1ROUA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP59-I
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Rotamase (isomerase)
total genus 25
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rouA00
1EYMA 2XPAA 4TNSA 1D7HA 1J4RA 1R9HA 3MDYB 2PV1A 5GPGA 2VN1A 4W9PA 4DZ3A 5HUAA 2L2SA 2MF9A 1BL4A 4JFMA 4U85A 4TW6A 4DRQA 3NRKA 1ROUA 2KI3A 4FN2A 5DIVA 3ODKA 1YW5A 1M5YA 4O2TA 2MNTA 1FAPA 2XP3A 4ITZA 4JFKA 4MGVA 2DG4A 2PPPA 3O5JA 4W9QA 3KAHA 1P5QA 2XP8A 4DH0A 2ZR6A 2PPOA 2KGJA 1A7XA 2ZR4A 3UI6A 3RGCA 2RQSA 3TCZA 1D7IA 4DRJA 3H9RB 1BKFA 3TDBA 2XP7A 5D75A 4BF8A 2KR7A 4ODPA 5I98A 2FKEA 1F40A 3KZ7A 4ODRA 2RUQA 3UF8A 2MLZA 3O5GA 4QIBA 2PPNA 3KACA 2XP5A 5HTGA 5HW8A 3KAFA 4TX0A 4W9OA 1KT0A 1N1AA 1NMWA 2DG9A 3JXVA 3PA7A 2F21A 2LJ4A 5DIUA 1FD9A 2KE0A 2XP4A 4DRHA 3O5QA 3CGNA 1ZK6A 1J4IA 2VCDA 2F4EA 1FKJA 3I6CA 3IK8A 4N19A 2F2DA 4JFJA 4U84A 3UI4A 1JNTA 4ODMA 1FKFA 2LGOA 3O5KA 1F8AB 2IF4A 1Q6UA 1Q6HA 4G2PA 4GGQA 4QT3A 4TYOA 1L1PA 1NSGA 2ZQTA 4JFIA 1HXVA 2DG3A 4IQ2A 1NMVA 2RURA 4DRNA 4DT4A 4TW7A 3IKGA 3UQAA 1JNSA 2RUCA 3EY6A 4LAXA 4DRMA 1FJDA 3IHZA 4JFLA 5B8IC 1FKGA 1B6CA 3OOBA 1J4HA 5DITA 5HKGA 1KT1A 1U79A 2ZR5A 3JYMA 4QT2A 3O5PA 2M2AA 3RFWA 2UZ5A 1ROTA 4ODKA 2JZVA 2LKNA 4ODQA 3PRBA 3UI5A 4ODLA 5HWBA 4G50A 4J4OA 3O5LA 1PBKA 2PBCA 4JYSA 3O5RA 4DRPA 3NTPA 2Q5AA 4FAPA 4NNRA 1FKRA 4IQCA 3IKDA 1ZCNA 2MPHA 4DROA 4LAYA 2KO7A 5HW7A 2M1IA 1FKBA 3KAIA 1EQ3A 4DZ2A 2D9FA 3GPKA 1Q1CA 1C9HA 3LUOA 2AWGA 2MLYA 3FAPA 3KADA 1FKLA 2ZQUA 1Q6IA 3KABA 4IPXA 2XP6A 4LAVA 2ZQSA 3WH0A 1J6YA 2K8IA 3UQBA 2LPVA 1JVWA 2KFWA 4C02B 3O5OA 1FKDA 1QPFA 2N87A 1Y0OA 3TC5A 2PV3A 3KCEA 3O5DA 5HW6A 4ODOA 2FAPA 1QZ2A 2RUDA 1W26A 1FKSA 2ZQVA 3KAGA 3NI6A 3CGMA 4DRKA 5HWCA 3O5MA 4GIVA 4R0XA 4DRIA 5J6EA 4MSPA 3UQIA 3O5IA 1TCOC 5HT1A 3O5EA 2OFNA 1FKIA 2Y78A 5BXJA 1FKTA 2XP9A 1D6OA 1FKKA 2PV2A 3O5FA 4LAWA 1QPLA 2M08A 3B7XA 4J4NA 4U86A 4TW8A 2ITKA 1T11A 1PINA 3JYJA 3VAWA 4ODNA 1YATA 2RSEA 2XPBA 4DIPA 3PRDA 1FKHA 2MLXA 1D7JA
chains in the Genus database with same CATH superfamily
1EYMA 1NWTA 2XPAA 1D7HA 3MDYB 2IUZA 1OGGA 2L2SA 4JFMA 1W9PA 4KR0B 5GQBA 4L72B 1M5YA 4O2TA 1FAPA 2F23A 4XAKA 4JFKA 2PPPA 2ZR6A 3CHFA 3UI6A 3TCZA 1BKFA 3TDBA 4QZVB 3CZ8A 1K9TA 1F40A 2O9OA 2YBUA 2MLZA 3O5GA 3ARTA 2B31A 1JCHB 4TX0A 1NH6A 4MNKA 1KT0A 2DG9A 3JXVA 2DT0A 4Z2LA 1FD9A 2F4EA 1FKJA 3I6CA 3IK8A 4N19A 3ARZA 1CTNA 1WNOA 4ODMA 3O5KA 2IF4A 3RMEA 1Q6UA 4MNMA 2DG3A 4S3JA 4DRNA 4HARA 1JNSA 3UQAA 4DRMA 3RM8A 2EULA 1UR8A 2DT1A 3OOBA 1U79A 2G41A 2M2AA 1ZBKA 2DSWA 2ESCA 4ODKA 3UI5A 5HWBA 1PBKA 4MNLA 3NTPA 3ALGA 1EIBA 1GUVA 1W1VA 4DROA 2M1IA 1LG2A 1WAWA 1EQ3A 3BXWA 1NWUA 2D9FA 1C9HA 2DPEA 3FAPA 1FKLA 2ZQSA 3UQBA 4UDMA 2KFWA 4C02B 1FKDA 2PV3A 1ZBWA 5HW6A 4ODOA 4MNJA 1QZ2A 2ZQVA 4NZCA 1FKSA 5HWCA 3ARPA 2WLYA 3WD4A 4R0XA 3BMBA 4MSPA 3UQIA 1ZBVA 3AS3A 5GPRA 3ARQA 2OFNA 2G8ZA 1KFWA 1FKIA 4LGXA 1ZU8A 1D6OA 4Z2KA 3G6LA 1YATA 4WKAA 2O92A 1H0GA 2A3EA 4TNSA 3OA5A 1W1PA 5HUAA 4U85A 4Z2HA 1W1YA 3NRKA 4ZPWR 2KI3A 3ARUA 3O5JA 4ML4A 1P5QA 4DH0A 3RGCA 4DRJA 3H9RB 2FKEA 3KZ7A 2RUQA 2WM0A 3ARXA 4QIBA 3KACA 2XP5A 4W5UA 3KAFA 4W9OA 3PA7A 1FJDA 2F21A 2LJ4A 4HBEA 3CGNA 1ZK6A 2VCDA 2FDMA 2F2DA 3CH9A 1FFRA 4U84A 3UI4A 1JNTA 1HKIA 3GTYX 1FKFA 4WKHA 1VF8A 1F8AB 3AROA 4QT3A 1Q6HA 4G2PA 4WK9A 1NSGA 1JNEA 4TW7A 1SR0A 2RUCA 3EY6A 4LAXA 3B8SA 3IHZA 1EDQA 5B8IC 4ZS6A 1FKGA 2P4VA 1KT1A 1ZB5A 2OLHA 3O5PA 3ARYA 3ARWA 2QF8A 1IX5A 3AS2A 3B9EA 4J4OA 3O5LA 4DRPA 4Z2GA 1W9VA 3WD1A 3CHCA 4IQCA 2MPHA 4LAYA 2KO7A 1FKBA 2YBTA 4DZ2A 3GPKA 1Q1CA 3LUOA 2MLYA 1W1TA 1Q6IA 4IPXA 2XP6A 1E44A 1J6YA 3WH0A 2K8IA 1JVWA 3O5OA 1E6RA 2A3AA 3TC5A 2A3CA 4ZPTR 1ITXA 3FXYA 1LG1A 2FAPA 2RUDA 3KAGA 3W4RA 3WD0A 1FFQA 4GIVA 1OGBA 5BXJA 3FY1A 3CHEA 3B9AA 4U86A 4J4NA 2PN0A 4TW8A 2ITKA 3VAWA 2RSEA 4DWSA 4DIPA 1D7JA 2DSZA 1E6PA 1ZBCA 3WKZA 2PV1A 1X6NA 1BL4A 4DRQA 4FN2A 2B5UB 4DWSD 5DIVA 3ODKA 1YW5A 3AQUA 4R5EA 4MPKA 4MGVA 3KAHA 3WQVA 1LQ0A 2XP8A 4WIWA 2PPOA 2ZR4A 1A7XA 2RQSA 1E9LA 1D7IA 4Q7NA 4ODPA 5I98A 1GPFA 4ODRA 3WIJA 4HBOA 5HTGA 1EHNA 1LJYA 1W9UA 2PPNA 4L3NA 1XHGA 1LL6A 5HBFA 1NMWA 1H0IA 3ARSA 3WQWA 1GRJA 4AY1A 4WKFA 1X6LA 4KQZA 3G6MA 1HJVA 2LGOA 1GOIA 1L1PA 2DT3A 3WL1A 4JFIA 4Q22A 1NWRA 1TFVA 1E15A 2DSVA 4IQ2A 1NMVA 2RURA 4DT4A 3IKGA 2PI6A 1B6CA 5HKGA 3JYMA 3RFWA 2UZ5A 2JZVA 2LKNA 4ODQA 1JNDA 1LL4A 3PRBA 4DWSB 4Z2IA 4MTVA 4G50A 4FAPA 3O5RA 4PTMA 2Q5AA 4ZPVR 3PRAA 2DSUA 3IKDA 1ZCNA 4WJXA 3KADA 4DWSC 4P8WA 3KABA 1HKKA 1HJXA 1UR9A 2LPVA 3B9DA 2N87A 3AS1A 4DRKA 4DRIA 1ZL1A 3GU0A 3RM9A 1TCOC 1HJWA 1HKMA 1FKKA 1QPLA 2M08A 3B7XA 4P8XA 2ETNA 1FKHA 4QT2A 1O6IA 1J4RA 1R9HA 5GPGA 2VN1A 4W9PA 4DZ3A 2MF9A 4TW6A 1ROUA 2MNTA 2XP3A 4ITZA 2DG4A 4W9QA 4NSBA 3ALFA 1RD6A 2KGJA 2XP7A 1XRVA 5D75A 1E6ZA 4BF8A 2KR7A 3UF8A 4IT4A 5HW8A 1N1AA 5DIUA 3ARRA 2KE0A 2XP4A 4DRHA 3O5QA 1J4IA 5DF0A 4JFJA 4P8UA 1E6NA 5DEZA 4GGQA 4TYOA 1SYTA 2ZQTA 5DO2A 1HXVA 4Z2JA 4P8VA 2WK2A 3EIPA 4JFLA 3WL0A 3WD3A 1J4HA 5DITA 1LL7A 2ZR5A 2WLZA 1ROTA 3QOKA 3RM4A 2AOSA 4S3KA 3AS0A 4ODLA 4JYSA 2PBCA 3ARVA 4NNRA 1FKRA 5HW7A 1OWQA 3KAIA 2AWGA 2ZQUA 4LAVA 1D2KA 1QPFA 1Y0OA 4IT6A 2DT2A 2A3BA 3KCEA 4MAVA 3O5DA 3NI6A 1W26A 3CGMA 3PR9A 3O5MA 5J6EA 3O5IA 1NWSA 5HT1A 3O5EA 4URIA 2Y78A 1FKTA 2XP9A 2PV2A 3O5FA 4LAWA 1WB0A 1T11A 1PINA 1HKJA 3JYJA 3WD2A 4ODNA 2XPBA 3CHDA 3PRDA 2MLXA 5JH8A
chains in the Genus database with same CATH topology
1EYMA 1NWTA 2XPAA 1D7HA 3MDYB 2IUZA 1OGGA 2L2SA 4JFMA 1W9PA 4KR0B 5GQBA 4L72B 1M5YA 4O2TA 1FAPA 4XAKA 4JFKA 2PPPA 2ZR6A 3CHFA 3UI6A 3TCZA 1BKFA 3TDBA 4QZVB 3CZ8A 1K9TA 1F40A 2O9OA 2YBUA 2MLZA 3O5GA 3ARTA 2B31A 4TX0A 1NH6A 4MNKA 1KT0A 2DG9A 3JXVA 2DT0A 4Z2LA 1FD9A 2F4EA 1FKJA 3I6CA 3IK8A 4N19A 3ARZA 1CTNA 1WNOA 4ODMA 3O5KA 2IF4A 3RMEA 1Q6UA 4MNMA 2DG3A 4S3JA 4DRNA 4HARA 1JNSA 3UQAA 4DRMA 3RM8A 1UR8A 2DT1A 3OOBA 1U79A 2G41A 2M2AA 1ZBKA 2DSWA 2ESCA 4ODKA 3UI5A 5HWBA 1PBKA 4MNLA 3NTPA 3ALGA 1EIBA 1GUVA 1W1VA 4DROA 2M1IA 1LG2A 1WAWA 1EQ3A 3BXWA 1NWUA 2D9FA 1C9HA 2DPEA 3FAPA 1FKLA 2ZQSA 3UQBA 2KFWA 4C02B 1FKDA 2PV3A 1ZBWA 5HW6A 4ODOA 4MNJA 1QZ2A 2ZQVA 4NZCA 1FKSA 5HWCA 3ARPA 2WLYA 3WD4A 4R0XA 4MSPA 3UQIA 1ZBVA 3AS3A 5GPRA 3ARQA 2OFNA 2G8ZA 1KFWA 1FKIA 4LGXA 1ZU8A 1D6OA 4Z2KA 3G6LA 1YATA 4WKAA 2O92A 1H0GA 2A3EA 4TNSA 3OA5A 1W1PA 5HUAA 4U85A 4Z2HA 1W1YA 3NRKA 4ZPWR 2KI3A 3ARUA 3O5JA 4ML4A 1P5QA 4DH0A 3RGCA 4DRJA 3H9RB 2FKEA 3KZ7A 2RUQA 2WM0A 3ARXA 4QIBA 3KACA 2XP5A 4W5UA 3KAFA 4W9OA 3PA7A 1FJDA 2F21A 2LJ4A 4HBEA 3CGNA 1ZK6A 2VCDA 2FDMA 2F2DA 3CH9A 1FFRA 4U84A 3UI4A 1JNTA 1HKIA 1FKFA 4WKHA 1VF8A 1F8AB 3AROA 4QT3A 1Q6HA 4G2PA 4WK9A 1NSGA 1JNEA 4TW7A 1SR0A 2RUCA 3EY6A 4LAXA 3B8SA 3IHZA 1EDQA 5B8IC 4ZS6A 1FKGA 1KT1A 1ZB5A 2OLHA 3O5PA 3ARYA 3ARWA 2QF8A 1IX5A 3AS2A 3B9EA 4J4OA 3O5LA 4DRPA 4Z2GA 1W9VA 3WD1A 3CHCA 4IQCA 2MPHA 4LAYA 2KO7A 1FKBA 2YBTA 4DZ2A 3GPKA 1Q1CA 3LUOA 2MLYA 1W1TA 1Q6IA 4IPXA 2XP6A 1J6YA 3WH0A 2K8IA 1JVWA 3O5OA 1E6RA 2A3AA 3TC5A 2A3CA 4ZPTR 1ITXA 3FXYA 1LG1A 2FAPA 2RUDA 3KAGA 3W4RA 3WD0A 1FFQA 4GIVA 1OGBA 5BXJA 3FY1A 3CHEA 3B9AA 4U86A 4J4NA 4TW8A 2ITKA 3VAWA 2RSEA 4DWSA 4DIPA 1D7JA 2DSZA 1E6PA 1ZBCA 3WKZA 2PV1A 1X6NA 1BL4A 4DRQA 4FN2A 4DWSD 5DIVA 3ODKA 1YW5A 3AQUA 4R5EA 4MPKA 4MGVA 3KAHA 3WQVA 1LQ0A 2XP8A 4WIWA 2PPOA 2ZR4A 1A7XA 2RQSA 1E9LA 1D7IA 4Q7NA 4ODPA 5I98A 1GPFA 4ODRA 3WIJA 4HBOA 5HTGA 1EHNA 1LJYA 1W9UA 2PPNA 4L3NA 1XHGA 1LL6A 5HBFA 1NMWA 1H0IA 3ARSA 3WQWA 4AY1A 4WKFA 1X6LA 4KQZA 3G6MA 1HJVA 2LGOA 1GOIA 1L1PA 2DT3A 3WL1A 4JFIA 4Q22A 1NWRA 1TFVA 1E15A 2DSVA 4IQ2A 1NMVA 2RURA 4DT4A 3IKGA 2PI6A 1B6CA 5HKGA 3JYMA 3RFWA 2UZ5A 2JZVA 2LKNA 4ODQA 1JNDA 1LL4A 3PRBA 4DWSB 4Z2IA 4MTVA 4G50A 4FAPA 3O5RA 4PTMA 2Q5AA 4ZPVR 3PRAA 2DSUA 3IKDA 1ZCNA 4WJXA 3KADA 4DWSC 4P8WA 3KABA 1HKKA 1HJXA 1UR9A 2LPVA 3B9DA 2N87A 3AS1A 4DRKA 4DRIA 1ZL1A 3RM9A 1TCOC 1HJWA 1HKMA 1FKKA 1QPLA 2M08A 3B7XA 4P8XA 1FKHA 4QT2A 1O6IA 1J4RA 1R9HA 5GPGA 2VN1A 4W9PA 4DZ3A 2MF9A 4TW6A 1ROUA 2MNTA 2XP3A 4ITZA 2DG4A 4W9QA 4NSBA 3ALFA 1RD6A 2KGJA 2XP7A 1XRVA 5D75A 1E6ZA 4BF8A 2KR7A 3UF8A 4IT4A 5HW8A 1N1AA 5DIUA 3ARRA 2KE0A 2XP4A 4DRHA 3O5QA 1J4IA 5DF0A 4JFJA 4P8UA 1E6NA 5DEZA 4GGQA 4TYOA 1SYTA 2ZQTA 5DO2A 1HXVA 4Z2JA 4P8VA 2WK2A 4JFLA 3WL0A 3WD3A 1J4HA 5DITA 1LL7A 2ZR5A 2WLZA 1ROTA 3QOKA 3RM4A 2AOSA 4S3KA 3AS0A 4ODLA 4JYSA 2PBCA 3ARVA 4NNRA 1FKRA 5HW7A 1OWQA 3KAIA 2AWGA 2ZQUA 4LAVA 1D2KA 1QPFA 1Y0OA 4IT6A 2DT2A 2A3BA 3KCEA 4MAVA 3O5DA 3NI6A 1W26A 3CGMA 3PR9A 3O5MA 5J6EA 3O5IA 1NWSA 5HT1A 3O5EA 4URIA 2Y78A 1FKTA 2XP9A 2PV2A 3O5FA 4LAWA 1WB0A 1T11A 1PINA 1HKJA 3JYJA 3WD2A 4ODNA 2XPBA 3CHDA 3PRDA 2MLXA 5JH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYM A;  2XPA A;  4TNS A;  1D7H A;  1J4R A;  1R9H A;  3MDY B;  2PV1 A;  5GPG A;  2VN1 A;  4W9P A;  4DZ3 A;  5HUA A;  2L2S A;  2MF9 A;  1BL4 A;  4JFM A;  4U85 A;  4TW6 A;  4DRQ A;  3NRK A;  1ROU A;  2KI3 A;  4FN2 A;  5DIV A;  3ODK A;  1YW5 A;  1M5Y A;  4O2T A;  2MNT A;  1FAP A;  2XP3 A;  4ITZ A;  4JFK A;  4MGV A;  2DG4 A;  2PPP A;  3O5J A;  4W9Q A;  3KAH A;  1P5Q A;  2XP8 A;  4DH0 A;  2ZR6 A;  2PPO A;  2KGJ A;  1A7X A;  2ZR4 A;  3UI6 A;  3RGC A;  2RQS A;  3TCZ A;  1D7I A;  4DRJ A;  3H9R B;  1BKF A;  3TDB A;  2XP7 A;  5D75 A;  4BF8 A;  2KR7 A;  4ODP A;  5I98 A;  2FKE A;  1F40 A;  3KZ7 A;  4ODR A;  2RUQ A;  3UF8 A;  2MLZ A;  3O5G A;  4QIB A;  2PPN A;  3KAC A;  2XP5 A;  5HTG A;  5HW8 A;  3KAF A;  4TX0 A;  4W9O A;  1KT0 A;  1N1A A;  1NMW A;  2DG9 A;  3JXV A;  3PA7 A;  2F21 A;  2LJ4 A;  5DIU A;  1FD9 A;  2KE0 A;  2XP4 A;  4DRH A;  3O5Q A;  3CGN A;  1ZK6 A;  1J4I A;  2VCD A;  2F4E A;  1FKJ A;  3I6C A;  3IK8 A;  4N19 A;  2F2D A;  4JFJ A;  4U84 A;  3UI4 A;  1JNT A;  4ODM A;  1FKF A;  2LGO A;  3O5K A;  1F8A B;  2IF4 A;  1Q6U A;  1Q6H A;  4G2P A;  4GGQ A;  4QT3 A;  4TYO A;  1L1P A;  1NSG A;  2ZQT A;  4JFI A;  1HXV A;  2DG3 A;  4IQ2 A;  1NMV A;  2RUR A;  4DRN A;  4DT4 A;  4TW7 A;  3IKG A;  3UQA A;  1JNS A;  2RUC A;  3EY6 A;  4LAX A;  4DRM A;  1FJD A;  3IHZ A;  4JFL A;  5B8I C;  1FKG A;  1B6C A;  3OOB A;  1J4H A;  5DIT A;  5HKG A;  1KT1 A;  1U79 A;  2ZR5 A;  3JYM A;  4QT2 A;  3O5P A;  2M2A A;  3RFW A;  2UZ5 A;  1ROT A;  4ODK A;  2JZV A;  2LKN A;  4ODQ A;  3PRB A;  3UI5 A;  4ODL A;  5HWB A;  4G50 A;  4J4O A;  3O5L A;  1PBK A;  2PBC A;  4JYS A;  3O5R A;  4DRP A;  3NTP A;  2Q5A A;  4FAP A;  4NNR A;  1FKR A;  4IQC A;  3IKD A;  1ZCN A;  2MPH A;  4DRO A;  4LAY A;  2KO7 A;  5HW7 A;  2M1I A;  1FKB A;  3KAI A;  1EQ3 A;  4DZ2 A;  2D9F A;  3GPK A;  1Q1C A;  1C9H A;  3LUO A;  2AWG A;  2MLY A;  3FAP A;  3KAD A;  1FKL A;  2ZQU A;  1Q6I A;  3KAB A;  4IPX A;  2XP6 A;  4LAV A;  2ZQS A;  3WH0 A;  1J6Y A;  2K8I A;  3UQB A;  2LPV A;  1JVW A;  2KFW A;  4C02 B;  3O5O A;  1FKD A;  1QPF A;  2N87 A;  1Y0O A;  3TC5 A;  2PV3 A;  3KCE A;  3O5D A;  5HW6 A;  4ODO A;  2FAP A;  1QZ2 A;  2RUD A;  1W26 A;  1FKS A;  2ZQV A;  3KAG A;  3NI6 A;  3CGM A;  4DRK A;  5HWC A;  3O5M A;  4GIV A;  4R0X A;  4DRI A;  5J6E A;  4MSP A;  3UQI A;  3O5I A;  1TCO C;  5HT1 A;  3O5E A;  2OFN A;  1FKI A;  2Y78 A;  5BXJ A;  1FKT A;  2XP9 A;  1D6O A;  1FKK A;  2PV2 A;  3O5F A;  4LAW A;  1QPL A;  2M08 A;  3B7X A;  4J4N A;  4U86 A;  4TW8 A;  2ITK A;  1T11 A;  1PIN A;  3JYJ A;  3VAW A;  4ODN A;  1YAT A;  2RSE A;  2XPB A;  4DIP A;  3PRD A;  1FKH A;  2MLX A;  1D7J A; 
#chains in the Genus database with same CATH topology
 1EYM A;  1NWT A;  2XPA A;  1D7H A;  3MDY B;  2IUZ A;  1OGG A;  2L2S A;  4JFM A;  1W9P A;  4KR0 B;  5GQB A;  4L72 B;  1M5Y A;  4O2T A;  1FAP A;  2F23 A;  4XAK A;  4JFK A;  2PPP A;  2ZR6 A;  3CHF A;  3UI6 A;  3TCZ A;  1BKF A;  3TDB A;  4QZV B;  3CZ8 A;  1K9T A;  1F40 A;  2O9O A;  2YBU A;  2MLZ A;  3O5G A;  3ART A;  2B31 A;  1JCH B;  4TX0 A;  1NH6 A;  4MNK A;  1KT0 A;  2DG9 A;  3JXV A;  2DT0 A;  4Z2L A;  1FD9 A;  2F4E A;  1FKJ A;  3I6C A;  3IK8 A;  4N19 A;  3ARZ A;  1CTN A;  1WNO A;  4ODM A;  3O5K A;  2IF4 A;  3RME A;  1Q6U A;  4MNM A;  2DG3 A;  4S3J A;  4DRN A;  4HAR A;  1JNS A;  3UQA A;  4DRM A;  3RM8 A;  2EUL A;  1UR8 A;  2DT1 A;  3OOB A;  1U79 A;  2G41 A;  2M2A A;  1ZBK A;  2DSW A;  2ESC A;  4ODK A;  3UI5 A;  5HWB A;  1PBK A;  4MNL A;  3NTP A;  3ALG A;  1EIB A;  1GUV A;  1W1V A;  4DRO A;  2M1I A;  1LG2 A;  1WAW A;  1EQ3 A;  3BXW A;  1NWU A;  2D9F A;  1C9H A;  2DPE A;  3FAP A;  1FKL A;  2ZQS A;  3UQB A;  4UDM A;  2KFW A;  4C02 B;  1FKD A;  2PV3 A;  1ZBW A;  5HW6 A;  4ODO A;  4MNJ A;  1QZ2 A;  2ZQV A;  4NZC A;  1FKS A;  5HWC A;  3ARP A;  2WLY A;  3WD4 A;  4R0X A;  3BMB A;  4MSP A;  3UQI A;  1ZBV A;  3AS3 A;  5GPR A;  3ARQ A;  2OFN A;  2G8Z A;  1KFW A;  1FKI A;  4LGX A;  1ZU8 A;  1D6O A;  4Z2K A;  3G6L A;  1YAT A;  4WKA A;  2O92 A;  1H0G A;  2A3E A;  4TNS A;  3OA5 A;  1W1P A;  5HUA A;  4U85 A;  4Z2H A;  1W1Y A;  3NRK A;  4ZPW R;  2KI3 A;  3ARU A;  3O5J A;  4ML4 A;  1P5Q A;  4DH0 A;  3RGC A;  4DRJ A;  3H9R B;  2FKE A;  3KZ7 A;  2RUQ A;  2WM0 A;  3ARX A;  4QIB A;  3KAC A;  2XP5 A;  4W5U A;  3KAF A;  4W9O A;  3PA7 A;  1FJD A;  2F21 A;  2LJ4 A;  4HBE A;  3CGN A;  1ZK6 A;  2VCD A;  2FDM A;  2F2D A;  3CH9 A;  1FFR A;  4U84 A;  3UI4 A;  1JNT A;  1HKI A;  3GTY X;  1FKF A;  4WKH A;  1VF8 A;  1F8A B;  3ARO A;  4QT3 A;  1Q6H A;  4G2P A;  4WK9 A;  1NSG A;  1JNE A;  4TW7 A;  1SR0 A;  2RUC A;  3EY6 A;  4LAX A;  3B8S A;  3IHZ A;  1EDQ A;  5B8I C;  4ZS6 A;  1FKG A;  2P4V A;  1KT1 A;  1ZB5 A;  2OLH A;  3O5P A;  3ARY A;  3ARW A;  2QF8 A;  1IX5 A;  3AS2 A;  3B9E A;  4J4O A;  3O5L A;  4DRP A;  4Z2G A;  1W9V A;  3WD1 A;  3CHC A;  4IQC A;  2MPH A;  4LAY A;  2KO7 A;  1FKB A;  2YBT A;  4DZ2 A;  3GPK A;  1Q1C A;  3LUO A;  2MLY A;  1W1T A;  1Q6I A;  4IPX A;  2XP6 A;  1E44 A;  1J6Y A;  3WH0 A;  2K8I A;  1JVW A;  3O5O A;  1E6R A;  2A3A A;  3TC5 A;  2A3C A;  4ZPT R;  1ITX A;  3FXY A;  1LG1 A;  2FAP A;  2RUD A;  3KAG A;  3W4R A;  3WD0 A;  1FFQ A;  4GIV A;  1OGB A;  5BXJ A;  3FY1 A;  3CHE A;  3B9A A;  4U86 A;  4J4N A;  2PN0 A;  4TW8 A;  2ITK A;  3VAW A;  2RSE A;  4DWS A;  4DIP A;  1D7J A;  2DSZ A;  1E6P A;  1ZBC A;  3WKZ A;  2PV1 A;  1X6N A;  1BL4 A;  4DRQ A;  4FN2 A;  2B5U B;  4DWS D;  5DIV A;  3ODK A;  1YW5 A;  3AQU A;  4R5E A;  4MPK A;  4MGV A;  3KAH A;  3WQV A;  1LQ0 A;  2XP8 A;  4WIW A;  2PPO A;  2ZR4 A;  1A7X A;  2RQS A;  1E9L A;  1D7I A;  4Q7N A;  4ODP A;  5I98 A;  1GPF A;  4ODR A;  3WIJ A;  4HBO A;  5HTG A;  1EHN A;  1LJY A;  1W9U A;  2PPN A;  4L3N A;  1XHG A;  1LL6 A;  5HBF A;  1NMW A;  1H0I A;  3ARS A;  3WQW A;  1GRJ A;  4AY1 A;  4WKF A;  1X6L A;  4KQZ A;  3G6M A;  1HJV A;  2LGO A;  1GOI A;  1L1P A;  2DT3 A;  3WL1 A;  4JFI A;  4Q22 A;  1NWR A;  1TFV A;  1E15 A;  2DSV A;  4IQ2 A;  1NMV A;  2RUR A;  4DT4 A;  3IKG A;  2PI6 A;  1B6C A;  5HKG A;  3JYM A;  3RFW A;  2UZ5 A;  2JZV A;  2LKN A;  4ODQ A;  1JND A;  1LL4 A;  3PRB A;  4DWS B;  4Z2I A;  4MTV A;  4G50 A;  4FAP A;  3O5R A;  4PTM A;  2Q5A A;  4ZPV R;  3PRA A;  2DSU A;  3IKD A;  1ZCN A;  4WJX A;  3KAD A;  4DWS C;  4P8W A;  3KAB A;  1HKK A;  1HJX A;  1UR9 A;  2LPV A;  3B9D A;  2N87 A;  3AS1 A;  4DRK A;  4DRI A;  1ZL1 A;  3GU0 A;  3RM9 A;  1TCO C;  1HJW A;  1HKM A;  1FKK A;  1QPL A;  2M08 A;  3B7X A;  4P8X A;  2ETN A;  1FKH A;  4QT2 A;  1O6I A;  1J4R A;  1R9H A;  5GPG A;  2VN1 A;  4W9P A;  4DZ3 A;  2MF9 A;  4TW6 A;  1ROU A;  2MNT A;  2XP3 A;  4ITZ A;  2DG4 A;  4W9Q A;  4NSB A;  3ALF A;  1RD6 A;  2KGJ A;  2XP7 A;  1XRV A;  5D75 A;  1E6Z A;  4BF8 A;  2KR7 A;  3UF8 A;  4IT4 A;  5HW8 A;  1N1A A;  5DIU A;  3ARR A;  2KE0 A;  2XP4 A;  4DRH A;  3O5Q A;  1J4I A;  5DF0 A;  4JFJ A;  4P8U A;  1E6N A;  5DEZ A;  4GGQ A;  4TYO A;  1SYT A;  2ZQT A;  5DO2 A;  1HXV A;  4Z2J A;  4P8V A;  2WK2 A;  3EIP A;  4JFL A;  3WL0 A;  3WD3 A;  1J4H A;  5DIT A;  1LL7 A;  2ZR5 A;  2WLZ A;  1ROT A;  3QOK A;  3RM4 A;  2AOS A;  4S3K A;  3AS0 A;  4ODL A;  4JYS A;  2PBC A;  3ARV A;  4NNR A;  1FKR A;  5HW7 A;  1OWQ A;  3KAI A;  2AWG A;  2ZQU A;  4LAV A;  1D2K A;  1QPF A;  1Y0O A;  4IT6 A;  2DT2 A;  2A3B A;  3KCE A;  4MAV A;  3O5D A;  3NI6 A;  1W26 A;  3CGM A;  3PR9 A;  3O5M A;  5J6E A;  3O5I A;  1NWS A;  5HT1 A;  3O5E A;  4URI A;  2Y78 A;  1FKT A;  2XP9 A;  2PV2 A;  3O5F A;  4LAW A;  1WB0 A;  1T11 A;  1PIN A;  1HKJ A;  3JYJ A;  3WD2 A;  4ODN A;  2XPB A;  3CHD A;  3PRD A;  2MLX A;  5JH8 A; 
#chains in the Genus database with same CATH homology
 1EYM A;  1NWT A;  2XPA A;  1D7H A;  3MDY B;  2IUZ A;  1OGG A;  2L2S A;  4JFM A;  1W9P A;  4KR0 B;  5GQB A;  4L72 B;  1M5Y A;  4O2T A;  1FAP A;  4XAK A;  4JFK A;  2PPP A;  2ZR6 A;  3CHF A;  3UI6 A;  3TCZ A;  1BKF A;  3TDB A;  4QZV B;  3CZ8 A;  1K9T A;  1F40 A;  2O9O A;  2YBU A;  2MLZ A;  3O5G A;  3ART A;  2B31 A;  4TX0 A;  1NH6 A;  4MNK A;  1KT0 A;  2DG9 A;  3JXV A;  2DT0 A;  4Z2L A;  1FD9 A;  2F4E A;  1FKJ A;  3I6C A;  3IK8 A;  4N19 A;  3ARZ A;  1CTN A;  1WNO A;  4ODM A;  3O5K A;  2IF4 A;  3RME A;  1Q6U A;  4MNM A;  2DG3 A;  4S3J A;  4DRN A;  4HAR A;  1JNS A;  3UQA A;  4DRM A;  3RM8 A;  1UR8 A;  2DT1 A;  3OOB A;  1U79 A;  2G41 A;  2M2A A;  1ZBK A;  2DSW A;  2ESC A;  4ODK A;  3UI5 A;  5HWB A;  1PBK A;  4MNL A;  3NTP A;  3ALG A;  1EIB A;  1GUV A;  1W1V A;  4DRO A;  2M1I A;  1LG2 A;  1WAW A;  1EQ3 A;  3BXW A;  1NWU A;  2D9F A;  1C9H A;  2DPE A;  3FAP A;  1FKL A;  2ZQS A;  3UQB A;  2KFW A;  4C02 B;  1FKD A;  2PV3 A;  1ZBW A;  5HW6 A;  4ODO A;  4MNJ A;  1QZ2 A;  2ZQV A;  4NZC A;  1FKS A;  5HWC A;  3ARP A;  2WLY A;  3WD4 A;  4R0X A;  4MSP A;  3UQI A;  1ZBV A;  3AS3 A;  5GPR A;  3ARQ A;  2OFN A;  2G8Z A;  1KFW A;  1FKI A;  4LGX A;  1ZU8 A;  1D6O A;  4Z2K A;  3G6L A;  1YAT A;  4WKA A;  2O92 A;  1H0G A;  2A3E A;  4TNS A;  3OA5 A;  1W1P A;  5HUA A;  4U85 A;  4Z2H A;  1W1Y A;  3NRK A;  4ZPW R;  2KI3 A;  3ARU A;  3O5J A;  4ML4 A;  1P5Q A;  4DH0 A;  3RGC A;  4DRJ A;  3H9R B;  2FKE A;  3KZ7 A;  2RUQ A;  2WM0 A;  3ARX A;  4QIB A;  3KAC A;  2XP5 A;  4W5U A;  3KAF A;  4W9O A;  3PA7 A;  1FJD A;  2F21 A;  2LJ4 A;  4HBE A;  3CGN A;  1ZK6 A;  2VCD A;  2FDM A;  2F2D A;  3CH9 A;  1FFR A;  4U84 A;  3UI4 A;  1JNT A;  1HKI A;  1FKF A;  4WKH A;  1VF8 A;  1F8A B;  3ARO A;  4QT3 A;  1Q6H A;  4G2P A;  4WK9 A;  1NSG A;  1JNE A;  4TW7 A;  1SR0 A;  2RUC A;  3EY6 A;  4LAX A;  3B8S A;  3IHZ A;  1EDQ A;  5B8I C;  4ZS6 A;  1FKG A;  1KT1 A;  1ZB5 A;  2OLH A;  3O5P A;  3ARY A;  3ARW A;  2QF8 A;  1IX5 A;  3AS2 A;  3B9E A;  4J4O A;  3O5L A;  4DRP A;  4Z2G A;  1W9V A;  3WD1 A;  3CHC A;  4IQC A;  2MPH A;  4LAY A;  2KO7 A;  1FKB A;  2YBT A;  4DZ2 A;  3GPK A;  1Q1C A;  3LUO A;  2MLY A;  1W1T A;  1Q6I A;  4IPX A;  2XP6 A;  1J6Y A;  3WH0 A;  2K8I A;  1JVW A;  3O5O A;  1E6R A;  2A3A A;  3TC5 A;  2A3C A;  4ZPT R;  1ITX A;  3FXY A;  1LG1 A;  2FAP A;  2RUD A;  3KAG A;  3W4R A;  3WD0 A;  1FFQ A;  4GIV A;  1OGB A;  5BXJ A;  3FY1 A;  3CHE A;  3B9A A;  4U86 A;  4J4N A;  4TW8 A;  2ITK A;  3VAW A;  2RSE A;  4DWS A;  4DIP A;  1D7J A;  2DSZ A;  1E6P A;  1ZBC A;  3WKZ A;  2PV1 A;  1X6N A;  1BL4 A;  4DRQ A;  4FN2 A;  4DWS D;  5DIV A;  3ODK A;  1YW5 A;  3AQU A;  4R5E A;  4MPK A;  4MGV A;  3KAH A;  3WQV A;  1LQ0 A;  2XP8 A;  4WIW A;  2PPO A;  2ZR4 A;  1A7X A;  2RQS A;  1E9L A;  1D7I A;  4Q7N A;  4ODP A;  5I98 A;  1GPF A;  4ODR A;  3WIJ A;  4HBO A;  5HTG A;  1EHN A;  1LJY A;  1W9U A;  2PPN A;  4L3N A;  1XHG A;  1LL6 A;  5HBF A;  1NMW A;  1H0I A;  3ARS A;  3WQW A;  4AY1 A;  4WKF A;  1X6L A;  4KQZ A;  3G6M A;  1HJV A;  2LGO A;  1GOI A;  1L1P A;  2DT3 A;  3WL1 A;  4JFI A;  4Q22 A;  1NWR A;  1TFV A;  1E15 A;  2DSV A;  4IQ2 A;  1NMV A;  2RUR A;  4DT4 A;  3IKG A;  2PI6 A;  1B6C A;  5HKG A;  3JYM A;  3RFW A;  2UZ5 A;  2JZV A;  2LKN A;  4ODQ A;  1JND A;  1LL4 A;  3PRB A;  4DWS B;  4Z2I A;  4MTV A;  4G50 A;  4FAP A;  3O5R A;  4PTM A;  2Q5A A;  4ZPV R;  3PRA A;  2DSU A;  3IKD A;  1ZCN A;  4WJX A;  3KAD A;  4DWS C;  4P8W A;  3KAB A;  1HKK A;  1HJX A;  1UR9 A;  2LPV A;  3B9D A;  2N87 A;  3AS1 A;  4DRK A;  4DRI A;  1ZL1 A;  3RM9 A;  1TCO C;  1HJW A;  1HKM A;  1FKK A;  1QPL A;  2M08 A;  3B7X A;  4P8X A;  1FKH A;  4QT2 A;  1O6I A;  1J4R A;  1R9H A;  5GPG A;  2VN1 A;  4W9P A;  4DZ3 A;  2MF9 A;  4TW6 A;  1ROU A;  2MNT A;  2XP3 A;  4ITZ A;  2DG4 A;  4W9Q A;  4NSB A;  3ALF A;  1RD6 A;  2KGJ A;  2XP7 A;  1XRV A;  5D75 A;  1E6Z A;  4BF8 A;  2KR7 A;  3UF8 A;  4IT4 A;  5HW8 A;  1N1A A;  5DIU A;  3ARR A;  2KE0 A;  2XP4 A;  4DRH A;  3O5Q A;  1J4I A;  5DF0 A;  4JFJ A;  4P8U A;  1E6N A;  5DEZ A;  4GGQ A;  4TYO A;  1SYT A;  2ZQT A;  5DO2 A;  1HXV A;  4Z2J A;  4P8V A;  2WK2 A;  4JFL A;  3WL0 A;  3WD3 A;  1J4H A;  5DIT A;  1LL7 A;  2ZR5 A;  2WLZ A;  1ROT A;  3QOK A;  3RM4 A;  2AOS A;  4S3K A;  3AS0 A;  4ODL A;  4JYS A;  2PBC A;  3ARV A;  4NNR A;  1FKR A;  5HW7 A;  1OWQ A;  3KAI A;  2AWG A;  2ZQU A;  4LAV A;  1D2K A;  1QPF A;  1Y0O A;  4IT6 A;  2DT2 A;  2A3B A;  3KCE A;  4MAV A;  3O5D A;  3NI6 A;  1W26 A;  3CGM A;  3PR9 A;  3O5M A;  5J6E A;  3O5I A;  1NWS A;  5HT1 A;  3O5E A;  4URI A;  2Y78 A;  1FKT A;  2XP9 A;  2PV2 A;  3O5F A;  4LAW A;  1WB0 A;  1T11 A;  1PIN A;  1HKJ A;  3JYJ A;  3WD2 A;  4ODN A;  2XPB A;  3CHD A;  3PRD A;  2MLX A;  5JH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...