1RODA

Chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
b'SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPASPIVKKIIEKMLNSDKSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC PROTEIN OF INTERLEUKIN 8 AND HUMAN MELANOMA GROWTH
publication title Structure and activity of a chimeric interleukin-8-melanoma-growth-stimulatory-activity protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 10
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rodA00
1HRJA 1MSGA 1KNAA 4IUPA 1NR4A 4HSVA 4MHEA 1EL0A 1RTNA 2K05A 1VMCA 1SSOA 2FHTA 1ML0D 1U4LA 3DEPA 1B2TA 1JE4A 1ESRA 1MSHA 1GUWA 1X3PA 1XX8A 2NYZD 3I91A 2NWGA 1QNKA 3FDTA 4NW2A 2B2UC 2KOLA 2MP1A 2N88A 2B2WC 1M8AA 2H1EA 5EPKA 2RA4A 2JYOA 1F9QA 2B2YC 3I8ZA 3ONAB 1DONA 4CJ1B 4IURA 1BBXC 4X3KA 1WD1A 4QUCA 1ILQA 2Q8RE 5E4WC 1LV9A 1BNZA 1TVXA 2HCIA 5CBAE 4R8IA 3KUPA 5D14A 5T1IA 1NCVA 4ZK9B 4ZKBB 1ILPA 4DN4M 4IUQA 5AFWA 1CA6A 4HAEA 1NAPA 1RODA 1VMPA 1QG7A 2M2LA 1O80A 1G91A 5CMDA 3DEOA 2K03A 1B50A 1O7ZA 2RSOA 3G7LA 5DNFA 4RWSC 1ZXTA 1X32A 4OIJA 1WTPA 1IKMA 2HCCA 1X3QA 5EPJA 3KBXA 3FPUB 3N52A 2HUGA 2HDMA 1WD0A 1J8IA 1QE6A 1IL8A 1C8CA 1E0BA 2HDLA 2IL8A 2K28A 1F9SA 1BO0A 2J7ZA 5T1GA 4ZKCB 2B2TA 2B2VC 4O42A 3I3CA 1A15A 1MI2A 2N55A 1IKLA 3MTSA 3GV6A 4RA8A 4CJ0B 3DM1A 5CBEE 4XDXA 1HFNA 1KNEA 1WTVA 1BF4A 2Q8TA 1SAPA 4HEDA 1DZ1A 2X6LA 1MGSA 1B3AA 2BDNA 1DOLA 2L12A 1F9RA 1U4PA 2FJ2A 3R93A 2MGSA 1AZPA 1HHVA 2MPMA 1JICA 2D9UA 3H91A 2XIWA 2K01A 5JJZA 4ZLTF 1AZQA 2B2YA 2L9HA 1ICWA 1U4MA 4IUUA 1HA6A 5CORA 3IL8A 4R9WA 1PFNA 1DOKA 2L4NA 1Q3LA 1EOTA 4IUTA 5COYA 1WTQA 1NR2A 4X3SA 4X3UA 3F2UA 1CM9A 1EQTA 5EJWA 4QUFA 1WTOA 2JP1A 2FINB 3QO2A 3MWYW 2KEDA 2RSNA 1PFBA 1RTOA 2NZ1D 1SDFA 4MN3A 2FFKB 2VXWA 5EQ0A 2X69A 1DOMA 2EOTA 2X6GA 1HUMA 1WTWA 3IFDA 1PDQA 1HFGA 1J9OA 1O7YA 4OIKA 5EPLA 4CJ2C 4IUVA 1CA5A 1PFMA 1U4RA 2SDFA 3D6WA 4ZAIA 3TN2A 2EPBA 1EIHA 2B2UA 2L11A 5E4XA 1F2LA 2B2WA 2DY7A 2FMMA 1RJTA 2DY8A 2L1BA 2R3ZA 4LMQD 4U68A 4X3TA 3I90A 1WTRA 1WTXA 1S4ZA 1PLFA 4XT3B 4HCSA 4XT1B 5D65A 2B2VA 2EE1A 1EIGA 3LWEA 1B53A 2MJ8A 2KECA 3P7JA 4UAIA 5EKIA 2RVLA 2KUMA 1G2SA 4RAUC 3GV3A 3SVMA 2CVRA 1WVLA 1AP0A 1G2TA 2K04A 1F9PA 1B4OA 2KVMA 1G6ZA 2KEEA 3TZDA 1XYIA 3HP3A 2K1BA 1RHPA 3UI2A 2B2TC 3Q6SA 1HUNA
chains in the Genus database with same CATH superfamily
4LF5Q 5IGEA 1WYDA 4HSVA 1TWCB 4YCWA 4JI3L 1EWHA 1TWHH 2E75C 5C4XB 5EAYA 2AWOA 3SDZA 2IX3A 3IRBA 1KABA 3I55A 1HNZQ 3GTPH 1LUZA 1EY4A 2PI2E 2QDLA 2VY3A 4R4OA 4X3KA 3HKZE 1X54A 4KN7C 2EDGA 5KYLA 2M9VA 5H1SE 5IT9L 1O80A 1PH6A 2QF7A 4LJZC 1V1OA 3WOEA 1VQPA 2WINB 3DWAA 3G7LA 1M4VA 5DNFA 1XMOQ 3F2BA 2LKVA 3KJPA 2YU9B 1PYWD 5EPJA 3QR8A 1KIXA 2PI2A 2YV5A 3PMFA 2CWAA 4BBSG 2IL8A 2UUAQ 2N8NA 3HOWB 1R4QB 3KJOA 4HJ8A 2B2VC 4JI8Q 3J7AV 3MEHA 2NN6H 1TU2B 2ZXOA 3HOUH 3AB9A 2Q8TA 1HXYD 1EZ6A 3RUZA 3U9SA 1YJWA 3Q8DA 2UXDQ 2L12A 2YTXA 3TRZA 5EKLA 1X9NA 2D9UA 3F8TA 1QVFA 2Z9HA 3CRLC 1HNXL 1DOKA 1EUJA 4IUTA 4C3JG 5LHY1 2BDOA 1AFPA 1CM9A 2IHFA 5IE8A 2UUCQ 2F4IA 3WOFA 2SNMA 1K3RA 1K8OA 4BA1I 1SMYD 2JXMB 3VR3A 1SJED 3H3VI 3P1HA 1C0AA 2B63H 2F0JA 1EOVA 2FMMA 4JV5L 2VUMG 4GLVB 1PTOF 1S4ZA 3K58A 3M4PA 1EIGA 3NEMA 2MJ8A 4LF7L 2ATWA 3AQQA 2B3GA 3T16A 3SVMA 1C7YA 4RFBA 4A3DB 2QDBA 4A4IA 4GLAC 3KFUA 1VQNA 5IYDH 4DGZA 2PW7A 3VA7A 1S3OA 4HIDA 3S1MB 1GUOA 4R4TA 5G3LD 3K5NA 3A5UA 1JOQA 3GTLH 5GAGC 2YTVA 1HR0Q 4IFDI 3W1GA 4POFA 3I91A 2R93H 3HOVG 4FXKC 2XN9C 3Q23A 5C6AA 2AWNA 1FNVA 1XTDA 1EYGA 1IZ6A 1WD1A 1PVOA 2Q8RE 4BBRB 4LF5L 5KIXA 3G4SA 4DN4M 4B3TL 4A3KH 3TP5A 2VQFL 1CSPA 1PH1A 1O7ZA 2NBFA 1Y1VG 2A6HD 1ASYA 3J81j 1HNZL 3KLRA 2R7FA 3GQBA 3PO2G 1FGBD 1D5MC 3QWNA 1H9SB 1BO0A 4Y7NB 4DAYB 2NZOA 1TWFH 1K9MC 4JCVE 4C2MB 4DR3Q 1A62A 1SNPA 2R92G 1DGSA 1XMOL 1X6OA 2AMCB 3GP7A 5DAUA 1B3AA 1A8VA 3DM3A 2RDFA 4R1JA 5IGCA 3N6RA 5JJZA 1EIFA 4B3RQ 2UUAL 4X6AH 3CD6A 1BXTA 3AFQA 4BXXH 1SNCA 2L4NA 4LNQA 5C4HA 3G48A 4JI8L 4N9TA 3IFTA 1LTAD 2DNCA 4QUFA 5IGGA 1QCBD 3S15B 1PTOH 2OWOA 3M3YB 4RHSA 4G7HC 2UXDL 3D6CA 1DOMA 2LY7A 1BOSA 1N33Q 1STBA 1O7YA 1KDBA 1U9RA 2CWPA 1K8GA 3D6WA 2I5MX 4OXPA 3PIP3 3ND9A 3H3VC 4X3TA 1QUQA 2D2CC 5JEAJ 4OO1I 2UUCL 1O7IA 4IPHA 2MFIA 2PZTA 3T56B 2J0TD 1H9SA 2Z6KC 1KTKA 3CHBD 2JEAI 5IY0A 5M3FG 3D0FA 3BVMA 4TSSA 2E74C 3U4ZA 2IWHA 3CPWA 1TXYA 4HIMA 2DJFC 2Q2HA 3FRPB 4KLKA 1SSOA 1VQLA 1LM0A 1GHJA 3C1EA 3K7AB 4K5XA 1DM0B 2DGYA 2JA5G 4LFCQ 1TY0A 4V190 1MHWC 2JE6I 5E4WC 3E6ZX 3CCLA 4C3JH 1TVXA 3VYUA 5M5YB 4KJOA 1K8MA 1FL0A 1LT3D 1S5ED 1U0LA 2CKZB 1FD7D 1HR0L 3PCOB 3RLOA 1CQVA 2ZXRA 3I7FA 2OT2A 1F77A 1VQHA 1RCVD 5FOBB 3VYRA 1B1ZA 2O5JC 2RDHA 5LMNQ 2AHOB 2Y0SB 1HTLD 1TY2A 1YNJD 2KCCA 4ME5A 4C1NK 2DNEA 2VUMH 1D6EC 1BCPB 1D2BA 1SJHD 2KHSA 2N55A 1PH5A 3IKJA 4RCNA 1PZID 4KY6A 2ALYB 4BY7B 3OHXC 4F8MA 5LL6X 2G5DA 1N36Q 3Q22A 2RDGA 1YITA 1JWUD 2B8GA 4DK1A 3I4MB 1Q8IA 1B7YB 4X3SA 5I9OA 4DR3L 4KI0A 5JAVA 4DV5Q 4A3EG 3IAYA 3HOVH 1BR9A 1RTOA 2IW3A 1SYFA 1GD7A 2EY5A 4DXFA 2EOTA 1UE5A 2AUJD 4C3IG 1I4QA 1I3QB 3GTKH 2PCFB 5J39A 1E22A 5DLQE 4X62Q 1AW7A 2EYHA 1F2LA 4U68A 4DV0Q 3ZYYX 3I73A 4XT1B 4KD3A 2E2IB 1YHBA 3GTGH 4YWMA 4OX9Q 2KA7A 3W3AA 1WFQA 3BS1A 2UUBQ 1G6ZA 5C44G 1Q7YC 1N33L 3TZDA 1XYIA 4KY5A 3TZUA 3PO2H 1VQIA 5FLXE 1KNAA 2OF1A 1PZJD 1SE4A 4IUPA 4RGNA 5E1FA 3PIPA 2R92H 1VF7A 1B2TA 1PRTB 2AKWB 3J81c 2L0CA 3FDTA 2MP1A 2QEXA 4A3IH 4TRDA 3NTHA 4A3BB 2CFMA 2RQXA 4JYAQ 1GXDC 1PYBA 2A8VA 1CA6A 2WAQE 3A55A 2JA8B 1BCPC 4HAEA 1J6QA 1G91A 2EJMA 1TIID 1SE8A 2MO0A 4DNTB 4RWSC 4JI0L 3CCMA 3S1RB 1HZBA 1KHIA 2BE5D 5IGBA 1KRSA 2A6ED 3NHHA 4AYBB 3RR5A 2F3WA 3AYHB 4P2CB 4ZKCB 1B3QA 2F0MA 4DK0A 5FO8B 3KYHC 3GV6A 1QVGA 3RLNA 3CC7A 3NQIA 2KENA 3AMUA 3T1YQ 1BF4A 2I46A 1SAPA 1SE3A 1LTGD 2X6LA 1MGSA 5I6YA 1PXUA 5M3FH 2LMCB 2MGSA 2HIVA 2BH8A 3HOXH 2A73B 5C4JB 3C46A 2L9HA 4ZRZA 1U4MA 5LMNL 4L5QA 1FR3A 1KD1C 1VQ6A 4TKOB 4FP5D 3MVVA 4ALPA 2ZJPA 5IP9G 3MWYW 2EYFA 3L3OC 1Y1WH 5CV6A 1YZ6A 2NZ1D 2CH4A 4YCVA 3J81L 1KDCA 1N36L 5GAEC 1S5FD 2JA6B 1TWHB 5EPLA 3Q24A 4JI4Q 2SDFA 5HGQA 4P73A 2B2WA 5G3LF 1RJTA 3SK5A 3J81i 3L9AX 2OQ0A 4NXMQ 2ICEC 1SE2A 1NY4A 4DV5L 3S14B 2KECA 1PRTC 2GA4B 1G2SA 2EVBA 2B8FA 4KV6A 4XQNA 3UDXA 2R7ZH 5IYCG 2C35B 1XJVA 4OL7A 1V8QA 1LTRD 3RZOB 1KLGD 4X62L 4BY1B 1HRJA 3BZDB 5JVG3 1RTNA 4DV0L 2QGQA 1JB7A 1ET6A 2LFNA 3TEHB 2E2DC 2F0PA 4A3FG 2O5IC 2K5WA 2PZWA 4HJ5A 1TS5A 2RBMA 5FLMG 3NTKA 4XQQA 4OX9L 2B2WC 2UUBL 3S2HB 5GQOA 1IXRA 2B39A 3SHLA 1LTSD 3FVQA 1J5EQ 1ILQA 1YIJA 1BVSA 4NXNQ 2UXCQ 2HCIA 4HR7B 1TS4A 2ID0A 4ZK9B 3PSIA 4POGA 4A3EH 4CKEA 1Z47A 2R6GA 1D5ZC 3H0GH 1X32A 1A0IA 1LABA 5TSSA 3M7GA 3N52A 2HUGA 2HDMA 3RZDB 1SRUA 1J8IA 4NMZA 4RMFA 1ZYRC 5BN5A 1D8LA 3Q0AA 4JYAL 2K5DA 1F9SA 2J7ZA 5CC4A 1EWCA 1X3GA 1A15A 5BN3A 3BZCA 1GOZA 1HA5A 5CBEE 4AIMA 2NVYB 3HOZH 2ZJRA 5CV7A 1U4PA 1D1IA 4NDXA 1TS2A 2ZXPA 3CMEA 5CORA 3P75A 4R9WA 2PQAA 1EOTA 3GTMB 1IYUA 3F2UA 4QL5A 1BQQT 4DA2A 1X55A 3MXNA 5I4DA 4QIWB 2F0OA 2F0FA 3T1YL 1EY5A 1QILA 4DV2Q 2Z0SA 4KMUC 1L1OB 1UWVA 2IPKD 2VB3X 3TP7A 1I4PA 4XXEA 4CGYB 1Q1EA 2R93G 1CA5A 2PZUA 3UDIA 1EIHA 2A74C 2DY7A 3TN2A 1KRTA 3R3OA 5ELCA 4DAVA 1HH2P 5D65A 3HOYB 3CXCA 3GDEA 1DJRD 5C4ZA 1XTCD 2OEOA 2EY6A 4RAUC 3A8KE 2F3VA 1VQGA 1DXMA 2OCEA 3GTOH 3PO3G 5KNCA 4L6TB 3J80c 3MA2B 2KQ3A 4JI4L 1L2FA 1IW7C 4A3MH 4DR7Q 3T13A 4GLXA 4CKBA 4HIOA 1U4LA 2RHSB 1STHA 1VQCA 4L8JA 2K5HA 1VQ9A 4NXML 3TSSA 1ESRA 1MSHA 1YNJC 3DUZA 3B6YA 3KF8A 4RKLA 2EY2A 4RCOA 1LACA 2H1EA 1K28A 3HKZB 2K75A 2JN4A 2RF4A 1GM5A 4JBMA 2OQKA 1LV9A 2WB1E 4R8IA 1Y14B 3KUPA 5I6WA 1I50B 3RNUA 2K03A 5D3IB 5IYBH 4BXXG 4OIJA 1LT6D 4B3TQ 1TWGH 4DV6Q 1X3QA 5C3EH 2VQFQ 1WD0A 1RD9D 4Q5VA 2HDLA 1J5EL 2D5DA 5M3MH 2G9HD 4NXNL 2UXCL 1L0YB 4GNXA 4FF1A 1EU4A 2L55A 1JJGA 5M5XH 3VR5A 4JBJA 2RCFA 1RL2A 4CJ0B 1GVPA 2BH2A 1XPUA 4FF2A 3TP8A 1DOLA 1ENFA 5IYCH 3R93A 1L1OC 1M90C 3GTQH 3URYA 3A8JE 4RGOS 1I6VC 4JW0A 3O13A 3J80L 3L0OA 3S1QB 4GOPB 1EU3A 5HY6A 4A3FH 2VNUD 4GN4B 1E2ZA 2ZTEA 4KN4C 4BBSB 3C3LA 1CHQD 5FLMH 3FEWX 3NWSA 3S16H 5ELFA 3J80i 4ZUIA 4X64Q 2X6GA 2NTSA 3D31A 1EYCA 3CQZB 1N32Q 3NP8A 5J22A 2M00A 3NBHA 1WTPA 1BCPD 1WTRA 2ZTDA 3JAMc 3VA5A 3T53B 3S17H 3HOWG 2F0VA 1ZEQX 4BA2I 4AH6A 2B29A 4DV2L 1WTHA 4Z9CB 1WVLA 4XQJA 1GKHA 3OMGA 4LFAQ 4LK1C 1PH9A 4HJAA 4JVZA 2F0UA 2JQOA 2NVQH 1LLRD 4HTHA 1Q46A 2MNAA 5JJIA 2BE5C 1S5DD 4M1UB 3HZXA 4RKBA 5A35A 3M7NA 2A6EC 2F1MA 4NKLA 1JOOA 2NYZD 3OOCA 3FHWA 2LSSA 1I6HB 2K50A 3E3XA 4GOPA 1SMXA 1HZ9A 4DV1Q 4IN3A 2L15A 4DR7L 1RF2D 1V43A 5D14A 2QCPX 4FXDA 2MHVA 3TDQA 4LAAA 1SEBD 1QG7A 4FO2A 4UDUC 4DR1Q 3EROA 4UPAA 3SK8A 4DV3Q 1F2MA 4RG1A 1YHAA 3MXUA 1SYCA 1IKMA 4J1MA 3FPUB 4R4QA 1QE6A 1E0BA 1KDAA 3ULLA 4A3DG 3OSOA 2UXBQ 3RD4A 2B2TA 1DCZA 4GOPC 4A3JH 4PG3A 3JAML 1PRTD 1STYA 5ELEA 1HFNA 4K5VA 3TP6A 5GADC 3OIQA 2BDNA 2F0LA 4DV6L 4XIGS 3PO3H 5CR3A 4DV4Q 1MIUA 1PH2A 1VQKA 3G6JB 1Y1VB 4A93B 1NUCA 4KKUA 1QUQB 3JAMi 1X65A 4JOIA 1G51A 4MTNA 2K32A 1HZCA 4H13C 4UP7A 1SYBA 4BBRG 2E2HB 2F0EA 2KEDA 3I4NB 4KY7A 1IYVA 4L63B 2ZTCA 4B9XA 2X69A 1EQVA 3M85A 3FKIH 1Q1BA 5FK9C 1AN8A 1V9PA 5E4XA 3S2DH 4A3IG 4LMQD 1HPCA 2NVXH 4UAIA 4CDFC 1LYLA 4RGMA 4LUVA 4X64L 1F9PA 5IGFA 3M4OH 1LTTD 2OTLA 2TSSA 3J81E 1H95A 1ZYRD 4N8X1 4X65Q 4CKCA 1N32L 4QB4A 1MSGA 4I65A 1PV4A 4PMWA 4K6LA 3DEPA 1TWCH 3NSWA 4UP8A 2NWGA 3A5ZB 5ELOA 2KOLA 2N88A 5EPKA 5C4XH 1QB5D 2YYZA 4DV7Q 1R9TB 4LFAL 5EBDA 4N8FA 2E76C 4DF7A 1RDPD 1BNZA 1HCZA 1LTLA 2VS1A 3BDOA 3ICEA 1WCMB 2NVTB 4BS9A 3HOXG 3L7ZC 1U5KA 5A2QE 1Z9FA 1TR5A 2A19A 2F0DA 1OXTA 2JJQA 3W5OA 2YU9H 3U4VA 3K80C 3GTJB 3MEFA 5FO9B 1Y1WG 1ESFA 4JI0Q 5KNBA 4DV1L 3WDNA 2J4XA 2JA5B 1S5CD 2PQEA 3HOWH 2QEJC 3C1FA 3R2IA 4DR1L 1VQ4A 3DM1A 2ASBA 4JI1Q 3VR6A 1KNEA 5KNDA 3CCQA 4DV3L 4K6DA 2AQ2B 1K0SA 4DUYQ 2V4DA 1EY9A 2O2LD 2YTYA 1YBYA 4YIJA 2K6AA 1I94Q 1HZAA 2UXBL 2TMPA 1IW7D 1H9JA 4KK7A 5LMUQ 4WJ4A 1QVCA 3FP9A 2R7ZG 1WTQA 1JT8A 3J7YW 3FPPA 2C5CA 2ICIA 3C2PA 3KDFA 1O78A 1PFBA 3QB3A 4N9PA 4H7BA 2WP8J 1HUMA 4DV4L 4JK1C 3A56A 4C3HB 4CJ2C 2N3SA 3RMHA 1S40A 3A74A 4HN7A 1QZGA 3CU7A 1JCKB 2L11A 2R3ZA 1PLFA 2Y0SG 4LW1A 2EE1A 1B53A 4RHRA 1ENAA 3OIPA 3SEBA 1E3PA 2EZVA 3OYYA 3X3NA 4A3GB 5IIFA 2V1CC 4A3DH 1RHPA 5GROA 4KHPQ 2RSNA 3H0GG 1FYCA 1HQRD 4A76A 4C3IB 1VQ7A 1Y8OB 3M4YA 2K05A 3SXHA 1D1KA 3S1MH 3STBD 3H3VH 4FVMA 1C4QA 1JE4A 3BG3A 2WKDA 1OXUA 2VL6A 2QILA 2K5NA 5I2YA 5M5WB 4LF8Q 4K0KQ 1JMCA 1A3VA 4HJ7A 2WAQB 4X65L 3HOZG 3VYTA 1CT1D 3HGBA 1SNOA 1SFOB 3S1NH 1L0XB 4ZKBB 5C44B 1VF5C 4BBRH 2E2JB 4ZCKA 1K83B 3BU2A 3UDGA 4XTCS 1X3EA 3ER0A 1Y8NB 1ZXTA 1Q82C 1TWAB 4GS3A 1EIYB 4DV7L 1UEAB 3K5OA 2Z4IA 3OW2A 1T5XD 4CDCC 3E5SA 4TQUS 2H4OA 1YI2A 3I3CA 2E8GA 4K5WA 4Y7NH 3F2CA 4I7AA 2WACA 4RA8A 4G57A 4C2MH 4XDXA 1WTVA 2A5HA 4JI6Q 1QNUA 1QOHA 1HHVA 4A3CH 1STEA 1JE5A 1EEID 2LS01 4ME3A 2B2YA 1HA6A 3CMAA 1YJ9A 3TREA 1YJNA 1PH4A 3EIVA 1II3A 4A3BG 1BCPF 1NE3A 2F03A 1VQEA 2A68C 1XPOA 3TS2A 4J6HA 4JI1L 4A3MG 2Q8IB 3E9IA 1Z7TA 3S15H 1ZKOA 2WKCA 1E1TA 4MN3A 4G7ZC 3CCJA 4DUYL 1NNXA 3BDLA 3M3YH 3CKIB 2KCMA 4LWCA 1I94L 3A7AB 1PTOD 2EJFC 3HFZB 4OIKA 1VQOA 2AQ1B 4F7XA 5LMUL 4ZAIA 3J80E 3EQLC 1CKOA 4ZQ3A 1WTXA 4AYBG 3NELA 2F0SA 3MHBA 3P7JA 3U58A 1BBUA 1PMRA 3ULPA 5KGUA 1GO3E 1WI5A 2EXZA 1CFMA 1SXTA 4GN5A 5K5PA 3J7AF 5IWAQ 5IYBG 2CHBD 4DPGA 2I07B 4K14A 5C3EG 4LUOA 2IY5B 5C3WA 5IOCA 2G9DA 5CV9A 2F0HA 5M3MG 4A75A 4O2DA 4Y52H 4HIKA 3GTPB 4RGTA 4GZYC 2JYOA 3ONAB 4FNFA 4KHPL 3K7AH 1UNSA 2NN6I 4OO1H 5KRUA 4QUCA 2JA6G 3TMEA 3MFGA 1G6PA 1NCVA 1JORA 4UP9A 1CZGA 5ISRA 4JPBW 5M5YH 1PRTF 4G4KA 1V1PA 1VS0A 3NQTA 5A2QL 4DR4Q 5HGTA 4LF8L 4K0KL 4PMCA 5JOBA 2PQAB 4YY3Q 1BBWA 1RKNA 5IP7G 1CKNA 2BCOA 2K5VA 2PO4A 2EYOA 1PFSA 3MXNB 4PV1C 4FXGC 3KBGA 5I2XA 3EFXD 5EGTA 1SNDA 3G71A 4BY1G 3MXPA 5JPNC 3HOUB 1CSQA 1A2TA 1XNRQ 4PQXA 2C9OA 1WJJA 3VR2A 1X3FA 4PZ6A 2ZM6Q 1IBMQ 1A2UA 2L5TA 3NE5B 4BY7H 4MTKA 3H91A 2K01A 1AZQA 1ICWA 4IUUA 1EY6A 2K4KA 1PFNA 4EGVA 1Q3LA 1KC8C 1X56A 1ICFB 4NB3A 3I4MH 3V96A 3MZ5A 1JWSD 3H6MA 1DYQA 5C0XG 3JAME 4JI6L 2FFKB 2VXWA 1Q81C 4ABNA 3OPOA 1EQRA 3BYYB 4B9WA 4HSPA 2F52A 2B63B 1I3QH 3CF5A 4XYOA 2I0QA 3K5LA 4JI2Q 1EYDA 3BVZA 4JI7Q 1JQYD 3KF8B 4XT3B 1DONA 3NPPA 5JEAG 2RVLA 2K52A 3DWPA 2PMZB 3HEJA 2E2IH 2FMCA 1HR0W 1AP0A 1BDOA 3VYSA 3MAQA 1KLUD 3ULJA 4LF6Q 2KJXA 1NMFA 1HUNA 1SN8A 1M1KC 3GTLB 1Y8PB 1SR3A 4DNRB 3D3RA 2R93B 1I4HA 4ILWA 1X3PA 2HT1A 2KHJA 1UE6A 1KAAA 1VQDA 2JSOA 2JA7G 5IWAL 1P16A 2MQHA 4WRDA 3VR4A 4A3JG 2OTJA 2WB1B 2EYPA 4K8JA 4GNXB 1EY0A 4CJ1B 4IPGA 4UY8C 4PZ7A 2JA9A 4DR6Q 5FJ8G 4L5SA 3JC66 1SBBB 3SE0A 3BVGA 4A3KB 2GN5A 2PMZE 4A3BH 5T1IA 5AFWA 4DK6C 2M2LA 5KYIA 2JA8H 5JVH3 1N34Q 3SK4A 2IX1A 2BA0A 1IHZA 1A63A 4YCUA 3G6EA 5J1ZA 3HOYG 3D8GA 4WFN3 3S1RH 1JJ2A 4P71A 2EYLA 5IT9c 1LTID 4KKTA 1CZWA 1TWFB 1NMGA 3D4DA 4MZ9A 1HTPA 2MUYA 1Q8KA 3FKIG 3MTSA 3EVQA 4F88A 1E2WA 2K14A 2VW9A 1QWYA 3H09A 2RKSA 2SOBA 4DR4L 3S2DB 2H5XA 2FJ2A 1I4RA 1LT4D 4DXGA 1C9OA 1AZPA 4YY3L 3NBHB 1UE7A 3HKZG 3UDFA 4HCEA 4K2LA 1AE2A 3IL8A 5C4JH 3CCVA 4FF3A 3PUVA 4GKJQ 3OWEB 1PTOB 1SLJA 2F0NA 4A3LG 3QO2A 1XNRL 3F2DA 1STNA 2E5LQ 3KOJA 3WWVA 1VDZA 1D7QA 2ZM6L 1IBML 3HS0C 5I9PA 2XRQD 3STBC 1UUPA 4DUZQ 1HFGA 1EFWA 3AU7A 2XGTA 4IQZA 1D5XC 4IUVA 2JA6H 5C4XG 4E6IA 3KF6A 3UI2A 4O0AA 4IZ8A 5F2DA 2DUDA 3CW2C 5J3BA 4HCSA 1PA6A 2B2VA 4UHVA 3I4LA 3W2DA 3TS0A 4GKKQ 2KUMA 2SNSA 1YNNC 3GO5A 4L5TA 5EKKA 3GV3A 3S14H 4BWGB 2HHHQ 1F2ZA 4EQNA 3BJUA 1DD2A 5IP7H 1JB3A 3NWTA 4GNXC 1ET9A 1NTGA 1AH9A 1TKWB 1IBLQ 4JI2L 1NR4A 2NZHA 3LX0A 3T4AC 1XNQQ 1PZKD 4JI7L 3RZOH 4BY1H 3NBIA 1VMCA 2FHTA 1VQFA 2NB0A 1MJCA 1JC7A 4OWTB 1IBKQ 3T1HQ 1M8AA 2EIFA 1LO5D 2XRSD 1CTMA 3I8ZA 4ULLA 2VQEQ 4LF4Q 2KCTA 4OWWB 4C3JB 3S2HH 1VQBA 3HKSA 4LF6L 1A3TA 2PPBC 4DU9A 2F0TA 1CI3M 5LMNW 2A68D 4DR5Q 2DN8A 1ASZA 5C0XH 1ENCA 2RSOA 4ZYSA 2F0IA 4H0LC 3K6OA 4DR6L 4H02A 3RZDH 2VUMB 3KLSA 2XWJB 3NENA 4P74A 3TQYA 5AJ3Q 2LXJA 1PTOC 5JEAH 4AQYQ 5K36G 3A7LA 4ID6A 1OTCA 1N34L 5EBCA 3DWQA 4R4CA 1F9RA 2NVYH 1QZHA 2XIWA 3J7A5 2Z1CA 3PGZA 1W3SA 5IODA 3M4QA 2NTTA 4X3UA 1O7LA 2XNAC 3ITPA 3HOVB 2WV6D 2R7DA 2FINB 3K57A 3GTMH 2EXDA 2JA7H 1SDFA 1MD2D 3GTKB 3LNNA 4IJLA 5FJ8H 1H9RA 1I4GA 2XSCA 5NUCA 2B2UA 4P75A 4GKJL 3PUXA 2L1BA 3GTGB 3A8IE 3MXGA 1QJOA 2PW5A 5DM73 4WJWA 2E5LL 1JWMD 3HOYH 3S1NB 3PO2B 1L0WA 1YEZA 4DUZL 3NXWA 1GUSA 4HJ9A 1YNXA 3V2TA 4DAPA 1B9NA 2I5HA 2EY1A 2B2TC 1A3UA 1XMQQ 4OGQC 2BOSA 2R92B 5CYUA 2BA1A 1BUVT 3U50C 4M8AA 4B3MQ 3DXJC 4L5RC 4A93G 1ML0D 2KBNA 2N49A 4KHVA 5FO7B 4IFDG 2Q2TA 3MFYA 4DNIA 4GKKL 1Q86C 1XX8A 4A3IB 2B2UC 2HHHL 3K0YA 1G8ZD 2WIIB 3I4NG 4ZUJA 1OXSC 4JOIC 1BBXC 2EYMA 5C5LA 1FJGQ 4C1NI 2D0OA 2HQEA 4DAMA 1KQSA 4DK3C 1IBLL 2EJGC 1VQ8A 2JEBI 1XNQL 4A3CG 4A3LH 1STAA 1RODA 2F0KA 3QOJA 4QCLA 1IBKL 4C56C 1W6JA 3DEOA 2NUCA 1I50H 1JJCB 3F1ZA 3T1HL 2JK8A 3NTIA 1EZ8A 2VQEL 4LF4L 2Z6KA 3K7UC 1IL8A 1T9HA 1JOKA 5D3DA 3E0JA 2Z8LA 2Q2UA 2VB2X 1A6XA 4NP5A 1I4XA 1NBWA 1R4PB 5T1GA 5C0XJ 2F0QA 3CC4A 1Y69U 3KDFB 4O42A 1MI2A 4EVOA 4DR5L 3DHQA 4K2KA 1VQ5A 3I4OA 5M3FB 1IL2A 5HURA 1UAPA 3HOXB 1PHJA 2N78A 3CPFA 3KLWA 4LFBQ 3I70A 1CHPD 5CV5A 2CW0C 1N8RC 5COYA 4OWXB 4QQBX 5AJ3L 2K5QA 3S1QH 1Y1WB 2CQOA 2OXPA 4AQYL 1B70B 4KTAA 3EBEA 1WCMG 4DAYA 4EX5A 1SYGA 4BBSH 3SK6A 3AEVA 4FDBA 3AFPA 1FVIA 2F4VQ 4PMBA 1S5BD 4EQ5A 5C5MA 2FXQA 2HQLA 1HNWQ 1U4RA 1FGUA 3TBIB 1VQJA 4QMGA 3CQZH 2HIXA 2DY8A 4OO1G 4X66Q 1SYDA 1JR0D 4IJHA 2R7ZB 3RLFA 1UEBA 2GVAA 3ERQA 3RN2A 4WJ3M 2A69D 2KVMA 1B4OA 1EEFD 2IJ0A 1PH3A 1EFID 1K73C 3OW7A 3PIO3 2EYJA 1BKBA 1W2BA 2F0WA 4G7OC 1OXXK 4DFAA 2MO1A 3LWUA 1T5EA 5K36H 4J8QA 4JBKA 1GUWA 1TQOA 1E1OA 3E0EA 1QNKA 4NW2A 3PF5A 4OEMB 4KD4A 1I6HH 1MJEA 2QKIC 2ES2A 2CH4W 1XMQL 1PH7A 1B44D 4A3EB 4BY7G 4C3HG 1S72A 4B3ML 1HQMC 1NAPA 4JG2A 1VMPA 1P8LA 3H0GB 3R2TA 2ZJQA 5JJKA 3DMUA 1CKMA 4H44C 3I4MG 4QY7A 3PUYA 3CAMA 4R4IA 1C8CA 4Q0FA 4F87A 4RH6A 1FJGL 4XYQA 4A3GG 4YHHQ 4TVAB 3K5MA 1VCIA 2UU9Q 1Z6HA 1B9MA 2Y0SE 4WORA 3EA6A 3HOZB 4OHJA 1YNND 1H9MA 4HEDA 4B3RL 2K33A 2A1AA 5KEEA 4B08A 1JICA 1SYEA 4JBWA 3CCEA 4ZLTF 4V0BA 4KKSA 2QW7A 3KLSX 1Y1VH 2RHQB 4A93H 1KXLA 2WAQG 1NR2A 1EQTA 4IFDH 3D4RA 4QJFA 4R8NA 3CP0A 2KCNA 3QIAA 2E2HH 3I4NH 2ZT9C 2VZAA 3UE0A 1C48A 1XXGA 3E9HA 3IFDA 1J9OA 3HRZC 2AUKA 4LFBL 1PFMA 1GUGA 2PNRC 2EPBA 4IOCA 1SNQA 4DR2Q 3OTOQ 3H94A 3I90A 4JI5Q 5EKIA 1I5FA 4YWLA 3I2ZA 3GTOB 2DJGC 4OELB 4HMIA 1H9KA 5C3XA 3K81C 3K59A 2AQ3B 1NSNS 2F4VL 2Q2IA 4CDDC 1CK1A 4FF4A 2JA8G 4A3MB 1HNWL 3Q6SA 4U673 1FNUA 4MHEA 4PZ8A 1V1PB 1TT2A 4X66L 4PNYA 4NPSA 3I56A 4LFCL 4QGUA 4IO9A 3LGJA 5JJLA 1CKNB 2RA4A 1F9QA 1CQFA 2B2YC 1SMYC 5BR8Q 4QF4A 3A54A 4K8IA 1R9TH 3KK7A 3PIOA 1ILPA 5IT9E 4IUQA 1GHKA 1PYSB 3DLLA 3CC2A 4B3SQ 1WCMH 2NVTH 1V1QA 5CV4A 5CMDA 1TWGB 1B50A 2R61A 5C3EB 3CRKC 2HCCA 5E3FA 3KBXA 4JC0A 5GAHC 5M3MB 5DEHA 2RCNA 4GN3B 2CQAA 3T51B 1PH8A 3GTJH 2K28A 5M5XB 3RN5A 3U9OA 3SR1A 4LUZA 4AYBE 2CCZA 2JA5H 1FNWA 3FMCA 4FYDA 4APVA 1OXVA 3QG1A 1MKHA 1Q12A 4CDEC 3GTQB 2K7VA 3P20A 3S24A 2MPMA 4CHTB 3CCRA 4DKAC 2IT1A 3PUWA 5IGDA 4YHHL 1IYJB 4A3FB 2IX0A 5JPMC 2UU9L 2WFWA 3S16B 2XTIA 5EJWA 3ZJYC 2JP1A 2XVSA 1LT5D 2IHEA 1HJPA 3ERSX 1YVCA 5EQ0A 4I7ZC 5C0XI 1AE3A 2A6HC 4ODGA 4LF9Q 2QA4A 2HD3A 4CBVA 2LXKA 4IOAA 2ENBA 1STGA 3QJYA 2F0GA 1K0RA 4IFDJ 4C3HH 3S17B 3I72A 2P5ZX 3K8AA 2PNHA 3EJIA 4JI3Q 3D4WA 1E2VA 1E24A 5E7NA 2NN6G 3HOUG 2CVRA 3BDCA 2K04A 1Q90A 2NVQB 2K1BA 3MC0B 3BYTB 3OWFA 3OMCA 4A3GH 5ELBA 1EY8A 3M9BA 3CCSA 3X3MA 1RIPA 1EL0A 4DR2L 4IALA 3PV0A 3OTOL 5CGKA 4C3IH 4JI5L 1UE1A 3QOLA 3S9WA 3BZKA 1B8AA 4O1NA 1K8AC 2XWBB 5FLXc 1AEXA 3NUCA 5M5WH 2D0PA 4IURA 3SGIA 5ELNA 2CW0D 3K0XA 5CBAE 2F3IA 1K3BC 2B63G 2D62A 1SFOH 5BN4A 5C44H 2GVBA 4J15A 1ONLA 1SNMA 2E2JH 1K83H 2O4XA 3V05A 4P72A 4HMJA 3PUZA 5IYDG 1TWAH 4IUNA 5BR8L 1YHQA 2SEBD 2JA7B 2EQSA 1HNXQ 4A3JB 1N9WA 1LTBD 2Z4HA 1IKLA 3GD7A 4B3SL 1VQAA 4OONA 3PO3B 4S3SA 4YWKA 1DZ1A 3CCUA 3W1BA 1GUTA 1TS3A 1G291 2KHIA 3R8BA 3KF6B 5DM63 4IPCA 2WB1G 2A69C 5FKAC 1NJIC 3PQIA 1CUKA 1OO9B 3VDYA 1F2YA 3EN2A 4JV5Q 1EY7A 2Z6BA 1WTOA 1KAWA 4A3KG 1GJXA 4KHZA 3UE1A 1E7ZA 1XPRA 1SROA 5CV8A 4LF7Q 1VQMA 3HG9A 5M9OA 2I5LX 1EYAA 3PF4A 1WOCA 5LL6S 1EQQA 3FKIB 4QIWE 1EWIA 1WTWA 1PDQA 1XWEA 5FLXL 4IPDA 4EQPA 3J7ZC 1W6KA 3NK9A 2NVXB 4KJNA 3L2PA 1MBYA 4MIUA 4EQOA 5ELDA 5L37A 3LWEA 3H15A 1GUNA 3M4OB 3A0JA 4LF9L 1G2TA 1KL9A 2KEEA 3HP3A 2PYKA 1L1OA 4MNOA 5IP9H 3ND8A
chains in the Genus database with same CATH topology
5IGEA 4HSVA 1TWCB 1EWHA 2E75C 5C4XB 2AWOA 3SDZA 2IX3A 1KABA 1EY4A 4X3KA 4KN7C 2EDGA 5KYLA 2M9VA 5IT9L 1O80A 2QF7A 4LJZC 1V1OA 3WOEA 2WINB 3DWAA 3G7LA 1M4VA 5DNFA 2LKVA 2YU9B 1PYWD 5EPJA 3PMFA 2IL8A 3HOWB 1R4QB 2B2VC 3J7AV 3MEHA 2NN6H 1TU2B 2ZXOA 3AB9A 2Q8TA 1HXYD 1EZ6A 3RUZA 3U9SA 2L12A 5EKLA 2D9UA 3CRLC 1DOKA 4IUTA 4C3JG 5LHY1 2BDOA 1AFPA 1CM9A 2F4IA 3WOFA 2SNMA 1K8OA 4BA1I 1SMYD 2JXMB 3VR3A 1SJED 3P1HA 2F0JA 2FMMA 1PTOF 1S4ZA 3K58A 1EIGA 2MJ8A 3T16A 3SVMA 4RFBA 4A3DB 2QDBA 4DGZA 2PW7A 3VA7A 3S1MB 1GUOA 5G3LD 3K5NA 1JOQA 4IFDI 3I91A 4FXKC 2XN9C 3Q23A 5C6AA 2AWNA 1FNVA 1WD1A 2Q8RE 4BBRB 5KIXA 4DN4M 3TP5A 1O7ZA 2NBFA 2A6HD 3KLRA 3GQBA 1FGBD 1D5MC 3QWNA 1H9SB 1BO0A 4Y7NB 4C2MB 1SNPA 3GP7A 5DAUA 1B3AA 5IGCA 2RDFA 3N6RA 5JJZA 1BXTA 1SNCA 2L4NA 5C4HA 4N9TA 3IFTA 1LTAD 2DNCA 4QUFA 5IGGA 1QCBD 3S15B 1PTOH 3M3YB 4RHSA 4G7HC 3D6CA 1DOMA 2LY7A 1BOSA 1STBA 1O7YA 1KDBA 1U9RA 3D6WA 3PIP3 3ND9A 3H3VC 4X3TA 2D2CC 5JEAJ 4OO1I 3T56B 2PZTA 2J0TD 1H9SA 1KTKA 3CHBD 2JEAI 3BVMA 4TSSA 2E74C 2IWHA 3FRPB 1SSOA 1GHJA 3C1EA 3K7AB 4K5XA 1DM0B 1TY0A 4V190 2JE6I 5E4WC 3E6ZX 1TVXA 3VYUA 5M5YB 4KJOA 1K8MA 1LT3D 1S5ED 1FD7D 1CQVA 2ZXRA 2OT2A 1F77A 1RCVD 5FOBB 3VYRA 1B1ZA 2O5JC 2RDHA 2Y0SB 1HTLD 1TY2A 1YNJD 2KCCA 4ME5A 4C1NK 2DNEA 1D6EC 1BCPB 1D2BA 1SJHD 2KHSA 2N55A 3IKJA 4RCNA 1PZID 4KY6A 4BY7B 3OHXC 4F8MA 5LL6X 3Q22A 2RDGA 1JWUD 2B8GA 4DK1A 3I4MB 1Q8IA 4X3SA 5I9OA 4KI0A 5JAVA 3IAYA 1BR9A 1RTOA 2IW3A 1SYFA 2EY5A 4DXFA 2EOTA 2AUJD 4C3IG 1I4QA 1I3QB 2PCFB 5J39A 1AW7A 2EYHA 1F2LA 4U68A 3ZYYX 3I73A 4XT1B 4KD3A 2E2IB 2KA7A 3W3AA 3BS1A 1G6ZA 3TZDA 1XYIA 4KY5A 3TZUA 5FLXE 1KNAA 2OF1A 1PZJD 1SE4A 4IUPA 4RGNA 5E1FA 1VF7A 1B2TA 1PRTB 2L0CA 3FDTA 2MP1A 4TRDA 3NTHA 4A3BB 2RQXA 1GXDC 1CA6A 3A55A 2JA8B 1BCPC 4HAEA 1G91A 2EJMA 1TIID 4DNTB 4RWSC 3S1RB 2BE5D 5IGBA 2A6ED 3NHHA 4AYBB 2F3WA 4P2CB 4ZKCB 2F0MA 4DK0A 5FO8B 3GV6A 3NQIA 3AMUA 1BF4A 2I46A 1SAPA 1SE3A 1LTGD 2X6LA 1MGSA 5I6YA 1PXUA 2LMCB 2MGSA 2A73B 5C4JB 3C46A 2L9HA 4ZRZA 1U4MA 1FR3A 4TKOB 4FP5D 3MVVA 3MWYW 2EYFA 3L3OC 5CV6A 2NZ1D 3J81L 1KDCA 1S5FD 2JA6B 1TWHB 5EPLA 3Q24A 2SDFA 2B2WA 5G3LF 1RJTA 3SK5A 3L9AX 2ICEC 1SE2A 3S14B 2KECA 1PRTC 2GA4B 1G2SA 2EVBA 2B8FA 4KV6A 4XQNA 4OL7A 1V8QA 1LTRD 3RZOB 1KLGD 4BY1B 1HRJA 3BZDB 5JVG3 1RTNA 1ET6A 2LFNA 2O5IC 2E2DC 2F0PA 2K5WA 2PZWA 1TS5A 2RBMA 3NTKA 4XQQA 2B2WC 3S2HB 2B39A 3SHLA 1LTSD 3FVQA 1ILQA 2HCIA 4HR7B 1TS4A 2ID0A 4ZK9B 4CKEA 1Z47A 2R6GA 1D5ZC 1X32A 1LABA 5TSSA 3M7GA 3N52A 2HUGA 2HDMA 3RZDB 1J8IA 4NMZA 1ZYRC 5BN5A 3Q0AA 2K5DA 1F9SA 2J7ZA 5CC4A 1EWCA 1A15A 5BN3A 1GOZA 1HA5A 5CBEE 2NVYB 5CV7A 1U4PA 1D1IA 4NDXA 1TS2A 2ZXPA 5CORA 3P75A 4R9WA 1EOTA 3GTMB 1IYUA 3F2UA 1BQQT 4DA2A 3MXNA 5I4DA 4QIWB 2F0OA 2F0FA 1EY5A 1QILA 4KMUC 2IPKD 2VB3X 3TP7A 1I4PA 4XXEA 4CGYB 1Q1EA 1CA5A 2PZUA 1EIHA 2A74C 2DY7A 3TN2A 3R3OA 5ELCA 4DAVA 5D65A 3HOYB 1DJRD 5C4ZA 1XTCD 2OEOA 2EY6A 4RAUC 3A8KE 2F3VA 1DXMA 5KNCA 4L6TB 3MA2B 2KQ3A 1IW7C 3T13A 4CKBA 1U4LA 1STHA 4L8JA 3TSSA 1ESRA 1MSHA 1YNJC 3DUZA 3KF8A 4RKLA 2EY2A 4RCOA 1LACA 2H1EA 3HKZB 1LV9A 4R8IA 3KUPA 5I6WA 1I50B 2K03A 5D3IB 4OIJA 1LT6D 1X3QA 1WD0A 1RD9D 4Q5VA 2HDLA 2D5DA 2G9HD 1L0YB 4FF1A 1EU4A 2L55A 3VR5A 4CJ0B 4FF2A 3TP8A 1DOLA 1ENFA 3R93A 3URYA 3A8JE 4RGOS 1I6VC 3O13A 3J80L 3S1QB 1EU3A 2VNUD 1E2ZA 4KN4C 4BBSB 3C3LA 1CHQD 3FEWX 3NWSA 5ELFA 4ZUIA 2X6GA 2NTSA 3D31A 1EYCA 3CQZB 3NP8A 5J22A 2M00A 3NBHA 1WTPA 1BCPD 1WTRA 3VA5A 3T53B 2F0VA 1ZEQX 4BA2I 4Z9CB 1WVLA 4XQJA 3OMGA 4LK1C 2F0UA 1LLRD 4HTHA 2BE5C 1S5DD 4M1UB 3HZXA 4RKBA 5A35A 3M7NA 2A6EC 2F1MA 4NKLA 1JOOA 2NYZD 3OOCA 1I6HB 4IN3A 1RF2D 1V43A 5D14A 2QCPX 4FXDA 2MHVA 3TDQA 4LAAA 1SEBD 1QG7A 4FO2A 4UDUC 3EROA 3SK8A 1F2MA 3MXUA 1SYCA 1IKMA 4J1MA 3FPUB 1QE6A 1E0BA 1KDAA 3OSOA 3RD4A 2B2TA 1DCZA 3JAML 1PRTD 1STYA 5ELEA 1HFNA 4K5VA 3TP6A 3OIQA 2BDNA 2F0LA 4XIGS 5CR3A 3G6JB 1Y1VB 4A93B 1NUCA 4KKUA 2K32A 4H13C 1SYBA 2E2HB 2F0EA 2KEDA 3I4NB 4KY7A 1IYVA 4L63B 4B9XA 2X69A 1EQVA 3M85A 1Q1BA 5FK9C 1AN8A 5E4XA 4LMQD 1HPCA 4UAIA 4RGMA 1F9PA 5IGFA 1LTTD 2TSSA 3J81E 1ZYRD 4CKCA 4QB4A 1MSGA 4I65A 4PMWA 4K6LA 3DEPA 3NSWA 2NWGA 2KOLA 2N88A 5EPKA 1QB5D 2YYZA 1R9TB 5EBDA 2E76C 4DF7A 1RDPD 1BNZA 1HCZA 3BDOA 1WCMB 2NVTB 4BS9A 3L7ZC 5A2QE 1TR5A 2F0DA 1OXTA 3GTJB 5FO9B 1ESFA 5KNBA 3WDNA 2J4XA 2JA5B 1S5CD 2PQEA 2QEJC 3C1FA 3R2IA 3DM1A 3VR6A 1KNEA 5KNDA 4K6DA 2AQ2B 2V4DA 1EY9A 2O2LD 4YIJA 2K6AA 2TMPA 1IW7D 1H9JA 4KK7A 1WTQA 3J7YW 3FPPA 2C5CA 2ICIA 3C2PA 1O78A 1PFBA 3QB3A 4N9PA 4H7BA 2WP8J 1HUMA 4JK1C 3A56A 4C3HB 4CJ2C 3RMHA 4HN7A 3CU7A 1JCKB 2L11A 2R3ZA 1PLFA 2EE1A 1B53A 4RHRA 1ENAA 3OIPA 3SEBA 2EZVA 3X3NA 4A3GB 5IIFA 1RHPA 2RSNA 1FYCA 1HQRD 4C3IB 1Y8OB 3M4YA 2K05A 3SXHA 1D1KA 4FVMA 1C4QA 1JE4A 3BG3A 2WKDA 1OXUA 2QILA 5I2YA 5M5WB 1A3VA 2WAQB 3VYTA 1CT1D 3HGBA 1SNOA 1SFOB 1L0XB 4ZKBB 5C44B 1VF5C 2E2JB 1K83B 4XTCS 1Y8NB 1ZXTA 1TWAB 1UEAB 3K5OA 2Z4IA 1T5XD 3E5SA 4TQUS 2H4OA 3I3CA 4K5WA 2WACA 4RA8A 4G57A 4XDXA 1WTVA 2A5HA 1QNUA 1QOHA 1HHVA 1STEA 1EEID 2LS01 2B2YA 1HA6A 1II3A 1BCPF 2F03A 2A68C 4J6HA 2Q8IB 1Z7TA 1ZKOA 2WKCA 4MN3A 4G7ZC 3BDLA 3CKIB 3A7AB 1PTOD 2EJFC 4OIKA 2AQ1B 4F7XA 4ZAIA 3J80E 3EQLC 4ZQ3A 1WTXA 2F0SA 3MHBA 3P7JA 1PMRA 5KGUA 2EXZA 1CFMA 1SXTA 5K5PA 3J7AF 2CHBD 2I07B 4K14A 5C3WA 5IOCA 2G9DA 5CV9A 2F0HA 3GTPB 4RGTA 4GZYC 2JYOA 3ONAB 4FNFA 1UNSA 2NN6I 4OO1H 5KRUA 4QUCA 3TMEA 3MFGA 1NCVA 1JORA 1CZGA 5ISRA 1PRTF 4G4KA 1V1PA 3NQTA 5A2QL 5HGTA 4PMCA 5JOBA 1RKNA 2BCOA 2PO4A 2EYOA 4PV1C 4FXGC 3KBGA 5I2XA 3EFXD 5EGTA 1SNDA 3HOUB 3MXPA 5JPNC 1A2TA 4PQXA 2C9OA 3VR2A 1A2UA 2L5TA 3NE5B 3H91A 2K01A 1AZQA 1ICWA 4IUUA 1EY6A 1PFNA 4EGVA 1Q3LA 3V96A 3MZ5A 1JWSD 3H6MA 1DYQA 5C0XG 3JAME 2FFKB 2VXWA 4ABNA 3OPOA 3BYYB 4B9WA 4HSPA 2B63B 4XYOA 3K5LA 1EYDA 3BVZA 1JQYD 4XT3B 1DONA 3NPPA 5JEAG 2RVLA 3DWPA 2PMZB 3HEJA 2FMCA 1AP0A 1BDOA 3VYSA 3MAQA 1KLUD 2KJXA 1HUNA 3GTLB 1Y8PB 4DNRB 3D3RA 2R93B 1I4HA 4ILWA 1X3PA 1KAAA 2JSOA 4WRDA 3VR4A 2WB1B 2EYPA 4K8JA 1EY0A 4CJ1B 1SBBB 3SE0A 3BVGA 4A3KB 5T1IA 5AFWA 2M2LA 5KYIA 5JVH3 3SK4A 2IX1A 2BA0A 1IHZA 5J1ZA 3D8GA 4WFN3 2EYLA 1LTID 4KKTA 1CZWA 1TWFB 3D4DA 1HTPA 2MUYA 3MTSA 3EVQA 4F88A 1E2WA 1QWYA 3H09A 2RKSA 2SOBA 3S2DB 2FJ2A 1I4RA 1LT4D 4DXGA 1AZPA 4HCEA 4K2LA 3IL8A 4FF3A 3PUVA 3OWEB 1PTOB 2F0NA 3QO2A 1STNA 1VDZA 3HS0C 5I9PA 2XRQD 1UUPA 1HFGA 3AU7A 4IQZA 1D5XC 4IUVA 4E6IA 3UI2A 4IZ8A 5F2DA 4HCSA 2B2VA 3W2DA 3I4LA 2KUMA 2SNSA 1YNNC 3GO5A 5EKKA 3GV3A 4BWGB 1F2ZA 4EQNA 1DD2A 1JB3A 3NWTA 1ET9A 1TKWB 1NR4A 3LX0A 3T4AC 1PZKD 3NBIA 1VMCA 2FHTA 2NB0A 1JC7A 1M8AA 1LO5D 2XRSD 1CTMA 3I8ZA 4ULLA 4C3JB 1A3TA 2PPBC 4DU9A 2F0TA 1CI3M 2A68D 2DN8A 5C0XH 1ENCA 2RSOA 4ZYSA 2F0IA 4H0LC 3K6OA 2VUMB 3KLSA 2XWJB 1PTOC 5JEAH 5K36G 3A7LA 4ID6A 5EBCA 3DWQA 1F9RA 2XIWA 2Z1CA 5IODA 2NTTA 4X3UA 1O7LA 2XNAC 3ITPA 3HOVB 2WV6D 3K57A 2FINB 1SDFA 1MD2D 3GTKB 3LNNA 1H9RA 1I4GA 2XSCA 5NUCA 2B2UA 3PUXA 2L1BA 3GTGB 3A8IE 3MXGA 1QJOA 2PW5A 5DM73 4WJWA 1JWMD 3S1NB 3PO2B 3NXWA 1GUSA 3V2TA 4DAPA 1B9NA 2EY1A 2B2TC 1A3UA 4OGQC 2BOSA 2R92B 5CYUA 2BA1A 1BUVT 4M8AA 3DXJC 1ML0D 4KHVA 5FO7B 4IFDG 3MFYA 1XX8A 4A3IB 2B2UC 3K0YA 1G8ZD 2WIIB 4ZUJA 1OXSC 1BBXC 2EYMA 5C5LA 4C1NI 2HQEA 2EJGC 2JEBI 1STAA 1RODA 2F0KA 3QOJA 4QCLA 4C56C 1W6JA 3DEOA 2NUCA 3NTIA 1EZ8A 1IL8A 1JOKA 5D3DA 3E0JA 2Z8LA 2VB2X 1A6XA 4NP5A 1I4XA 1R4PB 5T1GA 5C0XJ 2F0QA 1Y69U 4O42A 1MI2A 4EVOA 3DHQA 4K2KA 5M3FB 5HURA 1UAPA 3HOXB 3I70A 1CHPD 5CV5A 2CW0C 5COYA 2K5QA 1Y1WB 2OXPA 4KTAA 4DAYA 1SYGA 3SK6A 4PMBA 1S5BD 5C5MA 1U4RA 3TBIB 4QMGA 2DY8A 4OO1G 1SYDA 1JR0D 2R7ZB 3RLFA 3ERQA 2A69D 2KVMA 1B4OA 1EEFD 2IJ0A 1EFID 3OW7A 3PIO3 2EYJA 2F0WA 4G7OC 1OXXK 4DFAA 3LWUA 1T5EA 5K36H 4J8QA 1GUWA 1TQOA 1QNKA 4NW2A 4KD4A 2QKIC 1B44D 4A3EB 4C3HG 1HQMC 1NAPA 1VMPA 3H0GB 3R2TA 3DMUA 4H44C 3PUYA 1C8CA 4Q0FA 4F87A 4RH6A 4XYQA 3K5MA 1VCIA 1Z6HA 1B9MA 4WORA 3EA6A 3HOZB 4OHJA 1YNND 1H9MA 4HEDA 2K33A 5KEEA 4B08A 1JICA 1SYEA 4JBWA 4ZLTF 4V0BA 4KKSA 3KLSX 1NR2A 1EQTA 4IFDH 3D4RA 4R8NA 3QIAA 2KCNA 2ZT9C 1C48A 1XXGA 3IFDA 1J9OA 3HRZC 2AUKA 1PFMA 1GUGA 2PNRC 2EPBA 1SNQA 3H94A 3I90A 5EKIA 3GTOB 4HMIA 1H9KA 5C3XA 3K59A 2AQ3B 1NSNS 1CK1A 4FF4A 4A3MB 3Q6SA 4U673 1FNUA 4MHEA 1V1PB 1TT2A 4PNYA 2RA4A 1F9QA 1CQFA 2B2YC 1SMYC 4QF4A 3A54A 4K8IA 3KK7A 1ILPA 5IT9E 4IUQA 1GHKA 5CV4A 5CMDA 1TWGB 1B50A 2R61A 5C3EB 3CRKC 2HCCA 5E3FA 3KBXA 5M3MB 5DEHA 2CQAA 3T51B 2K28A 5M5XB 3U9OA 3SR1A 1FNWA 3FMCA 4FYDA 1OXVA 3QG1A 1Q12A 3GTQB 2K7VA 3P20A 2MPMA 4CHTB 2IT1A 3PUWA 5IGDA 4A3FB 2IX0A 5JPMC 3S16B 5EJWA 2JP1A 2XVSA 1LT5D 5EQ0A 4I7ZC 5C0XI 2A6HC 4ODGA 4CBVA 2ENBA 1STGA 3QJYA 2F0GA 4IFDJ 3S17B 3I72A 3EJIA 3D4WA 1E2VA 2NN6G 2CVRA 3BDCA 2K04A 1Q90A 2NVQB 2K1BA 3MC0B 3BYTB 3OWFA 3OMCA 5ELBA 1EY8A 3X3MA 1EL0A 4IALA 3PV0A 5CGKA 3QOLA 3S9WA 4O1NA 2XWBB 1AEXA 3NUCA 4IURA 2CW0D 5CBAE 2D62A 5BN4A 1ONLA 1SNMA 2O4XA 3V05A 4HMJA 3PUZA 4IUNA 2SEBD 2JA7B 4A3JB 1LTBD 2Z4HA 1IKLA 3GD7A 3PO3B 4S3SA 1DZ1A 1GUTA 1TS3A 1G291 3R8BA 5DM63 5FKAC 2A69C 1OO9B 1F2YA 1EY7A 1WTOA 1GJXA 4KHZA 5CV8A 3HG9A 5M9OA 1EYAA 5LL6S 3FKIB 1WTWA 1PDQA 1XWEA 5FLXL 4EQPA 1W6KA 3NK9A 2NVXB 4KJNA 1MBYA 4MIUA 4EQOA 5ELDA 3LWEA 1GUNA 3M4OB 1G2TA 2KEEA 3HP3A 2PYKA 3ND8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRJ A;  1MSG A;  1KNA A;  4IUP A;  1NR4 A;  4HSV A;  4MHE A;  1EL0 A;  1RTN A;  2K05 A;  1VMC A;  1SSO A;  2FHT A;  1ML0 D;  1U4L A;  3DEP A;  1B2T A;  1JE4 A;  1ESR A;  1MSH A;  1GUW A;  1X3P A;  1XX8 A;  2NYZ D;  3I91 A;  2NWG A;  1QNK A;  3FDT A;  4NW2 A;  2B2U C;  2KOL A;  2MP1 A;  2N88 A;  2B2W C;  1M8A A;  2H1E A;  5EPK A;  2RA4 A;  2JYO A;  1F9Q A;  2B2Y C;  3I8Z A;  3ONA B;  1DON A;  4CJ1 B;  4IUR A;  1BBX C;  4X3K A;  1WD1 A;  4QUC A;  1ILQ A;  2Q8R E;  5E4W C;  1LV9 A;  1BNZ A;  1TVX A;  2HCI A;  5CBA E;  4R8I A;  3KUP A;  5D14 A;  5T1I A;  1NCV A;  4ZK9 B;  4ZKB B;  1ILP A;  4DN4 M;  4IUQ A;  5AFW A;  1CA6 A;  4HAE A;  1NAP A;  1ROD A;  1VMP A;  1QG7 A;  2M2L A;  1O80 A;  1G91 A;  5CMD A;  3DEO A;  2K03 A;  1B50 A;  1O7Z A;  2RSO A;  3G7L A;  5DNF A;  4RWS C;  1ZXT A;  1X32 A;  4OIJ A;  1WTP A;  1IKM A;  2HCC A;  1X3Q A;  5EPJ A;  3KBX A;  3FPU B;  3N52 A;  2HUG A;  2HDM A;  1WD0 A;  1J8I A;  1QE6 A;  1IL8 A;  1C8C A;  1E0B A;  2HDL A;  2IL8 A;  2K28 A;  1F9S A;  1BO0 A;  2J7Z A;  5T1G A;  4ZKC B;  2B2T A;  2B2V C;  4O42 A;  3I3C A;  1A15 A;  1MI2 A;  2N55 A;  1IKL A;  3MTS A;  3GV6 A;  4RA8 A;  4CJ0 B;  3DM1 A;  5CBE E;  4XDX A;  1HFN A;  1KNE A;  1WTV A;  1BF4 A;  2Q8T A;  1SAP A;  4HED A;  1DZ1 A;  2X6L A;  1MGS A;  1B3A A;  2BDN A;  1DOL A;  2L12 A;  1F9R A;  1U4P A;  2FJ2 A;  3R93 A;  2MGS A;  1AZP A;  1HHV A;  2MPM A;  1JIC A;  2D9U A;  3H91 A;  2XIW A;  2K01 A;  5JJZ A;  4ZLT F;  1AZQ A;  2B2Y A;  2L9H A;  1ICW A;  1U4M A;  4IUU A;  1HA6 A;  5COR A;  3IL8 A;  4R9W A;  1PFN A;  1DOK A;  2L4N A;  1Q3L A;  1EOT A;  4IUT A;  5COY A;  1WTQ A;  1NR2 A;  4X3S A;  4X3U A;  3F2U A;  1CM9 A;  1EQT A;  5EJW A;  4QUF A;  1WTO A;  2JP1 A;  2FIN B;  3QO2 A;  3MWY W;  2KED A;  2RSN A;  1PFB A;  1RTO A;  2NZ1 D;  1SDF A;  4MN3 A;  2FFK B;  2VXW A;  5EQ0 A;  2X69 A;  1DOM A;  2EOT A;  2X6G A;  1HUM A;  1WTW A;  3IFD A;  1PDQ A;  1HFG A;  1J9O A;  1O7Y A;  4OIK A;  5EPL A;  4CJ2 C;  4IUV A;  1CA5 A;  1PFM A;  1U4R A;  2SDF A;  3D6W A;  4ZAI A;  3TN2 A;  2EPB A;  1EIH A;  2B2U A;  2L11 A;  5E4X A;  1F2L A;  2B2W A;  2DY7 A;  2FMM A;  1RJT A;  2DY8 A;  2L1B A;  2R3Z A;  4LMQ D;  4U68 A;  4X3T A;  3I90 A;  1WTR A;  1WTX A;  1S4Z A;  1PLF A;  4XT3 B;  4HCS A;  4XT1 B;  5D65 A;  2B2V A;  2EE1 A;  1EIG A;  3LWE A;  1B53 A;  2MJ8 A;  2KEC A;  3P7J A;  4UAI A;  5EKI A;  2RVL A;  2KUM A;  1G2S A;  4RAU C;  3GV3 A;  3SVM A;  2CVR A;  1WVL A;  1AP0 A;  1G2T A;  2K04 A;  1F9P A;  1B4O A;  2KVM A;  1G6Z A;  2KEE A;  3TZD A;  1XYI A;  3HP3 A;  2K1B A;  1RHP A;  3UI2 A;  2B2T C;  3Q6S A;  1HUN A; 
#chains in the Genus database with same CATH topology
 4LF5 Q;  5IGE A;  1WYD A;  4HSV A;  1TWC B;  4YCW A;  4JI3 L;  1EWH A;  1TWH H;  2E75 C;  5C4X B;  5EAY A;  2AWO A;  3SDZ A;  2IX3 A;  3IRB A;  1KAB A;  3I55 A;  1HNZ Q;  3GTP H;  1LUZ A;  1EY4 A;  2PI2 E;  2QDL A;  2VY3 A;  4R4O A;  4X3K A;  3HKZ E;  1X54 A;  4KN7 C;  2EDG A;  5KYL A;  2M9V A;  5H1S E;  5IT9 L;  1O80 A;  1PH6 A;  2QF7 A;  4LJZ C;  1V1O A;  3WOE A;  1VQP A;  2WIN B;  3DWA A;  3G7L A;  1M4V A;  5DNF A;  1XMO Q;  3F2B A;  2LKV A;  3KJP A;  2YU9 B;  1PYW D;  5EPJ A;  3QR8 A;  1KIX A;  2PI2 A;  2YV5 A;  3PMF A;  2CWA A;  4BBS G;  2IL8 A;  2UUA Q;  2N8N A;  3HOW B;  1R4Q B;  3KJO A;  4HJ8 A;  2B2V C;  4JI8 Q;  3J7A V;  3MEH A;  2NN6 H;  1TU2 B;  2ZXO A;  3HOU H;  3AB9 A;  2Q8T A;  1HXY D;  1EZ6 A;  3RUZ A;  3U9S A;  1YJW A;  3Q8D A;  2UXD Q;  2L12 A;  2YTX A;  3TRZ A;  5EKL A;  1X9N A;  2D9U A;  3F8T A;  1QVF A;  2Z9H A;  3CRL C;  1HNX L;  1DOK A;  1EUJ A;  4IUT A;  4C3J G;  5LHY 1;  2BDO A;  1AFP A;  1CM9 A;  2IHF A;  5IE8 A;  2UUC Q;  2F4I A;  3WOF A;  2SNM A;  1K3R A;  1K8O A;  4BA1 I;  1SMY D;  2JXM B;  3VR3 A;  1SJE D;  3H3V I;  3P1H A;  1C0A A;  2B63 H;  2F0J A;  1EOV A;  2FMM A;  4JV5 L;  2VUM G;  4GLV B;  1PTO F;  1S4Z A;  3K58 A;  3M4P A;  1EIG A;  3NEM A;  2MJ8 A;  4LF7 L;  2ATW A;  3AQQ A;  2B3G A;  3T16 A;  3SVM A;  1C7Y A;  4RFB A;  4A3D B;  2QDB A;  4A4I A;  4GLA C;  3KFU A;  1VQN A;  5IYD H;  4DGZ A;  2PW7 A;  3VA7 A;  1S3O A;  4HID A;  3S1M B;  1GUO A;  4R4T A;  5G3L D;  3K5N A;  3A5U A;  1JOQ A;  3GTL H;  5GAG C;  2YTV A;  1HR0 Q;  4IFD I;  3W1G A;  4POF A;  3I91 A;  2R93 H;  3HOV G;  4FXK C;  2XN9 C;  3Q23 A;  5C6A A;  2AWN A;  1FNV A;  1XTD A;  1EYG A;  1IZ6 A;  1WD1 A;  1PVO A;  2Q8R E;  4BBR B;  4LF5 L;  5KIX A;  3G4S A;  4DN4 M;  4B3T L;  4A3K H;  3TP5 A;  2VQF L;  1CSP A;  1PH1 A;  1O7Z A;  2NBF A;  1Y1V G;  2A6H D;  1ASY A;  3J81 j;  1HNZ L;  3KLR A;  2R7F A;  3GQB A;  3PO2 G;  1FGB D;  1D5M C;  3QWN A;  1H9S B;  1BO0 A;  4Y7N B;  4DAY B;  2NZO A;  1TWF H;  1K9M C;  4JCV E;  4C2M B;  4DR3 Q;  1A62 A;  1SNP A;  2R92 G;  1DGS A;  1XMO L;  1X6O A;  2AMC B;  3GP7 A;  5DAU A;  1B3A A;  1A8V A;  3DM3 A;  2RDF A;  4R1J A;  5IGC A;  3N6R A;  5JJZ A;  1EIF A;  4B3R Q;  2UUA L;  4X6A H;  3CD6 A;  1BXT A;  3AFQ A;  4BXX H;  1SNC A;  2L4N A;  4LNQ A;  5C4H A;  3G48 A;  4JI8 L;  4N9T A;  3IFT A;  1LTA D;  2DNC A;  4QUF A;  5IGG A;  1QCB D;  3S15 B;  1PTO H;  2OWO A;  3M3Y B;  4RHS A;  4G7H C;  2UXD L;  3D6C A;  1DOM A;  2LY7 A;  1BOS A;  1N33 Q;  1STB A;  1O7Y A;  1KDB A;  1U9R A;  2CWP A;  1K8G A;  3D6W A;  2I5M X;  4OXP A;  3PIP 3;  3ND9 A;  3H3V C;  4X3T A;  1QUQ A;  2D2C C;  5JEA J;  4OO1 I;  2UUC L;  1O7I A;  4IPH A;  2MFI A;  2PZT A;  3T56 B;  2J0T D;  1H9S A;  2Z6K C;  1KTK A;  3CHB D;  2JEA I;  5IY0 A;  5M3F G;  3D0F A;  3BVM A;  4TSS A;  2E74 C;  3U4Z A;  2IWH A;  3CPW A;  1TXY A;  4HIM A;  2DJF C;  2Q2H A;  3FRP B;  4KLK A;  1SSO A;  1VQL A;  1LM0 A;  1GHJ A;  3C1E A;  3K7A B;  4K5X A;  1DM0 B;  2DGY A;  2JA5 G;  4LFC Q;  1TY0 A;  4V19 0;  1MHW C;  2JE6 I;  5E4W C;  3E6Z X;  3CCL A;  4C3J H;  1TVX A;  3VYU A;  5M5Y B;  4KJO A;  1K8M A;  1FL0 A;  1LT3 D;  1S5E D;  1U0L A;  2CKZ B;  1FD7 D;  1HR0 L;  3PCO B;  3RLO A;  1CQV A;  2ZXR A;  3I7F A;  2OT2 A;  1F77 A;  1VQH A;  1RCV D;  5FOB B;  3VYR A;  1B1Z A;  2O5J C;  2RDH A;  5LMN Q;  2AHO B;  2Y0S B;  1HTL D;  1TY2 A;  1YNJ D;  2KCC A;  4ME5 A;  4C1N K;  2DNE A;  2VUM H;  1D6E C;  1BCP B;  1D2B A;  1SJH D;  2KHS A;  2N55 A;  1PH5 A;  3IKJ A;  4RCN A;  1PZI D;  4KY6 A;  2ALY B;  4BY7 B;  3OHX C;  4F8M A;  5LL6 X;  2G5D A;  1N36 Q;  3Q22 A;  2RDG A;  1YIT A;  1JWU D;  2B8G A;  4DK1 A;  3I4M B;  1Q8I A;  1B7Y B;  4X3S A;  5I9O A;  4DR3 L;  4KI0 A;  5JAV A;  4DV5 Q;  4A3E G;  3IAY A;  3HOV H;  1BR9 A;  1RTO A;  2IW3 A;  1SYF A;  1GD7 A;  2EY5 A;  4DXF A;  2EOT A;  1UE5 A;  2AUJ D;  4C3I G;  1I4Q A;  1I3Q B;  3GTK H;  2PCF B;  5J39 A;  1E22 A;  5DLQ E;  4X62 Q;  1AW7 A;  2EYH A;  1F2L A;  4U68 A;  4DV0 Q;  3ZYY X;  3I73 A;  4XT1 B;  4KD3 A;  2E2I B;  1YHB A;  3GTG H;  4YWM A;  4OX9 Q;  2KA7 A;  3W3A A;  1WFQ A;  3BS1 A;  2UUB Q;  1G6Z A;  5C44 G;  1Q7Y C;  1N33 L;  3TZD A;  1XYI A;  4KY5 A;  3TZU A;  3PO2 H;  1VQI A;  5FLX E;  1KNA A;  2OF1 A;  1PZJ D;  1SE4 A;  4IUP A;  4RGN A;  5E1F A;  3PIP A;  2R92 H;  1VF7 A;  1B2T A;  1PRT B;  2AKW B;  3J81 c;  2L0C A;  3FDT A;  2MP1 A;  2QEX A;  4A3I H;  4TRD A;  3NTH A;  4A3B B;  2CFM A;  2RQX A;  4JYA Q;  1GXD C;  1PYB A;  2A8V A;  1CA6 A;  2WAQ E;  3A55 A;  2JA8 B;  1BCP C;  4HAE A;  1J6Q A;  1G91 A;  2EJM A;  1TII D;  1SE8 A;  2MO0 A;  4DNT B;  4RWS C;  4JI0 L;  3CCM A;  3S1R B;  1HZB A;  1KHI A;  2BE5 D;  5IGB A;  1KRS A;  2A6E D;  3NHH A;  4AYB B;  3RR5 A;  2F3W A;  3AYH B;  4P2C B;  4ZKC B;  1B3Q A;  2F0M A;  4DK0 A;  5FO8 B;  3KYH C;  3GV6 A;  1QVG A;  3RLN A;  3CC7 A;  3NQI A;  2KEN A;  3AMU A;  3T1Y Q;  1BF4 A;  2I46 A;  1SAP A;  1SE3 A;  1LTG D;  2X6L A;  1MGS A;  5I6Y A;  1PXU A;  5M3F H;  2LMC B;  2MGS A;  2HIV A;  2BH8 A;  3HOX H;  2A73 B;  5C4J B;  3C46 A;  2L9H A;  4ZRZ A;  1U4M A;  5LMN L;  4L5Q A;  1FR3 A;  1KD1 C;  1VQ6 A;  4TKO B;  4FP5 D;  3MVV A;  4ALP A;  2ZJP A;  5IP9 G;  3MWY W;  2EYF A;  3L3O C;  1Y1W H;  5CV6 A;  1YZ6 A;  2NZ1 D;  2CH4 A;  4YCV A;  3J81 L;  1KDC A;  1N36 L;  5GAE C;  1S5F D;  2JA6 B;  1TWH B;  5EPL A;  3Q24 A;  4JI4 Q;  2SDF A;  5HGQ A;  4P73 A;  2B2W A;  5G3L F;  1RJT A;  3SK5 A;  3J81 i;  3L9A X;  2OQ0 A;  4NXM Q;  2ICE C;  1SE2 A;  1NY4 A;  4DV5 L;  3S14 B;  2KEC A;  1PRT C;  2GA4 B;  1G2S A;  2EVB A;  2B8F A;  4KV6 A;  4XQN A;  3UDX A;  2R7Z H;  5IYC G;  2C35 B;  1XJV A;  4OL7 A;  1V8Q A;  1LTR D;  3RZO B;  1KLG D;  4X62 L;  4BY1 B;  1HRJ A;  3BZD B;  5JVG 3;  1RTN A;  4DV0 L;  2QGQ A;  1JB7 A;  1ET6 A;  2LFN A;  3TEH B;  2E2D C;  2F0P A;  4A3F G;  2O5I C;  2K5W A;  2PZW A;  4HJ5 A;  1TS5 A;  2RBM A;  5FLM G;  3NTK A;  4XQQ A;  4OX9 L;  2B2W C;  2UUB L;  3S2H B;  5GQO A;  1IXR A;  2B39 A;  3SHL A;  1LTS D;  3FVQ A;  1J5E Q;  1ILQ A;  1YIJ A;  1BVS A;  4NXN Q;  2UXC Q;  2HCI A;  4HR7 B;  1TS4 A;  2ID0 A;  4ZK9 B;  3PSI A;  4POG A;  4A3E H;  4CKE A;  1Z47 A;  2R6G A;  1D5Z C;  3H0G H;  1X32 A;  1A0I A;  1LAB A;  5TSS A;  3M7G A;  3N52 A;  2HUG A;  2HDM A;  3RZD B;  1SRU A;  1J8I A;  4NMZ A;  4RMF A;  1ZYR C;  5BN5 A;  1D8L A;  3Q0A A;  4JYA L;  2K5D A;  1F9S A;  2J7Z A;  5CC4 A;  1EWC A;  1X3G A;  1A15 A;  5BN3 A;  3BZC A;  1GOZ A;  1HA5 A;  5CBE E;  4AIM A;  2NVY B;  3HOZ H;  2ZJR A;  5CV7 A;  1U4P A;  1D1I A;  4NDX A;  1TS2 A;  2ZXP A;  3CME A;  5COR A;  3P75 A;  4R9W A;  2PQA A;  1EOT A;  3GTM B;  1IYU A;  3F2U A;  4QL5 A;  1BQQ T;  4DA2 A;  1X55 A;  3MXN A;  5I4D A;  4QIW B;  2F0O A;  2F0F A;  3T1Y L;  1EY5 A;  1QIL A;  4DV2 Q;  2Z0S A;  4KMU C;  1L1O B;  1UWV A;  2IPK D;  2VB3 X;  3TP7 A;  1I4P A;  4XXE A;  4CGY B;  1Q1E A;  2R93 G;  1CA5 A;  2PZU A;  3UDI A;  1EIH A;  2A74 C;  2DY7 A;  3TN2 A;  1KRT A;  3R3O A;  5ELC A;  4DAV A;  1HH2 P;  5D65 A;  3HOY B;  3CXC A;  3GDE A;  1DJR D;  5C4Z A;  1XTC D;  2OEO A;  2EY6 A;  4RAU C;  3A8K E;  2F3V A;  1VQG A;  1DXM A;  2OCE A;  3GTO H;  3PO3 G;  5KNC A;  4L6T B;  3J80 c;  3MA2 B;  2KQ3 A;  4JI4 L;  1L2F A;  1IW7 C;  4A3M H;  4DR7 Q;  3T13 A;  4GLX A;  4CKB A;  4HIO A;  1U4L A;  2RHS B;  1STH A;  1VQC A;  4L8J A;  2K5H A;  1VQ9 A;  4NXM L;  3TSS A;  1ESR A;  1MSH A;  1YNJ C;  3DUZ A;  3B6Y A;  3KF8 A;  4RKL A;  2EY2 A;  4RCO A;  1LAC A;  2H1E A;  1K28 A;  3HKZ B;  2K75 A;  2JN4 A;  2RF4 A;  1GM5 A;  4JBM A;  2OQK A;  1LV9 A;  2WB1 E;  4R8I A;  1Y14 B;  3KUP A;  5I6W A;  1I50 B;  3RNU A;  2K03 A;  5D3I B;  5IYB H;  4BXX G;  4OIJ A;  1LT6 D;  4B3T Q;  1TWG H;  4DV6 Q;  1X3Q A;  5C3E H;  2VQF Q;  1WD0 A;  1RD9 D;  4Q5V A;  2HDL A;  1J5E L;  2D5D A;  5M3M H;  2G9H D;  4NXN L;  2UXC L;  1L0Y B;  4GNX A;  4FF1 A;  1EU4 A;  2L55 A;  1JJG A;  5M5X H;  3VR5 A;  4JBJ A;  2RCF A;  1RL2 A;  4CJ0 B;  1GVP A;  2BH2 A;  1XPU A;  4FF2 A;  3TP8 A;  1DOL A;  1ENF A;  5IYC H;  3R93 A;  1L1O C;  1M90 C;  3GTQ H;  3URY A;  3A8J E;  4RGO S;  1I6V C;  4JW0 A;  3O13 A;  3J80 L;  3L0O A;  3S1Q B;  4GOP B;  1EU3 A;  5HY6 A;  4A3F H;  2VNU D;  4GN4 B;  1E2Z A;  2ZTE A;  4KN4 C;  4BBS B;  3C3L A;  1CHQ D;  5FLM H;  3FEW X;  3NWS A;  3S16 H;  5ELF A;  3J80 i;  4ZUI A;  4X64 Q;  2X6G A;  2NTS A;  3D31 A;  1EYC A;  3CQZ B;  1N32 Q;  3NP8 A;  5J22 A;  2M00 A;  3NBH A;  1WTP A;  1BCP D;  1WTR A;  2ZTD A;  3JAM c;  3VA5 A;  3T53 B;  3S17 H;  3HOW G;  2F0V A;  1ZEQ X;  4BA2 I;  4AH6 A;  2B29 A;  4DV2 L;  1WTH A;  4Z9C B;  1WVL A;  4XQJ A;  1GKH A;  3OMG A;  4LFA Q;  4LK1 C;  1PH9 A;  4HJA A;  4JVZ A;  2F0U A;  2JQO A;  2NVQ H;  1LLR D;  4HTH A;  1Q46 A;  2MNA A;  5JJI A;  2BE5 C;  1S5D D;  4M1U B;  3HZX A;  4RKB A;  5A35 A;  3M7N A;  2A6E C;  2F1M A;  4NKL A;  1JOO A;  2NYZ D;  3OOC A;  3FHW A;  2LSS A;  1I6H B;  2K50 A;  3E3X A;  4GOP A;  1SMX A;  1HZ9 A;  4DV1 Q;  4IN3 A;  2L15 A;  4DR7 L;  1RF2 D;  1V43 A;  5D14 A;  2QCP X;  4FXD A;  2MHV A;  3TDQ A;  4LAA A;  1SEB D;  1QG7 A;  4FO2 A;  4UDU C;  4DR1 Q;  3ERO A;  4UPA A;  3SK8 A;  4DV3 Q;  1F2M A;  4RG1 A;  1YHA A;  3MXU A;  1SYC A;  1IKM A;  4J1M A;  3FPU B;  4R4Q A;  1QE6 A;  1E0B A;  1KDA A;  3ULL A;  4A3D G;  3OSO A;  2UXB Q;  3RD4 A;  2B2T A;  1DCZ A;  4GOP C;  4A3J H;  4PG3 A;  3JAM L;  1PRT D;  1STY A;  5ELE A;  1HFN A;  4K5V A;  3TP6 A;  5GAD C;  3OIQ A;  2BDN A;  2F0L A;  4DV6 L;  4XIG S;  3PO3 H;  5CR3 A;  4DV4 Q;  1MIU A;  1PH2 A;  1VQK A;  3G6J B;  1Y1V B;  4A93 B;  1NUC A;  4KKU A;  1QUQ B;  3JAM i;  1X65 A;  4JOI A;  1G51 A;  4MTN A;  2K32 A;  1HZC A;  4H13 C;  4UP7 A;  1SYB A;  4BBR G;  2E2H B;  2F0E A;  2KED A;  3I4N B;  4KY7 A;  1IYV A;  4L63 B;  2ZTC A;  4B9X A;  2X69 A;  1EQV A;  3M85 A;  3FKI H;  1Q1B A;  5FK9 C;  1AN8 A;  1V9P A;  5E4X A;  3S2D H;  4A3I G;  4LMQ D;  1HPC A;  2NVX H;  4UAI A;  4CDF C;  1LYL A;  4RGM A;  4LUV A;  4X64 L;  1F9P A;  5IGF A;  3M4O H;  1LTT D;  2OTL A;  2TSS A;  3J81 E;  1H95 A;  1ZYR D;  4N8X 1;  4X65 Q;  4CKC A;  1N32 L;  4QB4 A;  1MSG A;  4I65 A;  1PV4 A;  4PMW A;  4K6L A;  3DEP A;  1TWC H;  3NSW A;  4UP8 A;  2NWG A;  3A5Z B;  5ELO A;  2KOL A;  2N88 A;  5EPK A;  5C4X H;  1QB5 D;  2YYZ A;  4DV7 Q;  1R9T B;  4LFA L;  5EBD A;  4N8F A;  2E76 C;  4DF7 A;  1RDP D;  1BNZ A;  1HCZ A;  1LTL A;  2VS1 A;  3BDO A;  3ICE A;  1WCM B;  2NVT B;  4BS9 A;  3HOX G;  3L7Z C;  1U5K A;  5A2Q E;  1Z9F A;  1TR5 A;  2A19 A;  2F0D A;  1OXT A;  2JJQ A;  3W5O A;  2YU9 H;  3U4V A;  3K80 C;  3GTJ B;  3MEF A;  5FO9 B;  1Y1W G;  1ESF A;  4JI0 Q;  5KNB A;  4DV1 L;  3WDN A;  2J4X A;  2JA5 B;  1S5C D;  2PQE A;  3HOW H;  2QEJ C;  3C1F A;  3R2I A;  4DR1 L;  1VQ4 A;  3DM1 A;  2ASB A;  4JI1 Q;  3VR6 A;  1KNE A;  5KND A;  3CCQ A;  4DV3 L;  4K6D A;  2AQ2 B;  1K0S A;  4DUY Q;  2V4D A;  1EY9 A;  2O2L D;  2YTY A;  1YBY A;  4YIJ A;  2K6A A;  1I94 Q;  1HZA A;  2UXB L;  2TMP A;  1IW7 D;  1H9J A;  4KK7 A;  5LMU Q;  4WJ4 A;  1QVC A;  3FP9 A;  2R7Z G;  1WTQ A;  1JT8 A;  3J7Y W;  3FPP A;  2C5C A;  2ICI A;  3C2P A;  3KDF A;  1O78 A;  1PFB A;  3QB3 A;  4N9P A;  4H7B A;  2WP8 J;  1HUM A;  4DV4 L;  4JK1 C;  3A56 A;  4C3H B;  4CJ2 C;  2N3S A;  3RMH A;  1S40 A;  3A74 A;  4HN7 A;  1QZG A;  3CU7 A;  1JCK B;  2L11 A;  2R3Z A;  1PLF A;  2Y0S G;  4LW1 A;  2EE1 A;  1B53 A;  4RHR A;  1ENA A;  3OIP A;  3SEB A;  1E3P A;  2EZV A;  3OYY A;  3X3N A;  4A3G B;  5IIF A;  2V1C C;  4A3D H;  1RHP A;  5GRO A;  4KHP Q;  2RSN A;  3H0G G;  1FYC A;  1HQR D;  4A76 A;  4C3I B;  1VQ7 A;  1Y8O B;  3M4Y A;  2K05 A;  3SXH A;  1D1K A;  3S1M H;  3STB D;  3H3V H;  4FVM A;  1C4Q A;  1JE4 A;  3BG3 A;  2WKD A;  1OXU A;  2VL6 A;  2QIL A;  2K5N A;  5I2Y A;  5M5W B;  4LF8 Q;  4K0K Q;  1JMC A;  1A3V A;  4HJ7 A;  2WAQ B;  4X65 L;  3HOZ G;  3VYT A;  1CT1 D;  3HGB A;  1SNO A;  1SFO B;  3S1N H;  1L0X B;  4ZKB B;  5C44 B;  1VF5 C;  4BBR H;  2E2J B;  4ZCK A;  1K83 B;  3BU2 A;  3UDG A;  4XTC S;  1X3E A;  3ER0 A;  1Y8N B;  1ZXT A;  1Q82 C;  1TWA B;  4GS3 A;  1EIY B;  4DV7 L;  1UEA B;  3K5O A;  2Z4I A;  3OW2 A;  1T5X D;  4CDC C;  3E5S A;  4TQU S;  2H4O A;  1YI2 A;  3I3C A;  2E8G A;  4K5W A;  4Y7N H;  3F2C A;  4I7A A;  2WAC A;  4RA8 A;  4G57 A;  4C2M H;  4XDX A;  1WTV A;  2A5H A;  4JI6 Q;  1QNU A;  1QOH A;  1HHV A;  4A3C H;  1STE A;  1JE5 A;  1EEI D;  2LS0 1;  4ME3 A;  2B2Y A;  1HA6 A;  3CMA A;  1YJ9 A;  3TRE A;  1YJN A;  1PH4 A;  3EIV A;  1II3 A;  4A3B G;  1BCP F;  1NE3 A;  2F03 A;  1VQE A;  2A68 C;  1XPO A;  3TS2 A;  4J6H A;  4JI1 L;  4A3M G;  2Q8I B;  3E9I A;  1Z7T A;  3S15 H;  1ZKO A;  2WKC A;  1E1T A;  4MN3 A;  4G7Z C;  3CCJ A;  4DUY L;  1NNX A;  3BDL A;  3M3Y H;  3CKI B;  2KCM A;  4LWC A;  1I94 L;  3A7A B;  1PTO D;  2EJF C;  3HFZ B;  4OIK A;  1VQO A;  2AQ1 B;  4F7X A;  5LMU L;  4ZAI A;  3J80 E;  3EQL C;  1CKO A;  4ZQ3 A;  1WTX A;  4AYB G;  3NEL A;  2F0S A;  3MHB A;  3P7J A;  3U58 A;  1BBU A;  1PMR A;  3ULP A;  5KGU A;  1GO3 E;  1WI5 A;  2EXZ A;  1CFM A;  1SXT A;  4GN5 A;  5K5P A;  3J7A F;  5IWA Q;  5IYB G;  2CHB D;  4DPG A;  2I07 B;  4K14 A;  5C3E G;  4LUO A;  2IY5 B;  5C3W A;  5IOC A;  2G9D A;  5CV9 A;  2F0H A;  5M3M G;  4A75 A;  4O2D A;  4Y52 H;  4HIK A;  3GTP B;  4RGT A;  4GZY C;  2JYO A;  3ONA B;  4FNF A;  4KHP L;  3K7A H;  1UNS A;  2NN6 I;  4OO1 H;  5KRU A;  4QUC A;  2JA6 G;  3TME A;  3MFG A;  1G6P A;  1NCV A;  1JOR A;  4UP9 A;  1CZG A;  5ISR A;  4JPB W;  5M5Y H;  1PRT F;  4G4K A;  1V1P A;  1VS0 A;  3NQT A;  5A2Q L;  4DR4 Q;  5HGT A;  4LF8 L;  4K0K L;  4PMC A;  5JOB A;  2PQA B;  4YY3 Q;  1BBW A;  1RKN A;  5IP7 G;  1CKN A;  2BCO A;  2K5V A;  2PO4 A;  2EYO A;  1PFS A;  3MXN B;  4PV1 C;  4FXG C;  3KBG A;  5I2X A;  3EFX D;  5EGT A;  1SND A;  3G71 A;  4BY1 G;  3MXP A;  5JPN C;  3HOU B;  1CSQ A;  1A2T A;  1XNR Q;  4PQX A;  2C9O A;  1WJJ A;  3VR2 A;  1X3F A;  4PZ6 A;  2ZM6 Q;  1IBM Q;  1A2U A;  2L5T A;  3NE5 B;  4BY7 H;  4MTK A;  3H91 A;  2K01 A;  1AZQ A;  1ICW A;  4IUU A;  1EY6 A;  2K4K A;  1PFN A;  4EGV A;  1Q3L A;  1KC8 C;  1X56 A;  1ICF B;  4NB3 A;  3I4M H;  3V96 A;  3MZ5 A;  1JWS D;  3H6M A;  1DYQ A;  5C0X G;  3JAM E;  4JI6 L;  2FFK B;  2VXW A;  1Q81 C;  4ABN A;  3OPO A;  1EQR A;  3BYY B;  4B9W A;  4HSP A;  2F52 A;  2B63 B;  1I3Q H;  3CF5 A;  4XYO A;  2I0Q A;  3K5L A;  4JI2 Q;  1EYD A;  3BVZ A;  4JI7 Q;  1JQY D;  3KF8 B;  4XT3 B;  1DON A;  3NPP A;  5JEA G;  2RVL A;  2K52 A;  3DWP A;  2PMZ B;  3HEJ A;  2E2I H;  2FMC A;  1HR0 W;  1AP0 A;  1BDO A;  3VYS A;  3MAQ A;  1KLU D;  3ULJ A;  4LF6 Q;  2KJX A;  1NMF A;  1HUN A;  1SN8 A;  1M1K C;  3GTL B;  1Y8P B;  1SR3 A;  4DNR B;  3D3R A;  2R93 B;  1I4H A;  4ILW A;  1X3P A;  2HT1 A;  2KHJ A;  1UE6 A;  1KAA A;  1VQD A;  2JSO A;  2JA7 G;  5IWA L;  1P16 A;  2MQH A;  4WRD A;  3VR4 A;  4A3J G;  2OTJ A;  2WB1 B;  2EYP A;  4K8J A;  4GNX B;  1EY0 A;  4CJ1 B;  4IPG A;  4UY8 C;  4PZ7 A;  2JA9 A;  4DR6 Q;  5FJ8 G;  4L5S A;  3JC6 6;  1SBB B;  3SE0 A;  3BVG A;  4A3K B;  2GN5 A;  2PMZ E;  4A3B H;  5T1I A;  5AFW A;  4DK6 C;  2M2L A;  5KYI A;  2JA8 H;  5JVH 3;  1N34 Q;  3SK4 A;  2IX1 A;  2BA0 A;  1IHZ A;  1A63 A;  4YCU A;  3G6E A;  5J1Z A;  3HOY G;  3D8G A;  4WFN 3;  3S1R H;  1JJ2 A;  4P71 A;  2EYL A;  5IT9 c;  1LTI D;  4KKT A;  1CZW A;  1TWF B;  1NMG A;  3D4D A;  4MZ9 A;  1HTP A;  2MUY A;  1Q8K A;  3FKI G;  3MTS A;  3EVQ A;  4F88 A;  1E2W A;  2K14 A;  2VW9 A;  1QWY A;  3H09 A;  2RKS A;  2SOB A;  4DR4 L;  3S2D B;  2H5X A;  2FJ2 A;  1I4R A;  1LT4 D;  4DXG A;  1C9O A;  1AZP A;  4YY3 L;  3NBH B;  1UE7 A;  3HKZ G;  3UDF A;  4HCE A;  4K2L A;  1AE2 A;  3IL8 A;  5C4J H;  3CCV A;  4FF3 A;  3PUV A;  4GKJ Q;  3OWE B;  1PTO B;  1SLJ A;  2F0N A;  4A3L G;  3QO2 A;  1XNR L;  3F2D A;  1STN A;  2E5L Q;  3KOJ A;  3WWV A;  1VDZ A;  1D7Q A;  2ZM6 L;  1IBM L;  3HS0 C;  5I9P A;  2XRQ D;  3STB C;  1UUP A;  4DUZ Q;  1HFG A;  1EFW A;  3AU7 A;  2XGT A;  4IQZ A;  1D5X C;  4IUV A;  2JA6 H;  5C4X G;  4E6I A;  3KF6 A;  3UI2 A;  4O0A A;  4IZ8 A;  5F2D A;  2DUD A;  3CW2 C;  5J3B A;  4HCS A;  1PA6 A;  2B2V A;  4UHV A;  3I4L A;  3W2D A;  3TS0 A;  4GKK Q;  2KUM A;  2SNS A;  1YNN C;  3GO5 A;  4L5T A;  5EKK A;  3GV3 A;  3S14 H;  4BWG B;  2HHH Q;  1F2Z A;  4EQN A;  3BJU A;  1DD2 A;  5IP7 H;  1JB3 A;  3NWT A;  4GNX C;  1ET9 A;  1NTG A;  1AH9 A;  1TKW B;  1IBL Q;  4JI2 L;  1NR4 A;  2NZH A;  3LX0 A;  3T4A C;  1XNQ Q;  1PZK D;  4JI7 L;  3RZO H;  4BY1 H;  3NBI A;  1VMC A;  2FHT A;  1VQF A;  2NB0 A;  1MJC A;  1JC7 A;  4OWT B;  1IBK Q;  3T1H Q;  1M8A A;  2EIF A;  1LO5 D;  2XRS D;  1CTM A;  3I8Z A;  4ULL A;  2VQE Q;  4LF4 Q;  2KCT A;  4OWW B;  4C3J B;  3S2H H;  1VQB A;  3HKS A;  4LF6 L;  1A3T A;  2PPB C;  4DU9 A;  2F0T A;  1CI3 M;  5LMN W;  2A68 D;  4DR5 Q;  2DN8 A;  1ASZ A;  5C0X H;  1ENC A;  2RSO A;  4ZYS A;  2F0I A;  4H0L C;  3K6O A;  4DR6 L;  4H02 A;  3RZD H;  2VUM B;  3KLS A;  2XWJ B;  3NEN A;  4P74 A;  3TQY A;  5AJ3 Q;  2LXJ A;  1PTO C;  5JEA H;  4AQY Q;  5K36 G;  3A7L A;  4ID6 A;  1OTC A;  1N34 L;  5EBC A;  3DWQ A;  4R4C A;  1F9R A;  2NVY H;  1QZH A;  2XIW A;  3J7A 5;  2Z1C A;  3PGZ A;  1W3S A;  5IOD A;  3M4Q A;  2NTT A;  4X3U A;  1O7L A;  2XNA C;  3ITP A;  3HOV B;  2WV6 D;  2R7D A;  2FIN B;  3K57 A;  3GTM H;  2EXD A;  2JA7 H;  1SDF A;  1MD2 D;  3GTK B;  3LNN A;  4IJL A;  5FJ8 H;  1H9R A;  1I4G A;  2XSC A;  5NUC A;  2B2U A;  4P75 A;  4GKJ L;  3PUX A;  2L1B A;  3GTG B;  3A8I E;  3MXG A;  1QJO A;  2PW5 A;  5DM7 3;  4WJW A;  2E5L L;  1JWM D;  3HOY H;  3S1N B;  3PO2 B;  1L0W A;  1YEZ A;  4DUZ L;  3NXW A;  1GUS A;  4HJ9 A;  1YNX A;  3V2T A;  4DAP A;  1B9N A;  2I5H A;  2EY1 A;  2B2T C;  1A3U A;  1XMQ Q;  4OGQ C;  2BOS A;  2R92 B;  5CYU A;  2BA1 A;  1BUV T;  3U50 C;  4M8A A;  4B3M Q;  3DXJ C;  4L5R C;  4A93 G;  1ML0 D;  2KBN A;  2N49 A;  4KHV A;  5FO7 B;  4IFD G;  2Q2T A;  3MFY A;  4DNI A;  4GKK L;  1Q86 C;  1XX8 A;  4A3I B;  2B2U C;  2HHH L;  3K0Y A;  1G8Z D;  2WII B;  3I4N G;  4ZUJ A;  1OXS C;  4JOI C;  1BBX C;  2EYM A;  5C5L A;  1FJG Q;  4C1N I;  2D0O A;  2HQE A;  4DAM A;  1KQS A;  4DK3 C;  1IBL L;  2EJG C;  1VQ8 A;  2JEB I;  1XNQ L;  4A3C G;  4A3L H;  1STA A;  1ROD A;  2F0K A;  3QOJ A;  4QCL A;  1IBK L;  4C56 C;  1W6J A;  3DEO A;  2NUC A;  1I50 H;  1JJC B;  3F1Z A;  3T1H L;  2JK8 A;  3NTI A;  1EZ8 A;  2VQE L;  4LF4 L;  2Z6K A;  3K7U C;  1IL8 A;  1T9H A;  1JOK A;  5D3D A;  3E0J A;  2Z8L A;  2Q2U A;  2VB2 X;  1A6X A;  4NP5 A;  1I4X A;  1NBW A;  1R4P B;  5T1G A;  5C0X J;  2F0Q A;  3CC4 A;  1Y69 U;  3KDF B;  4O42 A;  1MI2 A;  4EVO A;  4DR5 L;  3DHQ A;  4K2K A;  1VQ5 A;  3I4O A;  5M3F B;  1IL2 A;  5HUR A;  1UAP A;  3HOX B;  1PHJ A;  2N78 A;  3CPF A;  3KLW A;  4LFB Q;  3I70 A;  1CHP D;  5CV5 A;  2CW0 C;  1N8R C;  5COY A;  4OWX B;  4QQB X;  5AJ3 L;  2K5Q A;  3S1Q H;  1Y1W B;  2CQO A;  2OXP A;  4AQY L;  1B70 B;  4KTA A;  3EBE A;  1WCM G;  4DAY A;  4EX5 A;  1SYG A;  4BBS H;  3SK6 A;  3AEV A;  4FDB A;  3AFP A;  1FVI A;  2F4V Q;  4PMB A;  1S5B D;  4EQ5 A;  5C5M A;  2FXQ A;  2HQL A;  1HNW Q;  1U4R A;  1FGU A;  3TBI B;  1VQJ A;  4QMG A;  3CQZ H;  2HIX A;  2DY8 A;  4OO1 G;  4X66 Q;  1SYD A;  1JR0 D;  4IJH A;  2R7Z B;  3RLF A;  1UEB A;  2GVA A;  3ERQ A;  3RN2 A;  4WJ3 M;  2A69 D;  2KVM A;  1B4O A;  1EEF D;  2IJ0 A;  1PH3 A;  1EFI D;  1K73 C;  3OW7 A;  3PIO 3;  2EYJ A;  1BKB A;  1W2B A;  2F0W A;  4G7O C;  1OXX K;  4DFA A;  2MO1 A;  3LWU A;  1T5E A;  5K36 H;  4J8Q A;  4JBK A;  1GUW A;  1TQO A;  1E1O A;  3E0E A;  1QNK A;  4NW2 A;  3PF5 A;  4OEM B;  4KD4 A;  1I6H H;  1MJE A;  2QKI C;  2ES2 A;  2CH4 W;  1XMQ L;  1PH7 A;  1B44 D;  4A3E B;  4BY7 G;  4C3H G;  1S72 A;  4B3M L;  1HQM C;  1NAP A;  4JG2 A;  1VMP A;  1P8L A;  3H0G B;  3R2T A;  2ZJQ A;  5JJK A;  3DMU A;  1CKM A;  4H44 C;  3I4M G;  4QY7 A;  3PUY A;  3CAM A;  4R4I A;  1C8C A;  4Q0F A;  4F87 A;  4RH6 A;  1FJG L;  4XYQ A;  4A3G G;  4YHH Q;  4TVA B;  3K5M A;  1VCI A;  2UU9 Q;  1Z6H A;  1B9M A;  2Y0S E;  4WOR A;  3EA6 A;  3HOZ B;  4OHJ A;  1YNN D;  1H9M A;  4HED A;  4B3R L;  2K33 A;  2A1A A;  5KEE A;  4B08 A;  1JIC A;  1SYE A;  4JBW A;  3CCE A;  4ZLT F;  4V0B A;  4KKS A;  2QW7 A;  3KLS X;  1Y1V H;  2RHQ B;  4A93 H;  1KXL A;  2WAQ G;  1NR2 A;  1EQT A;  4IFD H;  3D4R A;  4QJF A;  4R8N A;  3CP0 A;  2KCN A;  3QIA A;  2E2H H;  3I4N H;  2ZT9 C;  2VZA A;  3UE0 A;  1C48 A;  1XXG A;  3E9H A;  3IFD A;  1J9O A;  3HRZ C;  2AUK A;  4LFB L;  1PFM A;  1GUG A;  2PNR C;  2EPB A;  4IOC A;  1SNQ A;  4DR2 Q;  3OTO Q;  3H94 A;  3I90 A;  4JI5 Q;  5EKI A;  1I5F A;  4YWL A;  3I2Z A;  3GTO B;  2DJG C;  4OEL B;  4HMI A;  1H9K A;  5C3X A;  3K81 C;  3K59 A;  2AQ3 B;  1NSN S;  2F4V L;  2Q2I A;  4CDD C;  1CK1 A;  4FF4 A;  2JA8 G;  4A3M B;  1HNW L;  3Q6S A;  4U67 3;  1FNU A;  4MHE A;  4PZ8 A;  1V1P B;  1TT2 A;  4X66 L;  4PNY A;  4NPS A;  3I56 A;  4LFC L;  4QGU A;  4IO9 A;  3LGJ A;  5JJL A;  1CKN B;  2RA4 A;  1F9Q A;  1CQF A;  2B2Y C;  1SMY C;  5BR8 Q;  4QF4 A;  3A54 A;  4K8I A;  1R9T H;  3KK7 A;  3PIO A;  1ILP A;  5IT9 E;  4IUQ A;  1GHK A;  1PYS B;  3DLL A;  3CC2 A;  4B3S Q;  1WCM H;  2NVT H;  1V1Q A;  5CV4 A;  5CMD A;  1TWG B;  1B50 A;  2R61 A;  5C3E B;  3CRK C;  2HCC A;  5E3F A;  3KBX A;  4JC0 A;  5GAH C;  5M3M B;  5DEH A;  2RCN A;  4GN3 B;  2CQA A;  3T51 B;  1PH8 A;  3GTJ H;  2K28 A;  5M5X B;  3RN5 A;  3U9O A;  3SR1 A;  4LUZ A;  4AYB E;  2CCZ A;  2JA5 H;  1FNW A;  3FMC A;  4FYD A;  4APV A;  1OXV A;  3QG1 A;  1MKH A;  1Q12 A;  4CDE C;  3GTQ B;  2K7V A;  3P20 A;  3S24 A;  2MPM A;  4CHT B;  3CCR A;  4DKA C;  2IT1 A;  3PUW A;  5IGD A;  4YHH L;  1IYJ B;  4A3F B;  2IX0 A;  5JPM C;  2UU9 L;  2WFW A;  3S16 B;  2XTI A;  5EJW A;  3ZJY C;  2JP1 A;  2XVS A;  1LT5 D;  2IHE A;  1HJP A;  3ERS X;  1YVC A;  5EQ0 A;  4I7Z C;  5C0X I;  1AE3 A;  2A6H C;  4ODG A;  4LF9 Q;  2QA4 A;  2HD3 A;  4CBV A;  2LXK A;  4IOA A;  2ENB A;  1STG A;  3QJY A;  2F0G A;  1K0R A;  4IFD J;  4C3H H;  3S17 B;  3I72 A;  2P5Z X;  3K8A A;  2PNH A;  3EJI A;  4JI3 Q;  3D4W A;  1E2V A;  1E24 A;  5E7N A;  2NN6 G;  3HOU G;  2CVR A;  3BDC A;  2K04 A;  1Q90 A;  2NVQ B;  2K1B A;  3MC0 B;  3BYT B;  3OWF A;  3OMC A;  4A3G H;  5ELB A;  1EY8 A;  3M9B A;  3CCS A;  3X3M A;  1RIP A;  1EL0 A;  4DR2 L;  4IAL A;  3PV0 A;  3OTO L;  5CGK A;  4C3I H;  4JI5 L;  1UE1 A;  3QOL A;  3S9W A;  3BZK A;  1B8A A;  4O1N A;  1K8A C;  2XWB B;  5FLX c;  1AEX A;  3NUC A;  5M5W H;  2D0P A;  4IUR A;  3SGI A;  5ELN A;  2CW0 D;  3K0X A;  5CBA E;  2F3I A;  1K3B C;  2B63 G;  2D62 A;  1SFO H;  5BN4 A;  5C44 H;  2GVB A;  4J15 A;  1ONL A;  1SNM A;  2E2J H;  1K83 H;  2O4X A;  3V05 A;  4P72 A;  4HMJ A;  3PUZ A;  5IYD G;  1TWA H;  4IUN A;  5BR8 L;  1YHQ A;  2SEB D;  2JA7 B;  2EQS A;  1HNX Q;  4A3J B;  1N9W A;  1LTB D;  2Z4H A;  1IKL A;  3GD7 A;  4B3S L;  1VQA A;  4OON A;  3PO3 B;  4S3S A;  4YWK A;  1DZ1 A;  3CCU A;  3W1B A;  1GUT A;  1TS3 A;  1G29 1;  2KHI A;  3R8B A;  3KF6 B;  5DM6 3;  4IPC A;  2WB1 G;  2A69 C;  5FKA C;  1NJI C;  3PQI A;  1CUK A;  1OO9 B;  3VDY A;  1F2Y A;  3EN2 A;  4JV5 Q;  1EY7 A;  2Z6B A;  1WTO A;  1KAW A;  4A3K G;  1GJX A;  4KHZ A;  3UE1 A;  1E7Z A;  1XPR A;  1SRO A;  5CV8 A;  4LF7 Q;  1VQM A;  3HG9 A;  5M9O A;  2I5L X;  1EYA A;  3PF4 A;  1WOC A;  5LL6 S;  1EQQ A;  3FKI B;  4QIW E;  1EWI A;  1WTW A;  1PDQ A;  1XWE A;  5FLX L;  4IPD A;  4EQP A;  3J7Z C;  1W6K A;  3NK9 A;  2NVX B;  4KJN A;  3L2P A;  1MBY A;  4MIU A;  4EQO A;  5ELD A;  5L37 A;  3LWE A;  3H15 A;  1GUN A;  3M4O B;  3A0J A;  4LF9 L;  1G2T A;  1KL9 A;  2KEE A;  3HP3 A;  2PYK A;  1L1O A;  4MNO A;  5IP9 H;  3ND8 A; 
#chains in the Genus database with same CATH homology
 5IGE A;  4HSV A;  1TWC B;  1EWH A;  2E75 C;  5C4X B;  2AWO A;  3SDZ A;  2IX3 A;  1KAB A;  1EY4 A;  4X3K A;  4KN7 C;  2EDG A;  5KYL A;  2M9V A;  5IT9 L;  1O80 A;  2QF7 A;  4LJZ C;  1V1O A;  3WOE A;  2WIN B;  3DWA A;  3G7L A;  1M4V A;  5DNF A;  2LKV A;  2YU9 B;  1PYW D;  5EPJ A;  3PMF A;  2IL8 A;  3HOW B;  1R4Q B;  2B2V C;  3J7A V;  3MEH A;  2NN6 H;  1TU2 B;  2ZXO A;  3AB9 A;  2Q8T A;  1HXY D;  1EZ6 A;  3RUZ A;  3U9S A;  2L12 A;  5EKL A;  2D9U A;  3CRL C;  1DOK A;  4IUT A;  4C3J G;  5LHY 1;  2BDO A;  1AFP A;  1CM9 A;  2F4I A;  3WOF A;  2SNM A;  1K8O A;  4BA1 I;  1SMY D;  2JXM B;  3VR3 A;  1SJE D;  3P1H A;  2F0J A;  2FMM A;  1PTO F;  1S4Z A;  3K58 A;  1EIG A;  2MJ8 A;  3T16 A;  3SVM A;  4RFB A;  4A3D B;  2QDB A;  4DGZ A;  2PW7 A;  3VA7 A;  3S1M B;  1GUO A;  5G3L D;  3K5N A;  1JOQ A;  4IFD I;  3I91 A;  4FXK C;  2XN9 C;  3Q23 A;  5C6A A;  2AWN A;  1FNV A;  1WD1 A;  2Q8R E;  4BBR B;  5KIX A;  4DN4 M;  3TP5 A;  1O7Z A;  2NBF A;  2A6H D;  3KLR A;  3GQB A;  1FGB D;  1D5M C;  3QWN A;  1H9S B;  1BO0 A;  4Y7N B;  4C2M B;  1SNP A;  3GP7 A;  5DAU A;  1B3A A;  5IGC A;  2RDF A;  3N6R A;  5JJZ A;  1BXT A;  1SNC A;  2L4N A;  5C4H A;  4N9T A;  3IFT A;  1LTA D;  2DNC A;  4QUF A;  5IGG A;  1QCB D;  3S15 B;  1PTO H;  3M3Y B;  4RHS A;  4G7H C;  3D6C A;  1DOM A;  2LY7 A;  1BOS A;  1STB A;  1O7Y A;  1KDB A;  1U9R A;  3D6W A;  3PIP 3;  3ND9 A;  3H3V C;  4X3T A;  2D2C C;  5JEA J;  4OO1 I;  3T56 B;  2PZT A;  2J0T D;  1H9S A;  1KTK A;  3CHB D;  2JEA I;  3BVM A;  4TSS A;  2E74 C;  2IWH A;  3FRP B;  1SSO A;  1GHJ A;  3C1E A;  3K7A B;  4K5X A;  1DM0 B;  1TY0 A;  4V19 0;  2JE6 I;  5E4W C;  3E6Z X;  1TVX A;  3VYU A;  5M5Y B;  4KJO A;  1K8M A;  1LT3 D;  1S5E D;  1FD7 D;  1CQV A;  2ZXR A;  2OT2 A;  1F77 A;  1RCV D;  5FOB B;  3VYR A;  1B1Z A;  2O5J C;  2RDH A;  2Y0S B;  1HTL D;  1TY2 A;  1YNJ D;  2KCC A;  4ME5 A;  4C1N K;  2DNE A;  1D6E C;  1BCP B;  1D2B A;  1SJH D;  2KHS A;  2N55 A;  3IKJ A;  4RCN A;  1PZI D;  4KY6 A;  4BY7 B;  3OHX C;  4F8M A;  5LL6 X;  3Q22 A;  2RDG A;  1JWU D;  2B8G A;  4DK1 A;  3I4M B;  1Q8I A;  4X3S A;  5I9O A;  4KI0 A;  5JAV A;  3IAY A;  1BR9 A;  1RTO A;  2IW3 A;  1SYF A;  2EY5 A;  4DXF A;  2EOT A;  2AUJ D;  4C3I G;  1I4Q A;  1I3Q B;  2PCF B;  5J39 A;  1AW7 A;  2EYH A;  1F2L A;  4U68 A;  3ZYY X;  3I73 A;  4XT1 B;  4KD3 A;  2E2I B;  2KA7 A;  3W3A A;  3BS1 A;  1G6Z A;  3TZD A;  1XYI A;  4KY5 A;  3TZU A;  5FLX E;  1KNA A;  2OF1 A;  1PZJ D;  1SE4 A;  4IUP A;  4RGN A;  5E1F A;  1VF7 A;  1B2T A;  1PRT B;  2L0C A;  3FDT A;  2MP1 A;  4TRD A;  3NTH A;  4A3B B;  2RQX A;  1GXD C;  1CA6 A;  3A55 A;  2JA8 B;  1BCP C;  4HAE A;  1G91 A;  2EJM A;  1TII D;  4DNT B;  4RWS C;  3S1R B;  2BE5 D;  5IGB A;  2A6E D;  3NHH A;  4AYB B;  2F3W A;  4P2C B;  4ZKC B;  2F0M A;  4DK0 A;  5FO8 B;  3GV6 A;  3NQI A;  3AMU A;  1BF4 A;  2I46 A;  1SAP A;  1SE3 A;  1LTG D;  2X6L A;  1MGS A;  5I6Y A;  1PXU A;  2LMC B;  2MGS A;  2A73 B;  5C4J B;  3C46 A;  2L9H A;  4ZRZ A;  1U4M A;  1FR3 A;  4TKO B;  4FP5 D;  3MVV A;  3MWY W;  2EYF A;  3L3O C;  5CV6 A;  2NZ1 D;  3J81 L;  1KDC A;  1S5F D;  2JA6 B;  1TWH B;  5EPL A;  3Q24 A;  2SDF A;  2B2W A;  5G3L F;  1RJT A;  3SK5 A;  3L9A X;  2ICE C;  1SE2 A;  3S14 B;  2KEC A;  1PRT C;  2GA4 B;  1G2S A;  2EVB A;  2B8F A;  4KV6 A;  4XQN A;  4OL7 A;  1V8Q A;  1LTR D;  3RZO B;  1KLG D;  4BY1 B;  1HRJ A;  3BZD B;  5JVG 3;  1RTN A;  1ET6 A;  2LFN A;  2O5I C;  2E2D C;  2F0P A;  2K5W A;  2PZW A;  1TS5 A;  2RBM A;  3NTK A;  4XQQ A;  2B2W C;  3S2H B;  2B39 A;  3SHL A;  1LTS D;  3FVQ A;  1ILQ A;  2HCI A;  4HR7 B;  1TS4 A;  2ID0 A;  4ZK9 B;  4CKE A;  1Z47 A;  2R6G A;  1D5Z C;  1X32 A;  1LAB A;  5TSS A;  3M7G A;  3N52 A;  2HUG A;  2HDM A;  3RZD B;  1J8I A;  4NMZ A;  1ZYR C;  5BN5 A;  3Q0A A;  2K5D A;  1F9S A;  2J7Z A;  5CC4 A;  1EWC A;  1A15 A;  5BN3 A;  1GOZ A;  1HA5 A;  5CBE E;  2NVY B;  5CV7 A;  1U4P A;  1D1I A;  4NDX A;  1TS2 A;  2ZXP A;  5COR A;  3P75 A;  4R9W A;  1EOT A;  3GTM B;  1IYU A;  3F2U A;  1BQQ T;  4DA2 A;  3MXN A;  5I4D A;  4QIW B;  2F0O A;  2F0F A;  1EY5 A;  1QIL A;  4KMU C;  2IPK D;  2VB3 X;  3TP7 A;  1I4P A;  4XXE A;  4CGY B;  1Q1E A;  1CA5 A;  2PZU A;  1EIH A;  2A74 C;  2DY7 A;  3TN2 A;  3R3O A;  5ELC A;  4DAV A;  5D65 A;  3HOY B;  1DJR D;  5C4Z A;  1XTC D;  2OEO A;  2EY6 A;  4RAU C;  3A8K E;  2F3V A;  1DXM A;  5KNC A;  4L6T B;  3MA2 B;  2KQ3 A;  1IW7 C;  3T13 A;  4CKB A;  1U4L A;  1STH A;  4L8J A;  3TSS A;  1ESR A;  1MSH A;  1YNJ C;  3DUZ A;  3KF8 A;  4RKL A;  2EY2 A;  4RCO A;  1LAC A;  2H1E A;  3HKZ B;  1LV9 A;  4R8I A;  3KUP A;  5I6W A;  1I50 B;  2K03 A;  5D3I B;  4OIJ A;  1LT6 D;  1X3Q A;  1WD0 A;  1RD9 D;  4Q5V A;  2HDL A;  2D5D A;  2G9H D;  1L0Y B;  4FF1 A;  1EU4 A;  2L55 A;  3VR5 A;  4CJ0 B;  4FF2 A;  3TP8 A;  1DOL A;  1ENF A;  3R93 A;  3URY A;  3A8J E;  4RGO S;  1I6V C;  3O13 A;  3J80 L;  3S1Q B;  1EU3 A;  2VNU D;  1E2Z A;  4KN4 C;  4BBS B;  3C3L A;  1CHQ D;  3FEW X;  3NWS A;  5ELF A;  4ZUI A;  2X6G A;  2NTS A;  3D31 A;  1EYC A;  3CQZ B;  3NP8 A;  5J22 A;  2M00 A;  3NBH A;  1WTP A;  1BCP D;  1WTR A;  3VA5 A;  3T53 B;  2F0V A;  1ZEQ X;  4BA2 I;  4Z9C B;  1WVL A;  4XQJ A;  3OMG A;  4LK1 C;  2F0U A;  1LLR D;  4HTH A;  2BE5 C;  1S5D D;  4M1U B;  3HZX A;  4RKB A;  5A35 A;  3M7N A;  2A6E C;  2F1M A;  4NKL A;  1JOO A;  2NYZ D;  3OOC A;  1I6H B;  4IN3 A;  1RF2 D;  1V43 A;  5D14 A;  2QCP X;  4FXD A;  2MHV A;  3TDQ A;  4LAA A;  1SEB D;  1QG7 A;  4FO2 A;  4UDU C;  3ERO A;  3SK8 A;  1F2M A;  3MXU A;  1SYC A;  1IKM A;  4J1M A;  3FPU B;  1QE6 A;  1E0B A;  1KDA A;  3OSO A;  3RD4 A;  2B2T A;  1DCZ A;  3JAM L;  1PRT D;  1STY A;  5ELE A;  1HFN A;  4K5V A;  3TP6 A;  3OIQ A;  2BDN A;  2F0L A;  4XIG S;  5CR3 A;  3G6J B;  1Y1V B;  4A93 B;  1NUC A;  4KKU A;  2K32 A;  4H13 C;  1SYB A;  2E2H B;  2F0E A;  2KED A;  3I4N B;  4KY7 A;  1IYV A;  4L63 B;  4B9X A;  2X69 A;  1EQV A;  3M85 A;  1Q1B A;  5FK9 C;  1AN8 A;  5E4X A;  4LMQ D;  1HPC A;  4UAI A;  4RGM A;  1F9P A;  5IGF A;  1LTT D;  2TSS A;  3J81 E;  1ZYR D;  4CKC A;  4QB4 A;  1MSG A;  4I65 A;  4PMW A;  4K6L A;  3DEP A;  3NSW A;  2NWG A;  2KOL A;  2N88 A;  5EPK A;  1QB5 D;  2YYZ A;  1R9T B;  5EBD A;  2E76 C;  4DF7 A;  1RDP D;  1BNZ A;  1HCZ A;  3BDO A;  1WCM B;  2NVT B;  4BS9 A;  3L7Z C;  5A2Q E;  1TR5 A;  2F0D A;  1OXT A;  3GTJ B;  5FO9 B;  1ESF A;  5KNB A;  3WDN A;  2J4X A;  2JA5 B;  1S5C D;  2PQE A;  2QEJ C;  3C1F A;  3R2I A;  3DM1 A;  3VR6 A;  1KNE A;  5KND A;  4K6D A;  2AQ2 B;  2V4D A;  1EY9 A;  2O2L D;  4YIJ A;  2K6A A;  2TMP A;  1IW7 D;  1H9J A;  4KK7 A;  1WTQ A;  3J7Y W;  3FPP A;  2C5C A;  2ICI A;  3C2P A;  1O78 A;  1PFB A;  3QB3 A;  4N9P A;  4H7B A;  2WP8 J;  1HUM A;  4JK1 C;  3A56 A;  4C3H B;  4CJ2 C;  3RMH A;  4HN7 A;  3CU7 A;  1JCK B;  2L11 A;  2R3Z A;  1PLF A;  2EE1 A;  1B53 A;  4RHR A;  1ENA A;  3OIP A;  3SEB A;  2EZV A;  3X3N A;  4A3G B;  5IIF A;  1RHP A;  2RSN A;  1FYC A;  1HQR D;  4C3I B;  1Y8O B;  3M4Y A;  2K05 A;  3SXH A;  1D1K A;  4FVM A;  1C4Q A;  1JE4 A;  3BG3 A;  2WKD A;  1OXU A;  2QIL A;  5I2Y A;  5M5W B;  1A3V A;  2WAQ B;  3VYT A;  1CT1 D;  3HGB A;  1SNO A;  1SFO B;  1L0X B;  4ZKB B;  5C44 B;  1VF5 C;  2E2J B;  1K83 B;  4XTC S;  1Y8N B;  1ZXT A;  1TWA B;  1UEA B;  3K5O A;  2Z4I A;  1T5X D;  3E5S A;  4TQU S;  2H4O A;  3I3C A;  4K5W A;  2WAC A;  4RA8 A;  4G57 A;  4XDX A;  1WTV A;  2A5H A;  1QNU A;  1QOH A;  1HHV A;  1STE A;  1EEI D;  2LS0 1;  2B2Y A;  1HA6 A;  1II3 A;  1BCP F;  2F03 A;  2A68 C;  4J6H A;  2Q8I B;  1Z7T A;  1ZKO A;  2WKC A;  4MN3 A;  4G7Z C;  3BDL A;  3CKI B;  3A7A B;  1PTO D;  2EJF C;  4OIK A;  2AQ1 B;  4F7X A;  4ZAI A;  3J80 E;  3EQL C;  4ZQ3 A;  1WTX A;  2F0S A;  3MHB A;  3P7J A;  1PMR A;  5KGU A;  2EXZ A;  1CFM A;  1SXT A;  5K5P A;  3J7A F;  2CHB D;  2I07 B;  4K14 A;  5C3W A;  5IOC A;  2G9D A;  5CV9 A;  2F0H A;  3GTP B;  4RGT A;  4GZY C;  2JYO A;  3ONA B;  4FNF A;  1UNS A;  2NN6 I;  4OO1 H;  5KRU A;  4QUC A;  3TME A;  3MFG A;  1NCV A;  1JOR A;  1CZG A;  5ISR A;  1PRT F;  4G4K A;  1V1P A;  3NQT A;  5A2Q L;  5HGT A;  4PMC A;  5JOB A;  1RKN A;  2BCO A;  2PO4 A;  2EYO A;  4PV1 C;  4FXG C;  3KBG A;  5I2X A;  3EFX D;  5EGT A;  1SND A;  3HOU B;  3MXP A;  5JPN C;  1A2T A;  4PQX A;  2C9O A;  3VR2 A;  1A2U A;  2L5T A;  3NE5 B;  3H91 A;  2K01 A;  1AZQ A;  1ICW A;  4IUU A;  1EY6 A;  1PFN A;  4EGV A;  1Q3L A;  3V96 A;  3MZ5 A;  1JWS D;  3H6M A;  1DYQ A;  5C0X G;  3JAM E;  2FFK B;  2VXW A;  4ABN A;  3OPO A;  3BYY B;  4B9W A;  4HSP A;  2B63 B;  4XYO A;  3K5L A;  1EYD A;  3BVZ A;  1JQY D;  4XT3 B;  1DON A;  3NPP A;  5JEA G;  2RVL A;  3DWP A;  2PMZ B;  3HEJ A;  2FMC A;  1AP0 A;  1BDO A;  3VYS A;  3MAQ A;  1KLU D;  2KJX A;  1HUN A;  3GTL B;  1Y8P B;  4DNR B;  3D3R A;  2R93 B;  1I4H A;  4ILW A;  1X3P A;  1KAA A;  2JSO A;  4WRD A;  3VR4 A;  2WB1 B;  2EYP A;  4K8J A;  1EY0 A;  4CJ1 B;  1SBB B;  3SE0 A;  3BVG A;  4A3K B;  5T1I A;  5AFW A;  2M2L A;  5KYI A;  5JVH 3;  3SK4 A;  2IX1 A;  2BA0 A;  1IHZ A;  5J1Z A;  3D8G A;  4WFN 3;  2EYL A;  1LTI D;  4KKT A;  1CZW A;  1TWF B;  3D4D A;  1HTP A;  2MUY A;  3MTS A;  3EVQ A;  4F88 A;  1E2W A;  1QWY A;  3H09 A;  2RKS A;  2SOB A;  3S2D B;  2FJ2 A;  1I4R A;  1LT4 D;  4DXG A;  1AZP A;  4HCE A;  4K2L A;  3IL8 A;  4FF3 A;  3PUV A;  3OWE B;  1PTO B;  2F0N A;  3QO2 A;  1STN A;  1VDZ A;  3HS0 C;  5I9P A;  2XRQ D;  1UUP A;  1HFG A;  3AU7 A;  4IQZ A;  1D5X C;  4IUV A;  4E6I A;  3UI2 A;  4IZ8 A;  5F2D A;  4HCS A;  2B2V A;  3W2D A;  3I4L A;  2KUM A;  2SNS A;  1YNN C;  3GO5 A;  5EKK A;  3GV3 A;  4BWG B;  1F2Z A;  4EQN A;  1DD2 A;  1JB3 A;  3NWT A;  1ET9 A;  1TKW B;  1NR4 A;  3LX0 A;  3T4A C;  1PZK D;  3NBI A;  1VMC A;  2FHT A;  2NB0 A;  1JC7 A;  1M8A A;  1LO5 D;  2XRS D;  1CTM A;  3I8Z A;  4ULL A;  4C3J B;  1A3T A;  2PPB C;  4DU9 A;  2F0T A;  1CI3 M;  2A68 D;  2DN8 A;  5C0X H;  1ENC A;  2RSO A;  4ZYS A;  2F0I A;  4H0L C;  3K6O A;  2VUM B;  3KLS A;  2XWJ B;  1PTO C;  5JEA H;  5K36 G;  3A7L A;  4ID6 A;  5EBC A;  3DWQ A;  1F9R A;  2XIW A;  2Z1C A;  5IOD A;  2NTT A;  4X3U A;  1O7L A;  2XNA C;  3ITP A;  3HOV B;  2WV6 D;  3K57 A;  2FIN B;  1SDF A;  1MD2 D;  3GTK B;  3LNN A;  1H9R A;  1I4G A;  2XSC A;  5NUC A;  2B2U A;  3PUX A;  2L1B A;  3GTG B;  3A8I E;  3MXG A;  1QJO A;  2PW5 A;  5DM7 3;  4WJW A;  1JWM D;  3S1N B;  3PO2 B;  3NXW A;  1GUS A;  3V2T A;  4DAP A;  1B9N A;  2EY1 A;  2B2T C;  1A3U A;  4OGQ C;  2BOS A;  2R92 B;  5CYU A;  2BA1 A;  1BUV T;  4M8A A;  3DXJ C;  1ML0 D;  4KHV A;  5FO7 B;  4IFD G;  3MFY A;  1XX8 A;  4A3I B;  2B2U C;  3K0Y A;  1G8Z D;  2WII B;  4ZUJ A;  1OXS C;  1BBX C;  2EYM A;  5C5L A;  4C1N I;  2HQE A;  2EJG C;  2JEB I;  1STA A;  1ROD A;  2F0K A;  3QOJ A;  4QCL A;  4C56 C;  1W6J A;  3DEO A;  2NUC A;  3NTI A;  1EZ8 A;  1IL8 A;  1JOK A;  5D3D A;  3E0J A;  2Z8L A;  2VB2 X;  1A6X A;  4NP5 A;  1I4X A;  1R4P B;  5T1G A;  5C0X J;  2F0Q A;  1Y69 U;  4O42 A;  1MI2 A;  4EVO A;  3DHQ A;  4K2K A;  5M3F B;  5HUR A;  1UAP A;  3HOX B;  3I70 A;  1CHP D;  5CV5 A;  2CW0 C;  5COY A;  2K5Q A;  1Y1W B;  2OXP A;  4KTA A;  4DAY A;  1SYG A;  3SK6 A;  4PMB A;  1S5B D;  5C5M A;  1U4R A;  3TBI B;  4QMG A;  2DY8 A;  4OO1 G;  1SYD A;  1JR0 D;  2R7Z B;  3RLF A;  3ERQ A;  2A69 D;  2KVM A;  1B4O A;  1EEF D;  2IJ0 A;  1EFI D;  3OW7 A;  3PIO 3;  2EYJ A;  2F0W A;  4G7O C;  1OXX K;  4DFA A;  3LWU A;  1T5E A;  5K36 H;  4J8Q A;  1GUW A;  1TQO A;  1QNK A;  4NW2 A;  4KD4 A;  2QKI C;  1B44 D;  4A3E B;  4C3H G;  1HQM C;  1NAP A;  1VMP A;  3H0G B;  3R2T A;  3DMU A;  4H44 C;  3PUY A;  1C8C A;  4Q0F A;  4F87 A;  4RH6 A;  4XYQ A;  3K5M A;  1VCI A;  1Z6H A;  1B9M A;  4WOR A;  3EA6 A;  3HOZ B;  4OHJ A;  1YNN D;  1H9M A;  4HED A;  2K33 A;  5KEE A;  4B08 A;  1JIC A;  1SYE A;  4JBW A;  4ZLT F;  4V0B A;  4KKS A;  3KLS X;  1NR2 A;  1EQT A;  4IFD H;  3D4R A;  4R8N A;  3QIA A;  2KCN A;  2ZT9 C;  1C48 A;  1XXG A;  3IFD A;  1J9O A;  3HRZ C;  2AUK A;  1PFM A;  1GUG A;  2PNR C;  2EPB A;  1SNQ A;  3H94 A;  3I90 A;  5EKI A;  3GTO B;  4HMI A;  1H9K A;  5C3X A;  3K59 A;  2AQ3 B;  1NSN S;  1CK1 A;  4FF4 A;  4A3M B;  3Q6S A;  4U67 3;  1FNU A;  4MHE A;  1V1P B;  1TT2 A;  4PNY A;  2RA4 A;  1F9Q A;  1CQF A;  2B2Y C;  1SMY C;  4QF4 A;  3A54 A;  4K8I A;  3KK7 A;  1ILP A;  5IT9 E;  4IUQ A;  1GHK A;  5CV4 A;  5CMD A;  1TWG B;  1B50 A;  2R61 A;  5C3E B;  3CRK C;  2HCC A;  5E3F A;  3KBX A;  5M3M B;  5DEH A;  2CQA A;  3T51 B;  2K28 A;  5M5X B;  3U9O A;  3SR1 A;  1FNW A;  3FMC A;  4FYD A;  1OXV A;  3QG1 A;  1Q12 A;  3GTQ B;  2K7V A;  3P20 A;  2MPM A;  4CHT B;  2IT1 A;  3PUW A;  5IGD A;  4A3F B;  2IX0 A;  5JPM C;  3S16 B;  5EJW A;  2JP1 A;  2XVS A;  1LT5 D;  5EQ0 A;  4I7Z C;  5C0X I;  2A6H C;  4ODG A;  4CBV A;  2ENB A;  1STG A;  3QJY A;  2F0G A;  4IFD J;  3S17 B;  3I72 A;  3EJI A;  3D4W A;  1E2V A;  2NN6 G;  2CVR A;  3BDC A;  2K04 A;  1Q90 A;  2NVQ B;  2K1B A;  3MC0 B;  3BYT B;  3OWF A;  3OMC A;  5ELB A;  1EY8 A;  3X3M A;  1EL0 A;  4IAL A;  3PV0 A;  5CGK A;  3QOL A;  3S9W A;  4O1N A;  2XWB B;  1AEX A;  3NUC A;  4IUR A;  2CW0 D;  5CBA E;  2D62 A;  5BN4 A;  1ONL A;  1SNM A;  2O4X A;  3V05 A;  4HMJ A;  3PUZ A;  4IUN A;  2SEB D;  2JA7 B;  4A3J B;  1LTB D;  2Z4H A;  1IKL A;  3GD7 A;  3PO3 B;  4S3S A;  1DZ1 A;  1GUT A;  1TS3 A;  1G29 1;  3R8B A;  5DM6 3;  5FKA C;  2A69 C;  1OO9 B;  1F2Y A;  1EY7 A;  1WTO A;  1GJX A;  4KHZ A;  5CV8 A;  3HG9 A;  5M9O A;  1EYA A;  5LL6 S;  3FKI B;  1WTW A;  1PDQ A;  1XWE A;  5FLX L;  4EQP A;  1W6K A;  3NK9 A;  2NVX B;  4KJN A;  1MBY A;  4MIU A;  4EQO A;  5ELD A;  3LWE A;  1GUN A;  3M4O B;  1G2T A;  2KEE A;  3HP3 A;  2PYK A;  3ND8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...