1ROUA

Structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'GVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP59-I
publication title Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Rotamase (isomerase)
total genus 25
structure length 118
sequence length 118
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1rouA00
2AWGA 4DH0A 5DIUA 4JYSA 2PBCA 4QIBA 1ZK6A 1Q6HA 4DT4A 2XP6A 1EQ3A 2N87A 1C9HA 1Q1CA 4J4OA 1QZ2A 3EY6A 4QT3A 2M1IA 4TW7A 4TX0A 2DG3A 4DIPA 4IQ2A 4BF8A 4DRPA 2K8IA 3KAFA 4O2TA 3O5DA 4ODLA 1L1PA 2KR7A 1FKIA 2IF4A 3O5PA 1FKDA 2XP9A 4G50A 2UZ5A 3O5FA 2Y78A 4LAWA 4LAYA 4LAVA 4JFKA 2XP8A 2F2DA 4C02B 2FKEA 1M5YA 4MSPA 2MPHA 1D6OA 2RUQA 1F40A 1HXVA 2MF9A 2RQSA 2PPOA 1R9HA 3ODKA 4GGQA 3TCZA 1QPLA 4ODKA 3KAIA 3O5MA 3KAGA 1W26A 1PINA 1FAPA 2VCDA 3H9RB 2MLZA 4IQCA 4ODOA 1KT1A 3MDYB 5HW7A 1JNSA 3PRDA 1FD9A 5HW6A 2F21A 2ZR6A 4TW6A 4R0XA 1KT0A 4W9QA 3O5IA 1D7HA 1TCOC 1FKLA 4ITZA 1BKFA 1ROTA 1FJDA 2RUCA 2DG9A 1FKHA 1U79A 1FKJA 2VN1A 3GPKA 2KI3A 3NI6A 3NRKA 5DITA 2LJ4A 3O5LA 2KGJA 2ZQUA 1FKTA 3UQAA 3JYMA 3KCEA 4LAXA 3UF8A 4J4NA 3LUOA 2XP5A 2M08A 1J4RA 1ZCNA 5HT1A 1FKBA 5HWBA 3KAHA 1ROUA 2KO7A 3O5OA 3O5RA 1NMVA 4DRIA 3UQBA 2RUDA 1B6CA 3O5KA 4JFJA 4U85A 3KACA 3WH0A 1YW5A 1J4HA 4NNRA 1FKKA 1FKSA 2Q5AA 2XP7A 4JFLA 3CGMA 3PA7A 2PV2A 4ODRA 3B7XA 5BXJA 3O5GA 4MGVA 2XPBA 3TC5A 3CGNA 2ZQTA 5HTGA 3KADA 3I6CA 2PV1A 3O5EA 2LGOA 4DRJA 2ZQVA 5HKGA 3O5JA 4JFIA 4TYOA 4ODNA 4W9OA 5DIVA 2OFNA 4FAPA 3IHZA 1Q6IA 4DZ3A 2ZR4A 4ODMA 1Q6UA 2PPPA 2FAPA 2ZQSA 2M2AA 2ZR5A 4U86A 4DROA 4G2PA 4N19A 5HUAA 4IPXA 1NMWA 1P5QA 2KE0A 3PRBA 1BL4A 4TW8A 5GPGA 3UI6A 5B8IC 2PPNA 2MLXA 3TDBA 4DRNA 2XP4A 1PBKA 5I98A 1T11A 1J6YA 4ODPA 4DZ2A 3KABA 4U84A 2PV3A 2XPAA 3IKGA 3UQIA 2JZVA 3KZ7A 2XP3A 3FAPA 4GIVA 5D75A 1J4IA 4TNSA 3NTPA 1JNTA 1A7XA 3UI4A 3JXVA 4JFMA 3O5QA 2D9FA 1N1AA 1F8AB 4DRQA 4W9PA 5HWCA 4QT2A 1QPFA 1D7IA 1Y0OA 1YATA 3IK8A 4DRKA 2LPVA 3JYJA 2F4EA 2MNTA 3UI5A 2LKNA 2MLYA 4DRMA 1FKFA 3RFWA 4DRHA 5HW8A 2DG4A 3IKDA 1EYMA 4FN2A 3RGCA 1JVWA 1D7JA 4ODQA 1FKRA 3OOBA 2L2SA 1FKGA 2RURA 2KFWA 1NSGA 5J6EA 2ITKA 2RSEA 3VAWA
chains in the Genus database with same CATH superfamily
2AWGA 1NWRA 1E44A 3EY6A 2DG3A 4IQ2A 3ARQA 4Z2IA 2A3BA 3O5DA 1FKDA 3ARSA 3AS0A 2XP9A 4WKFA 4MSPA 1NWUA 2O9OA 1HKMA 2P4VA 1D6OA 1R9HA 3ODKA 4GGQA 3TCZA 1X6NA 1QPLA 4WJXA 4ODKA 3KAIA 4P8WA 1W26A 1WB0A 2MLZA 1KT1A 5HW7A 1FD9A 4Z2KA 2DPEA 5HW6A 2F21A 2QF8A 3AS3A 1HJVA 4ITZA 1BKFA 1LJYA 4DWSB 2DG9A 3GPKA 2KI3A 2KGJA 1ZBWA 3WD0A 4LAXA 3AS2A 5HT1A 2KO7A 3O5RA 1NMVA 4WIWA 1LL4A 1B6CA 3O5KA 4U85A 1W1YA 1W9PA 1J4HA 1FKKA 1W9VA 4JFLA 3CHDA 3PA7A 4DWSD 1D2KA 2LGOA 1KFWA 5HKGA 4IT4A 2OFNA 4FAPA 1LQ0A 3IHZA 2O92A 1Q6UA 2PPPA 4DROA 2ZQSA 1SR0A 3W4RA 4MPKA 4IPXA 3FXYA 5GPGA 2PPNA 2MLXA 3B8SA 3TDBA 5I98A 1PBKA 3KABA 4U84A 3UQIA 2WM0A 1J4IA 4P8VA 4TNSA 3WQVA 1JNTA 3GU0A 1NWSA 5HWCA 4QT2A 1GRJA 1QPFA 1D7IA 1Y0OA 3WL1A 2MNTA 2MLYA 3RFWA 4DRHA 5HBFA 3CHEA 1OGBA 1EYMA 1JVWA 3PRAA 2RURA 5J6EA 1O6IA 4DWSA 1LL7A 1ZBVA 1H0GA 4MNLA 1VF8A 3GTYX 4ZPTR 1Q6HA 1EQ3A 1Q1CA 4J4OA 4DIPA 4TX0A 4DRPA 3ARPA 2K8IA 3KAFA 3OA5A 1L1PA 1ZBCA 2KR7A 1FKIA 4LAWA 2UZ5A 3O5FA 4LAVA 4JFKA 1NWTA 4WK9A 2A3CA 2MF9A 2RQSA 2PPOA 4AY1A 1E15A 3KAGA 1PINA 4ODOA 4PTMA 1JNSA 1H0IA 4MNJA 3RM8A 2F23A 1ZBKA 1FJDA 1U79A 1FKJA 5DITA 4ZPWR 1HKJA 3O5LA 3UQAA 4S3KA 3KCEA 3UF8A 2M08A 1ZCNA 4WKAA 1FKBA 1EHNA 4JFJA 2PI6A 2DT3A 4NNRA 1ZL1A 1GPFA 2PV2A 4ODRA 5HTGA 3CGNA 3I6CA 3O5EA 1OWQA 4TYOA 3WD3A 3WIJA 2ZR4A 2DSZA 4U86A 2M2AA 2ZR5A 4G2PA 4N19A 5HUAA 4ZPVR 2G8ZA 1P5QA 3PRBA 5B8IC 3ARWA 1EDQA 4NZCA 1EIBA 3EIPA 3KZ7A 1HJWA 1JCHB 3FAPA 1HKKA 1K9TA 1LG1A 2WLZA 3UI4A 1E6NA 1OGGA 3AROA 3IK8A 4DRKA 3JYJA 1W1VA 3OOBA 3ARYA 2KFWA 2RSEA 4ML4A 3VAWA 4HARA 4DH0A 3BXWA 3QOKA 4HBOA 4DT4A 2XP6A 1C9HA 4TW7A 1QZ2A 4QT3A 4KQZA 4HBEA 4BF8A 4XAKA 2DT0A 2OLHA 3ARTA 4ODLA 3O5PA 5DF0A 4DWSC 2B5UB 4LAYA 4G50A 2YBTA 2AOSA 3FY1A 2RUQA 1F40A 2FDMA 3O5MA 4KR0B 1LG2A 2VCDA 4QZVB 5GQBA 3PRDA 4URIA 2ZR6A 4NSBA 1JNEA 1ITXA 4TW6A 2DSVA 3B9AA 1KT0A 4R0XA 4W9QA 3B9DA 3O5IA 4Z2JA 1TCOC 4MAVA 3RM4A 3AS1A 3G6MA 2VN1A 3CHFA 1W1TA 2ZQUA 1FKTA 1XRVA 3ARZA 4J4NA 3AQUA 2XP5A 3CZ8A 4DRIA 3UQBA 1W1PA 3WH0A 4S3JA 1YW5A 1FKSA 2XP7A 4P8UA 3G6LA 3O5GA 2XPBA 3TC5A 2ZQTA 4JFIA 4ODNA 1Q6IA 2B31A 1ZB5A 1WNOA 2FAPA 1LL6A 4L72B 1FFRA 1NMWA 1HJXA 2DSWA 3PR9A 1BL4A 3UI6A 3WKZA 4DRNA 1J6YA 1NH6A 1T11A 4P8XA 3CH9A 4ODPA 1WAWA 2JZVA 4WKHA 2XP3A 3RMEA 4GIVA 4Q22A 2YBUA 1A7XA 3O5QA 1RD6A 1N1AA 1F8AB 3BMBA 4DRQA 4W9PA 3WD2A 2F4EA 4DRMA 1FKFA 3ARVA 4Q7NA 3IKDA 5DEZA 3RGCA 1D7JA 2G41A 4IT6A 2L2SA 1NSGA 2ITKA 1SYTA 1TFVA 5DIUA 5GPRA 3WQWA 1E6ZA 4JYSA 2PBCA 4QIBA 2EULA 1ZK6A 4MNKA 2N87A 4Z2GA 2M1IA 4ZS6A 1X6LA 1E6PA 4O2TA 1UR8A 2IF4A 3WD4A 2Y78A 2XP8A 2F2DA 4C02B 2FKEA 1M5YA 2MPHA 2A3AA 2WLYA 1HXVA 4Z2HA 1FAPA 3H9RB 4IQCA 3MDYB 2DT2A 3WL0A 1IX5A 1XHGA 3WD1A 3ARXA 1D7HA 1UR9A 1FKLA 1ROTA 2RUCA 1FKHA 3NRKA 3NI6A 2LJ4A 3JYMA 4MNMA 3LUOA 2DSUA 1J4RA 5HWBA 3KAHA 1ROUA 3O5OA 4LGXA 2RUDA 3KACA 4Z2LA 2WK2A 3CHCA 2Q5AA 3ARUA 3CGMA 2PN0A 1E6RA 5JH8A 3B7XA 5BXJA 4MGVA 5DO2A 3KADA 2PV1A 4W5UA 4DRJA 2ZQVA 3O5JA 3ALGA 4W9OA 5DIVA 4DZ3A 4ODMA 1GOIA 1CTNA 3ARRA 2KE0A 1JNDA 4TW8A 1FFQA 1E9LA 2XP4A 4UDMA 4DZ2A 2PV3A 2XPAA 3IKGA 2IUZA 4R5EA 2DT1A 3B9EA 5D75A 3NTPA 3JXVA 4JFMA 2D9FA 2ESCA 1W9UA 3RM9A 2ETNA 1YATA 1ZU8A 4MTVA 1HKIA 2LPVA 3UI5A 2A3EA 2LKNA 5HW8A 1GUVA 2DG4A 4FN2A 4ODQA 1FKRA 1FKGA 3ALFA 4L3NA
chains in the Genus database with same CATH topology
2AWGA 1NWRA 3EY6A 2DG3A 4IQ2A 3ARQA 4Z2IA 2A3BA 3O5DA 1FKDA 3ARSA 3AS0A 2XP9A 4WKFA 4MSPA 1NWUA 2O9OA 1HKMA 1D6OA 1R9HA 3ODKA 4GGQA 3TCZA 1X6NA 1QPLA 4WJXA 4ODKA 3KAIA 4P8WA 1W26A 1WB0A 2MLZA 1KT1A 5HW7A 1FD9A 4Z2KA 2DPEA 5HW6A 2F21A 2QF8A 3AS3A 1HJVA 4ITZA 1BKFA 1LJYA 4DWSB 2DG9A 3GPKA 2KI3A 2KGJA 1ZBWA 3WD0A 4LAXA 3AS2A 5HT1A 2KO7A 3O5RA 1NMVA 4WIWA 1LL4A 1B6CA 3O5KA 4U85A 1W1YA 1W9PA 1J4HA 1FKKA 1W9VA 4JFLA 3CHDA 3PA7A 4DWSD 1D2KA 2LGOA 1KFWA 5HKGA 4IT4A 2OFNA 4FAPA 1LQ0A 3IHZA 2O92A 1Q6UA 2PPPA 4DROA 2ZQSA 1SR0A 3W4RA 4MPKA 4IPXA 3FXYA 5GPGA 2PPNA 2MLXA 3B8SA 3TDBA 5I98A 1PBKA 3KABA 4U84A 3UQIA 2WM0A 1J4IA 4P8VA 4TNSA 3WQVA 1JNTA 1NWSA 5HWCA 4QT2A 1QPFA 1D7IA 1Y0OA 3WL1A 2MNTA 2MLYA 3RFWA 4DRHA 5HBFA 3CHEA 1OGBA 1EYMA 1JVWA 3PRAA 2RURA 5J6EA 1O6IA 4DWSA 1LL7A 1ZBVA 1H0GA 4MNLA 1VF8A 4ZPTR 1Q6HA 1EQ3A 1Q1CA 4J4OA 4DIPA 4TX0A 4DRPA 3ARPA 2K8IA 3KAFA 3OA5A 1L1PA 1ZBCA 2KR7A 1FKIA 4LAWA 2UZ5A 3O5FA 4LAVA 4JFKA 1NWTA 4WK9A 2A3CA 2MF9A 2RQSA 2PPOA 4AY1A 1E15A 3KAGA 1PINA 4ODOA 4PTMA 1JNSA 1H0IA 4MNJA 3RM8A 1ZBKA 1FJDA 1U79A 1FKJA 5DITA 4ZPWR 1HKJA 3O5LA 3UQAA 4S3KA 3KCEA 3UF8A 2M08A 1ZCNA 4WKAA 1FKBA 1EHNA 4JFJA 2PI6A 2DT3A 4NNRA 1ZL1A 1GPFA 2PV2A 4ODRA 5HTGA 3CGNA 3I6CA 3O5EA 1OWQA 4TYOA 3WD3A 3WIJA 2ZR4A 2DSZA 4U86A 2M2AA 2ZR5A 4G2PA 4N19A 5HUAA 4ZPVR 2G8ZA 1P5QA 3PRBA 5B8IC 3ARWA 1EDQA 4NZCA 1EIBA 1HJWA 3KZ7A 3FAPA 1HKKA 1K9TA 1LG1A 2WLZA 3UI4A 1E6NA 1OGGA 3AROA 3IK8A 4DRKA 3JYJA 1W1VA 3OOBA 3ARYA 2KFWA 2RSEA 4ML4A 3VAWA 4HARA 4DH0A 3BXWA 3QOKA 4HBOA 4DT4A 2XP6A 1C9HA 4TW7A 1QZ2A 4QT3A 4KQZA 4HBEA 4BF8A 4XAKA 2DT0A 2OLHA 3ARTA 4ODLA 3O5PA 5DF0A 4DWSC 4LAYA 4G50A 2YBTA 2AOSA 3FY1A 2RUQA 1F40A 2FDMA 3O5MA 4KR0B 1LG2A 2VCDA 4QZVB 5GQBA 3PRDA 4URIA 2ZR6A 4NSBA 1JNEA 1ITXA 4TW6A 2DSVA 3B9AA 1KT0A 4R0XA 4W9QA 3B9DA 3O5IA 4Z2JA 1TCOC 4MAVA 3RM4A 3AS1A 3G6MA 2VN1A 3CHFA 1W1TA 2ZQUA 1FKTA 1XRVA 3ARZA 4J4NA 3AQUA 2XP5A 3CZ8A 4DRIA 3UQBA 1W1PA 3WH0A 4S3JA 1YW5A 1FKSA 2XP7A 4P8UA 3G6LA 3O5GA 2XPBA 3TC5A 2ZQTA 4JFIA 4ODNA 1Q6IA 2B31A 1ZB5A 1WNOA 2FAPA 1LL6A 4L72B 1FFRA 1NMWA 1HJXA 2DSWA 3PR9A 1BL4A 3UI6A 3WKZA 4DRNA 1J6YA 1NH6A 1T11A 4P8XA 3CH9A 4ODPA 1WAWA 2JZVA 4WKHA 2XP3A 3RMEA 4GIVA 4Q22A 2YBUA 1A7XA 3O5QA 1RD6A 1N1AA 1F8AB 4DRQA 4W9PA 3WD2A 2F4EA 4DRMA 1FKFA 3ARVA 4Q7NA 3IKDA 5DEZA 3RGCA 1D7JA 2G41A 4IT6A 2L2SA 1NSGA 2ITKA 1SYTA 1TFVA 5DIUA 5GPRA 3WQWA 1E6ZA 4JYSA 2PBCA 4QIBA 1ZK6A 4MNKA 2N87A 4Z2GA 2M1IA 4ZS6A 1X6LA 1E6PA 4O2TA 1UR8A 2IF4A 3WD4A 2Y78A 2XP8A 2F2DA 4C02B 2FKEA 1M5YA 2MPHA 2A3AA 2WLYA 1HXVA 4Z2HA 1FAPA 3H9RB 4IQCA 3MDYB 2DT2A 3WL0A 1IX5A 1XHGA 3WD1A 3ARXA 1D7HA 1UR9A 1FKLA 1ROTA 2RUCA 1FKHA 3NRKA 3NI6A 2LJ4A 3JYMA 4MNMA 3LUOA 2DSUA 1J4RA 5HWBA 3KAHA 1ROUA 3O5OA 4LGXA 2RUDA 3KACA 4Z2LA 2WK2A 3CHCA 2Q5AA 3ARUA 3CGMA 1E6RA 5JH8A 3B7XA 5BXJA 4MGVA 5DO2A 3KADA 2PV1A 4W5UA 4DRJA 2ZQVA 3O5JA 3ALGA 4W9OA 5DIVA 4DZ3A 4ODMA 1GOIA 1CTNA 3ARRA 2KE0A 1JNDA 4TW8A 1FFQA 1E9LA 2XP4A 4DZ2A 2PV3A 2XPAA 3IKGA 2IUZA 4R5EA 2DT1A 3B9EA 5D75A 3NTPA 3JXVA 4JFMA 2D9FA 2ESCA 1W9UA 3RM9A 1YATA 1ZU8A 4MTVA 1HKIA 2LPVA 3UI5A 2A3EA 2LKNA 5HW8A 1GUVA 2DG4A 4FN2A 4ODQA 1FKRA 1FKGA 3ALFA 4L3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWG A;  4DH0 A;  5DIU A;  4JYS A;  2PBC A;  4QIB A;  1ZK6 A;  1Q6H A;  4DT4 A;  2XP6 A;  1EQ3 A;  2N87 A;  1C9H A;  1Q1C A;  4J4O A;  1QZ2 A;  3EY6 A;  4QT3 A;  2M1I A;  4TW7 A;  4TX0 A;  2DG3 A;  4DIP A;  4IQ2 A;  4BF8 A;  4DRP A;  2K8I A;  3KAF A;  4O2T A;  3O5D A;  4ODL A;  1L1P A;  2KR7 A;  1FKI A;  2IF4 A;  3O5P A;  1FKD A;  2XP9 A;  4G50 A;  2UZ5 A;  3O5F A;  2Y78 A;  4LAW A;  4LAY A;  4LAV A;  4JFK A;  2XP8 A;  2F2D A;  4C02 B;  2FKE A;  1M5Y A;  4MSP A;  2MPH A;  1D6O A;  2RUQ A;  1F40 A;  1HXV A;  2MF9 A;  2RQS A;  2PPO A;  1R9H A;  3ODK A;  4GGQ A;  3TCZ A;  1QPL A;  4ODK A;  3KAI A;  3O5M A;  3KAG A;  1W26 A;  1PIN A;  1FAP A;  2VCD A;  3H9R B;  2MLZ A;  4IQC A;  4ODO A;  1KT1 A;  3MDY B;  5HW7 A;  1JNS A;  3PRD A;  1FD9 A;  5HW6 A;  2F21 A;  2ZR6 A;  4TW6 A;  4R0X A;  1KT0 A;  4W9Q A;  3O5I A;  1D7H A;  1TCO C;  1FKL A;  4ITZ A;  1BKF A;  1ROT A;  1FJD A;  2RUC A;  2DG9 A;  1FKH A;  1U79 A;  1FKJ A;  2VN1 A;  3GPK A;  2KI3 A;  3NI6 A;  3NRK A;  5DIT A;  2LJ4 A;  3O5L A;  2KGJ A;  2ZQU A;  1FKT A;  3UQA A;  3JYM A;  3KCE A;  4LAX A;  3UF8 A;  4J4N A;  3LUO A;  2XP5 A;  2M08 A;  1J4R A;  1ZCN A;  5HT1 A;  1FKB A;  5HWB A;  3KAH A;  1ROU A;  2KO7 A;  3O5O A;  3O5R A;  1NMV A;  4DRI A;  3UQB A;  2RUD A;  1B6C A;  3O5K A;  4JFJ A;  4U85 A;  3KAC A;  3WH0 A;  1YW5 A;  1J4H A;  4NNR A;  1FKK A;  1FKS A;  2Q5A A;  2XP7 A;  4JFL A;  3CGM A;  3PA7 A;  2PV2 A;  4ODR A;  3B7X A;  5BXJ A;  3O5G A;  4MGV A;  2XPB A;  3TC5 A;  3CGN A;  2ZQT A;  5HTG A;  3KAD A;  3I6C A;  2PV1 A;  3O5E A;  2LGO A;  4DRJ A;  2ZQV A;  5HKG A;  3O5J A;  4JFI A;  4TYO A;  4ODN A;  4W9O A;  5DIV A;  2OFN A;  4FAP A;  3IHZ A;  1Q6I A;  4DZ3 A;  2ZR4 A;  4ODM A;  1Q6U A;  2PPP A;  2FAP A;  2ZQS A;  2M2A A;  2ZR5 A;  4U86 A;  4DRO A;  4G2P A;  4N19 A;  5HUA A;  4IPX A;  1NMW A;  1P5Q A;  2KE0 A;  3PRB A;  1BL4 A;  4TW8 A;  5GPG A;  3UI6 A;  5B8I C;  2PPN A;  2MLX A;  3TDB A;  4DRN A;  2XP4 A;  1PBK A;  5I98 A;  1T11 A;  1J6Y A;  4ODP A;  4DZ2 A;  3KAB A;  4U84 A;  2PV3 A;  2XPA A;  3IKG A;  3UQI A;  2JZV A;  3KZ7 A;  2XP3 A;  3FAP A;  4GIV A;  5D75 A;  1J4I A;  4TNS A;  3NTP A;  1JNT A;  1A7X A;  3UI4 A;  3JXV A;  4JFM A;  3O5Q A;  2D9F A;  1N1A A;  1F8A B;  4DRQ A;  4W9P A;  5HWC A;  4QT2 A;  1QPF A;  1D7I A;  1Y0O A;  1YAT A;  3IK8 A;  4DRK A;  2LPV A;  3JYJ A;  2F4E A;  2MNT A;  3UI5 A;  2LKN A;  2MLY A;  4DRM A;  1FKF A;  3RFW A;  4DRH A;  5HW8 A;  2DG4 A;  3IKD A;  1EYM A;  4FN2 A;  3RGC A;  1JVW A;  1D7J A;  4ODQ A;  1FKR A;  3OOB A;  2L2S A;  1FKG A;  2RUR A;  2KFW A;  1NSG A;  5J6E A;  2ITK A;  2RSE A;  3VAW A; 
#chains in the Genus database with same CATH topology
 2AWG A;  1NWR A;  1E44 A;  3EY6 A;  2DG3 A;  4IQ2 A;  3ARQ A;  4Z2I A;  2A3B A;  3O5D A;  1FKD A;  3ARS A;  3AS0 A;  2XP9 A;  4WKF A;  4MSP A;  1NWU A;  2O9O A;  1HKM A;  2P4V A;  1D6O A;  1R9H A;  3ODK A;  4GGQ A;  3TCZ A;  1X6N A;  1QPL A;  4WJX A;  4ODK A;  3KAI A;  4P8W A;  1W26 A;  1WB0 A;  2MLZ A;  1KT1 A;  5HW7 A;  1FD9 A;  4Z2K A;  2DPE A;  5HW6 A;  2F21 A;  2QF8 A;  3AS3 A;  1HJV A;  4ITZ A;  1BKF A;  1LJY A;  4DWS B;  2DG9 A;  3GPK A;  2KI3 A;  2KGJ A;  1ZBW A;  3WD0 A;  4LAX A;  3AS2 A;  5HT1 A;  2KO7 A;  3O5R A;  1NMV A;  4WIW A;  1LL4 A;  1B6C A;  3O5K A;  4U85 A;  1W1Y A;  1W9P A;  1J4H A;  1FKK A;  1W9V A;  4JFL A;  3CHD A;  3PA7 A;  4DWS D;  1D2K A;  2LGO A;  1KFW A;  5HKG A;  4IT4 A;  2OFN A;  4FAP A;  1LQ0 A;  3IHZ A;  2O92 A;  1Q6U A;  2PPP A;  4DRO A;  2ZQS A;  1SR0 A;  3W4R A;  4MPK A;  4IPX A;  3FXY A;  5GPG A;  2PPN A;  2MLX A;  3B8S A;  3TDB A;  5I98 A;  1PBK A;  3KAB A;  4U84 A;  3UQI A;  2WM0 A;  1J4I A;  4P8V A;  4TNS A;  3WQV A;  1JNT A;  3GU0 A;  1NWS A;  5HWC A;  4QT2 A;  1GRJ A;  1QPF A;  1D7I A;  1Y0O A;  3WL1 A;  2MNT A;  2MLY A;  3RFW A;  4DRH A;  5HBF A;  3CHE A;  1OGB A;  1EYM A;  1JVW A;  3PRA A;  2RUR A;  5J6E A;  1O6I A;  4DWS A;  1LL7 A;  1ZBV A;  1H0G A;  4MNL A;  1VF8 A;  3GTY X;  4ZPT R;  1Q6H A;  1EQ3 A;  1Q1C A;  4J4O A;  4DIP A;  4TX0 A;  4DRP A;  3ARP A;  2K8I A;  3KAF A;  3OA5 A;  1L1P A;  1ZBC A;  2KR7 A;  1FKI A;  4LAW A;  2UZ5 A;  3O5F A;  4LAV A;  4JFK A;  1NWT A;  4WK9 A;  2A3C A;  2MF9 A;  2RQS A;  2PPO A;  4AY1 A;  1E15 A;  3KAG A;  1PIN A;  4ODO A;  4PTM A;  1JNS A;  1H0I A;  4MNJ A;  3RM8 A;  2F23 A;  1ZBK A;  1FJD A;  1U79 A;  1FKJ A;  5DIT A;  4ZPW R;  1HKJ A;  3O5L A;  3UQA A;  4S3K A;  3KCE A;  3UF8 A;  2M08 A;  1ZCN A;  4WKA A;  1FKB A;  1EHN A;  4JFJ A;  2PI6 A;  2DT3 A;  4NNR A;  1ZL1 A;  1GPF A;  2PV2 A;  4ODR A;  5HTG A;  3CGN A;  3I6C A;  3O5E A;  1OWQ A;  4TYO A;  3WD3 A;  3WIJ A;  2ZR4 A;  2DSZ A;  4U86 A;  2M2A A;  2ZR5 A;  4G2P A;  4N19 A;  5HUA A;  4ZPV R;  2G8Z A;  1P5Q A;  3PRB A;  5B8I C;  3ARW A;  1EDQ A;  4NZC A;  1EIB A;  3EIP A;  3KZ7 A;  1HJW A;  1JCH B;  3FAP A;  1HKK A;  1K9T A;  1LG1 A;  2WLZ A;  3UI4 A;  1E6N A;  1OGG A;  3ARO A;  3IK8 A;  4DRK A;  3JYJ A;  1W1V A;  3OOB A;  3ARY A;  2KFW A;  2RSE A;  4ML4 A;  3VAW A;  4HAR A;  4DH0 A;  3BXW A;  3QOK A;  4HBO A;  4DT4 A;  2XP6 A;  1C9H A;  4TW7 A;  1QZ2 A;  4QT3 A;  4KQZ A;  4HBE A;  4BF8 A;  4XAK A;  2DT0 A;  2OLH A;  3ART A;  4ODL A;  3O5P A;  5DF0 A;  4DWS C;  2B5U B;  4LAY A;  4G50 A;  2YBT A;  2AOS A;  3FY1 A;  2RUQ A;  1F40 A;  2FDM A;  3O5M A;  4KR0 B;  1LG2 A;  2VCD A;  4QZV B;  5GQB A;  3PRD A;  4URI A;  2ZR6 A;  4NSB A;  1JNE A;  1ITX A;  4TW6 A;  2DSV A;  3B9A A;  1KT0 A;  4R0X A;  4W9Q A;  3B9D A;  3O5I A;  4Z2J A;  1TCO C;  4MAV A;  3RM4 A;  3AS1 A;  3G6M A;  2VN1 A;  3CHF A;  1W1T A;  2ZQU A;  1FKT A;  1XRV A;  3ARZ A;  4J4N A;  3AQU A;  2XP5 A;  3CZ8 A;  4DRI A;  3UQB A;  1W1P A;  3WH0 A;  4S3J A;  1YW5 A;  1FKS A;  2XP7 A;  4P8U A;  3G6L A;  3O5G A;  2XPB A;  3TC5 A;  2ZQT A;  4JFI A;  4ODN A;  1Q6I A;  2B31 A;  1ZB5 A;  1WNO A;  2FAP A;  1LL6 A;  4L72 B;  1FFR A;  1NMW A;  1HJX A;  2DSW A;  3PR9 A;  1BL4 A;  3UI6 A;  3WKZ A;  4DRN A;  1J6Y A;  1NH6 A;  1T11 A;  4P8X A;  3CH9 A;  4ODP A;  1WAW A;  2JZV A;  4WKH A;  2XP3 A;  3RME A;  4GIV A;  4Q22 A;  2YBU A;  1A7X A;  3O5Q A;  1RD6 A;  1N1A A;  1F8A B;  3BMB A;  4DRQ A;  4W9P A;  3WD2 A;  2F4E A;  4DRM A;  1FKF A;  3ARV A;  4Q7N A;  3IKD A;  5DEZ A;  3RGC A;  1D7J A;  2G41 A;  4IT6 A;  2L2S A;  1NSG A;  2ITK A;  1SYT A;  1TFV A;  5DIU A;  5GPR A;  3WQW A;  1E6Z A;  4JYS A;  2PBC A;  4QIB A;  2EUL A;  1ZK6 A;  4MNK A;  2N87 A;  4Z2G A;  2M1I A;  4ZS6 A;  1X6L A;  1E6P A;  4O2T A;  1UR8 A;  2IF4 A;  3WD4 A;  2Y78 A;  2XP8 A;  2F2D A;  4C02 B;  2FKE A;  1M5Y A;  2MPH A;  2A3A A;  2WLY A;  1HXV A;  4Z2H A;  1FAP A;  3H9R B;  4IQC A;  3MDY B;  2DT2 A;  3WL0 A;  1IX5 A;  1XHG A;  3WD1 A;  3ARX A;  1D7H A;  1UR9 A;  1FKL A;  1ROT A;  2RUC A;  1FKH A;  3NRK A;  3NI6 A;  2LJ4 A;  3JYM A;  4MNM A;  3LUO A;  2DSU A;  1J4R A;  5HWB A;  3KAH A;  1ROU A;  3O5O A;  4LGX A;  2RUD A;  3KAC A;  4Z2L A;  2WK2 A;  3CHC A;  2Q5A A;  3ARU A;  3CGM A;  2PN0 A;  1E6R A;  5JH8 A;  3B7X A;  5BXJ A;  4MGV A;  5DO2 A;  3KAD A;  2PV1 A;  4W5U A;  4DRJ A;  2ZQV A;  3O5J A;  3ALG A;  4W9O A;  5DIV A;  4DZ3 A;  4ODM A;  1GOI A;  1CTN A;  3ARR A;  2KE0 A;  1JND A;  4TW8 A;  1FFQ A;  1E9L A;  2XP4 A;  4UDM A;  4DZ2 A;  2PV3 A;  2XPA A;  3IKG A;  2IUZ A;  4R5E A;  2DT1 A;  3B9E A;  5D75 A;  3NTP A;  3JXV A;  4JFM A;  2D9F A;  2ESC A;  1W9U A;  3RM9 A;  2ETN A;  1YAT A;  1ZU8 A;  4MTV A;  1HKI A;  2LPV A;  3UI5 A;  2A3E A;  2LKN A;  5HW8 A;  1GUV A;  2DG4 A;  4FN2 A;  4ODQ A;  1FKR A;  1FKG A;  3ALF A;  4L3N A; 
#chains in the Genus database with same CATH homology
 2AWG A;  1NWR A;  3EY6 A;  2DG3 A;  4IQ2 A;  3ARQ A;  4Z2I A;  2A3B A;  3O5D A;  1FKD A;  3ARS A;  3AS0 A;  2XP9 A;  4WKF A;  4MSP A;  1NWU A;  2O9O A;  1HKM A;  1D6O A;  1R9H A;  3ODK A;  4GGQ A;  3TCZ A;  1X6N A;  1QPL A;  4WJX A;  4ODK A;  3KAI A;  4P8W A;  1W26 A;  1WB0 A;  2MLZ A;  1KT1 A;  5HW7 A;  1FD9 A;  4Z2K A;  2DPE A;  5HW6 A;  2F21 A;  2QF8 A;  3AS3 A;  1HJV A;  4ITZ A;  1BKF A;  1LJY A;  4DWS B;  2DG9 A;  3GPK A;  2KI3 A;  2KGJ A;  1ZBW A;  3WD0 A;  4LAX A;  3AS2 A;  5HT1 A;  2KO7 A;  3O5R A;  1NMV A;  4WIW A;  1LL4 A;  1B6C A;  3O5K A;  4U85 A;  1W1Y A;  1W9P A;  1J4H A;  1FKK A;  1W9V A;  4JFL A;  3CHD A;  3PA7 A;  4DWS D;  1D2K A;  2LGO A;  1KFW A;  5HKG A;  4IT4 A;  2OFN A;  4FAP A;  1LQ0 A;  3IHZ A;  2O92 A;  1Q6U A;  2PPP A;  4DRO A;  2ZQS A;  1SR0 A;  3W4R A;  4MPK A;  4IPX A;  3FXY A;  5GPG A;  2PPN A;  2MLX A;  3B8S A;  3TDB A;  5I98 A;  1PBK A;  3KAB A;  4U84 A;  3UQI A;  2WM0 A;  1J4I A;  4P8V A;  4TNS A;  3WQV A;  1JNT A;  1NWS A;  5HWC A;  4QT2 A;  1QPF A;  1D7I A;  1Y0O A;  3WL1 A;  2MNT A;  2MLY A;  3RFW A;  4DRH A;  5HBF A;  3CHE A;  1OGB A;  1EYM A;  1JVW A;  3PRA A;  2RUR A;  5J6E A;  1O6I A;  4DWS A;  1LL7 A;  1ZBV A;  1H0G A;  4MNL A;  1VF8 A;  4ZPT R;  1Q6H A;  1EQ3 A;  1Q1C A;  4J4O A;  4DIP A;  4TX0 A;  4DRP A;  3ARP A;  2K8I A;  3KAF A;  3OA5 A;  1L1P A;  1ZBC A;  2KR7 A;  1FKI A;  4LAW A;  2UZ5 A;  3O5F A;  4LAV A;  4JFK A;  1NWT A;  4WK9 A;  2A3C A;  2MF9 A;  2RQS A;  2PPO A;  4AY1 A;  1E15 A;  3KAG A;  1PIN A;  4ODO A;  4PTM A;  1JNS A;  1H0I A;  4MNJ A;  3RM8 A;  1ZBK A;  1FJD A;  1U79 A;  1FKJ A;  5DIT A;  4ZPW R;  1HKJ A;  3O5L A;  3UQA A;  4S3K A;  3KCE A;  3UF8 A;  2M08 A;  1ZCN A;  4WKA A;  1FKB A;  1EHN A;  4JFJ A;  2PI6 A;  2DT3 A;  4NNR A;  1ZL1 A;  1GPF A;  2PV2 A;  4ODR A;  5HTG A;  3CGN A;  3I6C A;  3O5E A;  1OWQ A;  4TYO A;  3WD3 A;  3WIJ A;  2ZR4 A;  2DSZ A;  4U86 A;  2M2A A;  2ZR5 A;  4G2P A;  4N19 A;  5HUA A;  4ZPV R;  2G8Z A;  1P5Q A;  3PRB A;  5B8I C;  3ARW A;  1EDQ A;  4NZC A;  1EIB A;  1HJW A;  3KZ7 A;  3FAP A;  1HKK A;  1K9T A;  1LG1 A;  2WLZ A;  3UI4 A;  1E6N A;  1OGG A;  3ARO A;  3IK8 A;  4DRK A;  3JYJ A;  1W1V A;  3OOB A;  3ARY A;  2KFW A;  2RSE A;  4ML4 A;  3VAW A;  4HAR A;  4DH0 A;  3BXW A;  3QOK A;  4HBO A;  4DT4 A;  2XP6 A;  1C9H A;  4TW7 A;  1QZ2 A;  4QT3 A;  4KQZ A;  4HBE A;  4BF8 A;  4XAK A;  2DT0 A;  2OLH A;  3ART A;  4ODL A;  3O5P A;  5DF0 A;  4DWS C;  4LAY A;  4G50 A;  2YBT A;  2AOS A;  3FY1 A;  2RUQ A;  1F40 A;  2FDM A;  3O5M A;  4KR0 B;  1LG2 A;  2VCD A;  4QZV B;  5GQB A;  3PRD A;  4URI A;  2ZR6 A;  4NSB A;  1JNE A;  1ITX A;  4TW6 A;  2DSV A;  3B9A A;  1KT0 A;  4R0X A;  4W9Q A;  3B9D A;  3O5I A;  4Z2J A;  1TCO C;  4MAV A;  3RM4 A;  3AS1 A;  3G6M A;  2VN1 A;  3CHF A;  1W1T A;  2ZQU A;  1FKT A;  1XRV A;  3ARZ A;  4J4N A;  3AQU A;  2XP5 A;  3CZ8 A;  4DRI A;  3UQB A;  1W1P A;  3WH0 A;  4S3J A;  1YW5 A;  1FKS A;  2XP7 A;  4P8U A;  3G6L A;  3O5G A;  2XPB A;  3TC5 A;  2ZQT A;  4JFI A;  4ODN A;  1Q6I A;  2B31 A;  1ZB5 A;  1WNO A;  2FAP A;  1LL6 A;  4L72 B;  1FFR A;  1NMW A;  1HJX A;  2DSW A;  3PR9 A;  1BL4 A;  3UI6 A;  3WKZ A;  4DRN A;  1J6Y A;  1NH6 A;  1T11 A;  4P8X A;  3CH9 A;  4ODP A;  1WAW A;  2JZV A;  4WKH A;  2XP3 A;  3RME A;  4GIV A;  4Q22 A;  2YBU A;  1A7X A;  3O5Q A;  1RD6 A;  1N1A A;  1F8A B;  4DRQ A;  4W9P A;  3WD2 A;  2F4E A;  4DRM A;  1FKF A;  3ARV A;  4Q7N A;  3IKD A;  5DEZ A;  3RGC A;  1D7J A;  2G41 A;  4IT6 A;  2L2S A;  1NSG A;  2ITK A;  1SYT A;  1TFV A;  5DIU A;  5GPR A;  3WQW A;  1E6Z A;  4JYS A;  2PBC A;  4QIB A;  1ZK6 A;  4MNK A;  2N87 A;  4Z2G A;  2M1I A;  4ZS6 A;  1X6L A;  1E6P A;  4O2T A;  1UR8 A;  2IF4 A;  3WD4 A;  2Y78 A;  2XP8 A;  2F2D A;  4C02 B;  2FKE A;  1M5Y A;  2MPH A;  2A3A A;  2WLY A;  1HXV A;  4Z2H A;  1FAP A;  3H9R B;  4IQC A;  3MDY B;  2DT2 A;  3WL0 A;  1IX5 A;  1XHG A;  3WD1 A;  3ARX A;  1D7H A;  1UR9 A;  1FKL A;  1ROT A;  2RUC A;  1FKH A;  3NRK A;  3NI6 A;  2LJ4 A;  3JYM A;  4MNM A;  3LUO A;  2DSU A;  1J4R A;  5HWB A;  3KAH A;  1ROU A;  3O5O A;  4LGX A;  2RUD A;  3KAC A;  4Z2L A;  2WK2 A;  3CHC A;  2Q5A A;  3ARU A;  3CGM A;  1E6R A;  5JH8 A;  3B7X A;  5BXJ A;  4MGV A;  5DO2 A;  3KAD A;  2PV1 A;  4W5U A;  4DRJ A;  2ZQV A;  3O5J A;  3ALG A;  4W9O A;  5DIV A;  4DZ3 A;  4ODM A;  1GOI A;  1CTN A;  3ARR A;  2KE0 A;  1JND A;  4TW8 A;  1FFQ A;  1E9L A;  2XP4 A;  4DZ2 A;  2PV3 A;  2XPA A;  3IKG A;  2IUZ A;  4R5E A;  2DT1 A;  3B9E A;  5D75 A;  3NTP A;  3JXV A;  4JFM A;  2D9F A;  2ESC A;  1W9U A;  3RM9 A;  1YAT A;  1ZU8 A;  4MTV A;  1HKI A;  2LPV A;  3UI5 A;  2A3E A;  2LKN A;  5HW8 A;  1GUV A;  2DG4 A;  4FN2 A;  4ODQ A;  1FKR A;  1FKG A;  3ALF A;  4L3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...