1ROWA

Structure of ssp-19, an msp-domain protein like family member in caenorhabditis elegans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
LTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDVVITRTAGAPKEDKLVVHFASAPADATDAQAAFVAVAPAGTVTIPMSATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MSP-domain protein like family member
publication title Structure of sperm-specific protein SSP-19 from Caenorhabditis elegans.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural protein
total genus 18
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rowA00
1B0RB 4KJQD 4NRYA 5JPMA 1FDLH 1RZIA 3UTTD 3OR6B 1RJZB 3HI5H 3HE6D 3EO1B 1H3WM 4WGWB 4KZDL 3IU3A 4XP6H 4Y4KB 4QT5B 2DDQL 2R1XB 35C8L 1P9MC 4YHML 5IMKA 3NABH 1HOCB 4N90E 5J3HC 4KZEH 2Y6SC 1CVRA 1KIPB 3DX8B 3WKMH 3RIAF 4KVNL 1I4FB 4ORGB 1PY4A 1KLGB 4FP8L 1V7NL 2BSRA 5K59E 2CR3A 5F7DA 5CZXD 4IOIA 3LDBB 3S9DB 2AKRA 3NAAL 3ALWA 5EO1A 3TBWB 1C5CH 1JGDB 2P46B 1OAKH 3C5ZB 4WY7L 4NOFA 3HG1E 3V7MA 1XGPA 3W9DB 3FT2A 2IANE 4YXLL 3NCMA 4O4YH 3W39A 2DI7A 1UVQA 1JHKL 4X6EA 4MJ6A 2ICWI 5ID1B 4FQXB 2VLJA 2NTFB 5H35B 5K9QG 3IKCA 4ZOBA 1SYSA 5JORB 4PJIE 4NNPH 5EO9B 5SWZD 4RNRA 3EUUA 4Q9QL 4KDWA 4W70A 5HYJD 3GSUA 1NEZB 4NQDE 2OYPA 2XKUA 3DBXB 3T4YA 3ULUF 4K94C 4NQCD 5IW1B 1Y0LB 3VWJA 4NQVA 4JRWA 1NCBH 1HEZA 4JO1L 4OI9A 4NUGH 4PJHE 3QUKA 3IVKB 1XMWA 3EDJA 1U8JB 4MQTB 4X7TB 4PUBL 4G7VH 5DJXA 4BZ2H 2KQMA 3B6SA 3HB3D 2BCKB 4G6FD 3ULVE 3FO0H 1RZJH 4RMTA 1FZMA 1QSVA 1OL0A 1QSFE 3WIHH 2R39A 3CFKB 4NO5B 5I15L 5GRYA 3G9AB 3QIBD 5DVNA 5KSBB 1B2WL 2JJVA 4XRCA 4BK5A 1EHLH 4OCMC 1QP1A 3DVNA 5C6WH 5IKCA 2Z8VC 3Q3GA 4NUJB 4WUKH 4M5YL 1GC1H 3PWPA 5CSBA 5IVZA 5IVNA 3F7VB 1XZ0B 3P30H 3AFLA 4LVEA 3O3BB 4FOMA 1E6JL 1WCQA 3FRPA 4OUUB 1MUJA 3RVWD 5F7MC 4R4BB 3VFUA 5HHQA 3JVGC 5E8EA 3PDOA 5BOPA 3ZDXF 2EDKA 4R8WH 1MHPL 1WF5A 2AVGA 2FCBA 3QNZB 4B53A 5JW4Q 3EYUL 3NPSB 3ARTA 4XMPL 4WFFD 1KBGH 1H8NA 4M61B 1HQ4A 4FQCH 2ADGA 3VDCA 1K4DA 2BY1A 4QTHA 4U33A 4XZUA 3QB7C 3U9PL 3QHTC 1JPFA 1PZ5A 4JKWA 3GGWA 5IHZB 1T7WA 4WW2B 3L5WB 3S5LG 4NZRH 2VWEC 3C9NB 4YHKL 5IIEA 3FN0H 4GLRI 3WKNA 3CFCH 3MLYL 2OS7A 3HZKB 4MJ5B 2RQ8A 4O02H 3V5HA 1MH5B 3MLTB 3S3JA 5HYSA 1FL5B 4Y7MA 4TYUA 1E4XI 2D0HA 5FO7B 2F54E 3ZZ1A 2XQYG 4G6ML 3AUVA 4H8WC 3LKQB 2FZ3B 3S37L 1QA9A 2CIIA 3VH8G 2AJVH 4BELD 3CVIH 3GBML 1CS6A 5L2KE 3IAGC 4JQXA 4QRPD 4MZ3A 2AAVA 5ICZA 5T1LD 4F7CB 5BV7B 1A2YA 5HI4C 1U93A 1WK0A 2JB6B 4M7LT 4MA1C 4DGYH 4G42A 5C0BE 5ACLA 4ZXBD 2EIEA 4CMMB 5C0IA 2AK4A 4WU7B 5H94A 3BAEH 2VRAA 3VD4A 3AU1A 1DVFB 3BXNB 5BS0A 3CXHK 2NW2A 5ISZD 1MRCH 1O7VA 4L4VD 2AK1H 4XTRD 2H26B 2WSKA 4R26L 1BVLB 4HKBA 3B9KD 3HS0B 5DJCA 3CK0L 3FFDA 5BXFB 4HUXA 1O0VA 5KJRH 1UKQA 3ZMRA 2L7JA 5KVEL 3RPIA 5FKPB 2RBLA 5FM5O 2PW2A 4G43B 1AI1L 1UH3A 4U4BA 4EI6B 3VXSE 1HH6A 3B2UD 5J7CC 4S1SH 1TVHA 5J13C 3OGCA 1KPUB 2EE3A 3D39E 3IDUA 3I3BA 4MSWA 5CP7B 2PYFB 4Z76A 1A3LL 4F3FA 3CFDB 4K3HA 4YXHH 4XNZC 1MQ8A 3AROA 3MRKB 4I18B 3H8NA 4P2OC 3O2WH 3JWDL 2VLKD 4KKCC 5EOQL 4F33A 5GGUA 2BSED 4N0YL 4S1DC 1NAKL 5GJTH 3WNPA 3GIVB 4G7YH 4FQ2L 4NRZA 3CUPB 5KVFH 2HKFL 5F1NA 3MRPB 4LL9A 4MXQC 1K5NA 2XWBA 3VFMA 4IRJD 5BZWA 3SDAA 4WV1C 5BO1H 5I1LB 5GZOC 1XH3A 4P4KC 5C6TH 2EXWD 4NQTA 2RFXB 4P5KB 1YN6A 2V2WA 3RWJA 3MR9A 5L9DL 1FAIH 2L4OA 2HN7A 4KMLB 1RUPL 1EGJA 1Q72H 4NKIL 6CGTA 2MHAA 3D3VD 2FEEL 4LQFL 3NGBB 1ZANL 2GTZA 2NXZD 1MVUA 2ZCHH 1W72A 3BQUC 1A3RH 4OM1H 5B39G 3U48A 5KVGL 1C16A 3NTCL 1U41A 4Z7NF 1BM3L 3V4VH 3X13B 1KPRB 3UROR 5C92A 3MJ8B 1IFHL 1R3HB 5EULV 3SDDC 3QWOB 4CN4A 2AEQH 3QZWG 4I0PB 1T1XB 1SY6L 4UU9B 4K8RH 4UQ3A 5ADOH 2DYPA 5FGSA 5HDOA 4QOKB 3M17B 4EUPB 1S7RB 2UWEE 1YEHL 4ODVL 3IJHA 4YE4H 3V0VB 2F53B 4ENED 1J1XL 2O5XL 3L3DB 3BE1L 3MGTB 4NOBA 5FOJA 3BWAA 2HMID 3AMLA 3VXRE 3FL7A 3SDYL 2BSSA 3FMGH 2LVCA 1PY9A 2IPKA 3OX8A 4FXKB 4F58L 2ZNXA 1J0HA 3TJEL 4NJAH 2DQTH 4FZEL 3RGVA 1OLZA 1OTTC 3B9DA 1VGKA 3DGCR 3TCLB 1OAYL 4GBXC 4JPWL 4MA8H 4LLQB 4YDKL 1KXVC 2I9TB 1FE8H 1T1ZA 3MNWB 2BNRA 2PW1B 3CXDL 3MYZA 2EE6A 6FABH 3ORJA 2KL6A 5EC2A 2HT4C 3HI6H 2Y9RT 4OBSA 3DYMA 4OUOA 1LP9A 3D69B 3DJ9A 4MNHA 4HIXL 1OD9A 4G6JH 1BJ1H 3PWVA 4YO0B 4XBEH 4HAFA 4MXWH 5K9JH 3I3DA 4GAFB 1T21A 1I3UA 3RTQA 5F9JA 1BAFL 1CLZH 2NX5E 5L6YL 3VI4F 1NGWB 4YHYB 4K3DH 1FN4B 3UJJL 1ACZA 1P9MA 1KJ2L 1DANU 2K9UA 3V0WH 3HAEH 1FZOA 5D2LE 3EYSL 2BDNH 3H7BA 3CVHA 4ZTOH 3EOYG 1A6WL 1F8TL 3BN9C 4GAYA 3Q0HA 1NC2D 2O61A 1VDGA 1HINL 3HZMA 5KSUA 4EI5B 4YHIA 3Q1SH 5KZCD 3SDXA 5C9JB 1S5HB 1TJGL 5DRXA 1Q0XH 3MNZB 1DQLH 4HIJA 4NM8L 4Y5YB 5C3TA 5SWQA 1TVBA 2MFNA 5I8CA 4KXZI 4ZYKB 5C0GB 1QYGH 3ZE1E 3UPCA 5IESH 4PGBB 3RU8L 1NDMB 4TUOA 2P8PB 1BX2A 3HUJB 5INCA 4IJ3B 1J8HE 1XF5B 5BVPL 1MWAB 1SVCP 3EO0B 4GMTH 5EU5A 1QD0A 5C0RH 3G5XA 4HV8A 5DR5L 5CIPH 4CU6A 5JXAL 3VGGA 1FCCA 5FO9B 2MKWA 4S1RL 2JIXA 5CBAB 4JDTH 1T03L 5IF0A 3MGAA 1LGVA 4M1GH 3T0BA 1JGLH 5D71L 2A38A 3S35L 4C56B 1CGTA 2WUCH 1B4JH 1UB6A 1R0AL 2B20A 2V17H 3O9WD 4IOSD 4KJQC 4RX4D 3VA6A 5KSBF 2RJMA 5B8CC 1SJEB 5IHUL 3NCJH 2FO4A 1N2RB 3OKDA 5E2UL 2FSEB 1UA6H 4CW1A 3PV6A 1YMMB 4CKVX 4YGVB 4LLYB 1HQRB 3SKOA 5I76B 1BEYL 4GRMB 2GCYB 3EZJB 2XA8L 2DQDH 2VAJA 4HUWA 4AL8H 4Y1AE 5D96B 4JHWH 2JK5A 4CN1A 3BIKA 1UJ3A 4JY4A 2F8XC 1FPTH 2Z92B 5ELIA 1NGQL 2C3VA 4N90D 3OZ9L 1NUNB 4M6MH 2YBRB 3IKKA 1J1OL 1WEJH 5ACZB 3O6MH 1YEFH 1S7QB 4L4TB 3UTZA 3RX5A 3IFLL 1F45A 4O5LL 4HUVA 3GSXB 3LKPB 4WW2F 1MOEA 1AGEA 4LP5A 3EJZD 3BISA 3HMWH 4LHQB 4P49A 1CG9A 4EXKA 4LKXA 3JWOL 1JPSH 4JG1H 4RA3A 3HG1D 3QUXC 3MCKB 3KPRD 3QDMB 3MOBH 4Q74A 5DEZA 3ZE2F 2NYYC 4KTDH 4L8BA 1RK1A 2NY3B 1CBVH 3WNLA 2DAVA 4G80B 3IETA 1CGVA 2NXYD 5ERWB 4KRPB 4CRPA 2XPGB 1D5IH 4QWWC 3QFDB 5FHAH 1WSST 4ZO9A 5F7HA 2VDOH 1ZEAH 1IRAY 4HGWB 4UV4H 2MCG1 3REVB 1VESA 2IWGA 1LO3L 4LCCC 3PWNB 3O4LE 3HB3C 2BJMH 4L8DA 2VXQH 4BK4A 4ZUWB 3TA3C 4JRYE 4PS4L 35C8H 1KJ3L 3TIEA 5CMAB 1JWSA 3E8UH 3QIBC 1GGUA 3LQAL 4HAGA 4KV5F 4RCAA 5GGSY 3V5DB 4BFGA 4ONFL 4PJDA 1V7NH 4PJ8D 4HS6B 5GRZA 1PDKA 2ARJQ 1EEYA 2GEEA 4D8PB 3CX5J 3BGFB 5BV7H 2Q8AL 2AJZA 2OLDA 2W07A 5E9DA 1NCCL 3WV0A 1U8NA 4M7KL 1OTSC 3Q5OA 4Q9BA 3RVWC 4NQXA 3AAZA 3NOIA 4WEBH 3ROOA 4GKNA 1ZGLM 3Q5YA 1UWGL 2E9IA 1YNLH 3GSQB 1KNOA 1B3JA 3V95A 3I75A 1WCBB 3PJSA 4N8CL 3UO1H 1K6QH 4JN2B 2D03H 32C2A 3RY4A 3FO1B 5AWNL 3DUUA 5CILH 2IALB 5EZLB 4EN3C 4MX7A 3U7AA 3KYAA 2H32H 5D72H 1GGCH 2LTQB 3PWUA 4XCNA 5K9KB 1O7SA 3H0TA 3D9AL 4K3JL 4X7FC 3VGAB 1KCRL 2FB4H 2ESVA 4P2OA 1AXSB 3O2DL 2CDGB 4G6AD 4E5XB 1RIUH 1BQLL 4YPGA 5CEXB 1GVIA 1IC7H 1FP5A 1T04B 2W9LA 1AQDB 3C08L 4CNIA 1SBSL 1EJ6A 4P9HC 2BP3A 1KJVB 1RVFH 2GHWB 2MNUA 4P4KA 5D2NB 1IGTA 5HGBB 5TH2A 4V1DE 2N4IA 3G6DL 3NFNA 3SQBA 4LEOB 2P5WE 2QR0A 2A9MH 4J3SA 1X5KA 2AJUH 1MCNA 1NMBL 1B2WH 3BQUA 3IDXH 3O6LL 4GKZB 1MJJB 2HFEA 5ID0A 3QXDA 4NBYB 3VXUB 4Z7UE 3GMOB 1G7MA 2YN3A 3DX6A 2F54D 4LFHD 1MFEH 1NBZB 4ZXBC 3RTQD 1CDGA 3A67L 3WD5H 2Z8SA 5JW5A 5F96H 1AY1H 1ZTXH 1CR9L 3FRUB 4LHUB 3FAXA 1JRHH 1QLFB 3ETBF 4F7EB 2ICWJ 2ID5A 1XR8B 4KKLD 3T8XA 4U1NB 2WBKA 4K9EC 3QJHB 4XTRC 3KYMB 4RFEA 3HR6A 2ZUTA 2QHRL 1M4KA 1FORL 1GPOL 4POYA 2P8LA 3VXOB 1J5OH 4OKDA 5C0BD 5F8RC 1NFDE 3EYUH 2I9LB 5EBLB 1BLNB 5TDOB 1KG0A 2X70A 1N4XH 3OKOB 4XCYA 1UACL 1QFUH 3V6FB 2KZWA 3LKRB 1I75A 4NC2B 4ISVA 4H26B 5JHDB 3L3HB 4JM4H 3ILQC 1I9EA 1PW3A 3RPKA 4GBXA 1H5BC 2YC1A 3MCG1 2AW2A 2IC2A 1LK3H 1IM9B 3CFJA 1FGNL 3PQYE 2P48B 4LCWE 4YFLF 1NGXB 4YHKH 5DQJB 3MLYH 1D9KB 2UZIH 1P6FA 5MEQB 1HNFA 3MRIB 2FX8L 1JZ4A 3KPOA 3DI3B 1DQJB 3I02A 3QUYB 2QSTA 1F58H 5J12C 1CXFA 3EOBB 4OKVB 3TYFB 1WAAF 2BOCA 2EO1A 3VFSB 2YD1A 1XF1A 3EYVA 1K4CB 3QDJA 4PLJD 4L9LC 1BJMA 3WS3B 5FYKU 2DQCL 1CD1A 3LRSA 2NR6D 4JY6A 1NCWH 1X9QA 1XCTB 4P99A 4H1LA 3T1FB 4XNMA 5J57B 1BZ7A 4KKAD 3MUJA 4N0FA 2H1PL 3CLFL 3GFUA 2YS4A 3HR5B 3ULSA 1BECA 5EN2B 1J18A 2XFXB 3CPLB 2DQGH 5IFHL 4HIEA 3T2OA 2FBOJ 4K55A 5TF1H 2X41A 1W0WA 1D3CA 2R4RL 3VW3H 4OGXL 1I7RB 3ZE2E 2J7LA 3BPOB 5DMJB 4ZFGL 4JKLA 3NZHH 1RUML 3HUJF 4B7IA 2EDBA 1E4XL 2KKQA 4K7FB 1YEJL 4PG9B 5ETUA 2HMIC 1ZT4B 4OD3H 3RI5F 5GGTL 3H6JA 1MIMH 4HWEL 4Y4KA 3MRNB 4TOYL 3U36A 4L29A 4IRSD 3ULUD 1P7HL 2EECA 3HN3A 4HWBA 4GJTB 4AENB 5I1DA 3GMNB 1LK2B 5D7LB 4ORGA 1KLGA 2NNAA 2ADJB 1XF3A 4KV5E 4PTUB 1MWAH 3VXRD 2GITB 2AEPL 1NAKH 4QRSB 3N1FC 2P7TB 4OZIE 3JBG7 3GJFA 4P2QA 3C5ZA 5J6GB 2ICWB 1QVOA 4Y5XB 2C4FU 1IJ9A 1Z6JT 5EPMA 4LSPH 3W9DA 4PTTA 4Z7QE 4N8VG 3D25A 1DQQA 4UI2A 4NKIH 4P3WA 2NY6C 2OZ4H 5B38B 1EMTH 3CU7A 3N9GL 4QEGA 1IEHA 4DW2L 4IS6A 1MCBA 5I18H 5IBLD 5E8PA 4HF5H 1BM3H 2YUZA 1I85C 3ES6A 4G5ZL 1OD7A 5GGRA 5GGRY 3BPNB 5E94B 2GK0B 5I1CL 5DLML 4FFYH 2V5RA 1NEZA 4XGZB 5I30L 1W8OA 3DBXA 1N59B 5IW1A 4POZC 4NFCA 4YEFA 2W0LA 1SJHB 4ODVH 5ICXA 2P5EA 4PGJA 4HS8H 3UX9B 3L3GB 2DWEB 2O5XH 4TTGA 3DPBA 1MI5D 1YPZA 3REWA 4HWUA 1A7RL 3BE1H 3IVKA 5B3JE 4LVOC 4DN4H 4X7TA 4R2GB 5HHNB 1S8DA 4FFZL 1LE9A 3GSOB 1ADQA 2OJZL 3KYKH 1A6TB 3DURB 3VU2A 3GUTB 1IQWL 2I60H 1HHHA 5C0DB 4XP1H 2Y06L 4UNTA 2FIRT 4PLNC 3QG7L 5FGCB 4M6OL 1L0XA 2AQ1A 5HHVH 1TETL 1ZVYA 3QUXA 5C2UB 3CXDH 5ABDE 1A7QL 5JOFA 4QRUB 4GG8B 2EIBA 3BKYL 2MKLC 3BZFA 1JWMB 2J8UB 1P7KB 3EZ8A 3V8OA 2Y07H 1FGVL 4Q0XH 2ESVD 3O9WC 5C07A 4B50A 3L95A 4LAJH 4JFXB 2BERA 3MOQA 4XAKE 4XC1L 1PSKL 3EGSA 1A6UH 1XIWD 2QSVA 3UJJH 1X5JA 1VGEL 5SWSD 3CSYA 4LIQL 3AB0B 2XTJE 5E8NB 4XXCC 3SDCD 2BFVH 3RHWF 3VWKC 5DURD 4QF1A 3QR2A 4WO4B 1HINH 1QSEB 4WW2A 3OAYH 1I3RA 2H3NB 3IXTB 4K07A 5F7LB 3FQUB 1G9MC 3JV5A 3BDYH 3QJFA 3HZKA 2AI0H 1RY7B 4NM8H 4U7KA 2CK0L 4YNYA 1MH5A 4YAQB 4NSKB 5ALBH 1FL5A 3TPUB 3IF1B 4FTVE 4HS3B 3PHQB 4UIKH 5FO7A 3RU8H 3BSZL 4N9GA 4HKZB 5I8OH 1TJHL 4JANB 1ZHLB 2IAMB 4EN3A 3O45A 4PJ5A 1IAOA 5DHVB 4P9ML 1VKXA 4NM4L 2HJLB 1KT2B 4LBEB 2WBWB 4Y5VC 2JB6A 5CEZL 1KCLA 2EH8L 1N6UA 4N0UB 5EIQA 5FHBL 1I8IA 4HWZA 1DBMH 4UBDD 5JXAH 1IQDA 3MTRA 4U1SB 2APWA 2RB8A 3MA9H 4K7PL 1S9KC 1FNEA 3U6RB 2R56H 1XGUB 3ROLA 2NXYC 1R0AH 4JO4H 3GIZH 3KLDA 1CGXA 2X4QA 2A2QT 3VGDA 2AV7B 1HN1A 1U8MA 4YIQB 4B7LA 3DUSB 5DJ6B 5E2UH 5TJWK 3GBNL 2JJSA 2FIKA 5BCAA 5FUCE 4U6XB 3SGDH 3ZE0F 4F7MA 1PQZB 4L3EA 5J9PA 2E8YA 2OXHA 1U8LA 5DD1L 5CP7A 2XA8H 5JHLH 2W60B 5FK9A 1JHLH 1KIQB 3MXVL 5GS0L 1EJOL 3SKMA 5C0AA 5FKAA 2P1YA 4M7LH 3ULVC 3GI9H 4WVRA 3SE3C 1AD0B 2HT2C 4JRYD 4Y2DC 1KTLB 2CQVA 4QXTA 5K93A 3OXSA 4G9FE 1IEAB 3C5SB 1WISA 1AHWB 4XWOD 4FZ8H 1FNHA 3RWCB 3ZTNH 3C6SA 2G9HA 1BP3B 4O5LH 3QAZB 3P77A 5HD8C 2IBGA 4JZJC 1YMME 4OCWH 4PJAB 1H3UA 3LB6C 4M1CC 1DQDL 1NMAH 4F57L 1DEEA 1S9XB 3WUZA 4WJ5A 1AGBA 3DTXA 2YPVL 2C3GA 4ZUUB 3GRWH 4NWTH 1J0IA 1AE6L 4XHJC 1OB1A 2DJUA 3SGKA 4TUKL 4MD4B 1T1XA 4OZHA 1KCSH 2W0FA 3KDMB 4Y4KD 1TZHB 2HLFD 4GXVL 3M17A 3QPQD 4R97C 3V0VA 5JW4N 1SYVB 2VERN 4HJGB 4LF3B 3UTSB 5JDJA 3H3KA 4YHLH 1J0JA 1FL3A 5E5MB 5I71C 3RWHA 2XN9E 3AREA 4L9LA 1N3NB 4OGAD 4M7JL 1FFPB 1IGIH 1LHZA 1HXYB 2Z31B 2ZJSH 4M8QA 2V5YA 2XZQL 3VFTA 3RKDC 4X6BB 3IDNB 3WO4B 3C5ZD 5EU6E 5J6HB 4ONFH 4Q6IB 2Y7QB 4A6YL 3TCLA 1OM3L 3VFWB 1A3QA 1JNJA 5AD0A 5ESAB 5ANMB 3ZYIA 1EV2E 1FZJB 2PYEA 4OF8A 4Z7WA 3RIFF 1OP5H 4FQXD 4HUMB 1HI6A 2CLRA 3DYOA 2ED7A 3ARBA 1OPGH 1FFRA 4X6DB 2APVA 3EO9L 4HT1L 4NBZB 3VXMB 3TEUA 4YO0A 4C54A 4X4YA 5I1AB 1G6RL 2BMKB 5MP6L 5A3IC 3DMMB 2R9HD 4LMQE 4U1MB 2A6DA 5CGYD 4M6NL 1TCRB 4JO3H 2LAGB 3HC0B 4UV7L 9CGTA 5MHSE 4GQ9H 2V5SA 3KVQA 4YC2B 1A4JA 1WAAA 1AJ7H 3RVVD 3BWUC 1S9YA 1OLLA 2GTWA 4PRNB 4WDIB 4GW5B 4LRIC 3KPTA 3QEHA 1E28A 5D7IA 5FIEA 4Q2ZB 1A6AB 4ZQKB 4O9HL 4ZFOA 1KCRH 4RMVA 4F8TA 5GS1B 2Q7NA 5CJ8A 4LNVA 3DGGB 3O2DH 3FB6A 2KQNA 5TQ0L 1MAJA 3LQZB 5DZLA 3TYGL 3OKMB 4F2MB 5E00A 1NCNA 1DFBL 2A1WL 2J1KA 4OF5A 2FGWH 4YDVA 4P5TB 1KTDB 5C0GA 1RIVH 4HLJA 3RZCA 3G6DH 3VFRB 2F58L 4PGBA 1BFVL 4PY8J 2Z91A 3K2MC 4PLJC 4M5ZH 2IQAA 5JXED 1HILA 2NR6C 4DQOL 3HZYB 1MHCB 4LSVL 4GMSH 2FBJH 4R96B 5C09E 4A2MA 3LKOB 3A67H 4MVBD 4X4XB 2DMCA 3UPRB 3RFZC 4CU8A 2I24N 4N0CD 1S7UB 3D85A 2DIBA 4LFHG 5IG7B 2ZPKL 3ZKQD 5DJ8B 3CFIC 1CFTB 4BZYA 5JPNB 3RL1A 1FORH 3T2PA 4DTGL 2X7LB 4Y16B 5D8JL 3PHOA 1NKRA 5F88B 4LAQL 3GK8H 4HX1B 2Q76B 3NIFE 1T5WB 1NC4B 2BVPB 2O5ZL 2A6IB 3U4AA 3VRJA 1N2RA 5C0EB 2BNQE 3PIQB 3BZEB 1YEEH 4YHPA 4U1KB 1DLFL 4CJ0A 3SE9H 1CFNB 5J11B 2ERJB 4IRSC 1CWVA 1HQRA 2PN5A 3S98A 1RZJC 5I66B 4I2XB 5B21A 3GSVA 4GRMA 1UQSB 1FGNH 3MJ9A 2V9RA 3S4SB 1G7QA 3QXAB 3MRRB 3KPNB 5C0FB 4M1DL 4ZNCD 1U42A 4MNQB 1NDGB 2OSLB 2J8UF 1LNUB 4MCYB 4RFOL 5DZOA 1KCKA 5IHLB 5DMIL 1GC1C 2Z92A 2GFBA 4HQQH 4WI9A 1I9JH 2G2RB 3GB7A 5D70L 1Q38A 2YBRA 3JTTA 3MGOB 2A73A 3FT3B 4A6YB 4HPYH 4JVWA 2DTML 1BZ9B 2ORBH 1DVFD 3O11A 4L3CB 5JHDE 4XXCA 3VGBA 5E56A 3U46B 1C8PA 1S7WA 3VWKA 3HNSH 3FFCA 1U3JA 1C5DA 1A0QL 3MRQA 1YECL 1LDPH 4TULL 3C09C 1B88A 4KTEL 2HWZL 4LOUC 1G6RB 1KTKE 5GRXG 3BZ4A 4PRHB 4MGXA 3H9HB 4ZOAA 4GLRH 5I1KL 3QXUA 4DVRH 4TPRL 5GRWA 5ERWA 1KGCD 5CINL 1BFTA 5T5NF 4OV6F 3ARWA 3CZFA 3MV9E 1D6VL 3E2HB 4L1DA 1KJ2A 1S7XA 3KXFB 3P4NB 1AQKL 1YEJH 4GQPH 3FONB 1CGYA 3QCUL 4MA7H 4LLVB 5GGTH 4S0TD 4JLRB 4TOYH 2VKXA 5IMMB 2VLME 4EZMA 3ARFB 2KH2B 3BDXA 3N1GC 4OZ4A 4JQVC 4Y5VA 5E99L 3KNBA 1SM3L 1CVSC 3A6BH 3VCLB 4ZAKA 3DVGB 4HS6A 4KI5E 1X5XA 3QCTH 1YY8A 4GSDL 1WFOA 5DHVH 5FV2A 3UMTA 2IANA 1WBYB 3RL2B 1I7TA 4FFWC 2QQQA 1N0XH 3EOAA 4NNYA 2CLVB 1JJUA 2P45B 5D6DA 4ACPA 2WAHA 1NUFA 5AUMB 4U1JA 4PJIA 3TM6A 1X5HA 2FHBA 3GSQA 1UM6L 1VCAA 5CHNB 4I0PD 1F3RB 5HVGB 4NQDA 5T1DL 2GY7B 3WFDH 1R6VA 1T0NA 3BX7C 1CLOL 3FO1A 3SO5A 3PABB 4QOKD 3N9GH 1XIWC 3EYFB 4MJIB 4OGYH 4RGMC 1T7VA 1UB5A 2F53D 3OL2A 3OKYA 4OCXH 4BFIB 5D7LE 1MCOH 4LSQL 5EIIA 1XGRA 5LXGL 3HLAB 1I1YB 2Q8BL 2IG2H 4AEIL 5GGVL 1YEIL 5DD3L 1RQ5A 2NY7L 4E5XA 3SE3A 4JFHE 1NEUA 1XAUA 4NC0B 4AEHH 2VDKH 3G5VB 4XAKD 4Y2DA 1P84J 2X89A 3NIGE 2I07B 1Q0YL 1T0PB 5JO5B 1F97A 8FABB 2FJHA 1JUFA 4PRIE 5D2NA 4HCRL 4PJAF 1CF8H 3U4EB 1JN6B 1KTRL 3R1GH 1PVHA 1LD9A 2HG5A 1HZHH 2XWJB 2ATPB 1OW0A 3GSRA 4GKZA 5ALCL 1MJJA 2YSSA 3R06B 5EU4A 2VXVH 4RDQF 1WQVT 2ITDB 3L3IB 1A7QH 5CJXC 3PDGA 1UCTA 3PP3H 4I77L 5F9WB 1ZLWH 4PR5B 1B6DA 1FNGB 5IJVB 4ALAH 1MFDH 4RAVA 1K8IB 4LHUA 5ENWA 1TZIB 1Q1JH 1TNMA 3PGFL 2E7HA 3QIWC 1XR8A 3BP4A 2OK0L 4XNYH 3U0WL 4GG6A 1KLUB 3KYMA 2WWMD 3EYQD 1FGVH 5CBEB 5EA0H 4K8RC 2YEZA 2EH7H 4PFEA 3OKEB 5TDOA 1CXEA 3T3MF 4EI5D 1XF4B 4LLMB 3OKOA 3SBWC 1ZHKB 3KGRA 3LKRA 1FLRL 2NZIA 2WBJD 3WFEH 1G7JA 5AZEH 1YEGH 3IDJB 3L3HA 5FDWA 1VFBA 2WQRA 1U6AH 4HPOL 5AZ2H 1GZQA 1GGIH 1YN7B 1JGEB 4NKQB 5HY9B 3NIDE 4EVNA 3F6LA 3OKKB 4NJ9H 2Q6WA 5DQJA 3HE7C 5DK0A 3TT1L 3MRBB 2OL3L 4JZOB 5L2KA 1FYTB 4ZUTB 2A9NL 5I19H 1KLFA 2G60L 2K7PA 4OKVA 1IGMH 1I7UB 3QDGB 5HDQH 1MHEA 2XA3A 1XR9A 4XWOC 5HHOB 1A9BA 3PL6D 1TJHH 2DQJL 5F3BA 1K4CA 3QQ3B 5MEOA 3TNNB 3WN5B 1OGAB 1LO5A 1XCTA 1Y18B 4HXAH 4C56D 3C2AL 5I1HL 4PLKC 4JFFE 2EH8H 2K1MA 2OP4L 1OCWL 2DKUA 3VD3A 3HR5A 3BP7B 3MJ7A 2P42B 1Z9LA 2D4FA 5HPMA 2XFXA 4K3GA 4AYFA 3MLXH 4JR9H 2VZVA 1FJ1A 3L7EA 5C1MB 3BGMB 4W68A 1YMMD 4NN7C 4NO3A 4R7DA 3QPQC 1GOHA 5AEAA 5E08L 4CL7A 2GT9B 3X14A 5KSAB 4CADB 4AG4H 1CQYA 4KXZH 1FSKB 5M94B 2DQHH 3QFJA 3LD8B 4OZGE 1X7QB 5TGBB 4PG9A 1Z5LA 3MODH 1ERNA 2YXMA 1NGYA 1ZT4A 3BDBA 3CFBB 2RCSL 3MV7B 4R4NC 4U6YB 3C5JB 2X1QA 2VXSH 5DWUL 1PKQB 3VD5A 4JFEB 1ZGLB 1BQUA 3BJLA 5C71A 3MFGB 3MQIA 3E6HA 4RMRA 1U8HB 4XBPB 1LEIB 3IDGA 5I1GL 1F4WL 2FR4B 1HHJA 4L4TD 2QADC 1EO5A 4PTUA 1KEGL 5BRZB 1NGZB 2GITA 4I48B 1AP2B 4PB0H 2XACC 3GMLA 4JM2C 4MNGB 1FV1A 3S7GA 2AJXL 5SV4A 1C12B 1CE6A 3GNML 4UILH 3BVNA 1CGWA 1NUDA 3U1SL 3PGDB 2YD7A 1RZFL 4H0HB 4Z5RA 3P0VL 3QDMD 3WLBA 4JKMA 2FNBA 2ICEB 5DC4B 1F90H 4EBQL 5KN5B 2NY3D 3L7FB 4NO2A 4IRZL 2E8ZA 1DQDH 4HW6A 1XF2B 4WUUB 2EKSB 4YHNB 3LEVH 4KRPD 1HSBB 2UWEA 2Y36L 4CVXA 4LSUH 2VL4A 1OTUD 4XBGB 3RAJL 2YPVH 5I1EL 1QFWM 1DDHA 1XFPA 3SKUD 1NLDL 1CIUA 1KYOJ 3QWRA 4DZBA 4JPIB 2PUQT 5MHSD 1XGTB 5CD3A 3HAEG 1LO2L 4PJCE 3DV4B 5IOPA 3NACL 5EZIH 4UOW0 5FO8B 3EHBC 4LLWB 5FGBC 4X7DC 5DS8A 1A1NB 4FXGA 4OI8A 3WUWA 2X1OA 3ZSTA 2ZUQC 3PP3K 2EKJA 1ZT1B 4M7JH 5HHNA 4HDIB 3RWFB 1AR1C 1PYWB 4PJAE 1A6TA 3DURA 1R3JB 2A83B 2D7TL 2YPKB 5C0DA 5I6XB 2XG4A 3QEUA 2OL3B 4HFUL 3MMEA 3EDEA 3QUML 3U9UA 3OB0K 1ZXQA 2BRRH 4MVBC 1X5GA 3VFVA 2F19L 5IB4A 4EDWH 2NX5A 4TUJA 1NMCB 4Z7VB 2XWTB 5I16A 3CCHA 2CRZA 2NZ9D 4LEXL 1QHPA 4UUJB 1KB9J 3UTSE 1M7IB 4QHKI 4APQC 3MRFB 4F7TB 1FVDB 3BP6A 1OAUL 4PREA 4RGOH 3EYOA 1UZ6F 4OLUL 5EWIL 2P8MA 4M7ZB 4UQ2B 3IGAA 1J1PH 3T3ME 3CMOL 5F71A 4UNVA 1OF2B 4JQVA 4MHHG 2VITB 4E0RA 4UAOB 2CR6A 1AKJB 2F5BH 4LGPB 3ARGB 5F7FA 3TN0B 5FECB 3F7RA 4X5XA 4WO4A 1QSEA 4J1UB 3IJYA 1Z3GL 3TYGH 1QEWB 3GMQA 4Z7OF 2H3NA 2VLRB 3IXTA 4YDJB 2DM2A 2WNGA 4P46B 1MREH 1H3XA 4OFDA 3LRHA 4TSCL 3T3PF 1VADB 5CCKL 3UBXA 2HRLA 4YAQA 1J8HA 2IH3B 2YN5A 3MLWH 4NSKA 4RQQB 3W81A 5BV7C 3VXUD 4L5FL 3TPUA 4FN0A 4HS3A 4FQ1H 2F58H 5GSVB 2A6KA 3IU4H 3KLSA 1GHFH 3EOTL 4LHUD 3WXWH 5ESQA 1R5VB 5F7NC 1ZHLA 4EIZC 5JUEL 1DN0A 3H9YA 4S10A 4HJJL 3TNMB 5EZJB 1D5XA 3RVXD 1DQML 4NKMB 5M7QA 5HXMA 1CDCA 3INUL 5HVHC 2GAZA 1I8MA 2QSQA 4D3CH 1CDHA 1I7ZA 4NN5C 1ORSB 2E6PA 1VPOH 4QRQA 1EFQA 3X11B 4OD1H 2YPLA 4KROB 1KC5L 5HDBF 5JHDD 5FAAA 3FTGB 1T1WB 4OBRA 1XGUA 4UDTB 5D8JH 3UTQB 2H45A 1Y6NR 3FOMA 1IM9D 1RJLA 1NCAL 1J86A 4I18C 4Y1AA 3DNKA 1D9KD 2R2EB 5DJ6A 2DIAA 2IADB 3ZHDA 3ILPB 3KJ6H 1EDQA 5D1XC 3QUYD 1II4E 1U92B 4GRLC 1E4WL 4KQ3L 1W0VB 5F89A 43CAB 2AXGB 3ZO0A 4LLAA 4Z9KB 4X9GA 4P2RB 4FQQB 4UT6H 3MNVA 2OCFD 1CFSB 4PV8A 1S9WB 2HFFB 2XXCB 5I8KL 1CL7L 1UZ8B 1TTUA 3QRGH 2VJXA 4RWHA 5EC1A 3NGBC 4QCIA 3PNWB 1GZPA 2EYRA 2LFGA 3D0VB 2WLYA 2VDPL 4M3JA 5D70H 1JTTA 1QRNE 3P3YA 2R1YB 5C0JA 2OR8A 4ZS7H 2OJEA 3LCYA 1QFWI 3SBWA 4PJ9B 5CLWA 3QUMB 1A6ZA 1QBBA 4M4RA 4MYWB 4TVPH 4DKEL 2FX7L 2DS4A 4ODHH 1D5MA 4RA0C 3GEWB 5I75C 4UDUA 2EYTB 1PKOA 2HWZH 3R8QA 4OV5B 4NZDA 3V4UL 3HE7A 1Z2KA 4MD4A 1Z9SA 2J4WL 2YRLA 4O2FA 4TPRH 4GS7B 4R3SB 1QKZL 3OXRA 1E4KA 4L8SC 3TZVB 1JF1B 2XTJC 1U8QB 2J2ZA 5D7LD 1SYVA 4NT6A 4M62H 3V5KB 1N3NA 2X1XR 4RBPK 2E6QA 5A2FA 4JFHD 1FFNA 4XP9L 4Y4FB 1ETZB 2CKBL 3H3BC 1SEBB 5E1AA 1KCUH 4Z0XA 2AABL 2QBWA 5KS9B 5JW3L 1R3KB 2FYYA 1CK0L 3X3FL 1OT1A 1R5IA 3R0MA 4NHCL 1QLRA 3P0YL 1FBIL 2HJKB 1ED3B 4JFZH 1UG9A 4XMLH 4F9PC 4YHYC 1KELH 4XPFL 4ODTL 4JPVH 4X6DA 5IJKC 3U0PB 5M95B 5DJ2B 3VXMA 4S11A 1BBDH 3E1F1 4JCMA 5T3ZH 1S3KH 2VZSA 3DMMA 2WWMC 3EYQC 2IQ9L 1GXEA 3FQTA 3QWRD 2WIIB 3WFHB 1TCRA 3T0EB 3W11D 3TFKD 1G7HB 3QEGH 2MWCA 4XMKL 1P1ZB 1DBJL 5D1ZC 4ZPVA 2Z93B 1IBGH 3KR3L 3LIZH 4PGCB 5L8JB 4PRNA 2WBJC 3BO8B 3RBGA 4RGNB 5BW7C 1H3GA 2W91A 4X5LA 2PCPA 3GMPB 4OZFA 4Q2ZA 4EUPG 1CE1L 4X99A 4R2GD 4PYHA 1DN2A 5D7JA 2P5WA 5EOCH 4JM2A 3LPFA 3VGHA 3P4MB 5FUCC 2WUBL 1CDBA 4Z7OE 1F02I 3DSNA 1TMCB 4PJFE 1KTDA 4HCRH 4Z7UA 1MCWW 3B8SA 3TH2T 2BVOA 4M43H 3QULA 4Z77B 1EFXB 3PL6C 1AO7A 2GJ6A 4D0CB 1JNNH 2XQYK 1GAFL 5FYJL 3IDIB 3GSWB 3MV01 1EHXA 4TSBL 4OCYL 5CSZB 1MJ8H 1G0DA 1BBJB 1W2KT 1NFDA 1CGSL 4X4XA 4XAWL 3H42L 1X5IA 3HNTL 2D9CA 3UPRA 1FH5L 2CPCA 4KJYA 4BH7A 3MLRL 1K8DB 4FQLH 4OCSL 1U3HC 1OAZH 1MLBA 3U0WH 3TO4B 5FGBA 2DM4A 1A1MA 1CFTA 3HZVB 3FQXA 4JY5L 1NH6A 4MZ2A 3K2UL 5IROC 1BOGB 4BQ6A 1CZ8L 4WO4D 3ARDB 1QSED 3UJIH 3IDYC 4GAJL 2Q76A 5IK3B 4NQSA 1IGCH 3PQYA 4LCWA 3FB5B 1QBML 4UOJA 2BVPA 2I25N 2R0ZH 5DGRA 2DL2A 4U1KA 4DUVA 1CFNA 1YYLL 1D6EB 1FNSL 1LO4L 5DUMH 5I66A 3W2DL 5HI5D 1JNLL 2QSCH 3GKWL 4Z7VF 3S4SA 1X44A 3V6OE 3RP1A 2VISA 2VABB 3TT1H 4JDVA 5ITBH 2OL3H 3BPCA 4JKPL 1NDGA 2IAMD 1LNUA 1MCIA 2WW8A 3KPSE 3HPLB 2UZYB 4F7PA 4XVSL 4UTBL 4AM0A 4GUPB 3QEQB 4XVJH 1L7TH 3S97C 3T2NL 1S9VB 4JHZA 4TVPE 4AQOA 2D31A 2XI9A 2CKBB 2WLZA 4MB3A 3U7YL 5A16A 4S1QH 5I17B 1RUKL 1EZVX 4NFDA 2DQJH 3QWQB 2NMSA 4UT9L 1Q9WB 3FT3A 3RWDB 5CD5D 4NRYB 1CI5A 5JPMB 4A6YA 1REIA 1RZIB 3MCLL 4XVTL 4ONGL 4U3CA 3BW9A 4XNXH 5DUPL 3TCXA 3MLSL 4LK4A 3D6GA 4KRPC 4WU5A 1OCWH 2XKNA 2ZSVA 1HCFX 2X4PB 1RMFL 3ZHLA 5DVKA 1G6RA 2BSRB 5DUBA 4ZNEE 1SQ2N 5F7DB 3RNQA 4IOIB 4OCRL 5BJTA 5ESVB 2AKRB 1QTYT 1UT9A 2IGFH 5C0CE 5C9KA 2EDHA 4BFBD 5EUOF 1E4JA 3ARUA 5HHOE 3RX8A 1T2QL 1KOAA 5EORH 4U31A 5BMFH 5E24E 1XGPB 3FT2B 1V3KA 3W39B 4G8GB 3I50L 4X6EB 1V8HA 4MJ6B 1ZT7A 2VLJB 3IKCB 2VSDA 1MFNA 2E9BA 2HH0H 1SYSB 3IFPA 3U30B 5JZ7D 2XY2A 3DXAE 5DI8B 1F13A 1DUZB 2H32A 4RNRB 1KEGH 3K7UA 5T3ZE 1CLYL 5IVXB 1WBYA 3GSUB 3NCFB 3GI8L 1P84K 5HVWA 3T4YB 1FIGH 2AJXH 2GYSA 3VWJB 3GNMH 5AUMA 3ZYZA 5IR1B 2LTQC 1K3ZA 4XH2A 1BF8A 3QNYB 3BPLB 4FXLA 3VGAC 1NCTA 1UM4H 3MV8E 1AGCB 2I26N 3ARPA 5DJXB 1RURL 3GJEB 5DTFA 3B6SB 1X6NA 2P44B 2XRAH 1FZMB 1BHGA 1PKQE 4GRLA 1WC7A 2XZAH 4JFEE 1CFVL 1HIML 1JIBA 4JQIL 1U0QA 2J6EL 1JZ6A 3UTSD 5D93B 5IGXL 1VSCA 4XRCB 1NBYB 1QFPA 2VZ1A 3HLAA 3DVNB 3HFMH 5DRWB 3F65A 3Q6FA 5IKCB 3Q3GB 5BRZE 4JGJA 4WEUD 1EGJL 4PJGA 5CJ5A 2Z31D 3PWPB 4GRWH 1CICC 5IVZB 1BQHG 1PD6A 1W72L 4YEEA 3BOVA 2LE9A 2XG5A 3U4BL 4X9BA 5IB2A 1WITA 1DBKL 3WCYA 2EXYC 2OMBA 2X4UA 5D7SL 4V2BA 3VFUB 4FQHA 1TJIH 3S3PA 1IAIM 3EDFA 5E8EB 4XCCL 5DD0L 3PDOB 5TE6L 1SMOA 1L6ZA 1S7VB 2PR4L 2PXYA 3VI3E 1HYRC 2DQIH 2ZCKH 2YA2A 4WFED 2B0SL 1JHTB 1WZ1H 5IFJA 2BXZA 3VXMD 3IFNL 4MDJA 1L0QA 3O0RL 5I0ZA 3DMMD 2HTLD 1K4DB 1LO0H 4LPYA 1H15A 3QUMH 1FAKT 4QTHB 2NQCA 4J12A 2ITDA 4XZUB 3L3IA 3RVXC 1WWCA 3LPWA 2H2SD 1JPFB 1PZ5B 3GGWB 1SEQL 5CEZD 4WHYH 4ZD3L 1EERB 1OWRM 3RJQB 2VQ1A 4MQSB 3QA3A 5FUZL 1IZJA 5IIEB 1RSFA 4L8SA 4BQCA 2D3VA 3O6KL 3V5HB 5HYSB 1A8JH 4WI7A 4LPVA 5DA0B 4N1HB 2ZZUT 2VR4A 4BUHA 3M1BA 4L3AA 5GZND 1HHGA 2CMRH 1XF4A 5KS9F 1D9KC 3O4OC 1RZ8A 2B5IC 4ZSOB 2EEAA 1KCVH 1OSZA 3K1DA 4AMKH 2YA1A 4P5TD 2YR3A 4JFOA 5ICZB 3K8LA 1U9KA 4ONHA 4FTVA 1JGEA 1A2YB 2YD3A 1U93B 2JE8A 4P23C 3LKNA 4X6CB 4P5MA 5C0IB 2AK4B 3VD9A 4Z7VE 5H94B 4JZOA 3TGXA 5GS0D 3LSOA 5HYFA 3QHZL 5IJKA 2ZNWA 5BS0B 2Y5TA 4B5EA 2Z9TA 4KJPD 3S36L 1NFIA 3ZDZF 3EFDH 5ITFA 3DWTA 1INEH 4ZFFA 4MLIA 1UWXK 2VR5A 3ARXA 5D1QA 4KI5C 1JFQL 1OP3K 1A14H 3U7WH 3OAZH 4Z78A 5DJCB 5D1ZA 1JZ8A 1MHHA 3IXAA 2X4TB 2PNDA 4IMKC 1OGAA 3O8XB 5TE4H 5J06A 3HNVL 4HJJH 3RPIB 4LHUG 1JYXA 5BW7A 4Y16D 2PW2B 4O2EA 5CS7A 1LEGB 4OI7A 4LPCA 4J23A 4OQTH 2XV6B 5J4MA 1TVHB 1T0MA 5HHPB 3OGCB 1FRGH 4MSWB 4RISL 4J4PA 4X9FA 1QQDA 4YWGH 3T2QA 1NC4D 4LARL 3AM8C 4Z76B 2Y5EA 3ZHKA 2V5MA 3WS6C 4Q9CA 4UIMA 2ICCA 4QTIL 4QY8B 4BJLA 3ARYA 3LRGA 4F33B 5JMOC 4QXWA 1T3FA 4HJ0D 4NRZB 2GT9A 1LE5B 5F1NB 1K5NB 2XWBB 3VFMB 1ZMYA 5BZWB 3SDAB 1P7QA 4K94L 2ADFL 4QHNB 2OBGA 3DSFH 3V52H 1W0YT 1C1EL 4MNQD 1YN6B 2V2WB 5EUOE 3CFBA 3RWJB 3VJ6A 4KMTH 1BFOA 3MR9B 2DB8A 4L9DA 4G3YL 2WINA 3GJFK 3C5JA 1MJUH 1E4WH 4KQ3H 4MS8C 4HG4J 2NY4C 4G9FA 2GTZB 2OZ4A 1MVUB 1W72B 4OQ1A 1C16B 2BVTA 3PF2A 1U8HA 3TVMD 5MENE 3ZSSA 4O00A 4KMQA 2AGJH 4LKCA 3WFBH 5I8KH 2GSIA 2XXMB 1NGZA 4D9RD 3WXVL 1AP2A 2ADIA 3UTTE 1U3HA 1EBPA 2ENSA 2ZUVA 4MNGA 4QKXB 1SBBA 4UQ3B 2DYPB 3X3GH 5IROA 4XPHL 5D6CA 3BPNC 4CMHC 4PGEA 1CIDA 4UTAL 4Y4HC 1QNZL 3GMMA 5JIHA 3W11C 4PRHD 2F5AH 3BWAB 3WJLA 1IT9L 2XZZA 5KN5A 3H3PH 3FB7A 4PJXA 5DXWA 5ADPL 2BSSB 4DK6A 4WUUA 3OX8B 5HYEA 1XF2A 4WHCA 4GRWE 5L2JA 4HH9B 4P2RE 5KSVB 4XBGA 5I1IH 3KXFD 5I1JL 3RGVB 3RNKA 3G08B 4R2GC 3O81A 1VGKB 4XPGL 1N5YL 4PJ7E 3V4UH 1A7OH 2N1KA 2B2XH 2I5YH 3K8MA 2BNRB 3MRLB 2XT1B 3ARFD 5H2BA 1IAII 2R69H 4LNRB 2DICA 1ZLUH 5EC2B 4DWHA 1P6AB 1ZA3A 4I3RL 1B0WA 4FS0A 4U6HB 1MLCA 1T4KA 1UC6A 1AIFA 2R29L 2W9EH 1LP9B 4MNHB 4ETYA 3PWVB 1LWRA 5SWZE 4YXKH 1ODAA 1BIIA 4HDIA 1T2JA 4TNWK 5HJ3B 5HYJE 4HBCL 4MAUL 4DOHE 1M6OA 5F9JB 1G7IA 4WFGD 3VFPB 2CKBH 1QFWL 4F9LA 1R3JA 3G6JA 4R4FH 4NQCE 4OLVH 2YPKA 3N50A 3P2TA 1EBAA 4PJEB 4DFIA 1X5YA 4XI5D 4H8WL 1ZWIA 1XGQA 1FZOB 4NIKB 4IEFB 3UC0L 4GOSA 4GAYB 4OFIA 2QQLL 3IJSA 2O61B 5F9OH 1NCDH 2CDFA 3HZMB 5KSUB 4ODTH 1RUAL 4YHIB 3NFSL 4MJID 2CDEA 1TQCC 3SDXB 4QXGL 5B38G 1YY9C 1WIPA 4WWKC 4HIJB 2QEJA 5CAYB 1VENA 2BVYA 3CLEH 4KHTL 4MD5A 4DZ8A 1WFTA 3TV3L 4E41A 3KR3H 3T77B 4PG2C 1KEML 4NZUL 2B1AH 1FCGA 1JF5A 4CDHA 4AT6B 1OAQL 5DO2D 1FVEA 3RGHA 4PBXA 1X4YA 4U2YA 2IFFL 2R0LH 5INCB 3JWNC 2IH1A 5L88L 5IVXF 3ARGA 5FECA 2YK1H 1UWEH 4K3EH 2DMKA 2OR9H 3TPKA 1IGYA 5EU5B 1RZ7H 2FGZA 2V2TA 1QEWA 4FFVC 4HV8B 3P73A 2A74A 5I9QC 4LSDA 1DANT 5FDYA 2C1OB 5A43C 4WFFE 4XPAL 4QGYA 4I9WD 2D7PA 3EDDA 2JIXB 3WIIL 4KPHH 2IH3A 2VZTA 2FATH 1M7XA 2EDOA 4BQBA 3WNKA 2AXHA 3T0EE 1OT2A 1MIEL 3MRGA 4JG0L 5FM5M 1NSNL 1N6VA 3C6LA 3KPSD 2D7MA 4AIZB 2FEEI 3RY5A 4CW1B 1BIHA 3PV6B 3PXJA 1EHAA 3FOLB 3SKOB 4J2XA 5LCVH 1K2DA 4XAWH 3H42H 4QRTB 2VIRB 3F5WA 3TBTA 3L5JA 1CICA 4HUWB 5JNYA 3CD4A 2BNQA 5DEFA 3WFCH 3BIKB 4JY4B 3N85L 4QRPE 1DL7H 3BEVA 5IMOB 2W65A 2NY0C 3CFEA 4HKXA 2C3VB 3MOAL 1FO0L 1P4LB 1K3IA 2YOCA 3SQOH 3L5HA 1WICA 2R2EA 2IADA 1FYTD 4U1GB 3UTZB 1OAXH 3SGEI 5DT1L 5E0QA 3LEYL 5ISZE 1W0VA 4L4VE 4HUVB 3QDGD 3H7LA 3GKWH 5JZ7C 5LJYH 1YNTA 1CG9B 4FQQA 5HHOD 4H20L 4JPKL 1S9WA 1NL0H 3IAQA 3RVTC 1OGAD 1XGYL 2WWKT 25C8H 3TBSA 4XVSH 3RZWA 5T5NG 3MACL 3C8DA 2OTPA 4L8BB 5F70A 1RK1B 3P11H 5EU3A 1WV7T 2VDMH 4MMXC 3IETB 3U7YH 4X98A 1RUKH 3BKMH 3FAWA 2IPTH 2APBA 4IIQC 4ONGH 1A64A 4RWYH 5DUPH 1ZOXA 3QHFH 4L8DB 1ZLUK 1BJ8A 5B39B 2DLFH 4QHLA 4XPBH 5D7KE 3BD5A 4DAGL 4HWNA 5DJAA 3RRQA 3TIEB 5T3XL 4X6CF 5KSAD 1QLEL 1JWSB 3B9EA 2C4XA 5SX5K 2ZCLH 2IPUG 5GGSB 4MA1B 5DJYA 1AFVL 4N8PA 4PJDB 3TJHD 2VDNL 5AYQA 1UM5L 3MV7D 1FHGA 2AJZB 5IQ9A 3M8OL 3WO4C 5E9DB 4JFED 3BEWA 3C2SA 5LKNA 1ZA6A 2VTFA 4Q6IC 4NQXB 3AAZB 3NN8A 3ROOB 5KAQF 4GKNB 1K9TA 1KNOB 5BRZD 3I75B 5CKGA 3HC3L 3PJSB 5F1KC 4U05A 4NN6C 4DVBA 1KB5H 32C2B 5CZKA 4KK5D 4AEEA 4OIIH 2J5LC 2OQJB 4U3HA 3DUUB 1LILA 3MLZH 4MX7B 3UZEA 2CJUL 2ZWLT 3MJGX 2R2BA 1MCDA 3DARA 2DLEA 1R3KA 3PWUB 4XCNB 3UDWA 2VDLH 1OWWA 4XVUC 3AM8A 4JB9H 4XPTL 5HGAB 4XNZB 4R0LA 2HJKA 3GI8H 4YC2C 4P2OB 4UB0L 3T0VA 3AXLA 4WUUD 3R4DA 1YEKH 4HWBL 4YPGB 3AS1A 1Z9OA 4YDIH 3PWLA 5GJSL 5FB8A 2EIZA 3MRMB 4CNIB 5GS1C 3S96A 5C0ND 1G9NH 4P4KB 1IGTB 3A6CH 3SE8L 1N6QL 1G7HA 4D9LL 5IEKA 4D0BA 4FABL 2QR0B 4PGCA 1VFMA 3I3EA 5KBNC 4RDQG 4FQJH 4GAGH 5JIPA 4LGSB 3BQUB 3NFPA 5ID0B 1HE7A 4PRIA 3SPVA 2HYMA 5T5FH 2DD8H 3QXDB 4HIHB 5KTEL 1EGJH 3SCMC 4AY0A 1G7MB 3DX6B 3SDDB 1QOKA 1FO0B 4FQIL 1IC5L 2PKDA 1HWGB 4U0QB 2HJFB 1A7BA 2YKLH 4W4OC 3T8XB 3QI9C 1AGFA 4PB9H 4RFEB 2H2PC 2VN4A 1S7SA 4Y4HA 1SVZA 5DD0H 5LVEA 2P8LB 2PR4H 3HPJA 3P4LA 5B22A 3BT2L 1RK0A 1KG0B 1C5BH 2EZ0D 2P4AB 2X70B 2CD0A 5CSGA 4XCYB 2FEDC 2NY1C 3GM0A 4OTXL 5JA9A 4K2UH 2A77L 2GK2A 1BBJA 4GBXB 1ADQL 1R3IL 4U1IA 2YC1B 2DIJA 3WE6A 1CU4L 1LP9F 2DBLL 4X7SH 5FUZH 5DFVD 1CTNA 2WM0A 4IDJL 5E95B 1E27B 3TO4A 3SGJA 1AKJD 3ARGD 4WI4A 4X4ME 3TN0D 4HJ0C 3EJYD 4XWGL 4B41A 2HVKB 2YWYA 1GJIA 2BOCB 5IK3A 4OCNC 3K46A 1MCEA 3FB5A 3OF6D 1KUMA 2VLRD 4KHXH 4PJEF 1AXTH 5DVOA 4P46D 3QDJB 4OLWH 4Z8FL 1T7XA 1OQXA 4ZUVB 1CD1B 4JY6B 3O3EA 5C2BH 1MFAL 4WCYL 4XNMB 1BZ7B 3B5GA 5CJOL 4N0FB 2W0PA 4IOFC 1DBBL 1PG7L 3KWWB 3SDXF 3TVMC 1ZHNA 4JO2L 2VDQL 1OARL 2OM5A 2VABA 4QXUL 2AXFA 2CRIA 1GGTA 5D5MA 4HIEB 3CVHH 1WTGT 4HGKC 3NCBB 3UXFA 1W0WB 3QEQA 1S9VA 3I6LE 1FG2A 4PP1D 3LZFL 1I1AC 5E1HB 1A7PL 3HKFA 5ICYA 3RWDA 4PG2A 1UFUA 5DRZA 3WLWD 5ETUB 4KROD 3QCVL 4OFPA 4ETQA 3BH9B 3U36B 3AY4C 4L29B 5LQBL 2B1HL 3MBXH 2X4PA 5HGDA 5I1DB 4OZGA 3TH3T 4JN1H 2NNAB 1XF3B 4KAQH 5TPWH 1KIRA 1MSPA 3H9SB 4IDLA 2VAAA 4JCLA 4X8JA 3TT3H 2VXUH 1KENH 5ESVA 1CDYA 4QNPE 3LEXA 2ATKA 2PO6C 3BHBA 4P2RD 3GJFB 2KDGA 4P2QB 3PP4H 2FJGA 4YBHA 1NBVH 1QVOB 1C1EH 1J10A 5EPMB 1OQOA 4PTTB 3KPRE 4OLZL 7FABH 1QFHA 5C6PB 2E7LA 1F4YH 3D25B 4G8GA 4TVSa 3L9RA 1DQQB 4P57A 4P9HL 2MCPH 1TFHA 3S34H 3OJMB 2YWZA 4EOWH 4WNQA 4Y0GA 2LU4A 4XI5C 5LWYH 4IS6B 3BESR 2HRPH 5E8PB 3ES6B 1YNKL 1YYML 3TC9A 5DI8A 5GGRB 1DUZA 1P5VA 5HHXL 1IC4L 1N64L 4PJ9D 5IVXA 2OI9C 4UT7L 4HIIA 4GH7B 4PLOB 3WJJC 5IB1B 5FYLL 1CD9B 5JQ6L 5ICXB 2P5EB 4X80L 3VD7A 5IR1A 2KZ1B 2DOCA 2ITCB 3CH8A 4FRWA 5E2WH 2IFGA 5TQ2H 3QNYA 5IEHA 1YPZB 3REWB 4KDTC 3P9LA 3OJVC 5TE7L 1AGCA 4QGTA 3BUTA 3BKJH 2FD6H 1S8DB 3GJEA 1LE9B 4K9EL 3ULUH 3VFNA 4CUCA 1T1YA 1TPXC 3T0WA 3NH7H 3TZVD 1QR1A 1HHHB 1MRDH 3MZGB 3MBEC 2DI9A 5I1JH 2C4FT 4EKXA 1NBYA 3W9EA 1L7IL 1N5YH 4XPGH 1ZLVK 5J56B 5DRWA 5DQDH 3QUXB 4J3OC 4NC1E 1JGVH 1DBAH 5JOFB 5JW4R 3B2VL 4Y4FD 4YGAB 3LHPH 2VC2L 3OJDA 3BJ91 3TBVA 3L3KA 1JPTL 3PUCA 3BZFB 4IIQA 1HKLL 5F9WC 1KV3A 4ODSH 1EPFA 5FCUL 1ZS8A 4HBCH 3JZ7A 1S7VA 5C07B 4LCCB 3V6OC 1QFWH 1EO7A 3L95B 1KJMA 4R7NA 2JJTC 5IM7A 1JHTA 2OX5A 2E27H 3TA3B 1ZVSB 3Q6GH 3EGSB 4PJDF 4TRPH 3KPQB 3CSYB 5KW9H 2IBBA 2C9AA 4QF1B 3QUZC 5HHMB 3BP5A 3W5MA 2QQLH 4I0CC 3T0ED 1RJYB 2KBGA 2QQKL 1YUHA 2IJ0C 5AYUL 3KLHD 4KUZL 3NFSH 4M4PA 1UKSA 2AS5M 1I3RB 4QXGH 5LGKA 4YX2H 1IAIL 4RGND 3MXWL 3QJFB 2ZUUA 1HK6A 2CUMA 3MYJB 3P40A 3CDCA 4YNYB 1A6VL 3U79A 1EVTC 5TFSH 2RGSA 1DEDA 1CDJA 5E6IC 4KGLA 4XX1E 3UBXI 2FL5A 5FFLA 1FNLA 3PV7A 3RA7H 4N9GB 5SX4I 4ZSOA 4OF6A 1I9RH 5L88H 4EN3B 3B5HA 1AGDA 1VFOA 3O45B 4PJ5B 4RSVA 1IAOB 4U7MA 4O58L 4XC3L 1VKXB 5B4MC 5L7XH 2Y1VA 3FHAA 3O2VL 3QPXL 2UVEA 4MAYC 1EFXD 3OR7B 4X6CA 1I8IB 4MDIA 4C83A 4HWZB 4NZTH 4DKFH 4LSSH 2DLGA 3S8WA 3WN5C 1IQDB 1EZVY 1MFBL 4W81A 3SDXE 4M6AA 4YH6A 1GOFA 2EC9U 4YK4C 1F11A 1HYSD 4HH8A 1FNEB 4ZFOL 2UVFA 4HMCA 1EEZA 3W0WA 1NLBL 1V7MH 4PPTA 3ROLB 1IVLA 3IYLW 2NTSP 5H8DA 3QIUC 3EW3B 2O5YL 4LRNL 1LQSR 1IEBB 1NSNH 2X4QB 2JCCA 5LGHH 3THML 2X4TA 2ZG3A 1U8MB 1P4IL 4ZFZA 4LSTH 3FQRA 3TO4D 3O8XA 3J8F7 2FO1A 3MC0A 2FIKB 3CZJA 4HKJA 3WIFA 4HG4K 4F7MB 4X7CC 1LEGA 3ARDD 5T1MA 5ILTL 4Q97A 1FSKC 4L3EB 5J9PB 3LD8C 3N0PB 1U8LB 5HHPA 2ED9A 1X4XA 3MSPA 3TJHC 3K1KC 5FK9B 1QBLH 2AV1A 3SKMB 5C0AB 5TDPA 3O6FC 5GGQH 4NNXA 5FKAB 4OM0H 4QY8A 3N85H 4OT1L 5D7KD 2V6HA 4W4OA 1LE5A 4QXTB 3OXSB 3P9WB 1I9IH 4LASH 3QQ9D 4MCZA 3T04D 5GISH 5DC0A 5CUSL 1EH9A 2J6EA 4QHNA 3SJVB 4DUWA 3JTSB 3C6SB 3O3AB 2G9HB 1KFAL 5A2LH 3LEYH 3P77B 2CKNA 3QEQD 4KK5C 3VG9B 2Y25A 3GSNL 3STZA 3TLRA 3RDTC 1DEEB 1QRNA 3E0GA 4OAWB 15C8H 5GHWL 4CBPA 1OOAA 4H20H 1V5JA 1AGBB 3DTXB 4WJ5B 5CP3A 4DKAA 1QFOA 3F7YA 5DD5H 4Y19A 1BD2B 1M71A 1OB1B 4OZHB 1KN2L 2W0FB 5I8EA 4YUEH 2GJZA 5FYKL 1IARB 3ULUE 3MLVL 3MJ9L 3QO0A 4R90H 5EG6C 1PLGH 5C0NC 4HK0A 1UXWA 1R3LB 4DEPC 1FL3B 2LU3A 1RJCA 3RWHB 1ZLSH 3AREB 2YD8A 2JJWA 4L9LB 1UXSA 2BSTB 1IE5A 1JMZA 4M8QB 4JGUA 5E8DL 2R0WH 3RBSA 3VFTB 4HH9A 5KSVA 1MFCL 4M9OA 5IT2L 2X4RA 4G9DA 3G08A 2R8SL 5AD0B 3HC4H 1RFDH 1UENA 3D87B 4H1LH 2PYEB 3MRLA 4Z7WB 1MPAH 4G8GD 4YBQC 5CJQH 4LNRA 1HI6B 2VLJD 2CLRB 2HTKC 4NO0A 3WSQH 3ARBB 4U6HA 2VLLA 4GXUN 4EDXA 2ZKHL 3DYPA 1I1AA 4X4YB 4U7SA 2YMXL 1QO3A 1YJDH 4KK8C 3HC3H 2A6DB 1G9ML 4XCFH 5E03A 5HJ3A 3C60C 2VH5H 2ZOKA 1F2QA 1NMCC 3VFPA 4OLYL 5T33L 5CKAA 3VWJD 4ODUA 1A4JB 3ZDXE 1RI8A 2YZ8A 1S9YB 2R0KH 3AY4A 2GTWB 4OF0A 2J88H 3HMXL 4OB5H 5F1SA 4PJEA 4AK1A 5FYJD 4P3CL 4UINL 4DGVH 1MI5E 1CD8A 1MF2L 3QEHB 1E28B 4PJDE 5D7IB 4ZFOB 2VL5A 1MNUL 1F6FB 4X9IA 3GHBH 4M7ZC 2X4NA 2VSCA 4KY1L 4PP2B 3FB6B 4HWBH 5E9DE 3SY0B 1VEMA 3RWIA 3WHXB 5E00B 1EK3A 2W9DH 2PO6A 5KOMC 4G8EA 2NY2B 4XNUL 2EC8A 3EJYC 5IBUB 4YDVB 3ARVA 4ORZC 1N6QH 4QRRA 1MCJA 1E6OL 5IFAL 4RIRA 3RZCB 4BA8A 5HPOA 3S88H 3PWPD 3T77A 4EEEA 5DFTA 4FABH 1S5IL 1EO8L 4AT6A 2Z91B 1MY5A 2NY6B 1QRKA 1MAML 2C3WA 2IQAB 1HILB 4JZNA 3SE4C 4PJFA 2CIKA 3S5LA 4NPYA 5CWSB 1YDPB 2ESVE 4XT1C 3D18A 4FG6D 3DV6A 4FQIH 1BGXL 4E42B 3L5XH 3WJJA 4JHAH 2ZSWA 1YPZF 2C1OA 3D85B 2Q86B 1LVEA 5SWSE 4LU5L 3L1OL 4OSUL 4NWUL 3RL1B 2MPAL 1TLKA 4ERSL 1J87A 3PHOB 4LCIH 3U82B 4YQXL 12E8H 1RULH 3ULVL 3VH8A 1NAMA 4JFDA 3STBA 4BZ1L 3TESA 1F6AA 5E6YA 2EO9A 1DSFL 4KROC 4WRLA 3HE6C 3VRJB 4AIZA 4LQ1A 1IAKB 3MBEA 4YHPB 1T7ZA 3KPPB 3SKJL 4HC1H 3FOLA 3I6LD 5IV2A 4KQ4L 4Z95H 2DQUH 3OV6A 4U6VH 4QRTA 3GO1L 3GSVB 5H37H 2VIRA 3AMKA 4GFTB 1MCWM 4XP4L 2XQBH 1G7QB 2GW5A 3BYYA 4IDJH 5JA8B 5CZXC 1P4BL 2A0LD 2E7MA 3T65B 5IMOA 2XTLA 2GFBB 1JBJA 3OAUL 4I0KA 4YHOH 4Y89A 3JVGA 4NGHL 4O51A 3U0TA 4F37F 1P4LA 1H8SA 3GB7B 3IDMA 3V6OA 3VMOA 2AK4D 3JTTB 2A73B 2JJTA 3VFGL 4I3SL 3O11B 5BS0D 1ES0A 1IGFL 4U1HB 5F7EL 5CJOH 4Q58C 5E2VL 2OTUA 4YDLB 1S7WB 1DBBH 2CGRL 3VWKB 3DX9A 3FFCB 3QUZA 3K4DA 3DRTB 43C9A 1C5DB 1EEUA 2VN7A 3KHQA 1OSPH 3MRQB 1WIUA 1YA5A 4PJ9C 2FJFB 5EFIB 3BZ4B 3O8XD 4Z7NE 2XZCH 1ORQA 4MQ7A 2UYLB 4P59L 4E9LA 1A6PA 4WHDA 2W38A 1JGUL 2FECI 3LZFH 2BRQA 3P4OA 2Y23A 4MXVF 4PRPA 5DMIH 3CZFB 1KJ2B 1S7XB 1GCFA 3QDJE 4NP4L 2D0GA 5DSCA 4KZDH 5B39A 2DDQH 4QLRA 1NJ9A 4Z18A 3T08A 4YHMH 2B1HH 5C0CA 3OPZL 1MVFA 4OZ4B 3DHJA 1H3PL 1MCPL 5EOTA 3SDAD 3TWCL 4KVNH 4Y5VB 5GGSA 1XT5A 3KNBB 5IB3A 3BRGC 3QZWA 4ZAKB 4FP8H 1G84A 1YY8B 2Z35A 2IANB 3HRPA 3HI5L 3NAAH 4TQEL 1I7TB 4Y4FC 3EOAB 3F62A 4NNYB 3E3QE 4XP6L 1B0GB 1URLA 3DLQR 4U1JB 4PJIB 3NABL 1RZKC 1P2CA 4KZEL 2VUYA 3QIUA 3WKML 4WY7H 3DXAA 3RKPA 2BVEA 5F1IA 2DWDA 1HHIB 3D2UB 4OLZH 3M07A 4YXLH 4N5ED 5IBTL 4P9HH 4NQDB 1JHKH 4J8RA 5DZNA 2DYPD 1T0NB 3CXHJ 2OQJA 1C5CL 4KVCL 4J3UA 3O3DA 5FM8A 1SHMA 1UB5B 3T09A 3VI4E 1TITA 3ALXA 1NFKA 4ZS6D 1OAKL 5HHXH 1N64H 1XGRB 2ZP0T 4TNVK 3MV8A 5EIIB 2HVJA 5HGAA 3T0EC 4Q9QH 3UCRA 3KLHC 1A5FL 4O4YL 4RAUB 4WI3A 4Y2DB 3MO1A 1QSFB 4P2QE 3MRMA 4NNPL 3RGVD 4WHYG 4WV1A 4JO1H 2FJHB 1JUFB 3DRQA 2H9GB 4W6WB 3ZKMD 1CT8A 5MI0C 4RFNC 4PUBH 4S2SB 2BNRD 4BSWA 1ZHBA 1PG7W 1LD9B 2H8PA 5HVFB 4JZJB 3GBLA 5I15H 2HG5B 3VG0L 3RDTA 3GSRB 1L7IH 5E5RB 2YSSB 3ZKXC 2EDDA 5EU4B 5DJ0A 2EDJA 3ISWA 4OZHF 1L6XA 1FLTX 4HIHA 4NUGL 3JXAA 2J12B 1IGJA 4M5YH 3SDDA 5FCSH 4DCQB 4G7VL 3LAFA 4BZ2L 1FO0A 3FO0L 2VC2H 1E6JH 1RZJL 2HJFA 4RAVB 5ENWB 1JPTH 3WIHL 5J3HD 3BP4B 2Y6SD 2VZ3A 4GG6B 4R97B 1YPZE 2IMMA 1EHLL 2YEZB 1MHPH 3MLUL 3B9KC 4WUKL 5I71B 4EUPH 4XMPH 1GC1L 1A4KB 5C08A 3NMEA 1MCSA 3P30L 1G7JB 5KSBE 2JKXA 3U9PH 4Z0BL 4Z7WF 5FDWB 3ARDC 1LDSA 1VFBB 3B2UC 2E7CA 1GZQB 1IKNC 3DO7A 1GYAA 4EVNB 4LCYA 2JTDA 3H2WA 2Q6WB 5JLZA 5L8LB 5DK0B 1E27A 4H25B 4X0KA 5L2KB 1KBGL 2Y4SA 5JOPD 2IEPA 4FQCL 1J11A 5KVDL 5J1AA 2HVKA 4IRJC 5L0QC 2XNAA 3QQ9C 4G6MH 5C07E 1MHEB 1J0KA 3S37H 3C60A 1XR9B 2EXWC 1Q9LA 1A9BB 2YRZA 2L7UA 4NQEA 5F3BB 2NY5C 4NZRL 3GBMH 5MEOB 4ZUVA 5D7IF 2JIXD 3FN0L 3CFCL 4XC3H 1LO5B 3QG6A 5FUOL 4O02L 4NDMA 3O2VH 2CXGA 1KACB 2NXZC 5HHME 3K81A 5CJBA 4YBLC 3KWWA 1ITCA 3MJ7B 3X12A 5HPMB 1JYWA 2AJVL 3CVIL 1FJ1B 1QG3A 3L7EB 1NLBH 3NA9L 4ELMA 4R26H 5F6IB 4NO3B 4R7DB 3VXSB 3X14B 1I1FA 4HHAA 4DGYL 4ENEC 3D39B 3CK0H 3F7QA 4YFDB 3QFJB 1T22A 1ONQA 1P4IH 2V7NA 4WHTA 1Z5LB 3BAEL 5KVEH 3MREB 1NGYB 4JRXA 4PJ5E 3FZUD 3BH9A 1AI1H 1V05A 1MRCL 4HMDA 3C8KA 2AK1L 2IBZX 3WHE1 2R2CA 3VE0A 4JJ5A 2X10A 2R23A 1A3LH 3E6HB 4OGZA 3IDGB 3A0OA 1MEXL 3JWDH 1HHJB 3H9SA 1ZVHA 4N5UA 5EOQH 5KJRL 4N0YH 3GMLB 4ZDHA 4FQ2H 1WZKA 3UEZA 1FV1B 2HKFH 1T6VN 3U30C 1CE6B 3BVNB 4S1SL 5MENA 2Q1EA 4YXHL 3WLBB 3FHQA 4Z5RB 1MELA 5L9DH 5C7XL 5B8CA 3HE6A 1RUPH 3O2WL 4NO2B 5IWLC 1TTFA 4JFPB 3PE9A 4LQFH 5GJTL 1ZANH 2DLTA 4KC3B 4G7YL 1HWHB 5GHWH 4KKNA 5KVFL 2UWEB 3NTCH 4CVXB 1KGCE 5KVGH 1YC8A 2QKIA 3BPLC 4M9PA 1IFHH 5C6TL 1DDHB 2A6JA 4JREC 2AEIT 4RRPG 4DZBB 1SY6H 4HFWA 1FAIL 5CD3B 5IB1A 3ARRA 1Q72L 1CXIA 5IOPB 1YEHH 3DHMA 5HI4D 2ITCA 3FQNA 2ZCHL 4DN3L 5DS8B 1A3RL 1J1XH 1N0LA 1B9ZA 3MROB 3VXTA 4GW1A 3GDBA 4FXGB 1S7TB 3V4VL 4PJ7A 5DMKA 3WUWB 4K71C 5E4EB 1MQKL 1J05A 3SDYH 2AEQL 3SEPA 3D0LA 4F58H 1T66D 3B4NA 1B90A 5E9DD 3TJEH 4K8RL 1CFBA 3SGEH 5ADOL 4FZEH 5DEGA 4N0RA 5FF6A 4I5BA 3QEUB 3G04B 4YE4L 5JIKA 5SWZA 1OAYH 2F15A 4JPWH 3MMEB 3C09B 4YDKH 3U9UB 3RUGA 3VFVB 5IB4B 4PJBA 1YQVL 2HLAA 3UPAA 2NX5B 4NQCA 4TUJB 4NYLA 1AD9A 4FA8A 4FMKA 4QOKE 2NLJA 4HIXH 3LN5A 3CCHB 5I16B 4NJAL 2F53E 2DQTL 1CTOA 5K59F 2YMXH 3BD3A 5D2LB 2ARJA 2QJDA 1QBAA 5IVOA 5IUSA 3BP6B 4P2OD 4PREB 1FE8L 4LCCA 5IHBA 1BAFH 3EYOB 3E6FA 5L6YH 6FABL 4QHUB 2P8MB 5CEYA 4S1DD 3TA3A 1ZVSA 3HI6L 3IGAB 1KJ2H 3KPQA 4KK6D 4LVHC 4MXQD 4E0RB 3QIBA 5IQ7L 1L0YA 3EYSH 4G6JL 2YXFA 4XBEL 1A6WH 1F8TH 4P4KD 4RAHA 4X5XB 1MNUH 4MXWL 5K9JL 2E7BA 2APTA 3G5ZA 1RJYA 2PYEE 4Z7WE 1U8IA 3IJYB 2V2XA 4PJIF 3GMQB 1CLZL 1TJGH 3OKNA 2A0LC 1NANI 4JQXC 3BQUD 3MYJA 2RAMA 3UBXB 1J8HB 3IAPA 3RWGB 2BDNL 4ZTOL 1ND0A 3SDDD 5DVMA 2A6KB 1EO8H 2HKHL 3KYNA 1WAAE 5ESQB 1MAKA 2X9XA 5GPRA 3JV6A 1DQLL 5BVPH 1DN0B 3EFFA 5DK2A 5D7IE 3MJ6A 1M05A 3FRPG 1JF6A 1V3MA 4M93C 1D5XB 3ULVF 3EJZC 2LU7A 1QYGL 3WEXB 5DR5H 3OR7A 4RMQA 5IESL 1BREA 2GAZB 1I8MB 2ZG1A 4OQTA 1I7ZB 4S1RH 1FNFA 4QRQB 1T03H 4LU5H 2YPLB 1I8KA 2DM3A 5D71H 4J3TA 3S35H 4ERSH 3OG4B 3GM8A 1RAMA 4GBXD 1IILE 2H41A 3FOMB 3LOWA 4GMTL 4QO1A 1IEBA 1RJLB 5C0RL 3OSKA 5IHUH 4Y1AB 2BHYA 1G9NC 4R9HA 3HUJE 4ELKA 1I3GL 3G9VA 2X09A 4JDTL 3SKJH 1PEZA 3VRIA 2DLHA 5F89B 1BEYH 5T1LA 3SDAC 5T3XD 2WUCL 1B4JL 1OVZA 5HYSG 2BNUA 3CH1A 5CZVL 4O2CA 4PJ8C 4ZXBA 3MNVB 4KRLB 3QDJD 4GG6F 4PV8B 1RU9L 1ZE3C 3NCJL 3QIWB 1UA6L 1NGQH 5ISZA 5EC1B 4EJ1C 5KANI 4QCIB 4C56E 1GZPB 2EYRB 3OZ9H 3BN9D 3B9KA 1J1OH 5C0JB 2DQDL 3SJVA 3JTSA 4NC1C 4W4NA 3B8YA 3O3AA 2OJEB 4N5EC 5TDNB 3IFLH 1ZV5A 4KH2A 1A6ZB 1FPTL 2EYSB 2CGRH 1IAMA 1RZGA 1D5MB 4OAWA 3PWJA 1IKNA 3JWOH 1H5BA 4UDUB 4ZS6C 2DF3A 1FL6A 3ELAT 5FA4A 1QZ1A 1BD2A 1JPGA 1WEJL 4X6FB 3O6ML 2WANA 4P59H 3O4LB 3HE7B 2VLKA 4G6AC 4KUCF 3H9ZA 2D2OA 3N1PC 2BVQA 4O2FB 5KAQG 3T0DA 3OXRB 2FWOA 1FVCA 1G7PA 1TTGA 3RGVC 4N8VA 1BWMA 2WZPD 4NT6B 3ZKMC 1R3LA 1JPSL 1N8ZB 4JG1L 1LO3H 3H9SD 4L4TE 1LEKB 4L8CA 3MOBL 5IMLB 4F15B 2BSTA 2J8HA 4PS4H 1KJ3H 1CBVL 1FFNB 2BK8A 3D3VA 2CUIA 3LQAH 3OKLA 3FFCE 4P2QD 5E1AB 4Z0XB 3FQWA 4NKOA 2XYCA 1D5IL 5GIRB 5BVJB 5FHAL 5FV1L 3FO2A 4BSJA 2VDOL 1ZEAL 2FYYB 4UV4L 3HAEB 3QDME 1R5IB 1Q9KB 4TQEH 1N7ML 4GW4A 1QLRB 2Q8AH 3RTQC 4AH2A 5DK3A 1VEOA 2BJML 1NCCH 2VXQL 1UEYA 3QRFM 5AAWA 4NN7B 1D7FA 4M7KH 1W8NA 3E8UL 3EAKA 2FECL 4KKLC 5DMGD 2E9WA 1UWGH 2AERT 1DZBA 4N8CH 3BKCL 5IBTH 4PRAA 5DFWH 3FQTB 1T89C 4N9OB 3OAYK 3F12B 4BKLB 2EICA 4MD0A 4ZPVB 1PX3A 1FQ9C 5BV7L 5AWNH 3SO3C 3EKCA 4KVCH 2P5ED 3B9VA 4LVNC 3RHWK 4WEBL 1MCLA 2PCPB 3D9AH 4OZFB 2G75A 4K3JH 1YNLL 1JL8A 4X99B 3IT8D 3FO9A 4V1DB 3UO1L 1K6QL 5D7JB 1A5FH 2QADB 4PP2A 1BQLH 2JF1A 2P5WB 3HRZA 2D03L 4JM2B 3SY0A 3WHXA 3C08H 5CIPB 1SBSH 5CILL 1KPVB 3X17A 2AJ3B 4OFKA 5D72L 1GGCL 2DQFA 1CFQB 3QUXD 4Z7UB 5DQ9B 2MQ0A 2FB4L 5D9SA 2BVOB 2NYYD 3QULB 2UWEF 4U1LB 1DE4B 3B5TA 1AO7B 1RIUL 2GJ6B 3VG0H 5IWLA 2BY2A 3BRDA 2XOTA 1IC7L 1NMBH 3O6LH 2VDRL 3U2SB 4QWWD 4D94A 4KKAC 1I85A 3I6GA 1RVFL 2E3VA 1UCBL 3K4AA 4WI2A 4ODWA 5CWSA 1YDPA 1RHFA 3VDAA 1R5WA 5C07D 1NC2A 4HSQA 1NFDB 2C1PA 3TO2A 1U58B 1CR9H 4E42A 1CL7I 2ZOLA 3TA3D 3ALPA 4KJYB 4BH7B 1M7DA 4XX1G 2Q86A 2A9ML 1H9VA 2OR7A 2AJUL 1MLBB 1A1MB 3IDXL 4C55A 2QHRH 3FQXB 1GPOH 5HHMD 5D2NE 3MLUH 3GSNA 2ZUQB 5JDSA 3IFOA 4HK3N 1MFEL 1HCVA 3PQYB 4NQSB 4LCWB 3WD5L 5F96L 1UACH 1AY1L 4W6XB 1ZTXL 5FEBA 1JRHL 1UJ3C 1IAKA 1OTSD 3FZUC 4Z0BH 3KPPA 4X4MA 3ULUC 2JB5L 4XP5L 3VXUE 3ZE0E 3CNKA 5J8OA 1J5OL 1F42A 5HDLA 1JYVA 3S37X 5E8OA 1S78D 2VISB 4U1GC 4JDVB 1N4XL 3BPCB 5E2JA 1IMHC 5D2LF 4IM8A 1QFUL 3UP1A 2FX8H 4EN3D 4PJ5D 3T65A 4GG6E 4F7PB 4PGDB 4AM0B 5KVDH 4JM4L 2VMFA 4APQB 3DX7A 2D31B 3LMJL 5A16B 4JFQA 3O9WA 4CGTA 3I6KB 1U8KB 1LK3L 4RX4A 2Z0BA 1G7LA 4PRDA 2DQCH 1U8OA 3BW9B 2UZIL 3ECBB 1F2XK 5FUOH 5F7KC 4U1HA 2BY0A 2R1WA 4PV9B 3ZE1F 3LN9A 5GXBB 3CIQA 1F58L 2H1PH 3CLFH 4WU5B 1VFUA 2XKNB 2ZSVB 5IBLC 3DRTA 5A1AA 3QH3A 4URTB 2FRGP 2AJSL 3CX5K 3TIDB 1H3VA 2C5DC 3HCVA 5IFHH 2FJFA 5EFIA 2MMXA 5DUBB 4LCUA 2UYLA 2R4RH 3RNQB 4OGXH 1NCWL 3NA9H 5BJTB 4L3ED 3TBYB 5FYLD 4ZFGH 4JFYA 1X5AA 1RUMH 3HMXA 4C59B 1E4XH 1Y6MR 5C0AD 4ONOA 2DQGL 5SX4H 4HWEH 1OP5K 1T66C 4P3DB 5TF1L 2CH8A 3V7AE 3VW3L 1ZT7B 2F8OA 4OZIB 1KB5A 3IFPB 4W6YB 5B3NA 3BUYB 4C4KT 3NZHL 2V7HA 1MEXH 3SJVD 5HVHB 3HG1A 1HXMA 2H32B 3RIFK 3KPRA 3V9FA 4NN5B 2AEPH 4WI8A 4OD3L 1MIML 2LVEA 3MRCB 1B0GA 3ILQD 4JJHA 3LKSA 4XH2B 3QFJE 1DR9A 1NPUA 4S0SD 1BD2D 1HHIA 3D2UA 5C7XH 2UZXB 2X9WA 1MWAL 1INQB 1T5XA 5DTFB 5BQ7A 5D1XB 4C4KO 2C7UA 4DW2H 4GRLB 4KK6C 1WC7B 4G5ZH 3SDCC 2CXKA 3UTOA 3KPMB 5DLMH 3LY6A 4PJ8A 4PJHA 4X83A 5I1CH 3ARED 5ECJE 2EDRA 5I30H 3Q6FB 4LSPL 4PJGB 4JDZA 1WWWX 2EDYA 1HSAA 2FH6A 4RAUA 2OZ4L 3JV4A 3BIAX 1QSFA 4DN3H 5I0DA 1EMTL 3BGAA 5IB2B 1U95A 5I18L 1A7RH 4HF5L 2X4UB 2H9GA 4MJ2A 1ZSDA 4FQHB 4S2SA 4GKSA 1MQKH 2PYED 4FFZH 4HK3J 4FFYL 2GJJA 2OJZH 2PXYB 3ARBD 3WO3B 1IQWH 4JZJA 5EOCJ 2Y06H 3R0NA 5IFJB 3QG7H 4HS8L 4M6OH 4MDJB 1HH9A 2MSPA 4HEPG 5I75B 3A6OA 1TETH 1H15B 3PGCA 1ZKAA 4DN4L 4DCQA 1YQVH 4UBDC 2VQ1B 3KYKL 2HFTA 4WTXA 3QA3B 3BKYH 2I60L 2X44D 4L8SB 4XP1L 2XTJB 5HHVL 5DC9B 3VA2C 2YUXA 3M1BB 1A4KA 1HHGB 1JK8B 1H3TA 4XC1H 1PSKH 4YR6B 1CXHA 1VGEH 1RZ8B 3QNXB 4LIQH 1TQBB 2NY2D 5IQ7H 1ULVA 3DVIA 3L6FB 1OSZB 5FGCE 4JFOB 5DDHA 4IBLT 3RY6C 1CLCA 4ONHB 4FTVB 3T4AA 3RZCD 4Q9RL 2Y07L 1EAPB 1F00I 4Q0XL 2F54A 4X6DF 3UTPE 3LKNB 4P5MB 2I27N 2X40A 3GMRA 2NY6D 4JVPA 1VERA 1JV5B 5EUKA 4H25A 3LSOB 1A6UL 2CK0H 5I73B 3OMZA 3Q5TA 2Y5TB 4ODBD 2BFVL 2G5BB 2J3SA 2J8UE 3ESVF 1NFIB 4TNVF 1SJVA 5ITFB 1NCUA 5C0BA 4ZFFB 5A40E 2HKHH 3BSZH 1T89A 5D1QB 4Z78B 5D1ZB 4POZD 1MHHB 3IXAB 3D85D 3KHOA 1YJDC 1U91A 3BDYL 2ZUXA 3V4PL 3C87A 3E3QC 2AI0L 4P9MH 2WBJB 4NM4H 4LRIA 4PY7B 5IB5A 1Z0NA 5ALBL 3S35X 4O2EB 3ARQA 5EBMA 5CEZH 4JM2F 5FHBH 1QSEE 2F9BT 1G9EA 4UIKL 1MCFA 1T0MB 1QQDB 4K7PH 2X9YA 5I8OL 4UIMB 4OZFH 3LV3B 4Y4KC 5FM4A 4Z7UF 2HLFC 2B4CL 3V6ZA 1T3FB 3VXSA 5GS2D 1HHKA 5FYKD 4WTZA 2YA0A 3D39A 3LN4B 1XCQA 4OCLC 1P7QB 4KJWD 2CK2A 3ARZA 4ZTPL 4EQ3A 4XNQA 1DBML