1ROUA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Rotamase (isomerase)
molecule keywords FKBP59-I
total genus 25
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rouA00
1TCOC 4MSPA 1FKJA 2N87A 3KADA 4ODMA 5J6EA 3RGCA 1BKFA 1KT0A 4DRHA 1FKLA 2XP5A 4TX0A 3O5LA 1FKIA 3ODKA 1BL4A 1T11A 2K8IA 3O5IA 4W9QA 3O5JA 2M2AA 4N19A 1D7HA 4QT3A 2RQSA 5DIUA 1J4IA 1M5YA 4DZ3A 4TW8A 1ZK6A 2D9FA 2LGOA 4JFLA 5DITA 4DRKA 2DG3A 1FD9A 2MLYA 3PRBA 2ZR4A 1Q6IA 2UZ5A 4ITZA 3O5MA 5DIVA 2F4EA 2KO7A 2RUDA 3JYMA 4LAWA 5HWBA 5HUAA 4JFMA 2XP6A 1KT1A 1FKSA 4U84A 1N1AA 3JYJA 2OFNA 2XPBA 3GPKA 1FKTA 1R9HA 5HW8A 4GIVA 3H9RB 1ROTA 3O5PA 4J4OA 4DZ2A 1YATA 3UQIA 4IQ2A 1NMWA 1EYMA 1FKHA 3O5FA 3PA7A 4G50A 4JFJA 4DRJA 4BF8A 5HKGA 4TW6A 4NNRA 2RSEA 5I98A 1FKRA 2AWGA 2KR7A 3UI4A 2JZVA 4FAPA 5HTGA 3FAPA 1D6OA 1FKFA 2MNTA 1FKGA 3UI6A 3KAGA 2F2DA 3MDYB 2RUCA 2LKNA 2Y78A 1J4RA 3OOBA 1Y0OA 3WH0A 5HWCA 3UF8A 4J4NA 3UQAA 2VCDA 2XP8A 1Q6HA 3O5DA 3JXVA 2KGJA 2PPPA 2FAPA 2PBCA 2MPHA 2M08A 1F40A 4GGQA 2PV2A 4IQCA 4TW7A 3IHZA 4TNSA 2XP3A 3KZ7A 4JFIA 4ODQA 4JYSA 3EY6A 2KE0A 5B8IC 3KAFA 1HXVA 2L2SA 1ROUA 4ODNA 3O5QA 1JNSA 2DG9A 3TCZA 2RURA 2XPAA 1D7JA 2ZQTA 3KAHA 2LJ4A 2IF4A 4DROA 3IKGA 5D75A 1Q6UA 1FKKA 4LAXA 2KI3A 1U79A 3KACA 4W9PA 1QZ2A 2DG4A 1NMVA 4U85A 3KABA 1ZCNA 5GPGA 1J4HA 2LPVA 3NTPA 3B7XA 3UI5A 1W26A 2PPNA 4QT2A 1C9HA 2PV3A 4DRIA 2VN1A 4TYOA 1EQ3A 4R0XA 3O5RA 2ZQUA 2MLZA 4DH0A 3O5GA 3PRDA 4DRNA 2M1IA 1FJDA 1YW5A 1L1PA 1D7IA 2FKEA 4LAVA 4JFKA 3TC5A 4IPXA 3RFWA 4ODPA 3KAIA 2MF9A 5BXJA 1Q1CA 4DT4A 1A7XA 1J6YA 1FAPA 4O2TA 4C02B 4QIBA 2ZR5A 3TDBA 1QPLA 4DRMA 3CGMA 3I6CA 4LAYA 2XP4A 3IK8A 3VAWA 2KFWA 1PBKA 1PINA 2F21A 4ODOA 4DRPA 1FKDA 1F8AB 4ODKA 2ZQSA 3NI6A 4DRQA 5HW6A 1FKBA 1JNTA 4DIPA 4U86A 2PV1A 4FN2A 3KCEA 3LUOA 4G2PA 5HW7A 2Q5AA 3NRKA 1JVWA 2PPOA 2RUQA 3CGNA 1NSGA 2XP7A 4ODRA 3IKDA 2XP9A 2MLXA 2ITKA 2ZR6A 2ZQVA 4MGVA 4W9OA 3O5EA 5HT1A 3O5OA 1QPFA 1B6CA 4ODLA 3O5KA 1P5QA 3UQBA
chains in the Genus database with same CATH superfamily
3RM9A 3WIJA 2XP5A 4TX0A 3O5LA 1T11A 4W9QA 2YBTA 3O5JA 1SYTA 4JFLA 5DITA 3W4RA 1UR9A 3PRBA 3ARXA 4U84A 1FKSA 3JYJA 3RMEA 1FKTA 3H9RB 4AY1A 4DZ2A 5HKGA 3CHEA 1NWSA 4TW6A 2RSEA 2AWGA 2KR7A 4NSBA 2JZVA 1FKGA 2F2DA 2DSZA 2RUCA 3CHFA 4S3JA 2XP8A 3JXVA 2KGJA 2PPPA 2FAPA 3B9DA 4MPKA 2MPHA 2PV2A 3WQVA 1W1YA 3KZ7A 1GPFA 4HARA 1UR8A 1NWTA 1NWRA 1GUVA 2L2SA 1JNSA 2FDMA 1ZBWA 1D7JA 3B8SA 1HJVA 3QOKA 1LL4A 4DROA 2IF4A 3BMBA 4W5UA 4LAXA 3ARRA 4P8WA 4U85A 1HXVA 1J4HA 3B9AA 3B7XA 4DRIA 4L3NA 2ZQUA 4KQZA 1FJDA 1D7IA 1VF8A 3RM8A 3TC5A 4IT6A 4ODPA 4MNMA 2DT3A 1WNOA 4O2TA 3CGMA 1NH6A 3IK8A 1ZBVA 1PBKA 4WK9A 1O6IA 1W1PA 4WKAA 2PV1A 2WK2A 1FFQA 2RUQA 4ODRA 2WLZA 1TFVA 4MAVA 5HBFA 2ZQVA 4WJXA 3O5OA 1E6PA 3O5KA 3WD3A 3FXYA 1TCOC 2N87A 3RGCA 1W9PA 4P8VA 3ALGA 4DRHA 4IT4A 1E15A 3WKZA 1FKIA 3ODKA 1E6RA 1OGGA 4ML4A 4QT3A 2RQSA 1J4IA 4DZ3A 4TW8A 1KFWA 1FD9A 1RD6A 1Q6IA 4ITZA 2RUDA 3JYMA 4XAKA 3RM4A 1N1AA 2WLYA 3GPKA 1R9HA 2P4VA 4GIVA 5HW8A 4J4OA 3UQIA 3PA7A 1H0IA 1EIBA 3CZ8A 3O5FA 4JFJA 5I98A 4KR0B 4WKFA 4FAPA 1ZL1A 5HTGA 3ARTA 1LG2A 1OGBA 1FKFA 3UI6A 2QF8A 1E6NA 1J4RA 5HWCA 3UF8A 4J4NA 2EULA 2M08A 4LGXA 4TW7A 3ARQA 4Z2HA 4TNSA 4HBOA 4JFIA 4ODQA 1JNDA 2DG9A 3TCZA 2XPAA 1XHGA 3KAHA 2LJ4A 3IKGA 1Q6UA 1LJYA 4NZCA 3KABA 4ZS6A 1C9HA 2PV3A 2VN1A 3ARYA 4TYOA 1EQ3A 4R0XA 2MLZA 3ALFA 4DH0A 3PRDA 4ZPWR 1LL6A 1YW5A 4DWSB 3G6MA 3KAIA 1J6YA 1A7XA 1FAPA 5DO2A 1FFRA 3TDBA 3B9EA 4DRMA 1ZBKA 1PINA 4DRPA 4ODOA 3WQWA 1F8AB 1FKBA 1JNTA 3AQUA 4WIWA 3LUOA 3ARSA 2PI6A 4Z2JA 3CGNA 4WKHA 2XP9A 4URIA 4MGVA 4W9OA 3O5EA 4MTVA 2A3AA 5HT1A 4Z2IA 1QPFA 4HBEA 3OA5A 4MSPA 1FKJA 4ODMA 1BKFA 1HJXA 1KT0A 3WD2A 1EDQA 1BL4A 4ZPTR 3O5IA 4N19A 5DIUA 1ZK6A 4QZVB 2A3BA 4DRKA 2DG3A 2MLYA 2ZR4A 2UZ5A 3O5MA 4LAWA 4DWSC 4UDMA 4JFMA 1LG1A 2XPBA 1W9VA 3G6LA 1ZBCA 2G41A 1ROTA 2DT1A 4L72B 1NMWA 1FKHA 3FY1A 4DRJA 4BF8A 3UI4A 2MNTA 4Q7NA 3KAGA 3AS0A 3OOBA 2Y78A 3WH0A 1Y0OA 5GQBA 3UQAA 2A3CA 2VCDA 1Q6HA 3GTYX 5DEZA 1GRJA 2PBCA 1E44A 4GGQA 4IQCA 4Z2KA 2O92A 2XP3A 1CTNA 2B31A 4JYSA 3EY6A 2F23A 1ROUA 3O5QA 2AOSA 2G8ZA 1ZU8A 2ZQTA 1E6ZA 1SR0A 1X6LA 1X6NA 1U79A 4W9PA 1GOIA 1QZ2A 2DG4A 1NMVA 1ZCNA 3UI5A 3NTPA 1ZB5A 1W26A 2PPNA 2WM0A 4QT2A 2DT2A 1E9LA 3O5RA 3WL1A 1L1PA 3O5GA 4DRNA 2M1IA 1W1TA 4LAVA 1W1VA 4JFKA 1XRVA 1HKIA 2YBUA 5BXJA 4DWSD 3PR9A 4QIBA 1IX5A 2ZR5A 4Z2GA 1QPLA 3I6CA 2XP4A 4MNJA 4Q22A 1H0GA 3NI6A 5HW6A 4DIPA 4U86A 4FN2A 4Z2LA 3KCEA 3NRKA 2OLHA 2XP7A 2PN0A 3IKDA 2ITKA 4MNLA 3WD4A 4ODLA 3BXWA 1D2KA 1P5QA 3AROA 2DSUA 3ARZA 3ARVA 3KADA 1NWUA 1FKLA 1JCHB 2K8IA 2M2AA 1D7HA 4MNKA 1HJWA 1M5YA 2D9FA 2LGOA 5GPRA 3CHCA 3AS1A 5DIVA 2F4EA 2KO7A 5HWBA 5HUAA 1WB0A 1WAWA 2XP6A 1KT1A 2OFNA 1HKMA 1JNEA 3CHDA 3O5PA 4ZPVR 1YATA 4IQ2A 1EYMA 4G50A 5DF0A 4NNRA 1FKRA 4DWSA 3FAPA 1D6OA 3MDYB 2LKNA 4P8UA 4PTMA 3WD1A 3O5DA 2O9OA 1LQ0A 1LL7A 3AS2A 1F40A 3GU0A 3IHZA 2KE0A 1HKJA 3KAFA 5B8IC 4ODNA 3WD0A 3CH9A 2RURA 2A3EA 3EIPA 4P8XA 3AS3A 5D75A 1FKKA 2KI3A 3KACA 4R5EA 1OWQA 1HKKA 1W9UA 2B5UB 5GPGA 2ESCA 2LPVA 2DPEA 2FKEA 3ARPA 3ARUA 4IPXA 3RFWA 2MF9A 2IUZA 1Q1CA 2DSWA 4DT4A 4C02B 1ITXA 3PRAA 4LAYA 3VAWA 2KFWA 2F21A 1FKDA 4ODKA 5J6EA 2ZQSA 4DRQA 3ARWA 4G2PA 1EHNA 4S3KA 5HW7A 2Q5AA 1JVWA 2PPOA 2DSVA 1NSGA 2DT0A 2MLXA 1K9TA 2ZR6A 3WL0A 2ETNA 1B6CA 3UQBA 5JH8A
chains in the Genus database with same CATH topology
3RM9A 3WIJA 2XP5A 4TX0A 3O5LA 1T11A 4W9QA 2YBTA 3O5JA 1SYTA 4JFLA 5DITA 3W4RA 1UR9A 3PRBA 3ARXA 4U84A 1FKSA 3JYJA 3RMEA 1FKTA 3H9RB 4AY1A 4DZ2A 5HKGA 3CHEA 1NWSA 4TW6A 2RSEA 2AWGA 2KR7A 4NSBA 2JZVA 1FKGA 2F2DA 2DSZA 2RUCA 3CHFA 4S3JA 2XP8A 3JXVA 2KGJA 2PPPA 2FAPA 3B9DA 4MPKA 2MPHA 2PV2A 3WQVA 1W1YA 3KZ7A 1GPFA 4HARA 1UR8A 1NWTA 1NWRA 1GUVA 2L2SA 1JNSA 2FDMA 1ZBWA 1D7JA 3B8SA 1HJVA 3QOKA 1LL4A 4DROA 2IF4A 4W5UA 4LAXA 3ARRA 4P8WA 4U85A 1HXVA 1J4HA 3B9AA 3B7XA 4DRIA 4L3NA 2ZQUA 4KQZA 1FJDA 1D7IA 1VF8A 3RM8A 3TC5A 4IT6A 4ODPA 4MNMA 2DT3A 1WNOA 4O2TA 3CGMA 1NH6A 3IK8A 1ZBVA 1PBKA 4WK9A 1O6IA 1W1PA 4WKAA 2PV1A 2WK2A 1FFQA 2RUQA 4ODRA 2WLZA 1TFVA 4MAVA 5HBFA 2ZQVA 4WJXA 3O5OA 1E6PA 3O5KA 3WD3A 3FXYA 1TCOC 2N87A 3RGCA 1W9PA 4P8VA 3ALGA 4DRHA 4IT4A 1E15A 3WKZA 1FKIA 3ODKA 1E6RA 1OGGA 4ML4A 4QT3A 2RQSA 1J4IA 4DZ3A 4TW8A 1KFWA 1FD9A 1RD6A 1Q6IA 4ITZA 2RUDA 3JYMA 4XAKA 3RM4A 1N1AA 2WLYA 3GPKA 1R9HA 5HW8A 4GIVA 4J4OA 3UQIA 3PA7A 1H0IA 1EIBA 3CZ8A 3O5FA 4JFJA 5I98A 4KR0B 4WKFA 4FAPA 1ZL1A 5HTGA 3ARTA 1LG2A 1OGBA 1FKFA 3UI6A 2QF8A 1E6NA 1J4RA 5HWCA 3UF8A 4J4NA 2M08A 4LGXA 4TW7A 3ARQA 4Z2HA 4TNSA 4HBOA 4JFIA 4ODQA 1JNDA 2DG9A 3TCZA 2XPAA 1XHGA 3KAHA 2LJ4A 3IKGA 1Q6UA 1LJYA 4NZCA 3KABA 4ZS6A 1C9HA 2PV3A 2VN1A 3ARYA 4TYOA 1EQ3A 4R0XA 2MLZA 3ALFA 4DH0A 3PRDA 4ZPWR 1LL6A 1YW5A 4DWSB 3G6MA 3KAIA 1J6YA 1A7XA 1FAPA 5DO2A 1FFRA 3TDBA 3B9EA 4DRMA 1ZBKA 1PINA 4DRPA 4ODOA 3WQWA 1F8AB 1FKBA 1JNTA 3AQUA 4WIWA 3LUOA 3ARSA 2PI6A 4Z2JA 3CGNA 4WKHA 2XP9A 4URIA 4MGVA 4W9OA 3O5EA 4MTVA 2A3AA 5HT1A 4Z2IA 1QPFA 4HBEA 3OA5A 4MSPA 1FKJA 4ODMA 1BKFA 1HJXA 1KT0A 3WD2A 1EDQA 1BL4A 4ZPTR 3O5IA 4N19A 5DIUA 1ZK6A 4QZVB 2A3BA 4DRKA 2DG3A 2MLYA 2ZR4A 2UZ5A 3O5MA 4LAWA 4DWSC 4JFMA 1LG1A 2XPBA 1W9VA 3G6LA 1ZBCA 2G41A 1ROTA 2DT1A 4L72B 1NMWA 1FKHA 3FY1A 4DRJA 4BF8A 3UI4A 2MNTA 4Q7NA 3KAGA 3AS0A 3OOBA 2Y78A 3WH0A 1Y0OA 5GQBA 3UQAA 2A3CA 2VCDA 1Q6HA 5DEZA 2PBCA 4GGQA 4IQCA 4Z2KA 2O92A 2XP3A 1CTNA 2B31A 4JYSA 3EY6A 1ROUA 3O5QA 2AOSA 2G8ZA 1ZU8A 2ZQTA 1E6ZA 1SR0A 1X6LA 1X6NA 1U79A 4W9PA 1GOIA 1QZ2A 2DG4A 1NMVA 1ZCNA 3UI5A 3NTPA 1ZB5A 1W26A 2PPNA 2WM0A 4QT2A 2DT2A 1E9LA 3O5RA 3WL1A 1L1PA 3O5GA 4DRNA 2M1IA 1W1TA 4LAVA 1W1VA 4JFKA 1XRVA 1HKIA 2YBUA 5BXJA 4DWSD 3PR9A 4QIBA 1IX5A 2ZR5A 4Z2GA 1QPLA 3I6CA 2XP4A 4MNJA 4Q22A 1H0GA 3NI6A 5HW6A 4DIPA 4U86A 4FN2A 4Z2LA 3KCEA 3NRKA 2OLHA 2XP7A 3IKDA 2ITKA 4MNLA 3WD4A 4ODLA 3BXWA 1D2KA 1P5QA 3AROA 2DSUA 3ARZA 3ARVA 3KADA 1NWUA 1FKLA 2K8IA 2M2AA 1D7HA 4MNKA 1HJWA 1M5YA 2D9FA 2LGOA 5GPRA 3CHCA 3AS1A 5DIVA 2F4EA 2KO7A 5HWBA 5HUAA 1WB0A 1WAWA 2XP6A 1KT1A 2OFNA 1HKMA 1JNEA 3CHDA 3O5PA 4ZPVR 1YATA 4IQ2A 1EYMA 4G50A 5DF0A 4NNRA 1FKRA 4DWSA 3FAPA 1D6OA 3MDYB 2LKNA 4P8UA 4PTMA 3WD1A 3O5DA 2O9OA 1LQ0A 1LL7A 3AS2A 1F40A 3IHZA 2KE0A 1HKJA 3KAFA 5B8IC 4ODNA 3WD0A 3CH9A 2RURA 2A3EA 4P8XA 3AS3A 5D75A 1FKKA 2KI3A 3KACA 4R5EA 1OWQA 1HKKA 1W9UA 5GPGA 2ESCA 2LPVA 2DPEA 2FKEA 3ARPA 3ARUA 4IPXA 3RFWA 2MF9A 2IUZA 1Q1CA 2DSWA 4DT4A 4C02B 1ITXA 3PRAA 4LAYA 3VAWA 2KFWA 2F21A 1FKDA 4ODKA 5J6EA 2ZQSA 4DRQA 3ARWA 4G2PA 1EHNA 4S3KA 5HW7A 2Q5AA 1JVWA 2PPOA 2DSVA 1NSGA 2DT0A 2MLXA 1K9TA 2ZR6A 3WL0A 1B6CA 3UQBA 5JH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCO C;  4MSP A;  1FKJ A;  2N87 A;  3KAD A;  4ODM A;  5J6E A;  3RGC A;  1BKF A;  1KT0 A;  4DRH A;  1FKL A;  2XP5 A;  4TX0 A;  3O5L A;  1FKI A;  3ODK A;  1BL4 A;  1T11 A;  2K8I A;  3O5I A;  4W9Q A;  3O5J A;  2M2A A;  4N19 A;  1D7H A;  4QT3 A;  2RQS A;  5DIU A;  1J4I A;  1M5Y A;  4DZ3 A;  4TW8 A;  1ZK6 A;  2D9F A;  2LGO A;  4JFL A;  5DIT A;  4DRK A;  2DG3 A;  1FD9 A;  2MLY A;  3PRB A;  2ZR4 A;  1Q6I A;  2UZ5 A;  4ITZ A;  3O5M A;  5DIV A;  2F4E A;  2KO7 A;  2RUD A;  3JYM A;  4LAW A;  5HWB A;  5HUA A;  4JFM A;  2XP6 A;  1KT1 A;  1FKS A;  4U84 A;  1N1A A;  3JYJ A;  2OFN A;  2XPB A;  3GPK A;  1FKT A;  1R9H A;  5HW8 A;  4GIV A;  3H9R B;  1ROT A;  3O5P A;  4J4O A;  4DZ2 A;  1YAT A;  3UQI A;  4IQ2 A;  1NMW A;  1EYM A;  1FKH A;  3O5F A;  3PA7 A;  4G50 A;  4JFJ A;  4DRJ A;  4BF8 A;  5HKG A;  4TW6 A;  4NNR A;  2RSE A;  5I98 A;  1FKR A;  2AWG A;  2KR7 A;  3UI4 A;  2JZV A;  4FAP A;  5HTG A;  3FAP A;  1D6O A;  1FKF A;  2MNT A;  1FKG A;  3UI6 A;  3KAG A;  2F2D A;  3MDY B;  2RUC A;  2LKN A;  2Y78 A;  1J4R A;  3OOB A;  1Y0O A;  3WH0 A;  5HWC A;  3UF8 A;  4J4N A;  3UQA A;  2VCD A;  2XP8 A;  1Q6H A;  3O5D A;  3JXV A;  2KGJ A;  2PPP A;  2FAP A;  2PBC A;  2MPH A;  2M08 A;  1F40 A;  4GGQ A;  2PV2 A;  4IQC A;  4TW7 A;  3IHZ A;  4TNS A;  2XP3 A;  3KZ7 A;  4JFI A;  4ODQ A;  4JYS A;  3EY6 A;  2KE0 A;  5B8I C;  3KAF A;  1HXV A;  2L2S A;  1ROU A;  4ODN A;  3O5Q A;  1JNS A;  2DG9 A;  3TCZ A;  2RUR A;  2XPA A;  1D7J A;  2ZQT A;  3KAH A;  2LJ4 A;  2IF4 A;  4DRO A;  3IKG A;  5D75 A;  1Q6U A;  1FKK A;  4LAX A;  2KI3 A;  1U79 A;  3KAC A;  4W9P A;  1QZ2 A;  2DG4 A;  1NMV A;  4U85 A;  3KAB A;  1ZCN A;  5GPG A;  1J4H A;  2LPV A;  3NTP A;  3B7X A;  3UI5 A;  1W26 A;  2PPN A;  4QT2 A;  1C9H A;  2PV3 A;  4DRI A;  2VN1 A;  4TYO A;  1EQ3 A;  4R0X A;  3O5R A;  2ZQU A;  2MLZ A;  4DH0 A;  3O5G A;  3PRD A;  4DRN A;  2M1I A;  1FJD A;  1YW5 A;  1L1P A;  1D7I A;  2FKE A;  4LAV A;  4JFK A;  3TC5 A;  4IPX A;  3RFW A;  4ODP A;  3KAI A;  2MF9 A;  5BXJ A;  1Q1C A;  4DT4 A;  1A7X A;  1J6Y A;  1FAP A;  4O2T A;  4C02 B;  4QIB A;  2ZR5 A;  3TDB A;  1QPL A;  4DRM A;  3CGM A;  3I6C A;  4LAY A;  2XP4 A;  3IK8 A;  3VAW A;  2KFW A;  1PBK A;  1PIN A;  2F21 A;  4ODO A;  4DRP A;  1FKD A;  1F8A B;  4ODK A;  2ZQS A;  3NI6 A;  4DRQ A;  5HW6 A;  1FKB A;  1JNT A;  4DIP A;  4U86 A;  2PV1 A;  4FN2 A;  3KCE A;  3LUO A;  4G2P A;  5HW7 A;  2Q5A A;  3NRK A;  1JVW A;  2PPO A;  2RUQ A;  3CGN A;  1NSG A;  2XP7 A;  4ODR A;  3IKD A;  2XP9 A;  2MLX A;  2ITK A;  2ZR6 A;  2ZQV A;  4MGV A;  4W9O A;  3O5E A;  5HT1 A;  3O5O A;  1QPF A;  1B6C A;  4ODL A;  3O5K A;  1P5Q A;  3UQB A; 
#chains in the Genus database with same CATH topology
 3RM9 A;  3WIJ A;  2XP5 A;  4TX0 A;  3O5L A;  1T11 A;  4W9Q A;  2YBT A;  3O5J A;  1SYT A;  4JFL A;  5DIT A;  3W4R A;  1UR9 A;  3PRB A;  3ARX A;  4U84 A;  1FKS A;  3JYJ A;  3RME A;  1FKT A;  3H9R B;  4AY1 A;  4DZ2 A;  5HKG A;  3CHE A;  1NWS A;  4TW6 A;  2RSE A;  2AWG A;  2KR7 A;  4NSB A;  2JZV A;  1FKG A;  2F2D A;  2DSZ A;  2RUC A;  3CHF A;  4S3J A;  2XP8 A;  3JXV A;  2KGJ A;  2PPP A;  2FAP A;  3B9D A;  4MPK A;  2MPH A;  2PV2 A;  3WQV A;  1W1Y A;  3KZ7 A;  1GPF A;  4HAR A;  1UR8 A;  1NWT A;  1NWR A;  1GUV A;  2L2S A;  1JNS A;  2FDM A;  1ZBW A;  1D7J A;  3B8S A;  1HJV A;  3QOK A;  1LL4 A;  4DRO A;  2IF4 A;  3BMB A;  4W5U A;  4LAX A;  3ARR A;  4P8W A;  4U85 A;  1HXV A;  1J4H A;  3B9A A;  3B7X A;  4DRI A;  4L3N A;  2ZQU A;  4KQZ A;  1FJD A;  1D7I A;  1VF8 A;  3RM8 A;  3TC5 A;  4IT6 A;  4ODP A;  4MNM A;  2DT3 A;  1WNO A;  4O2T A;  3CGM A;  1NH6 A;  3IK8 A;  1ZBV A;  1PBK A;  4WK9 A;  1O6I A;  1W1P A;  4WKA A;  2PV1 A;  2WK2 A;  1FFQ A;  2RUQ A;  4ODR A;  2WLZ A;  1TFV A;  4MAV A;  5HBF A;  2ZQV A;  4WJX A;  3O5O A;  1E6P A;  3O5K A;  3WD3 A;  3FXY A;  1TCO C;  2N87 A;  3RGC A;  1W9P A;  4P8V A;  3ALG A;  4DRH A;  4IT4 A;  1E15 A;  3WKZ A;  1FKI A;  3ODK A;  1E6R A;  1OGG A;  4ML4 A;  4QT3 A;  2RQS A;  1J4I A;  4DZ3 A;  4TW8 A;  1KFW A;  1FD9 A;  1RD6 A;  1Q6I A;  4ITZ A;  2RUD A;  3JYM A;  4XAK A;  3RM4 A;  1N1A A;  2WLY A;  3GPK A;  1R9H A;  2P4V A;  4GIV A;  5HW8 A;  4J4O A;  3UQI A;  3PA7 A;  1H0I A;  1EIB A;  3CZ8 A;  3O5F A;  4JFJ A;  5I98 A;  4KR0 B;  4WKF A;  4FAP A;  1ZL1 A;  5HTG A;  3ART A;  1LG2 A;  1OGB A;  1FKF A;  3UI6 A;  2QF8 A;  1E6N A;  1J4R A;  5HWC A;  3UF8 A;  4J4N A;  2EUL A;  2M08 A;  4LGX A;  4TW7 A;  3ARQ A;  4Z2H A;  4TNS A;  4HBO A;  4JFI A;  4ODQ A;  1JND A;  2DG9 A;  3TCZ A;  2XPA A;  1XHG A;  3KAH A;  2LJ4 A;  3IKG A;  1Q6U A;  1LJY A;  4NZC A;  3KAB A;  4ZS6 A;  1C9H A;  2PV3 A;  2VN1 A;  3ARY A;  4TYO A;  1EQ3 A;  4R0X A;  2MLZ A;  3ALF A;  4DH0 A;  3PRD A;  4ZPW R;  1LL6 A;  1YW5 A;  4DWS B;  3G6M A;  3KAI A;  1J6Y A;  1A7X A;  1FAP A;  5DO2 A;  1FFR A;  3TDB A;  3B9E A;  4DRM A;  1ZBK A;  1PIN A;  4DRP A;  4ODO A;  3WQW A;  1F8A B;  1FKB A;  1JNT A;  3AQU A;  4WIW A;  3LUO A;  3ARS A;  2PI6 A;  4Z2J A;  3CGN A;  4WKH A;  2XP9 A;  4URI A;  4MGV A;  4W9O A;  3O5E A;  4MTV A;  2A3A A;  5HT1 A;  4Z2I A;  1QPF A;  4HBE A;  3OA5 A;  4MSP A;  1FKJ A;  4ODM A;  1BKF A;  1HJX A;  1KT0 A;  3WD2 A;  1EDQ A;  1BL4 A;  4ZPT R;  3O5I A;  4N19 A;  5DIU A;  1ZK6 A;  4QZV B;  2A3B A;  4DRK A;  2DG3 A;  2MLY A;  2ZR4 A;  2UZ5 A;  3O5M A;  4LAW A;  4DWS C;  4UDM A;  4JFM A;  1LG1 A;  2XPB A;  1W9V A;  3G6L A;  1ZBC A;  2G41 A;  1ROT A;  2DT1 A;  4L72 B;  1NMW A;  1FKH A;  3FY1 A;  4DRJ A;  4BF8 A;  3UI4 A;  2MNT A;  4Q7N A;  3KAG A;  3AS0 A;  3OOB A;  2Y78 A;  3WH0 A;  1Y0O A;  5GQB A;  3UQA A;  2A3C A;  2VCD A;  1Q6H A;  3GTY X;  5DEZ A;  1GRJ A;  2PBC A;  1E44 A;  4GGQ A;  4IQC A;  4Z2K A;  2O92 A;  2XP3 A;  1CTN A;  2B31 A;  4JYS A;  3EY6 A;  2F23 A;  1ROU A;  3O5Q A;  2AOS A;  2G8Z A;  1ZU8 A;  2ZQT A;  1E6Z A;  1SR0 A;  1X6L A;  1X6N A;  1U79 A;  4W9P A;  1GOI A;  1QZ2 A;  2DG4 A;  1NMV A;  1ZCN A;  3UI5 A;  3NTP A;  1ZB5 A;  1W26 A;  2PPN A;  2WM0 A;  4QT2 A;  2DT2 A;  1E9L A;  3O5R A;  3WL1 A;  1L1P A;  3O5G A;  4DRN A;  2M1I A;  1W1T A;  4LAV A;  1W1V A;  4JFK A;  1XRV A;  1HKI A;  2YBU A;  5BXJ A;  4DWS D;  3PR9 A;  4QIB A;  1IX5 A;  2ZR5 A;  4Z2G A;  1QPL A;  3I6C A;  2XP4 A;  4MNJ A;  4Q22 A;  1H0G A;  3NI6 A;  5HW6 A;  4DIP A;  4U86 A;  4FN2 A;  4Z2L A;  3KCE A;  3NRK A;  2OLH A;  2XP7 A;  2PN0 A;  3IKD A;  2ITK A;  4MNL A;  3WD4 A;  4ODL A;  3BXW A;  1D2K A;  1P5Q A;  3ARO A;  2DSU A;  3ARZ A;  3ARV A;  3KAD A;  1NWU A;  1FKL A;  1JCH B;  2K8I A;  2M2A A;  1D7H A;  4MNK A;  1HJW A;  1M5Y A;  2D9F A;  2LGO A;  5GPR A;  3CHC A;  3AS1 A;  5DIV A;  2F4E A;  2KO7 A;  5HWB A;  5HUA A;  1WB0 A;  1WAW A;  2XP6 A;  1KT1 A;  2OFN A;  1HKM A;  1JNE A;  3CHD A;  3O5P A;  4ZPV R;  1YAT A;  4IQ2 A;  1EYM A;  4G50 A;  5DF0 A;  4NNR A;  1FKR A;  4DWS A;  3FAP A;  1D6O A;  3MDY B;  2LKN A;  4P8U A;  4PTM A;  3WD1 A;  3O5D A;  2O9O A;  1LQ0 A;  1LL7 A;  3AS2 A;  1F40 A;  3GU0 A;  3IHZ A;  2KE0 A;  1HKJ A;  3KAF A;  5B8I C;  4ODN A;  3WD0 A;  3CH9 A;  2RUR A;  2A3E A;  3EIP A;  4P8X A;  3AS3 A;  5D75 A;  1FKK A;  2KI3 A;  3KAC A;  4R5E A;  1OWQ A;  1HKK A;  1W9U A;  2B5U B;  5GPG A;  2ESC A;  2LPV A;  2DPE A;  2FKE A;  3ARP A;  3ARU A;  4IPX A;  3RFW A;  2MF9 A;  2IUZ A;  1Q1C A;  2DSW A;  4DT4 A;  4C02 B;  1ITX A;  3PRA A;  4LAY A;  3VAW A;  2KFW A;  2F21 A;  1FKD A;  4ODK A;  5J6E A;  2ZQS A;  4DRQ A;  3ARW A;  4G2P A;  1EHN A;  4S3K A;  5HW7 A;  2Q5A A;  1JVW A;  2PPO A;  2DSV A;  1NSG A;  2DT0 A;  2MLX A;  1K9T A;  2ZR6 A;  3WL0 A;  2ETN A;  1B6C A;  3UQB A;  5JH8 A; 
#chains in the Genus database with same CATH homology
 3RM9 A;  3WIJ A;  2XP5 A;  4TX0 A;  3O5L A;  1T11 A;  4W9Q A;  2YBT A;  3O5J A;  1SYT A;  4JFL A;  5DIT A;  3W4R A;  1UR9 A;  3PRB A;  3ARX A;  4U84 A;  1FKS A;  3JYJ A;  3RME A;  1FKT A;  3H9R B;  4AY1 A;  4DZ2 A;  5HKG A;  3CHE A;  1NWS A;  4TW6 A;  2RSE A;  2AWG A;  2KR7 A;  4NSB A;  2JZV A;  1FKG A;  2F2D A;  2DSZ A;  2RUC A;  3CHF A;  4S3J A;  2XP8 A;  3JXV A;  2KGJ A;  2PPP A;  2FAP A;  3B9D A;  4MPK A;  2MPH A;  2PV2 A;  3WQV A;  1W1Y A;  3KZ7 A;  1GPF A;  4HAR A;  1UR8 A;  1NWT A;  1NWR A;  1GUV A;  2L2S A;  1JNS A;  2FDM A;  1ZBW A;  1D7J A;  3B8S A;  1HJV A;  3QOK A;  1LL4 A;  4DRO A;  2IF4 A;  4W5U A;  4LAX A;  3ARR A;  4P8W A;  4U85 A;  1HXV A;  1J4H A;  3B9A A;  3B7X A;  4DRI A;  4L3N A;  2ZQU A;  4KQZ A;  1FJD A;  1D7I A;  1VF8 A;  3RM8 A;  3TC5 A;  4IT6 A;  4ODP A;  4MNM A;  2DT3 A;  1WNO A;  4O2T A;  3CGM A;  1NH6 A;  3IK8 A;  1ZBV A;  1PBK A;  4WK9 A;  1O6I A;  1W1P A;  4WKA A;  2PV1 A;  2WK2 A;  1FFQ A;  2RUQ A;  4ODR A;  2WLZ A;  1TFV A;  4MAV A;  5HBF A;  2ZQV A;  4WJX A;  3O5O A;  1E6P A;  3O5K A;  3WD3 A;  3FXY A;  1TCO C;  2N87 A;  3RGC A;  1W9P A;  4P8V A;  3ALG A;  4DRH A;  4IT4 A;  1E15 A;  3WKZ A;  1FKI A;  3ODK A;  1E6R A;  1OGG A;  4ML4 A;  4QT3 A;  2RQS A;  1J4I A;  4DZ3 A;  4TW8 A;  1KFW A;  1FD9 A;  1RD6 A;  1Q6I A;  4ITZ A;  2RUD A;  3JYM A;  4XAK A;  3RM4 A;  1N1A A;  2WLY A;  3GPK A;  1R9H A;  5HW8 A;  4GIV A;  4J4O A;  3UQI A;  3PA7 A;  1H0I A;  1EIB A;  3CZ8 A;  3O5F A;  4JFJ A;  5I98 A;  4KR0 B;  4WKF A;  4FAP A;  1ZL1 A;  5HTG A;  3ART A;  1LG2 A;  1OGB A;  1FKF A;  3UI6 A;  2QF8 A;  1E6N A;  1J4R A;  5HWC A;  3UF8 A;  4J4N A;  2M08 A;  4LGX A;  4TW7 A;  3ARQ A;  4Z2H A;  4TNS A;  4HBO A;  4JFI A;  4ODQ A;  1JND A;  2DG9 A;  3TCZ A;  2XPA A;  1XHG A;  3KAH A;  2LJ4 A;  3IKG A;  1Q6U A;  1LJY A;  4NZC A;  3KAB A;  4ZS6 A;  1C9H A;  2PV3 A;  2VN1 A;  3ARY A;  4TYO A;  1EQ3 A;  4R0X A;  2MLZ A;  3ALF A;  4DH0 A;  3PRD A;  4ZPW R;  1LL6 A;  1YW5 A;  4DWS B;  3G6M A;  3KAI A;  1J6Y A;  1A7X A;  1FAP A;  5DO2 A;  1FFR A;  3TDB A;  3B9E A;  4DRM A;  1ZBK A;  1PIN A;  4DRP A;  4ODO A;  3WQW A;  1F8A B;  1FKB A;  1JNT A;  3AQU A;  4WIW A;  3LUO A;  3ARS A;  2PI6 A;  4Z2J A;  3CGN A;  4WKH A;  2XP9 A;  4URI A;  4MGV A;  4W9O A;  3O5E A;  4MTV A;  2A3A A;  5HT1 A;  4Z2I A;  1QPF A;  4HBE A;  3OA5 A;  4MSP A;  1FKJ A;  4ODM A;  1BKF A;  1HJX A;  1KT0 A;  3WD2 A;  1EDQ A;  1BL4 A;  4ZPT R;  3O5I A;  4N19 A;  5DIU A;  1ZK6 A;  4QZV B;  2A3B A;  4DRK A;  2DG3 A;  2MLY A;  2ZR4 A;  2UZ5 A;  3O5M A;  4LAW A;  4DWS C;  4JFM A;  1LG1 A;  2XPB A;  1W9V A;  3G6L A;  1ZBC A;  2G41 A;  1ROT A;  2DT1 A;  4L72 B;  1NMW A;  1FKH A;  3FY1 A;  4DRJ A;  4BF8 A;  3UI4 A;  2MNT A;  4Q7N A;  3KAG A;  3AS0 A;  3OOB A;  2Y78 A;  3WH0 A;  1Y0O A;  5GQB A;  3UQA A;  2A3C A;  2VCD A;  1Q6H A;  5DEZ A;  2PBC A;  4GGQ A;  4IQC A;  4Z2K A;  2O92 A;  2XP3 A;  1CTN A;  2B31 A;  4JYS A;  3EY6 A;  1ROU A;  3O5Q A;  2AOS A;  2G8Z A;  1ZU8 A;  2ZQT A;  1E6Z A;  1SR0 A;  1X6L A;  1X6N A;  1U79 A;  4W9P A;  1GOI A;  1QZ2 A;  2DG4 A;  1NMV A;  1ZCN A;  3UI5 A;  3NTP A;  1ZB5 A;  1W26 A;  2PPN A;  2WM0 A;  4QT2 A;  2DT2 A;  1E9L A;  3O5R A;  3WL1 A;  1L1P A;  3O5G A;  4DRN A;  2M1I A;  1W1T A;  4LAV A;  1W1V A;  4JFK A;  1XRV A;  1HKI A;  2YBU A;  5BXJ A;  4DWS D;  3PR9 A;  4QIB A;  1IX5 A;  2ZR5 A;  4Z2G A;  1QPL A;  3I6C A;  2XP4 A;  4MNJ A;  4Q22 A;  1H0G A;  3NI6 A;  5HW6 A;  4DIP A;  4U86 A;  4FN2 A;  4Z2L A;  3KCE A;  3NRK A;  2OLH A;  2XP7 A;  3IKD A;  2ITK A;  4MNL A;  3WD4 A;  4ODL A;  3BXW A;  1D2K A;  1P5Q A;  3ARO A;  2DSU A;  3ARZ A;  3ARV A;  3KAD A;  1NWU A;  1FKL A;  2K8I A;  2M2A A;  1D7H A;  4MNK A;  1HJW A;  1M5Y A;  2D9F A;  2LGO A;  5GPR A;  3CHC A;  3AS1 A;  5DIV A;  2F4E A;  2KO7 A;  5HWB A;  5HUA A;  1WB0 A;  1WAW A;  2XP6 A;  1KT1 A;  2OFN A;  1HKM A;  1JNE A;  3CHD A;  3O5P A;  4ZPV R;  1YAT A;  4IQ2 A;  1EYM A;  4G50 A;  5DF0 A;  4NNR A;  1FKR A;  4DWS A;  3FAP A;  1D6O A;  3MDY B;  2LKN A;  4P8U A;  4PTM A;  3WD1 A;  3O5D A;  2O9O A;  1LQ0 A;  1LL7 A;  3AS2 A;  1F40 A;  3IHZ A;  2KE0 A;  1HKJ A;  3KAF A;  5B8I C;  4ODN A;  3WD0 A;  3CH9 A;  2RUR A;  2A3E A;  4P8X A;  3AS3 A;  5D75 A;  1FKK A;  2KI3 A;  3KAC A;  4R5E A;  1OWQ A;  1HKK A;  1W9U A;  5GPG A;  2ESC A;  2LPV A;  2DPE A;  2FKE A;  3ARP A;  3ARU A;  4IPX A;  3RFW A;  2MF9 A;  2IUZ A;  1Q1C A;  2DSW A;  4DT4 A;  4C02 B;  1ITX A;  3PRA A;  4LAY A;  3VAW A;  2KFW A;  2F21 A;  1FKD A;  4ODK A;  5J6E A;  2ZQS A;  4DRQ A;  3ARW A;  4G2P A;  1EHN A;  4S3K A;  5HW7 A;  2Q5A A;  1JVW A;  2PPO A;  2DSV A;  1NSG A;  2DT0 A;  2MLX A;  1K9T A;  2ZR6 A;  3WL0 A;  1B6C A;  3UQB A;  5JH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...