1ROUA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Rotamase (isomerase)
molecule keywords FKBP59-I
total genus 25
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rouA00
1FKBA 2MLYA 2KO7A 2F21A 1D7IA 4NNRA 1Q6IA 2F2DA 1FKLA 2XPAA 4N19A 1C9HA 1D7HA 3KCEA 2VN1A 3IK8A 2D9FA 2KGJA 2ZQUA 4DRQA 4JYSA 2ZQTA 1EQ3A 2DG3A 2FKEA 4GIVA 3KABA 3H9RB 2M08A 1N1AA 3O5LA 1M5YA 1L1PA 2Q5AA 2MNTA 4U86A 1YATA 4W9QA 2ZR4A 3RGCA 1ZK6A 2KR7A 3O5OA 3UQBA 2PPOA 3KAFA 1FKGA 2MF9A 2PV2A 3O5QA 1HXVA 2XP8A 1P5QA 4MGVA 2RURA 2Y78A 1BL4A 1Q1CA 1B6CA 2OFNA 4ODPA 2LPVA 4TX0A 1Q6UA 4FN2A 4DRKA 1T11A 5HWBA 4MSPA 1FJDA 1FD9A 2ITKA 3RFWA 3KAIA 4TW7A 3OOBA 1QPLA 2RUCA 3KAGA 4TNSA 2LKNA 1TCOC 2ZQSA 2IF4A 4DZ3A 5HW7A 4JFJA 3NRKA 2ZQVA 1FKFA 1FKSA 2PBCA 1FKRA 1PINA 4DRHA 4J4OA 1J4IA 2PPPA 4BF8A 1JNTA 1FKHA 4C02B 4JFMA 2K8IA 4R0XA 4QT2A 3JYJA 5HUAA 1F8AB 3GPKA 2PPNA 2M1IA 4TW6A 2XP3A 4DRJA 4DT4A 1FKTA 3LUOA 2N87A 2LJ4A 3KZ7A 2PV1A 4TW8A 2XP5A 1A7XA 2KE0A 1R9HA 2KI3A 4O2TA 4LAYA 3UI4A 3UF8A 1PBKA 1J4HA 3O5EA 3O5RA 4DRNA 2AWGA 3B7XA 3PA7A 2DG9A 4G2PA 5HW6A 3EY6A 3ODKA 4G50A 3O5MA 4ITZA 3NI6A 5DIVA 4U84A 1ROUA 2MPHA 3O5IA 5DIUA 4DROA 5HKGA 3CGNA 5HTGA 3UQAA 3CGMA 1U79A 5D75A 5J6EA 2L2SA 5HWCA 4ODQA 1FAPA 3VAWA 1FKKA 2MLXA 4ODKA 2RQSA 4DZ2A 5BXJA 3O5KA 4DH0A 3MDYB 2ZR5A 3JYMA 2ZR6A 1D7JA 4QIBA 3IKGA 4W9OA 4ODLA 4IPXA 2RUDA 4TYOA 4DIPA 1YW5A 2F4EA 3O5DA 1FKJA 4LAVA 1JVWA 1BKFA 3TDBA 3O5PA 4DRMA 1FKDA 1NMVA 2XP9A 4QT3A 3NTPA 3WH0A 1NMWA 1D6OA 2M2AA 3O5GA 4FAPA 5B8IC 1F40A 4DRIA 3PRDA 2UZ5A 4ODRA 3TC5A 3IHZA 4DRPA 3I6CA 1JNSA 1Q6HA 3TCZA 2FAPA 4J4NA 2MLZA 1FKIA 1Y0OA 1NSGA 1J4RA 4IQCA 2RSEA 1J6YA 2XP4A 3O5FA 2VCDA 2XP7A 3KADA 5HT1A 4W9PA 4IQ2A 5GPGA 3UQIA 1QPFA 2JZVA 3O5JA 4ODMA 5I98A 1ROTA 1W26A 3FAPA 3UI5A 3UI6A 1QZ2A 3JXVA 4JFIA 4ODNA 1ZCNA 4JFKA 2LGOA 2XP6A 4JFLA 2DG4A 4LAWA 4ODOA 3KAHA 2XPBA 4LAXA 3KACA 1KT1A 5HW8A 1KT0A 2KFWA 3IKDA 1EYMA 2PV3A 4GGQA 4U85A 5DITA 3PRBA 2RUQA
chains in the Genus database with same CATH superfamily
3ARQA 4Z2JA 2A3EA 1W9PA 2B5UB 1NWTA 1C9HA 1D7HA 2KGJA 3WQVA 4JYSA 2IUZA 4Z2KA 1L1PA 2Q5AA 4W9QA 2YBUA 3KAFA 4WJXA 1FKGA 2DT3A 2MF9A 4MTVA 2PV2A 4R5EA 3O5QA 2A3BA 4MGVA 2RURA 1ZBVA 1Q1CA 2OFNA 5HWBA 1LG2A 3KAIA 1KFWA 2RUCA 3AS0A 1TCOC 1E9LA 3CHDA 4NSBA 4XAKA 1PINA 1JNDA 5HBFA 1J4IA 4BF8A 1JNTA 1O6IA 5DF0A 2QF8A 2EULA 3LUOA 2LJ4A 4TW8A 1A7XA 2YBTA 2KE0A 2KI3A 3UF8A 4MNMA 3O5RA 4DRNA 1WAWA 3B7XA 5HW6A 5HKGA 5DIVA 3O5IA 3UQAA 3CGMA 1U79A 4MNJA 4ODQA 2O92A 2ZR5A 1HJWA 3IKGA 4HARA 2ESCA 4DIPA 3O5DA 4LAVA 3O5PA 1EIBA 3AS1A 2M2AA 3O5GA 4FAPA 2DT0A 3IHZA 5DO2A 3TC5A 1JNSA 4J4NA 1E6NA 1LJYA 3CHEA 1D2KA 4HBOA 1NH6A 1J6YA 2XP4A 3O5FA 3O5JA 4ODMA 3ARWA 1ROTA 1W26A 4P8WA 3UI5A 3B9DA 1LL6A 1W1YA 1GRJA 1JCHB 1TFVA 1VF8A 1KT1A 2O9OA 4NZCA 2KO7A 3ARUA 2F2DA 3B9AA 1E44A 3KCEA 4DRQA 2ZQUA 2PN0A 4GIVA 3H9RB 4HBEA 2G41A 3CHFA 3RGCA 1ZK6A 3UQBA 3O5OA 3QOKA 2PPOA 5DEZA 1W1TA 2XP8A 2F23A 3GU0A 2Y78A 3FY1A 3ARSA 4DRKA 2LPVA 1Q6UA 2A3CA 4KQZA 4MSPA 4ZS6A 2ITKA 4S3JA 1QPLA 3KAGA 2LKNA 2DSVA 2IF4A 5HW7A 3NRKA 2WM0A 4DRHA 4C02B 2WLZA 4JFMA 4QT2A 1HJVA 2PPNA 3RM9A 4DRJA 1GOIA 2PV1A 4URIA 3BXWA 4LAYA 1IX5A 1J4HA 2AWGA 3PA7A 3EY6A 4Z2GA 3PRAA 5DIUA 1NWUA 4DROA 3RMEA 4LGXA 2DSWA 2L2SA 4WK9A 1FAPA 3ARVA 3VAWA 2MLXA 3FXYA 5BXJA 3JYMA 4W9OA 4QIBA 2WK2A 2RUDA 4IPXA 4TYOA 1JVWA 1BKFA 1ZL1A 4Q7NA 3WH0A 2B31A 1OWQA 3PRDA 4DRPA 1JNEA 4Z2LA 3TCZA 3PR9A 1J4RA 4IQCA 2RSEA 1LL7A 1QPFA 3JXVA 1GUVA 4ODNA 1ZCNA 4DWSD 2AOSA 2LGOA 2XP6A 3WL1A 2XPBA 2KFWA 3IKDA 2PV3A 4U85A 2RUQA 1EHNA 1D7IA 4NNRA 1LQ0A 2XPAA 1H0IA 2OLHA 1LG1A 1W1PA 2DG3A 2DSZA 3KABA 1HKMA 1UR8A 4MAVA 1HXVA 1P5QA 1BL4A 4TX0A 1FJDA 4FN2A 3WD3A 1FD9A 3RFWA 1NWRA 4TW7A 1E6PA 4WKFA 1UR9A 2ZQSA 4JFJA 3WD0A 2ZQVA 1FKFA 1FKSA 2PBCA 3ALGA 1W1VA 4R0XA 2DT2A 1GPFA 1ZU8A 1F8AB 5HUAA 2PI6A 3GPKA 4TW6A 1LL4A 4P8VA 1NWSA 1OGGA 1ITXA 3ARYA 2XP5A 4DWSC 4ZPTR 3B9EA 3O5EA 1E6RA 2DG9A 4G2PA 4QZVB 5JH8A 3O5MA 4ITZA 3RM4A 4U84A 2ETNA 2MPHA 3CGNA 3AS3A 4L72B 1HKIA 5D75A 5J6EA 1E15A 4ZPVR 4DWSA 1FKKA 1RD6A 4ODKA 2RQSA 3WD1A 3WD2A 3OA5A 3O5KA 3MDYB 4ODLA 2F4EA 3WKZA 1FKJA 3TDBA 4DRMA 1XHGA 1NMVA 3NTPA 1NMWA 2DT1A 3B8SA 4WIWA 3I6CA 2FDMA 2MLZA 5GQBA 1NSGA 2VCDA 3KADA 5HT1A 4IQ2A 5GPGA 4PTMA 1SR0A 2A3AA 2JZVA 4KR0B 1QZ2A 3ARTA 4JFIA 4JFKA 3WL0A 1XRVA 3ARXA 1SYTA 3EIPA 4ODOA 3ALFA 5HW8A 1KT0A 3WD4A 1HKJA 5DITA 3PRBA 4IT4A 1FKBA 2MLYA 2F21A 3CH9A 1Q6IA 1FKLA 1H0GA 1CTNA 4N19A 2VN1A 3IK8A 2D9FA 1FFQA 1K9TA 2ZQTA 1EQ3A 2FKEA 3O5LA 2M08A 1N1AA 1M5YA 2MNTA 4U86A 1YATA 2ZR4A 2KR7A 1WB0A 3G6LA 1ZBKA 4DWSB 2G8ZA 1B6CA 4ODPA 1T11A 3OOBA 4TNSA 4Z2IA 4DZ3A 3ARZA 4P8XA 1FKRA 1FFRA 3GTYX 4J4OA 2PPPA 2DPEA 5GPRA 1FKHA 4W5UA 4P8UA 2K8IA 4MPKA 3JYJA 2M1IA 3CHCA 2XP3A 4MNKA 4DT4A 1FKTA 1HJXA 2N87A 3KZ7A 1R9HA 4O2TA 3UI4A 3ARRA 3BMBA 1HKKA 1PBKA 1X6LA 4AY1A 4ZPWR 3G6MA 3AQUA 4Z2HA 3ODKA 4G50A 3WQWA 3NI6A 4UDMA 1ROUA 5HTGA 4MNLA 1W9VA 5HWCA 1ZBCA 4DZ2A 3AROA 4DH0A 1ZBWA 2ZR6A 3ARPA 1D7JA 4L3NA 3WIJA 1YW5A 2P4VA 1ZB5A 1FKDA 2XP9A 4WKHA 4QT3A 1EDQA 2DSUA 1D6OA 5B8IC 1F40A 1WNOA 4DRIA 2UZ5A 4ODRA 1W9UA 1Q6HA 2FAPA 4S3KA 3RM8A 1FKIA 4IT6A 2WLYA 4ML4A 1E6ZA 1Y0OA 2XP7A 4W9PA 3UQIA 5I98A 1X6NA 3FAPA 3UI6A 3CZ8A 4Q22A 3AS2A 4WKAA 4JFLA 2DG4A 4LAWA 1OGBA 3KAHA 4LAXA 3KACA 1EYMA 4GGQA 3W4RA
chains in the Genus database with same CATH topology
3ARQA 4Z2JA 2A3EA 1W9PA 1NWTA 1C9HA 1D7HA 2KGJA 3WQVA 4JYSA 2IUZA 4Z2KA 1L1PA 2Q5AA 4W9QA 2YBUA 3KAFA 4WJXA 1FKGA 2DT3A 2MF9A 4MTVA 2PV2A 4R5EA 3O5QA 2A3BA 4MGVA 2RURA 1ZBVA 1Q1CA 2OFNA 5HWBA 1LG2A 3KAIA 1KFWA 2RUCA 3AS0A 1TCOC 1E9LA 3CHDA 4NSBA 4XAKA 1PINA 1JNDA 5HBFA 1J4IA 4BF8A 1JNTA 1O6IA 5DF0A 2QF8A 3LUOA 2LJ4A 4TW8A 1A7XA 2YBTA 2KE0A 2KI3A 3UF8A 4MNMA 3O5RA 4DRNA 1WAWA 3B7XA 5HW6A 5HKGA 5DIVA 3O5IA 3UQAA 3CGMA 1U79A 4MNJA 4ODQA 2O92A 2ZR5A 1HJWA 3IKGA 4HARA 2ESCA 4DIPA 3O5DA 4LAVA 3O5PA 1EIBA 3AS1A 2M2AA 3O5GA 4FAPA 2DT0A 3IHZA 5DO2A 3TC5A 1JNSA 4J4NA 1E6NA 1LJYA 3CHEA 1D2KA 4HBOA 1NH6A 1J6YA 2XP4A 3O5FA 3O5JA 4ODMA 3ARWA 1ROTA 1W26A 4P8WA 3UI5A 3B9DA 1LL6A 1W1YA 1TFVA 1VF8A 1KT1A 2O9OA 4NZCA 2KO7A 3ARUA 2F2DA 3B9AA 3KCEA 4DRQA 2ZQUA 4GIVA 3H9RB 4HBEA 2G41A 3CHFA 3RGCA 1ZK6A 3UQBA 3O5OA 3QOKA 2PPOA 5DEZA 1W1TA 2XP8A 2Y78A 3FY1A 3ARSA 4DRKA 2LPVA 1Q6UA 2A3CA 4KQZA 4MSPA 4ZS6A 2ITKA 4S3JA 1QPLA 3KAGA 2LKNA 2DSVA 2IF4A 5HW7A 3NRKA 2WM0A 4DRHA 4C02B 2WLZA 4JFMA 4QT2A 1HJVA 2PPNA 3RM9A 4DRJA 1GOIA 2PV1A 4URIA 3BXWA 4LAYA 1IX5A 1J4HA 2AWGA 3PA7A 3EY6A 4Z2GA 3PRAA 5DIUA 1NWUA 4DROA 3RMEA 4LGXA 2DSWA 2L2SA 4WK9A 1FAPA 3ARVA 3VAWA 2MLXA 3FXYA 5BXJA 3JYMA 4W9OA 4QIBA 2WK2A 2RUDA 4IPXA 4TYOA 1JVWA 1BKFA 1ZL1A 4Q7NA 3WH0A 2B31A 1OWQA 3PRDA 4DRPA 1JNEA 4Z2LA 3TCZA 3PR9A 1J4RA 4IQCA 2RSEA 1LL7A 1QPFA 3JXVA 1GUVA 4ODNA 1ZCNA 4DWSD 2AOSA 2LGOA 2XP6A 3WL1A 2XPBA 2KFWA 3IKDA 2PV3A 4U85A 2RUQA 1EHNA 1D7IA 4NNRA 1LQ0A 2XPAA 1H0IA 2OLHA 1LG1A 1W1PA 2DG3A 2DSZA 3KABA 1HKMA 1UR8A 4MAVA 1HXVA 1P5QA 1BL4A 4TX0A 1FJDA 4FN2A 3WD3A 1FD9A 3RFWA 1NWRA 4TW7A 1E6PA 4WKFA 1UR9A 2ZQSA 4JFJA 3WD0A 2ZQVA 1FKFA 1FKSA 2PBCA 3ALGA 1W1VA 4R0XA 2DT2A 1GPFA 1ZU8A 1F8AB 5HUAA 2PI6A 3GPKA 4TW6A 1LL4A 4P8VA 1NWSA 1OGGA 1ITXA 3ARYA 2XP5A 4DWSC 4ZPTR 3B9EA 3O5EA 1E6RA 2DG9A 4G2PA 4QZVB 5JH8A 3O5MA 4ITZA 3RM4A 4U84A 2MPHA 3CGNA 3AS3A 4L72B 1HKIA 5D75A 5J6EA 1E15A 4ZPVR 4DWSA 1FKKA 1RD6A 4ODKA 2RQSA 3WD1A 3WD2A 3OA5A 3O5KA 3MDYB 4ODLA 2F4EA 3WKZA 1FKJA 3TDBA 4DRMA 1XHGA 1NMVA 3NTPA 1NMWA 2DT1A 3B8SA 4WIWA 3I6CA 2FDMA 2MLZA 5GQBA 1NSGA 2VCDA 3KADA 5HT1A 4IQ2A 5GPGA 4PTMA 1SR0A 2A3AA 2JZVA 4KR0B 1QZ2A 3ARTA 4JFIA 4JFKA 3WL0A 1XRVA 3ARXA 1SYTA 4ODOA 3ALFA 5HW8A 1KT0A 3WD4A 1HKJA 5DITA 4IT4A 3PRBA 1FKBA 2MLYA 2F21A 3CH9A 1Q6IA 1FKLA 1H0GA 1CTNA 4N19A 2VN1A 3IK8A 2D9FA 1FFQA 1K9TA 2ZQTA 1EQ3A 2FKEA 3O5LA 2M08A 1N1AA 1M5YA 2MNTA 4U86A 1YATA 2ZR4A 2KR7A 1WB0A 3G6LA 1ZBKA 4DWSB 2G8ZA 1B6CA 4ODPA 1T11A 3OOBA 4TNSA 4Z2IA 4DZ3A 3ARZA 4P8XA 1FKRA 1FFRA 4J4OA 2PPPA 2DPEA 5GPRA 1FKHA 4W5UA 4P8UA 2K8IA 4MPKA 3JYJA 2M1IA 3CHCA 2XP3A 4MNKA 4DT4A 1FKTA 1HJXA 2N87A 3KZ7A 1R9HA 4O2TA 3UI4A 3ARRA 1HKKA 1PBKA 1X6LA 4AY1A 4ZPWR 3G6MA 3AQUA 4Z2HA 3ODKA 4G50A 3WQWA 3NI6A 1ROUA 5HTGA 4MNLA 1W9VA 5HWCA 1ZBCA 4DZ2A 3AROA 4DH0A 1ZBWA 2ZR6A 3ARPA 1D7JA 4L3NA 3WIJA 1YW5A 1ZB5A 1FKDA 2XP9A 4WKHA 4QT3A 1EDQA 2DSUA 1D6OA 5B8IC 1F40A 1WNOA 4DRIA 2UZ5A 4ODRA 1W9UA 1Q6HA 2FAPA 4S3KA 3RM8A 1FKIA 4IT6A 2WLYA 4ML4A 1E6ZA 1Y0OA 2XP7A 4W9PA 3UQIA 5I98A 1X6NA 3FAPA 3UI6A 3CZ8A 4Q22A 3AS2A 4WKAA 4JFLA 2DG4A 4LAWA 1OGBA 3KAHA 4LAXA 3KACA 1EYMA 4GGQA 3W4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKB A;  2MLY A;  2KO7 A;  2F21 A;  1D7I A;  4NNR A;  1Q6I A;  2F2D A;  1FKL A;  2XPA A;  4N19 A;  1C9H A;  1D7H A;  3KCE A;  2VN1 A;  3IK8 A;  2D9F A;  2KGJ A;  2ZQU A;  4DRQ A;  4JYS A;  2ZQT A;  1EQ3 A;  2DG3 A;  2FKE A;  4GIV A;  3KAB A;  3H9R B;  2M08 A;  1N1A A;  3O5L A;  1M5Y A;  1L1P A;  2Q5A A;  2MNT A;  4U86 A;  1YAT A;  4W9Q A;  2ZR4 A;  3RGC A;  1ZK6 A;  2KR7 A;  3O5O A;  3UQB A;  2PPO A;  3KAF A;  1FKG A;  2MF9 A;  2PV2 A;  3O5Q A;  1HXV A;  2XP8 A;  1P5Q A;  4MGV A;  2RUR A;  2Y78 A;  1BL4 A;  1Q1C A;  1B6C A;  2OFN A;  4ODP A;  2LPV A;  4TX0 A;  1Q6U A;  4FN2 A;  4DRK A;  1T11 A;  5HWB A;  4MSP A;  1FJD A;  1FD9 A;  2ITK A;  3RFW A;  3KAI A;  4TW7 A;  3OOB A;  1QPL A;  2RUC A;  3KAG A;  4TNS A;  2LKN A;  1TCO C;  2ZQS A;  2IF4 A;  4DZ3 A;  5HW7 A;  4JFJ A;  3NRK A;  2ZQV A;  1FKF A;  1FKS A;  2PBC A;  1FKR A;  1PIN A;  4DRH A;  4J4O A;  1J4I A;  2PPP A;  4BF8 A;  1JNT A;  1FKH A;  4C02 B;  4JFM A;  2K8I A;  4R0X A;  4QT2 A;  3JYJ A;  5HUA A;  1F8A B;  3GPK A;  2PPN A;  2M1I A;  4TW6 A;  2XP3 A;  4DRJ A;  4DT4 A;  1FKT A;  3LUO A;  2N87 A;  2LJ4 A;  3KZ7 A;  2PV1 A;  4TW8 A;  2XP5 A;  1A7X A;  2KE0 A;  1R9H A;  2KI3 A;  4O2T A;  4LAY A;  3UI4 A;  3UF8 A;  1PBK A;  1J4H A;  3O5E A;  3O5R A;  4DRN A;  2AWG A;  3B7X A;  3PA7 A;  2DG9 A;  4G2P A;  5HW6 A;  3EY6 A;  3ODK A;  4G50 A;  3O5M A;  4ITZ A;  3NI6 A;  5DIV A;  4U84 A;  1ROU A;  2MPH A;  3O5I A;  5DIU A;  4DRO A;  5HKG A;  3CGN A;  5HTG A;  3UQA A;  3CGM A;  1U79 A;  5D75 A;  5J6E A;  2L2S A;  5HWC A;  4ODQ A;  1FAP A;  3VAW A;  1FKK A;  2MLX A;  4ODK A;  2RQS A;  4DZ2 A;  5BXJ A;  3O5K A;  4DH0 A;  3MDY B;  2ZR5 A;  3JYM A;  2ZR6 A;  1D7J A;  4QIB A;  3IKG A;  4W9O A;  4ODL A;  4IPX A;  2RUD A;  4TYO A;  4DIP A;  1YW5 A;  2F4E A;  3O5D A;  1FKJ A;  4LAV A;  1JVW A;  1BKF A;  3TDB A;  3O5P A;  4DRM A;  1FKD A;  1NMV A;  2XP9 A;  4QT3 A;  3NTP A;  3WH0 A;  1NMW A;  1D6O A;  2M2A A;  3O5G A;  4FAP A;  5B8I C;  1F40 A;  4DRI A;  3PRD A;  2UZ5 A;  4ODR A;  3TC5 A;  3IHZ A;  4DRP A;  3I6C A;  1JNS A;  1Q6H A;  3TCZ A;  2FAP A;  4J4N A;  2MLZ A;  1FKI A;  1Y0O A;  1NSG A;  1J4R A;  4IQC A;  2RSE A;  1J6Y A;  2XP4 A;  3O5F A;  2VCD A;  2XP7 A;  3KAD A;  5HT1 A;  4W9P A;  4IQ2 A;  5GPG A;  3UQI A;  1QPF A;  2JZV A;  3O5J A;  4ODM A;  5I98 A;  1ROT A;  1W26 A;  3FAP A;  3UI5 A;  3UI6 A;  1QZ2 A;  3JXV A;  4JFI A;  4ODN A;  1ZCN A;  4JFK A;  2LGO A;  2XP6 A;  4JFL A;  2DG4 A;  4LAW A;  4ODO A;  3KAH A;  2XPB A;  4LAX A;  3KAC A;  1KT1 A;  5HW8 A;  1KT0 A;  2KFW A;  3IKD A;  1EYM A;  2PV3 A;  4GGQ A;  4U85 A;  5DIT A;  3PRB A;  2RUQ A; 
#chains in the Genus database with same CATH topology
 3ARQ A;  4Z2J A;  2A3E A;  1W9P A;  2B5U B;  1NWT A;  1C9H A;  1D7H A;  2KGJ A;  3WQV A;  4JYS A;  2IUZ A;  4Z2K A;  1L1P A;  2Q5A A;  4W9Q A;  2YBU A;  3KAF A;  4WJX A;  1FKG A;  2DT3 A;  2MF9 A;  4MTV A;  2PV2 A;  4R5E A;  3O5Q A;  2A3B A;  4MGV A;  2RUR A;  1ZBV A;  1Q1C A;  2OFN A;  5HWB A;  1LG2 A;  3KAI A;  1KFW A;  2RUC A;  3AS0 A;  1TCO C;  1E9L A;  3CHD A;  4NSB A;  4XAK A;  1PIN A;  1JND A;  5HBF A;  1J4I A;  4BF8 A;  1JNT A;  1O6I A;  5DF0 A;  2QF8 A;  2EUL A;  3LUO A;  2LJ4 A;  4TW8 A;  1A7X A;  2YBT A;  2KE0 A;  2KI3 A;  3UF8 A;  4MNM A;  3O5R A;  4DRN A;  1WAW A;  3B7X A;  5HW6 A;  5HKG A;  5DIV A;  3O5I A;  3UQA A;  3CGM A;  1U79 A;  4MNJ A;  4ODQ A;  2O92 A;  2ZR5 A;  1HJW A;  3IKG A;  4HAR A;  2ESC A;  4DIP A;  3O5D A;  4LAV A;  3O5P A;  1EIB A;  3AS1 A;  2M2A A;  3O5G A;  4FAP A;  2DT0 A;  3IHZ A;  5DO2 A;  3TC5 A;  1JNS A;  4J4N A;  1E6N A;  1LJY A;  3CHE A;  1D2K A;  4HBO A;  1NH6 A;  1J6Y A;  2XP4 A;  3O5F A;  3O5J A;  4ODM A;  3ARW A;  1ROT A;  1W26 A;  4P8W A;  3UI5 A;  3B9D A;  1LL6 A;  1W1Y A;  1GRJ A;  1JCH B;  1TFV A;  1VF8 A;  1KT1 A;  2O9O A;  4NZC A;  2KO7 A;  3ARU A;  2F2D A;  3B9A A;  1E44 A;  3KCE A;  4DRQ A;  2ZQU A;  2PN0 A;  4GIV A;  3H9R B;  4HBE A;  2G41 A;  3CHF A;  3RGC A;  1ZK6 A;  3UQB A;  3O5O A;  3QOK A;  2PPO A;  5DEZ A;  1W1T A;  2XP8 A;  2F23 A;  3GU0 A;  2Y78 A;  3FY1 A;  3ARS A;  4DRK A;  2LPV A;  1Q6U A;  2A3C A;  4KQZ A;  4MSP A;  4ZS6 A;  2ITK A;  4S3J A;  1QPL A;  3KAG A;  2LKN A;  2DSV A;  2IF4 A;  5HW7 A;  3NRK A;  2WM0 A;  4DRH A;  4C02 B;  2WLZ A;  4JFM A;  4QT2 A;  1HJV A;  2PPN A;  3RM9 A;  4DRJ A;  1GOI A;  2PV1 A;  4URI A;  3BXW A;  4LAY A;  1IX5 A;  1J4H A;  2AWG A;  3PA7 A;  3EY6 A;  4Z2G A;  3PRA A;  5DIU A;  1NWU A;  4DRO A;  3RME A;  4LGX A;  2DSW A;  2L2S A;  4WK9 A;  1FAP A;  3ARV A;  3VAW A;  2MLX A;  3FXY A;  5BXJ A;  3JYM A;  4W9O A;  4QIB A;  2WK2 A;  2RUD A;  4IPX A;  4TYO A;  1JVW A;  1BKF A;  1ZL1 A;  4Q7N A;  3WH0 A;  2B31 A;  1OWQ A;  3PRD A;  4DRP A;  1JNE A;  4Z2L A;  3TCZ A;  3PR9 A;  1J4R A;  4IQC A;  2RSE A;  1LL7 A;  1QPF A;  3JXV A;  1GUV A;  4ODN A;  1ZCN A;  4DWS D;  2AOS A;  2LGO A;  2XP6 A;  3WL1 A;  2XPB A;  2KFW A;  3IKD A;  2PV3 A;  4U85 A;  2RUQ A;  1EHN A;  1D7I A;  4NNR A;  1LQ0 A;  2XPA A;  1H0I A;  2OLH A;  1LG1 A;  1W1P A;  2DG3 A;  2DSZ A;  3KAB A;  1HKM A;  1UR8 A;  4MAV A;  1HXV A;  1P5Q A;  1BL4 A;  4TX0 A;  1FJD A;  4FN2 A;  3WD3 A;  1FD9 A;  3RFW A;  1NWR A;  4TW7 A;  1E6P A;  4WKF A;  1UR9 A;  2ZQS A;  4JFJ A;  3WD0 A;  2ZQV A;  1FKF A;  1FKS A;  2PBC A;  3ALG A;  1W1V A;  4R0X A;  2DT2 A;  1GPF A;  1ZU8 A;  1F8A B;  5HUA A;  2PI6 A;  3GPK A;  4TW6 A;  1LL4 A;  4P8V A;  1NWS A;  1OGG A;  1ITX A;  3ARY A;  2XP5 A;  4DWS C;  4ZPT R;  3B9E A;  3O5E A;  1E6R A;  2DG9 A;  4G2P A;  4QZV B;  5JH8 A;  3O5M A;  4ITZ A;  3RM4 A;  4U84 A;  2ETN A;  2MPH A;  3CGN A;  3AS3 A;  4L72 B;  1HKI A;  5D75 A;  5J6E A;  1E15 A;  4ZPV R;  4DWS A;  1FKK A;  1RD6 A;  4ODK A;  2RQS A;  3WD1 A;  3WD2 A;  3OA5 A;  3O5K A;  3MDY B;  4ODL A;  2F4E A;  3WKZ A;  1FKJ A;  3TDB A;  4DRM A;  1XHG A;  1NMV A;  3NTP A;  1NMW A;  2DT1 A;  3B8S A;  4WIW A;  3I6C A;  2FDM A;  2MLZ A;  5GQB A;  1NSG A;  2VCD A;  3KAD A;  5HT1 A;  4IQ2 A;  5GPG A;  4PTM A;  1SR0 A;  2A3A A;  2JZV A;  4KR0 B;  1QZ2 A;  3ART A;  4JFI A;  4JFK A;  3WL0 A;  1XRV A;  3ARX A;  1SYT A;  3EIP A;  4ODO A;  3ALF A;  5HW8 A;  1KT0 A;  3WD4 A;  1HKJ A;  5DIT A;  3PRB A;  4IT4 A;  1FKB A;  2MLY A;  2F21 A;  3CH9 A;  1Q6I A;  1FKL A;  1H0G A;  1CTN A;  4N19 A;  2VN1 A;  3IK8 A;  2D9F A;  1FFQ A;  1K9T A;  2ZQT A;  1EQ3 A;  2FKE A;  3O5L A;  2M08 A;  1N1A A;  1M5Y A;  2MNT A;  4U86 A;  1YAT A;  2ZR4 A;  2KR7 A;  1WB0 A;  3G6L A;  1ZBK A;  4DWS B;  2G8Z A;  1B6C A;  4ODP A;  1T11 A;  3OOB A;  4TNS A;  4Z2I A;  4DZ3 A;  3ARZ A;  4P8X A;  1FKR A;  1FFR A;  3GTY X;  4J4O A;  2PPP A;  2DPE A;  5GPR A;  1FKH A;  4W5U A;  4P8U A;  2K8I A;  4MPK A;  3JYJ A;  2M1I A;  3CHC A;  2XP3 A;  4MNK A;  4DT4 A;  1FKT A;  1HJX A;  2N87 A;  3KZ7 A;  1R9H A;  4O2T A;  3UI4 A;  3ARR A;  3BMB A;  1HKK A;  1PBK A;  1X6L A;  4AY1 A;  4ZPW R;  3G6M A;  3AQU A;  4Z2H A;  3ODK A;  4G50 A;  3WQW A;  3NI6 A;  4UDM A;  1ROU A;  5HTG A;  4MNL A;  1W9V A;  5HWC A;  1ZBC A;  4DZ2 A;  3ARO A;  4DH0 A;  1ZBW A;  2ZR6 A;  3ARP A;  1D7J A;  4L3N A;  3WIJ A;  1YW5 A;  2P4V A;  1ZB5 A;  1FKD A;  2XP9 A;  4WKH A;  4QT3 A;  1EDQ A;  2DSU A;  1D6O A;  5B8I C;  1F40 A;  1WNO A;  4DRI A;  2UZ5 A;  4ODR A;  1W9U A;  1Q6H A;  2FAP A;  4S3K A;  3RM8 A;  1FKI A;  4IT6 A;  2WLY A;  4ML4 A;  1E6Z A;  1Y0O A;  2XP7 A;  4W9P A;  3UQI A;  5I98 A;  1X6N A;  3FAP A;  3UI6 A;  3CZ8 A;  4Q22 A;  3AS2 A;  4WKA A;  4JFL A;  2DG4 A;  4LAW A;  1OGB A;  3KAH A;  4LAX A;  3KAC A;  1EYM A;  4GGQ A;  3W4R A; 
#chains in the Genus database with same CATH homology
 3ARQ A;  4Z2J A;  2A3E A;  1W9P A;  1NWT A;  1C9H A;  1D7H A;  2KGJ A;  3WQV A;  4JYS A;  2IUZ A;  4Z2K A;  1L1P A;  2Q5A A;  4W9Q A;  2YBU A;  3KAF A;  4WJX A;  1FKG A;  2DT3 A;  2MF9 A;  4MTV A;  2PV2 A;  4R5E A;  3O5Q A;  2A3B A;  4MGV A;  2RUR A;  1ZBV A;  1Q1C A;  2OFN A;  5HWB A;  1LG2 A;  3KAI A;  1KFW A;  2RUC A;  3AS0 A;  1TCO C;  1E9L A;  3CHD A;  4NSB A;  4XAK A;  1PIN A;  1JND A;  5HBF A;  1J4I A;  4BF8 A;  1JNT A;  1O6I A;  5DF0 A;  2QF8 A;  3LUO A;  2LJ4 A;  4TW8 A;  1A7X A;  2YBT A;  2KE0 A;  2KI3 A;  3UF8 A;  4MNM A;  3O5R A;  4DRN A;  1WAW A;  3B7X A;  5HW6 A;  5HKG A;  5DIV A;  3O5I A;  3UQA A;  3CGM A;  1U79 A;  4MNJ A;  4ODQ A;  2O92 A;  2ZR5 A;  1HJW A;  3IKG A;  4HAR A;  2ESC A;  4DIP A;  3O5D A;  4LAV A;  3O5P A;  1EIB A;  3AS1 A;  2M2A A;  3O5G A;  4FAP A;  2DT0 A;  3IHZ A;  5DO2 A;  3TC5 A;  1JNS A;  4J4N A;  1E6N A;  1LJY A;  3CHE A;  1D2K A;  4HBO A;  1NH6 A;  1J6Y A;  2XP4 A;  3O5F A;  3O5J A;  4ODM A;  3ARW A;  1ROT A;  1W26 A;  4P8W A;  3UI5 A;  3B9D A;  1LL6 A;  1W1Y A;  1TFV A;  1VF8 A;  1KT1 A;  2O9O A;  4NZC A;  2KO7 A;  3ARU A;  2F2D A;  3B9A A;  3KCE A;  4DRQ A;  2ZQU A;  4GIV A;  3H9R B;  4HBE A;  2G41 A;  3CHF A;  3RGC A;  1ZK6 A;  3UQB A;  3O5O A;  3QOK A;  2PPO A;  5DEZ A;  1W1T A;  2XP8 A;  2Y78 A;  3FY1 A;  3ARS A;  4DRK A;  2LPV A;  1Q6U A;  2A3C A;  4KQZ A;  4MSP A;  4ZS6 A;  2ITK A;  4S3J A;  1QPL A;  3KAG A;  2LKN A;  2DSV A;  2IF4 A;  5HW7 A;  3NRK A;  2WM0 A;  4DRH A;  4C02 B;  2WLZ A;  4JFM A;  4QT2 A;  1HJV A;  2PPN A;  3RM9 A;  4DRJ A;  1GOI A;  2PV1 A;  4URI A;  3BXW A;  4LAY A;  1IX5 A;  1J4H A;  2AWG A;  3PA7 A;  3EY6 A;  4Z2G A;  3PRA A;  5DIU A;  1NWU A;  4DRO A;  3RME A;  4LGX A;  2DSW A;  2L2S A;  4WK9 A;  1FAP A;  3ARV A;  3VAW A;  2MLX A;  3FXY A;  5BXJ A;  3JYM A;  4W9O A;  4QIB A;  2WK2 A;  2RUD A;  4IPX A;  4TYO A;  1JVW A;  1BKF A;  1ZL1 A;  4Q7N A;  3WH0 A;  2B31 A;  1OWQ A;  3PRD A;  4DRP A;  1JNE A;  4Z2L A;  3TCZ A;  3PR9 A;  1J4R A;  4IQC A;  2RSE A;  1LL7 A;  1QPF A;  3JXV A;  1GUV A;  4ODN A;  1ZCN A;  4DWS D;  2AOS A;  2LGO A;  2XP6 A;  3WL1 A;  2XPB A;  2KFW A;  3IKD A;  2PV3 A;  4U85 A;  2RUQ A;  1EHN A;  1D7I A;  4NNR A;  1LQ0 A;  2XPA A;  1H0I A;  2OLH A;  1LG1 A;  1W1P A;  2DG3 A;  2DSZ A;  3KAB A;  1HKM A;  1UR8 A;  4MAV A;  1HXV A;  1P5Q A;  1BL4 A;  4TX0 A;  1FJD A;  4FN2 A;  3WD3 A;  1FD9 A;  3RFW A;  1NWR A;  4TW7 A;  1E6P A;  4WKF A;  1UR9 A;  2ZQS A;  4JFJ A;  3WD0 A;  2ZQV A;  1FKF A;  1FKS A;  2PBC A;  3ALG A;  1W1V A;  4R0X A;  2DT2 A;  1GPF A;  1ZU8 A;  1F8A B;  5HUA A;  2PI6 A;  3GPK A;  4TW6 A;  1LL4 A;  4P8V A;  1NWS A;  1OGG A;  1ITX A;  3ARY A;  2XP5 A;  4DWS C;  4ZPT R;  3B9E A;  3O5E A;  1E6R A;  2DG9 A;  4G2P A;  4QZV B;  5JH8 A;  3O5M A;  4ITZ A;  3RM4 A;  4U84 A;  2MPH A;  3CGN A;  3AS3 A;  4L72 B;  1HKI A;  5D75 A;  5J6E A;  1E15 A;  4ZPV R;  4DWS A;  1FKK A;  1RD6 A;  4ODK A;  2RQS A;  3WD1 A;  3WD2 A;  3OA5 A;  3O5K A;  3MDY B;  4ODL A;  2F4E A;  3WKZ A;  1FKJ A;  3TDB A;  4DRM A;  1XHG A;  1NMV A;  3NTP A;  1NMW A;  2DT1 A;  3B8S A;  4WIW A;  3I6C A;  2FDM A;  2MLZ A;  5GQB A;  1NSG A;  2VCD A;  3KAD A;  5HT1 A;  4IQ2 A;  5GPG A;  4PTM A;  1SR0 A;  2A3A A;  2JZV A;  4KR0 B;  1QZ2 A;  3ART A;  4JFI A;  4JFK A;  3WL0 A;  1XRV A;  3ARX A;  1SYT A;  4ODO A;  3ALF A;  5HW8 A;  1KT0 A;  3WD4 A;  1HKJ A;  5DIT A;  4IT4 A;  3PRB A;  1FKB A;  2MLY A;  2F21 A;  3CH9 A;  1Q6I A;  1FKL A;  1H0G A;  1CTN A;  4N19 A;  2VN1 A;  3IK8 A;  2D9F A;  1FFQ A;  1K9T A;  2ZQT A;  1EQ3 A;  2FKE A;  3O5L A;  2M08 A;  1N1A A;  1M5Y A;  2MNT A;  4U86 A;  1YAT A;  2ZR4 A;  2KR7 A;  1WB0 A;  3G6L A;  1ZBK A;  4DWS B;  2G8Z A;  1B6C A;  4ODP A;  1T11 A;  3OOB A;  4TNS A;  4Z2I A;  4DZ3 A;  3ARZ A;  4P8X A;  1FKR A;  1FFR A;  4J4O A;  2PPP A;  2DPE A;  5GPR A;  1FKH A;  4W5U A;  4P8U A;  2K8I A;  4MPK A;  3JYJ A;  2M1I A;  3CHC A;  2XP3 A;  4MNK A;  4DT4 A;  1FKT A;  1HJX A;  2N87 A;  3KZ7 A;  1R9H A;  4O2T A;  3UI4 A;  3ARR A;  1HKK A;  1PBK A;  1X6L A;  4AY1 A;  4ZPW R;  3G6M A;  3AQU A;  4Z2H A;  3ODK A;  4G50 A;  3WQW A;  3NI6 A;  1ROU A;  5HTG A;  4MNL A;  1W9V A;  5HWC A;  1ZBC A;  4DZ2 A;  3ARO A;  4DH0 A;  1ZBW A;  2ZR6 A;  3ARP A;  1D7J A;  4L3N A;  3WIJ A;  1YW5 A;  1ZB5 A;  1FKD A;  2XP9 A;  4WKH A;  4QT3 A;  1EDQ A;  2DSU A;  1D6O A;  5B8I C;  1F40 A;  1WNO A;  4DRI A;  2UZ5 A;  4ODR A;  1W9U A;  1Q6H A;  2FAP A;  4S3K A;  3RM8 A;  1FKI A;  4IT6 A;  2WLY A;  4ML4 A;  1E6Z A;  1Y0O A;  2XP7 A;  4W9P A;  3UQI A;  5I98 A;  1X6N A;  3FAP A;  3UI6 A;  3CZ8 A;  4Q22 A;  3AS2 A;  4WKA A;  4JFL A;  2DG4 A;  4LAW A;  1OGB A;  3KAH A;  4LAX A;  3KAC A;  1EYM A;  4GGQ A;  3W4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...