;  2K32 A;  3NWT A;  2CWA A;  2E2H B;  5BN5 A;  3OWF A;  1SFO H;  4ODG A;  1GHJ A;  2RA4 A;  4R4T A;  2F4V L;  4G7O C;  1YZ6 A;  2DGY A;  4DAV A;  4LF6 L;  1JWU D;  1LTT D;  1V1O A;  3HOX B;  2MUY A;  2D0O A;  2L12 A;  1CKN B;  2BE5 D;  5LMN W;  4OHJ A;  2DY7 A;  2EYL A;  2JA7 H;  2LKV A;  1GXD C;  4F88 A;  1VQ5 A;  4QL5 A;  3DHQ A;  3KF6 B;  2ICE C;  1QUQ A;  4LW1 A;  1PFB A;  3OYY A;  5CV6 A;  1VMP A;  1SJH D;  1JWS D;  4FO2 A;  1J9O A;  2PI2 E;  3TZU A;  4GOP C;  2MPM A;  4DNI A;  4BY1 G;  2F1M A;  4EX5 A;  1F9S A;  4RGT A;  3IL8 A;  1BBU A;  2UUC L;  1DM0 B;  1RJT A;  3CPW A;  3WDN A;  4X65 Q;  5IOC A;  4ZLT F;  2AMC B;  1PZI D;  4J8Q A;  4RHS A;  2BA1 A;  3I4N G;  4B08 A;  1PRT B;  1AZQ A;  2A19 A;  3CKI B;  3N52 A;  3S2H B;  2HIV A;  4DR4 L;  3D8G A;  1JMC A;  4CJ1 B;  4BY7 B;  3Q6S A;  1EFW A;  1TWA B;  4PMC A;  2WFW A;  4O1N A;  1FYC A;  1XWE A;  3ERO A;  4DF7 A;  3J81 E;  3M4P A;  2LXJ A;  1QVC A;  4CDF C;  2EPB A;  3Q22 A;  2BH2 A;  1XNR Q;  3G4S A;  4GNX B;  4B3M L;  1TWC H;  1BCP D;  1BR9 A;  1Q3L A;  2VW9 A;  1FR3 A;  3MXG A;  3OHX C;  2FIN B;  2PNR C;  3F1Z A;  4YCU A;  1PTO B;  2IL8 A;  2PYK A;  5IE8 A;  1Y1W B;  1QB5 D;  1STH A;  1ESR A;  3QJY A;  3HOV G;  2X6L A;  1K0S A;  2N8N A;  3A7A B;  1I4R A;  1NNX A;  1JE4 A;  2EYM A;  3MFG A;  1J5E L;  1EY7 A;  5JAV A;  5CBE E;  2VUM B;  2KHI A;  3BZK A;  2YV5 A;  1SDF A;  5IT9 c;  1XMQ L;  1S4Z A;  4CHT B;  4CJ0 B;  3KDF B;  3SK6 A;  1YJW A;  4X3K A;  4B3T L;  1VQM A;  1CKM A;  1FNV A;  3FKI H;  3A0J A;  2CVR A;  3TDQ A;  3PUW A;  2OF1 A;  4QQB X;  4K8I A;  3U4Z A;  1Q8I A;  5KIX A;  3M4O H;  2B2V A;  1XJV A;  1SYD A;  5KGU A;  1GHK A;  3NTH A;  2E2J H;  1N33 L;  1JJ2 A;  1JB3 A;  2WAQ G;  4JPB W;  1IYJ B;  5CV7 A;  4A3L G;  5I6Y A;  3G48 A;  4DAM A;  5IGE A;  1S40 A;  2UUA L;  4RCO A;  5GAG C;  4C3I G;  3CF5 A;  4YCW A;  3VYR A;  2A74 C;  5DM7 3;  3GTJ H;  2PPB C;  3OW7 A;  3NBH B;  3QIA A;  2WP8 J;  3CC2 A;  5JJZ A;  2AUJ D;  2IX3 A;  1W2B A;  1Z9F A;  2XWJ B;  2B63 G;  1HNW L;  1RF2 D;  4XT1 B;  1AE2 A;  4H13 C;  1ET9 A;  4B9W A;  3J7A 5;  1JC7 A;  2BA0 A;  4A3K H;  4A3E B;  1KTK A;  4HIK A;  3A8K E;  1K8M A;  5FOB B;  1KHI A;  1X3P A;  3KK7 A;  3HKZ G;  3ER0 A;  1BUV T;  2HQE A;  1F2M A;  3K58 A;  4V0B A;  1LTI D;  4BBS B;  1HQR D;  3RMH A;  2QEX A;  2F03 A;  4G7Z C;  5FO9 B;  1WCM H;  5M3M B;  2J4X A;  3H94 A;  5C44 G;  1AZP A;  5DM6 3;  2ALY B;  2K05 A;  2DNE A;  2YTV A;  2FJ2 A;  3M9B A;  4YIJ A;  2CH4 A;  3X3N A;  5F2D A;  2FXQ A;  3OMC A;  4POF A;  2XNA C;  4DR6 Q;  1EYC A;  4GN5 A;  3GTP H;  3BDC A;  4OO1 G;  3Q24 A;  2NUC A;  3GTM H;  3S15 H;  1HJP A;  3QOL A;  5C0X G;  4KKT A;  3CPF A;  1FGU A;  3HOW H;  2F4V Q;  4LF6 Q;  1A15 A;  3OTO L;  1JOQ A;  2JQO A;  4JVZ A;  1IKM A;  3MC0 B;  2G9H D;  3A5Z B;  4OWX B;  4FF1 A;  3M3Y H;  2AKW B;  1YJ9 A;  4ZKC B;  3K81 C;  4BBR G;  2UU9 L;  1JJG A;  2PNH A;  3DWQ A;  3I2Z A;  4LFC L;  4HJ9 A;  5D65 A;  3KLS A;  2IY5 B;  5IGB A;  1DON A;  3SE0 A;  5E3F A;  3H0G G;  2UUC Q;  2MHV A;  1ZKO A;  3HG9 A;  1YIJ A;  3KJP A;  5C4H A;  2ICI A;  1H9K A;  3CQZ H;  3V05 A;  5C6A A;  4Q5V A;  4KLK A;  4XYQ A;  1QIL A;  1YJN A;  2YYZ A;  3RZO B;  1IW7 D;  2F0H A;  1N34 L;  3KUP A;  1I4H A;  2DNC A;  1NAP A;  4JBW A;  1VS0 A;  1VQP A;  1FNW A;  4WJ4 A;  4L5T A;  1EOT A;  2I5M X;  4A3G H;  1KRT A;  5KYI A;  3HOX G;  3S1R H;  4B3M Q;  4CDD C;  1RL2 A;  5ISR A;  5IYC G;  4IAL A;  5E1F A;  1UE7 A;  4CKB A;  2VQE L;  4UPA A;  3LNN A;  5AFW A;  5JPM C;  1CZG A;  4TKO B;  1L1O A;  5L37 A;  4GLA C;  1SNO A;  1T9H A;  1TQO A;  5C3E B;  1K3B C;  1KDB A;  1ROD A;  3TP8 A;  4CKE A;  1T5E A;  1J5E Q;  3GD7 A;  4O42 A;  4I7A A;  1Y1V B;  5IWA L;  2R6G A;  2D62 A;  3FHW A;  3PIO 3;  2JA9 A;  1XTD A;  4DV3 Q;  1XMQ Q;  1N36 L;  3VYS A;  2F0S A;  3GTK B;  4IFD I;  1GUT A;  2V1C C;  4KKS A;  4B3T Q;  2B2V C;  2JN4 A;  1VQB A;  4OON A;  4A4I A;  4NDX A;  4C3J H;  1EYD A;  1QG7 A;  1STN A;  4BY7 G;  1CI3 M;  2QIL A;  2QA4 A;  3CCV A;  2PO4 A;  1YHQ A;  1K3R A;  1HR0 L;  1C9O A;  2BDN A;  2O4X A;  1SE2 A;  1Y14 B;  1B9M A;  1N33 Q;  4IUR A;  4OL7 A;  1AN8 A;  4K0K Q;  5COY A;  2N78 A;  2UUA Q;  2UXB L;  4FVM A;  1E1T A;  1EZ6 A;  2EY6 A;  3UDF A;  1FNU A;  1N32 L;  3ZJY C;  2NVT H;  1NMG A;  1Y1W G;  3BZD B;  4CDE C;  3GTG B;  5FLX E;  1YHB A;  1I3Q H;  2VY3 A;  3CCR A;  4CDC C;  2EYH A;  4F7X A;  1HNW Q;  1WVL A;  2VUM G;  3S24 A;  5FJ8 H;  1DGS A;  4MNO A;  2M9V A;  3U9S A;  4ZUJ A;  1F9R A;  5M5X B;  3AU7 A;  4KY5 A;  3FDT A;  2K75 A;  1JOK A;  4ALP A;  1Q82 C;  1CK1 A;  1VQO A;  2B2Y C;  3FRP B;  5EBC A;  2Z6K A;  4QF4 A;  4BXX G;  1EQR A;  1IXR A;  5GRO A;  4ILW A;  1STE A;  2ZTC A;  4B3R L;  1QJO A;  1YVC A;  2JXM B;  4RCN A;  1C8C A;  3R3O A;  2KBN A;  4KV6 A;  4GZY C;  3HOY B;  2IW3 A;  3M7N A;  1GOZ A;  2KHJ A;  4HIM A;  1L0X B;  1SYF A;  4ABN A;  4RAU C;  1STY A;  2HDM A;  2IPK D;  2YTY A;  2NN6 H;  1BDO A;  3PO3 G;  2OXP A;  1EEI D;  2R93 B;  3C1F A;  1WTW A;  3KFU A;  2OTL A;  2SNS A;  1V9P A;  3H6M A;  1VQH A;  5EKK A;  1X6O A;  4A3J B;  1CHP D;  4KI0 A;  2TSS A;  5IY0 A;  1Q46 A;  1EEF D;  2P5Z X;  2E76 C;  1OXS C;  4QGU A;  1SMY C;  2Q2T A;  2H5X A;  4A3E G;  3OTO Q;  1W6J A;  1LT6 D;  1EWI A;  2B8F A;  1H95 A;  4P75 A;  2PW5 A;  1D5X C;  2K01 A;  1ESF A;  2UU9 Q;  3PQI A;  4BBS G;  2GN5 A;  4LFC Q;  5M3M G;  1LUZ A;  4F8M A;  2NVQ B;  4KY6 A;  4IOC A;  5A2Q L;  1EZ8 A;  1PTO D;  1PA6 A;  3EJI A;  1NCV A;  4L8J A;  1G51 A;  2MJ8 A;  3SVM A;  1KAB A;  1STG A;  4DGZ A;  1ZYR D;  3NK9 A;  5ELN A;  3GTL H;  1I6H H;  1V43 A;  3I72 A;  4GLX A;  4A3B B;  4B3S L;  4OIJ A;  1A3U A;  1SXT A;  4H44 C;  1N34 Q;  5DLQ E;  3UDI A;  4JI5 L;  3J80 E;  3OOC A;  4DKA C;  2CCZ A;  3J7Y W;  1ICW A;  5CMD A;  3I70 A;  2K4K A;  3DWA A;  1L1O C;  1X54 A;  1O7I A;  4JG2 A;  1TII D;  4H7B A;  2VQE Q;  5HGQ A;  1PRT C;  5LHY 1;  4UDU C;  1TVX A;  3BZC A;  5IP9 H;  5KYL A;  4DK1 A;  1AH9 A;  2C9O A;  3TRE A;  4JI4 L;  4HMJ A;  1F77 A;  4IFD J;  3I3C A;  2PQE A;  1OO9 B;  4K14 A;  3PMF A;  1XX8 A;  5IWA Q;  4DV0 L;  1N36 Q;  4R9W A;  4A3C H;  3NEM A;  2QW7 A;  2RDG A;  2ZT9 C;  1TU2 B;  4EGV A;  2PZT A;  5JEA H;  3CCL A;  1AE3 A;  4UP7 A;  3FMC A;  1LT4 D;  1K83 H;  3V2T A;  4F87 A;  1JIC A;  2RHQ B;  4ZCK A;  4LFA L;  2CQO A;  4XXE A;  1HR0 Q;  3MZ5 A;  4M8A A;  1VQE A;  4DR3 L;  4DU9 A;  3QWN A;  2A6E C;  3E5S A;  2XRQ D;  1WTV A;  1GO3 E;  5ELB A;  4JI3 L;  1JE5 A;  2UXB Q;  1HA6 A;  4ZKB B;  2BDO A;  1TY2 A;  4C1N K;  1A3V A;  1N32 Q;  2EXD A;  2D0P A;  1VQJ A;  3DEO A;  1ICF B;  4A3D H;  5I2X A;  5C3E G;  1B53 A;  4C3H B;  1WJJ A;  4V19 0;  1CSP A;  2A5H A;  3U4V A;  3JAM c;  4K5W A;  3TQY A;  1XYI A;  1K8A C;  3F2D A;  1TS5 A;  3D4W A;  1Y1V G;  1PYW D;  1Q12 A;  1QOH A;  3VYU A;  2H4O A;  2K14 A;  2Z6K C;  1WTX A;  3S1Q B;  4WJW A;  4XIG S;  1PFM A;  3SEB A;  3CMA A;  5EQ0 A;  5ELD A;  1LTS D;  4JBM A;  3KF8 A;  1Y69 U;  4C2M B;  2OQK A;  2EYP A;  4DR7 L;  1HZB A;  1IBM L;  3W2D A;  4B3R Q;  1DCZ A;  1MHW C;  4OX9 L;  4Y7N B;  2I07 B;  2CW0 D;  4ULL A;  3H09 A;  2B2W A;  1D5Z C;  3RLF A;  3GTO H;  3STB D;  1HHV A;  1W6K A;  4HN7 A;  1A3T A;  2VL6 A;  1RKN A;  4HJ7 A;  2JA6 G;  3DM3 A;  3ERQ A;  4QUF A;  2DUD A;  1RHP A;  3ITP A;  4RA8 A;  3FP9 A;  4P71 A;  1O7L A;  5JPN C;  4A3F H;  3PO2 B;  3HP3 A;  4LFB L;  3HOU B;  1TWH B;  3GTQ B;  2E74 C;  1QZG A;  1HRJ A;  3BYY B;  3EIV A;  1LTL A;  3QOJ A;  1F9Q A;  1HUN A;  1DOK A;  4N9P A;  1MSG A;  3W1B A;  2HT1 A;  3TS0 A;  2X69 A;  4S3S A;  1OTC A;  5K36 H;  1LLR D;  5T1I A;  1SN8 A; 
#chains in the Genus database with same CATH homology
 2WV6 D;  2Z1C A;  1EFI D;  2NVY B;  4R8N A;  1D6E C;  1D5M C;  1RCV D;  3G7L A;  4RGN A;  1NR4 A;  1D1K A;  1VMC A;  4OGQ C;  3GTP B;  2JEB I;  5C5M A;  3S17 B;  3K5O A;  3SXH A;  1E2V A;  2O5I C;  1SSO A;  4RFB A;  3SK4 A;  5CV5 A;  3R8B A;  1IYU A;  1CM9 A;  1U4M A;  2VB2 X;  3BVM A;  1JR0 D;  1B2T A;  4ZYS A;  1CA5 A;  2R3Z A;  2J7Z A;  3NHH A;  1TWF B;  1CA6 A;  4R8I A;  4KD4 A;  5CV9 A;  1DOM A;  1EY9 A;  2XIW A;  3HZX A;  1SYB A;  2VXW A;  1HQM C;  2EOT A;  4IUU A;  3SDZ A;  2A73 B;  3FPP A;  2OT2 A;  3S1N B;  4ME5 A;  2RSN A;  2Q8I B;  3URY A;  4U67 3;  2B2U C;  3A8I E;  2KCC A;  1S5D D;  1I50 B;  2K28 A;  3V96 A;  2A68 D;  1E2Z A;  2WB1 B;  2BE5 C;  1V1P A;  5C4J B;  1CZW A;  1NR2 A;  4DNT B;  4K6D A;  1H9J A;  1HTP A;  2XRS D;  5ELC A;  5M9O A;  1KNA A;  3A55 A;  5C4X B;  3ND8 A;  3PUV A;  1Y8O B;  2AWN A;  2XVS A;  3F2U A;  2LMC B;  1O78 A;  2F3V A;  2F3W A;  1CT1 D;  1C48 A;  1IKL A;  2B2W C;  3T51 B;  3N6R A;  1CFM A;  1EWC A;  1O7Z A;  1X3Q A;  3H91 A;  1IHZ A;  2XWB B;  3PO3 B;  4RHR A;  2RQX A;  2RBM A;  1BCP C;  2R7Z B;  1H9S A;  1SE3 A;  1JCK B;  4C3H G;  2TMP A;  1CQF A;  2FMM A;  3CHB D;  2N55 A;  1OXU A;  5C3X A;  4MN3 A;  1SYG A;  2NZ1 D;  1G6Z A;  1TR5 A;  1S5F D;  2JA5 B;  3SK8 A;  4OO1 H;  1PZK D;  3EVQ A;  1EL0 A;  1HFN A;  4RKL A;  1V8Q A;  2B2Y A;  1Q1E A;  5C0X H;  3C2P A;  5BN3 A;  3I4L A;  2AWO A;  1EYA A;  1LT3 D;  1YNJ D;  1VDZ A;  4M1U B;  4HSV A;  4DN4 M;  1STB A;  1BQQ T;  2EJM A;  3K59 A;  1ET6 A;  1AEX A;  3SR1 A;  2EYJ A;  1I4G A;  2IX0 A;  1RDP D;  2F0O A;  4HTH A;  4WRD A;  3HEJ A;  3JAM L;  4IQZ A;  2F4I A;  3RZD B;  1JWM D;  1A6X A;  1SNM A;  3NSW A;  1LT5 D;  1PDQ A;  1YNN D;  5C5L A;  1LTA D;  3I4M B;  5JOB A;  3IAY A;  1X32 A;  3FVQ A;  2F0J A;  4XQN A;  4HCE A;  3T16 A;  1ENF A;  1GUN A;  2F0G A;  1IYV A;  4RGO S;  2ZXP A;  3QG1 A;  4CGY B;  4MIU A;  2A69 D;  5E4W C;  3CU7 A;  2Y0S B;  1R9T B;  4DNR B;  2ZXR A;  3OSO A;  4HMI A;  2JA8 B;  3T4A C;  2PW7 A;  5E4X A;  2B39 A;  3TP7 A;  5JVG 3;  1J8I A;  4KKU A;  1OXX K;  2D2C C;  2F0W A;  3TN2 A;  2KHS A;  3OWE B;  1SNC A;  2SDF A;  4X3U A;  4BA2 I;  3MEH A;  1EQV A;  2AQ2 B;  3VR5 A;  3KLR A;  1B9N A;  1EY0 A;  2XSC A;  4XQQ A;  3NPP A;  1HXY D;  2E2D C;  3U9O A;  5G3L F;  1PTO H;  1TS4 A;  5IGF A;  3NTK A;  1LTR D;  4A3M B;  2F0F A;  4BWG B;  3I8Z A;  2FHT A;  1QE6 A;  1IW7 C;  4QMG A;  1EY8 A;  2JA6 B;  1CTM A;  1EY6 A;  2Q8R E;  2WAC A;  3HS0 C;  4IFD G;  3QO2 A;  4K8J A;  3L9A X;  2IT1 A;  1I6V C;  2JE6 I;  4WOR A;  2LFN A;  1TY0 A;  3D3R A;  1I4X A;  3X3M A;  2E2I B;  2RDF A;  4N9T A;  4C3J G;  1B50 A;  1XTC D;  5C4Z A;  2SEB D;  1O7Y A;  2ENB A;  5M3F B;  5C3W A;  2MGS A;  5BN4 A;  3NBH A;  1HTL D;  3D6W A;  4LK1 C;  3HOZ B;  3LWU A;  2EYF A;  4NW2 A;  2I46 A;  5KNC A;  2L5T A;  4KMU C;  5EKL A;  1UAP A;  4XQJ A;  2NN6 I;  4FXK C;  5IT9 L;  4H0L C;  1SJE D;  2O5J C;  1JOR A;  2A6H D;  4KJO A;  1ILQ A;  3NP8 A;  3DEP A;  3J7A F;  3D4R A;  4A93 B;  3GQB A;  2C5C A;  1D1I A;  1ENC A;  1EY4 A;  2H1E A;  5EGT A;  2DN8 A;  1MI2 A;  4C56 C;  4DK0 A;  1SFO B;  2F0E A;  2V4D A;  2JP1 A;  2HCC A;  1MBY A;  2YU9 B;  1VF7 A;  4E6I A;  5JVH 3;  2LY7 A;  2KOL A;  3K57 A;  3H3V C;  2D5D A;  2JA7 B;  2K5D A;  3P20 A;  4DA2 A;  1WTR A;  1BF4 A;  3CRK C;  3O13 A;  1UNS A;  5D3I B;  4X3T A;  3SK5 A;  4ZUI A;  3NUC A;  2F0I A;  5IOD A;  4L6T B;  2E75 C;  3DMU A;  4L63 B;  1ILP A;  4Q0F A;  1DD2 A;  1QNU A;  2Z4I A;  2KQ3 A;  5CV8 A;  5CGK A;  5DAU A;  5EPK A;  1S5C D;  5LL6 S;  2JYO A;  1PTO C;  2K04 A;  2NYZ D;  3CRL C;  1TWC B;  2AQ1 B;  2NTT A;  2F0L A;  1ZYR C;  2F0Q A;  4HR7 B;  4RKB A;  3I91 A;  3DWP A;  4KK7 A;  4J1M A;  1I4P A;  3ZYY X;  1WTO A;  1E2W A;  2B2U A;  3K0Y A;  1B1Z A;  3NXW A;  5A2Q E;  1EY5 A;  1D2B A;  4QCL A;  5KRU A;  2B8G A;  1BXT A;  1Z6H A;  2MP1 A;  5HGT A;  2JSO A;  3FKI B;  3M4Y A;  5EKI A;  4FXD A;  3KBX A;  3R2I A;  3M4O B;  1KLU D;  2K03 A;  2F0V A;  1QWY A;  4Z9C B;  2E2J B;  3NQT A;  4BA1 I;  4K2L A;  4NKL A;  1TT2 A;  2EE1 A;  4CJ2 C;  3NBI A;  3WOF A;  1HUM A;  3OPO A;  3UI2 A;  3GTJ B;  3MXU A;  3BVZ A;  1O80 A;  5IIF A;  1SYE A;  1A2U A;  4A3K B;  3GP7 A;  3TBI B;  3PUY A;  4KHZ A;  1BNZ A;  3GV6 A;  1I4Q A;  1UUP A;  3AB9 A;  1WCM B;  4X3S A;  1ML0 D;  4XT3 B;  1B3A A;  4EQO A;  4B9X A;  1VCI A;  2F0U A;  1SNQ A;  3D31 A;  5IGD A;  5I4D A;  3RUZ A;  2EY1 A;  1RD9 D;  3J81 L;  2ZXO A;  4IUP A;  5EPJ A;  3GTM B;  3S15 B;  2CW0 C;  3K5M A;  5EJW A;  3HOW B;  3PIP 3;  3NE5 B;  1B44 D;  4I65 A;  5KNB A;  4A3I B;  3BG3 A;  3M3Y B;  3VYT A;  1G29 1;  1GUG A;  3BYT B;  3IKJ A;  2R92 B;  2K5Q A;  3L3O C;  2WIN B;  4DXF A;  1DXM A;  1L0Y B;  3RD4 A;  4NMZ A;  3P75 A;  4WFN 3;  3CQZ B;  2Q8T A;  1U4P A;  1F2L A;  4ZRZ A;  1H9R A;  5FKA C;  5I6W A;  2K5W A;  1GUO A;  2OEO A;  3A8J E;  1KNE A;  5M5Y B;  1U9R A;  5IGG A;  4DXG A;  3EQL C;  3T53 B;  5JEA J;  4A3G B;  3S1R B;  4IN3 A;  5DEH A;  1EU4 A;  2JEA I;  3TP6 A;  4QUC A;  3IFD A;  4PMW A;  4LMQ D;  2Z8L A;  1R4Q B;  1U4L A;  3Q0A A;  2VNU D;  5ELE A;  3OIQ A;  4QB4 A;  2HDL A;  2L4N A;  1CHQ D;  1STA A;  4C3J B;  4KN7 C;  2B2T A;  1QCB D;  4I7Z C;  1EU3 A;  5COR A;  3OMG A;  3MHB A;  1F2Y A;  4XDX A;  4ZK9 B;  3BDO A;  1Z47 A;  3MAQ A;  2EJF C;  2RVL A;  1UEA B;  1EWH A;  2KEC A;  2NVT B;  3MA2 B;  1GJX A;  4FXG C;  4K5X A;  4K6L A;  1PXU A;  5G3L D;  1I3Q B;  1KLG D;  1AP0 A;  2QF7 A;  3MFY A;  2A68 C;  2NBF A;  3WOE A;  4U68 A;  3DXJ C;  1Y8P B;  1JQY D;  1PLF A;  3T13 A;  4HCS A;  1DZ1 A;  2KJX A;  4ZQ3 A;  1SND A;  2K33 A;  4PQX A;  3OIP A;  5EBD A;  2DY8 A;  4OO1 I;  1TS2 A;  3MXP A;  1LO5 D;  2BOS A;  4FF3 A;  1E0B A;  5C0X I;  1SBB B;  4KJN A;  3S9W A;  4RGM A;  3TZD A;  1S5B D;  2L55 A;  4UAI A;  2R61 A;  1WD1 A;  5D14 A;  1KDC A;  3QB3 A;  3GV3 A;  4KN4 C;  3K6O A;  1ZEQ X;  4JK1 C;  4KTA A;  2L1B A;  2FMC A;  2RSO A;  2F0K A;  5IGC A;  3K7A B;  4TQU S;  4HSP A;  1G2T A;  1LV9 A;  4AYB B;  2LS0 1;  3E0J A;  2KVM A;  2M00 A;  3GTL B;  1TKW B;  1I6H B;  3R2T A;  3BS1 A;  1KDA A;  2PMZ B;  1KAA A;  3FEW X;  3NTI A;  4QIW B;  5CBA E;  3G6J B;  1FGB D;  4BS9 A;  2X6G A;  4CKC A;  4FF4 A;  2L0C A;  1SYC A;  5CYU A;  1YNJ C;  5KND A;  5A35 A;  2WKD A;  2L9H A;  4PV1 C;  1NSN S;  1M8A A;  5HUR A;  4PNY A;  5I9P A;  5FLX L;  2EYO A;  1BCP F;  3M7G A;  3VR4 A;  1II3 A;  5CC4 A;  1SEB D;  1BO0 A;  2RDH A;  4G57 A;  3T56 B;  1S5E D;  2QEJ C;  1YNN C;  1FD7 D;  1A2T A;  3M85 A;  2B2T C;  1AFP A;  2CHB D;  4RWS C;  1LTG D;  2QCP X;  1G8Z D;  2G9D A;  3MVV A;  4NP5 A;  2N88 A;  3JAM E;  1K83 B;  2K7V A;  2EZV A;  1F2Z A;  2GA4 B;  3MTS A;  2A69 C;  4IFD H;  2F0N A;  3EFX D;  4EVO A;  5I2Y A;  5ELF A;  3D4D A;  4J6H A;  3VA7 A;  2O2L D;  4A3D B;  3PV0 A;  1F9P A;  4K2K A;  1HA5 A;  1G2S A;  1WTQ A;  4K5V A;  1LTB D;  3K5N A;  1BBX C;  1G91 A;  4IUT A;  5I9O A;  3W3A A;  1DJR D;  2PZU A;  3MWY W;  4KD3 A;  3PUX A;  2KEE A;  4OIK A;  3LWE A;  4G4K A;  4EQP A;  3C3L A;  2F0D A;  3GO5 A;  5CR3 A;  2IJ0 A;  2EJG C;  1SMY D;  1IL8 A;  5LL6 X;  3GTO B;  5C0X J;  2RKS A;  3NWS A;  2IWH A;  2NB0 A;  5K5P A;  1BCP B;  3ONA B;  4A3F B;  1PFN A;  2PZW A;  3J80 L;  1OXV A;  3TME A;  1Y8N B;  1Q1B A;  1ENA A;  1ONL A;  1WTP A;  2KCN A;  1K8O A;  3P1H A;  1RTO A;  2F0T A;  5FO8 B;  2QDB A;  2WII B;  5FO7 B;  1HCZ A;  1CQV A;  3S16 B;  2AUK A;  1MGS A;  2WKC A;  5J22 A;  1PRT D;  4IUQ A;  2NN6 G;  4TRD A;  3S14 B;  1EIG A;  2KA7 A;  4FF2 A;  1GUW A;  1NUC A;  4C1N I;  2AQ3 B;  1XXG A;  4XYO A;  4LJZ C;  3HGB A;  2EXZ A;  4G7H C;  3VR3 A;  4BY1 B;  3BDL A;  1OXT A;  2Z4H A;  1C4Q A;  2CQA A;  2BCO A;  3TP5 A;  1M4V A;  5DNF A;  3PUZ A;  2KED A;  5TSS A;  3I4N B;  1DYQ A;  5NUC A;  5EPL A;  2A6H C;  3ND9 A;  1LAB A;  1BOS A;  2A6E D;  1Q90 A;  3S1M B;  2J0T D;  4MHE A;  3C46 A;  2F0P A;  1SNP A;  4ID6 A;  1Z7T A;  5CV4 A;  2NTS A;  4DAY A;  2PCF B;  3KBG A;  2K1B A;  1PMR A;  3J7A V;  1AW7 A;  5FK9 C;  3AMU A;  3A56 A;  3NQI A;  3BVG A;  4FNF A;  1JOO A;  3HOV B;  5IT9 E;  2FFK B;  2M2L A;  2XN9 C;  2SNM A;  5KEE A;  3SHL A;  5J39 A;  2D9U A;  2QKI C;  4HAE A;  3D6C A;  1ZXT A;  1LAC A;  1V1P B;  3HRZ C;  3FPU B;  2HUG A;  2F0M A;  1PZJ D;  1QNK A;  2WAQ B;  1EIH A;  1MD2 D;  2EY5 A;  1B4O A;  3Q23 A;  1HPC A;  1R4P B;  4IUV A;  4C3I B;  5D3D A;  2NWG A;  3VR2 A;  3I90 A;  3TSS A;  3A7L A;  1U4R A;  5JEA G;  1TS3 A;  2EVB A;  2B63 B;  3L7Z C;  3EA6 A;  3DM1 A;  3KLS X;  1WD0 A;  5T1G A;  1RTN A;  3HKZ B;  4DFA A;  1SAP A;  2HCI A;  3I73 A;  1H9S B;  5M5W B;  1H9M A;  3LX0 A;  4IZ8 A;  3K5L A;  3VR6 A;  1DOL A;  2KUM A;  3DUZ A;  1EQT A;  4CBV A;  2EY2 A;  2SOB A;  4XTC S;  5C44 B;  4FP5 D;  4TSS A;  2K6A A;  4PMB A;  2ID0 A;  2L11 A;  1HFG A;  3R93 A;  2NVX B;  1PRT F;  4RH6 A;  2VB3 X;  3A54 A;  1SE4 A;  4HED A;  4EQN A;  4P2C B;  4ZAI A;  4KY7 A;  1VF5 C;  5J1Z A;  3C1E A;  4IUN A;  3P7J A;  3E6Z X;  3VA5 A;  3MXN A;  1TWG B;  1PTO F;  1GUS A;  4BBR B;  4FYD A;  2IX1 A;  3H0G B;  4LAA A;  5K36 G;  1T5X D;  4DAP A;  4KHV A;  3IFT A;  3S2D B;  1MSH A;  2EDG A;  2K32 A;  3NWT A;  2E2H B;  5BN5 A;  3OWF A;  4ODG A;  1GHJ A;  2RA4 A;  4G7O C;  4DAV A;  1JWU D;  1LTT D;  1V1O A;  3HOX B;  2MUY A;  2L12 A;  2BE5 D;  4OHJ A;  2DY7 A;  2EYL A;  2LKV A;  1GXD C;  4F88 A;  3DHQ A;  2ICE C;  1PFB A;  5CV6 A;  1VMP A;  1SJH D;  1JWS D;  4FO2 A;  1J9O A;  3TZU A;  2MPM A;  2F1M A;  1F9S A;  4RGT A;  3IL8 A;  1DM0 B;  1RJT A;  3WDN A;  5IOC A;  4ZLT F;  1PZI D;  4J8Q A;  4RHS A;  2BA1 A;  4B08 A;  1PRT B;  1AZQ A;  3CKI B;  3N52 A;  3S2H B;  3D8G A;  4CJ1 B;  4BY7 B;  3Q6S A;  1TWA B;  4PMC A;  4O1N A;  1FYC A;  1XWE A;  4DF7 A;  3ERO A;  3J81 E;  3Q22 A;  2EPB A;  1BCP D;  1BR9 A;  1Q3L A;  1FR3 A;  3MXG A;  3OHX C;  2FIN B;  2PNR C;  1PTO B;  2IL8 A;  2PYK A;  1Y1W B;  1QB5 D;  1STH A;  1ESR A;  3QJY A;  2X6L A;  3A7A B;  1I4R A;  1JE4 A;  2EYM A;  3MFG A;  1EY7 A;  5JAV A;  5CBE E;  2VUM B;  1SDF A;  1S4Z A;  4CHT B;  4CJ0 B;  3SK6 A;  4X3K A;  1FNV A;  2CVR A;  3TDQ A;  3PUW A;  2OF1 A;  4K8I A;  1Q8I A;  5KIX A;  2B2V A;  1SYD A;  5KGU A;  1GHK A;  3NTH A;  1JB3 A;  5CV7 A;  5I6Y A;  5IGE A;  4RCO A;  4C3I G;  3VYR A;  2A74 C;  5DM7 3;  2PPB C;  3OW7 A;  3QIA A;  2WP8 J;  5JJZ A;  2AUJ D;  2IX3 A;  2XWJ B;  1RF2 D;  4XT1 B;  4H13 C;  1ET9 A;  4B9W A;  1JC7 A;  2BA0 A;  4A3E B;  1KTK A;  3A8K E;  1K8M A;  5FOB B;  1X3P A;  3KK7 A;  1BUV T;  2HQE A;  1F2M A;  3K58 A;  4V0B A;  1LTI D;  4BBS B;  1HQR D;  3RMH A;  2F03 A;  4G7Z C;  5FO9 B;  5M3M B;  2J4X A;  3H94 A;  1AZP A;  5DM6 3;  2K05 A;  2DNE A;  4YIJ A;  2FJ2 A;  3X3N A;  5F2D A;  3OMC A;  2XNA C;  1EYC A;  3BDC A;  4OO1 G;  3Q24 A;  2NUC A;  3QOL A;  5C0X G;  4KKT A;  1A15 A;  1JOQ A;  1IKM A;  3MC0 B;  2G9H D;  4FF1 A;  4ZKC B;  3DWQ A;  5D65 A;  3KLS A;  5IGB A;  1DON A;  3SE0 A;  5E3F A;  2MHV A;  1ZKO A;  3HG9 A;  5C4H A;  2ICI A;  1H9K A;  3V05 A;  5C6A A;  4Q5V A;  4XYQ A;  1QIL A;  2YYZ A;  3RZO B;  1IW7 D;  2F0H A;  3KUP A;  1I4H A;  2DNC A;  1NAP A;  4JBW A;  1FNW A;  1EOT A;  5KYI A;  5ISR A;  4IAL A;  5E1F A;  4CKB A;  3LNN A;  5AFW A;  5JPM C;  1CZG A;  4TKO B;  1SNO A;  1TQO A;  5C3E B;  1KDB A;  1ROD A;  3TP8 A;  4CKE A;  1T5E A;  3GD7 A;  4O42 A;  1Y1V B;  2R6G A;  2D62 A;  3PIO 3;  3VYS A;  2F0S A;  3GTK B;  4IFD I;  1GUT A;  4KKS A;  2B2V C;  4NDX A;  1EYD A;  1QG7 A;  1STN A;  1CI3 M;  2QIL A;  2PO4 A;  2BDN A;  2O4X A;  1SE2 A;  1B9M A;  4IUR A;  4OL7 A;  1AN8 A;  5COY A;  4FVM A;  1EZ6 A;  2EY6 A;  1FNU A;  3BZD B;  3GTG B;  5FLX E;  2EYH A;  4F7X A;  1WVL A;  3U9S A;  2M9V A;  4ZUJ A;  1F9R A;  5M5X B;  3AU7 A;  4KY5 A;  3FDT A;  1JOK A;  1CK1 A;  2B2Y C;  3FRP B;  5EBC A;  4QF4 A;  4ILW A;  1STE A;  1QJO A;  2JXM B;  4RCN A;  1C8C A;  3R3O A;  4KV6 A;  4GZY C;  3HOY B;  2IW3 A;  3M7N A;  1GOZ A;  1L0X B;  1SYF A;  4ABN A;  4RAU C;  1STY A;  2HDM A;  2IPK D;  2NN6 H;  1BDO A;  2OXP A;  1EEI D;  2R93 B;  3C1F A;  1WTW A;  2SNS A;  3H6M A;  5EKK A;  4A3J B;  1CHP D;  4KI0 A;  2TSS A;  1EEF D;  2E76 C;  1OXS C;  1SMY C;  1W6J A;  1LT6 D;  2B8F A;  2PW5 A;  1D5X C;  2K01 A;  1ESF A;  4F8M A;  2NVQ B;  4KY6 A;  5A2Q L;  1EZ8 A;  1PTO D;  3EJI A;  1NCV A;  4L8J A;  2MJ8 A;  3SVM A;  1KAB A;  1STG A;  4DGZ A;  1ZYR D;  3NK9 A;  1V43 A;  3I72 A;  4A3B B;  4OIJ A;  1SXT A;  1A3U A;  4H44 C;  3J80 E;  3OOC A;  3J7Y W;  1ICW A;  5CMD A;  3I70 A;  3DWA A;  1TII D;  4H7B A;  1PRT C;  5LHY 1;  4UDU C;  1TVX A;  5KYL A;  4DK1 A;  2C9O A;  4HMJ A;  1F77 A;  4IFD J;  3I3C A;  2PQE A;  1OO9 B;  4K14 A;  3PMF A;  1XX8 A;  4R9W A;  2RDG A;  2ZT9 C;  1TU2 B;  4EGV A;  2PZT A;  5JEA H;  3FMC A;  1LT4 D;  3V2T A;  4F87 A;  1JIC A;  4XXE A;  3MZ5 A;  4M8A A;  4DU9 A;  3QWN A;  2A6E C;  3E5S A;  2XRQ D;  1WTV A;  5ELB A;  1HA6 A;  4ZKB B;  2BDO A;  1TY2 A;  4C1N K;  1A3V A;  3DEO A;  5I2X A;  1B53 A;  4C3H B;  4V19 0;  2A5H A;  4K5W A;  1XYI A;  1TS5 A;  3D4W A;  1PYW D;  1Q12 A;  1QOH A;  3VYU A;  2H4O A;  1WTX A;  3S1Q B;  4WJW A;  4XIG S;  1PFM A;  3SEB A;  5EQ0 A;  5ELD A;  1LTS D;  3KF8 A;  1Y69 U;  4C2M B;  2EYP A;  3W2D A;  1DCZ A;  4Y7N B;  2I07 B;  2CW0 D;  4ULL A;  3H09 A;  2B2W A;  1D5Z C;  3RLF A;  1HHV A;  1W6K A;  4HN7 A;  1A3T A;  1RKN A;  3ERQ A;  4QUF A;  1RHP A;  3ITP A;  4RA8 A;  1O7L A;  5JPN C;  3PO2 B;  3HP3 A;  3HOU B;  1TWH B;  3GTQ B;  2E74 C;  1HRJ A;  3BYY B;  1HUN A;  3QOJ A;  1F9Q A;  1DOK A;  4N9P A;  1MSG A;  2X69 A;  4S3S A;  5K36 H;  1LLR D;  5T1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...