1RP8A

Crystal structure of barley alpha-amylase isozyme 1 (amy1) inactive mutant d180a in complex with maltoheptaose
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLAFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type 1 isozyme
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rp8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rp8A01
3CHCA 1UG6A 2CETA 2VZSA 3BUIA 4NX0A 1LLOA 5BXSA 2XG9A 3UG5A 2IXUA 4NRRA 2WMFA 1GOWA 1E71M 2V3DA 2WCGA 3W82A 1E1EA 5BRQA 3ZT6A 4OUEA 1C93A 3EJPA 3QHOA 2PF0A 5DF0A 4PTXA 3OB8A 2CYGA 1WDPA 3AJ7A 1E5NA 2QV4A 2J7FA 2XVPA 1OT2A 1P6WA 4DUVA 2XJ7A 2CBJA 2VZTA 3AS2A 3I3BA 5JBDA 2XM2A 1ITCA 5I24A 1MYRA 2XSBA 5EBAA 3POCA 3A3HA 1TQTA 1ESWA 3RJXA 2YBTA 3FHQA 1U2YA 2XVNA 1W1PA 1CEOA 5A6AA 3VM5A 3UR7A 5E6YA 4HA1A 2DSWA 4EAMA 3CTTA 2EBNA 1NH6A 4W86A 2OW6A 1HKKA 5M5DA 3D50A 3L4WA 4CN6A 5E70A 2E40A 3ARWA 4TVCA 1QNOA 1OT1A 3ALGA 3VX1A 4YHGA 2WK2A 3B9DA 4A3HA 3NDYA 2XIBA 1HP5A 3T2OA 2DT3A 5DT5A 4GI6A 3ZJ6A 5BRPA 4UQDA 1UWRA 4XB3A 5DMYA 3CC1A 3ARXA 5I3DA 4HA4A 2VRQA 2IXVA 3TTYA 1UYQA 2D0HA 1W2VA 1XC6A 4TTGA 1H1NA 1LL6A 1QOXA 4DO5A 3UR8A 1G01A 3AHTA 1UWUA 2XPKA 4A4AA 3QHNA 1LL7A 4Q22A 3A4AA 3II1A 1V3LA 1TA3A 1B3XA 1JZ8A 2MANA 1GHRA 2XGBA 1JI2A 1HJSA 2X8RA 3SURA 2G3IA 1JNEA 3H55A 4K68A 4MNKA 5GNYA 4PMNA 5A8OA 1I75A 3A5VA 3SCVA 5CSYA 1L0PA 2D3NA 1GUVA 1W2PA 3AIUA 1W9XA 4BQ3A 3W29A 4LPCA 1JXJA 4M56A 3WD2A 2GJRA 2DT0A 4M81A 1U30A 1HT6A 3N9KA 1JF6A 4AMXA 4DUXA 3WFZA 1BGAA 2WC3A 4QDMA 1NWSA 3WELA 3GH5A 2DSKA 4FF5A 4JL2A 1J12A 2ZXAA 5CGTA 1EDQA 1EGZA 2V3FA 3SCPA 2WBGA 3S5ZA 2YL6A 1V0MA 3VGEA 3F5LA 4D6JA 4BQ5A 4ATDA 1K9EA 7TAAA 1KXHA 1WDSA 2WHJA 1BHGA 2F7RA 2J75A 4WJXA 2BY1A 1VRXA 4ZE5A 4L4PA 1WB0A 1WZAA 4NZJA 1US3A 1OIFA 1UR0A 1B0IA 1E1FA 4WKFA 2GDUA 2XN1A 4ZEPA 5CLTA 3ZR5A 3VOCA 2EPMX 1QPKA 3BMWA 4BA0A 3HN3A 5A3HA 3VUPA 1XD1A 4M24A 2OWWA 3WQVA 3KL5A 2W5FA 3WY3A 5BXRA 2VZUA 1CGWA 1M53A 2WLZA 4UFLA 4B3KA 1JYVA 1UWSA 4CD4A 3OLGA 3BAJA 4UFKA 1KGXA 1W3JA 1BPLB 4FLSA 5A8MA 3AIQA 4V28A 1DWIM 1WAWA 3D4ZA 1WZMA 3WNPA 3L4XA 1BYBA 1DTUA 4QAWA 4MB3A 2J8GA 3LPFA 3S5YA 1KR1A 1HL8A 5ABFB 3VKKA 3AHYA 3PZMA 1EQCA 4GZIA 2VRJA 5A2AA 1L8NA 1H41A 1B3YA 3TV8A 3CO4A 5A6KA 3ARUA 4JAWA 1A3HA 3VGBA 3D52A 3WD4A 4AISA 2DSUA 4KGLA 1GORA 3WDRA 1W9PA 3VIGA 4LX4A 2Y2WA 1UD5A 1NM9A 2VUYA 4J3TA 1JIBA 2OYLA 2X2YA 5E0CA 1R85A 3EDDA 4W5ZA 1MVYA 1W3HA 8A3HA 4MNLA 5I5RA 4AY1A 4AIUA 4JFTA 3GNPA 1GONA 3BSGA 3F4VA 1B3WA 1JF5A 2ZUVA 1Q6GA 3BVWA 5EFDA 3THCA 3ZJ8A 1W1YA 1H0IA 2VR5A 1OCQA 3J7HA 3MUAA 2J7CA 1OBAA 1E56A 4AEEA 3L2MA 1NP0A 5EFFA 3U5UA 2W63A 1VBRA 2EPNA 1AQHA 2X2HA 3D3AA 5I2UA 2EQDA 1QBBA 4GI9A 1VFFA 4UFJA 2CKSA 4M80A 1E6XM 4CCDA 3IAQA 1EHNA 3I3EA 3VD5A 2J25A 2ZOXA 1QW9A 3A24A 1FHDA 1F4AA 2BVYA 4S3JA 1H49A 2WBKA 1UZ1A 5CG0A 1KXVA 4WIWA 2FE0A 3WNNA 2J8FA 2E0PA 1BGGA 1V0NA 3GM8A 4U2ZA 4MJ4A 4IISA 3PTQA 2WHMA 4AD3A 1FFQA 4AIOA 4HU8A 2VZOA 3AQUA 4RE3A 1S46A 2D22A 1NWTA 5E0FA 2CNCA 3ZT7A 3AHXA 3PZIA 4Y7EA 2V3EA 3IJ7A 3BLPX 2YL8A 4CD5A 5I77A 3GXNA 2PI6A 1XCWA 2J77A 3LRLA 4PN2A 1GOMA 3WNMA 2E8ZA 3EMZA 4YN5A 3N13A 1E43A 3AMLA 4EK7A 1HF6A 2JE8A 3L2LA 2YFOA 5CLWA 4DO6A 4JFVA 1KQZA 3VDAA 1ZBKA 4XX6A 4UCFA 2ZX8A 3S6TA 5IHRA 1RH9A 4F66A 1ISYA 2EPKX 1LQ0A 1Q6CA 1NOUA 5KEZA 3VDBA 2FGLA 2CBUA 4XV0A 1M7XA 3CHDA 4MB5A 1CYGA 1HJQA 1ECEA 1CXEA 2A3AA 3MSDA 1HWWA 3NDZA 1C92A 1XSJA 9CGTA 3OGRA 4IPNB 2VQTA 1J0KA 1C8XA 2WCSA 4PMVA 1VJSA 5D4YA 2WSKA 3CHEA 3GH7A 5FOOA 3L4UA 2AOSA 4QLLA 4DWSC 5AYBA 3WY4A 2BY3A 1GQJA 5CPSA 3CUFA 4HZ6A 1BG9A 4JKKA 2JEPA 3DX2A 4Z2GA 3AZRA 4FNRA 1ITXA 5GNXA 3RO8A 1DWAM 4JZ5A 4QLJA 4P8UA 1E15A 4H8UA 1G5AA 1UD6A 2WXDM 2D0GA 2CBVA 3FAWA 2VVNA 2BXZA 2V5DA 2Y24A 3OLDA 5CGMA 1OIMA 4AZ6A 4CU7A 2VL4A 1JNDA 6CGTA 3QOMA 2GSJA 2VCBA 4TXEA 5BROA 5A6SA 3AS1A 1M03A 3BC9A 3CPUA 3AS0A 2VCAA 2GK1B 3RJYA 4QP0A 3GBDA 3MU7A 6A3HA 2VMFA 4HPGA 4ML4A 4KMQA 3CZ8A 4P7NA 4PMOA 2EACA 1KR0A 3OIHA 5DO8A 1C91A 1QI4A 1KXQA 1B31A 5HPCA 3SUSA 1V02E 2W4XA 2QF8A 1KCKA 3WL0A 3WDJA 5JBEA 1TMQA 3FW6A 4UR9A 4OOZA 2F61A 3W37A 2ZIDA 1W91A 2WHKA 2EADA 4H8HA 2J74A 3AIRA 3WMCA 1UKTA 3UERA 1BYCA 5D9PA 3UETA 2WLYA 5FD0A 3VINA 5LA1A 3VD7A 1H3GA 1EDGA 3NSNA 3VIPA 5A8PA 5M03A 4HZ8A 4FMVA 4J3WA 3W53A 4AD5A 2J79A 1SMDA 3DDFA 1G94A 4MB4A 4HTYA 2E8YA 4U5IA 5JBFA 4PYSA 1ISZA 3RILA 2W67A 1HKIA 2IUZA 1V6YA 3SCWA 2VURA 2PWEA 5A6MA 2DQXA 3WMSA 3HG2A 4Z2JA 3GYCA 4WKHA 2DH2A 3VM7A 5E09A 2WB5A 2XFRA 1GJUA 1K9TA 3DYMA 3AIBA 4N42A 1XGZA 5AY7A 1JZ7A 1E4LA 2ZX6A 4LYQA 3CZSA 1BLIA 5CSUA 1J01A 1WNOA 4JCMA 5BCAA 1NOWA 2ZX7A 3GXIA 1U33A 3W28A 2A3CA 4AC1X 3FNDA 1HKMA 4B3LA 3U57A 2EJ1A 4P7OA 3QOKA 1CIUA 3LXCA 5A8NA 2W66A 1JYNA 2CBIA 2D24A 2J7HA 3BUQA 3D4YA 4PMDA 2WMIA 1UH4A 3VMOA 2NT0A 1J0HA 4MTVA 4ZFMA 1LJYA 3AICA 3WDPP 4OKDA 1QX1A 1B3ZA 5M3WA 5A2BA 1QI5A 2ZWZA 5A6JA 4PMXA 2A3HA 4V27A 1HP4A 3T0BA 1TVPA 1V02A 3VD3A 3VGFA 1HNYA 4E4PA 3WEMA 2E3ZA 1E6SM 3OG2A 1G1YA 2W62A 4HU0A 2AAAA 5GNZA 2CITA 1H09A 2OSYA 5HBFA 1ZL1A 1E6ZA 4PMRA 2WAGA 2BHUA 1W1TA 2OYMA 2YL5A 3KL3A 5D8ZA 5FL1A 2XVKA 2WNWA 4UZUA 4M29A 1CGUA 5HXMA 2ZUWA 4M1RA 5I79A 3WEZA 3RIKA 3WEOA 2ZUSA 1XRVA 7A3HA 1ZU8A 2VX4A 2Y5EA 4PMUA 3HG5A 1CGVA 1N82A 3LX9A 4Z2LA 1HL9A 3K1DA 3WNOA 1FFRA 3JUGA 1QNQA 2CKRA 1PIGA 1KTCA 1KTBA 4ATLA 2FHCA 3WF3A 1YQ2A 1KB3A 1MXGA 3A21A 4H8VA 3EMQA 3BVXA 3GBEA 2BVTA 2GVYA 4W93A 1E5JA 3SEPA 1GQLA 3WD0A 1MQPA 1XV8A 1KBBA 2FDMA 4PUEA 1BTCA 3W38A 1OGGA 4OZOA 1X1NA 1WCGA 3IJ8A 2NW0A 1NP2A 2YFNA 4J3XA 3QR3A 2YIHA 4X0NA 3EJRA 1AQMA 3UCQA 3CMGA 1EQPA 1K9FA 3WDIA 4W5UA 3FN9A 2WC4A 3L4VA 4UFMA 1DWJM 1V03A 4NZCA 1ISWA 6TAAA 2X1IA 2DDXA 3WH9A 1ISXA 2UY2A 3WQ5A 2QLYA 1BYDA 3CIVA 3M46A 3ARTA 1J11A 2WMGA 2ZXQA 2FHBA 2VT0A 2V5CA 3PZ9A 4W8BA 4AYGA 4W84A 3ZT5A 2D20A 1RPKA 4AZCB 1VENA 5A2CA 2F1BA 5D9NA 1M04A 1GHSA 3IJ9A 3U7VA 1OINA 4W88A 1EOKA 1LWJA 1VIWA 1KQYA 3ARRA 4WK9A 4NSBA 3L4TA 4DWSA 4FNTA 3AYRA 1UR4A 1CBGA 4NRSA 1CGTA 3WIJA 3OLIA 4RL3A 1MQRA 3AIEA 3E1F1 3K4AA 2GJPA 4B15A 1KBKA 1JD9A 3T09A 3K8KA 3M07A 1KCLA 3N17A 1CENA 3THDA 2EPOA 4FNUA 4B9YA 1RP9A 1E4IA 4NXKA 4YHEA 1SFSA 3PZVA 5LA2A 2BVDA 2YA1A 2TAAA 3WDHA 1CNVA 2X05A 2YDSA 3VNYA 1O6IA 3HZ3A 4UOJA 2GK1A 3N18A 4PCTA 5I6SA 2VX6A 1QI0A 1E0WA 2VNCA 5A1AA 3W6LA 4UQ9A 4PMZA 3EDEA 2O92A 4S3KA 2DT1A 4D1IA 1Z32X 3N1AA 3WSUA 1RP8A 3BAIA 3TTQA 4W7UA 1XSKA 2WHLA 1R33A 1W9UA 2PC8A 1HJWA 4P7RA 3CBWA 5HPOA 1V3IA 1QNPA 1JZ6A 2J7EA 2YBUA 2WANA 1JYWA 1X6NA 3CZNA 1ZBCA 3FAXA 1GNXA 3WKZA 4Z2HA 4JHOA 2WVVB 1UD4A 1WP6A 4D6IA 3EDFA 1E3XA 4AZIA 1W3KA 5DEZA 1UWQA 3T0DA 4RE4A 2ZUMA 3WQWA 2W92A 4E8DA 3VIIA 1VJZA 3W4RA 4UQBA 4P7QA 3QGVA 3T2QA 3T08A 1O7DC 3AHZA 3BUPA 1BF2A 1WDQA 2XSAA 5FIPA 1J9YA 3B9EA 2DPEA 3WF4A 3VGDA 2PWFA 1JYXA 3DHUA 1CZ1A 1UKQA 3BAWA 3EDJA 1W1VA 3GH4A 1E0VA 2G3MA 2BXYA 1UD3A 4J7RA 1EA9C 4CGTA 1QVBA 3ARZA 2WPGA 1D2KA 4HMEA 1Q6DA 1CXLA 3EJUA 2ZUNA 1VAHA 4OGZA 1TZ7A 2JIWA 2ZWYA 4GQQA 4CD7A 1NOFA 1JFXA 3VIJA 1MFVA 3S2CA 2D1ZA 4P8WA 3ZM8A 1WZLA 1B9ZA 4AD0A 1IT0A 1KGWA 3M6DA 3W27A 2WSPA 2ZUTA 1V6WA 4JCLA 2J7DA 1H5VA 1W9BM 4OIFA 3MUZ1 1Q6FA 5ABHA 2XFYA 4MB1A 4OBRA 1OSEA 1I1WA 1H0GA 3BCDA 2FH8A 5I0DA 3MKKA 2XFFA 3EJTA 3RDKA 3VIOA 3WF2A 3PZGA 3CUIA 3LXAA 4D72A 5FL0A 4AZBA 3IGUA 3K8LA 1UH2A 3CZLA 3HJEA 1ODZA 2O9RA 4MJ2A 2GJXB 2WKGA 1XYFA 5GPRA 2VJXA 3AHVA 4AXNA 4KRUA 3NJ3A 3IAPA 4MADA 1DP0A 4MDOA 3MS8A 1GOOA 1IZJA 4LYPA 4W7WA 1GJWA 1R47A 3ARYA 2VO5A 3KLLA 3W81A 3NYDA 2WC7A 4IUGA 2HVMA 2JFEX 2Y4SA 4A3YA 5LYRA 4RE2A 2JF6A 3SUVA 1XHGA 3L4YA 4NF7A 4JKMA 3ZIZA 2G3JA 3CUGA 4MNMA 2UY4A 4CD6A 1XCXA 4U31A 4CU6A 3B9AA 4PCSA 2CXGA 1PPIA 3BVVA 4KH2A 3CV5A 4DWSD 3VMNA 3DX3A 1EH9A 1UQZA 1W32A 1JXKA 2Y8VA 2EABA 4JFUA 4D6EA 2YL9A 4P8VA 3CUJA 3BAXA 4PSRA 3WH5A 1SMAA 1C7SA 4PRWA 4J28A 2EO7A 2OWXA 2PWGA 1E6QM 1G0CA 2WVVA 4ZXLA 4ACZA 1V3MA 1A47A 2VI0A 1QI3A 4J3SA 3IANA 3BXWA 5AC4A 3EDKA 1MW3A 3EJSA 1HTYA 1FH7A 1HVQA 3T2PA 1VFUA 3MI6A 4V2XA 1DWHM 3WNLA 2C8NA 1KWGA 1E9LA 4CN4A 2ALWA 2WZHA 1JAKA 1C8QA 1TCMA 1CXKA 1FH9A 3AXHA 4U3CA 3M7SA 2DSZA 2ZICA 5A6LA 2X0HA 4AWEA 1QBAA 3OBAA 1CLVA 2WVSA 3U5YA 1X6LA 4PSPA 3NCOA 2Z1KA 1JDCA 2XN2A 3EJQA 1DWFM 2VZVA 3AS3A 1UKSA 3WH6A 1UR8A 5I78A 1J10A 4PUDA 1V6VA 3SUWA 2B31A 4TX6A 2CHNA 1UUQA 2CERA 4W7VA 4CCCA 5CJ5A 4J3VA 2QPUA 1XH0A 2XWDA 4N0RA 1HJUA 5F7UA 3VSVA 4HOXA 3O9NA 1UD2A 3U7BA 2F8QA 1UQYA 2XIIA 1NWUA 2JF7A 2XGIA 4ACZB 1MWOA 5ABEA 4C7FA 3OGVA 1QWUA 2X09A 4BQ4A 1CXHA 3O6AA 2X2IA 2X0YA 3WY1A 3AMDA 1UWIA 1JI1A 5AC5A 3AROA 5DT7A 2D0FA 3PBGA 2WKLA 1QHPA 3CZKA 2UWFA 1XD0A 4JIEA 3ARSA 1QHOA 1E70M 2F7QA 2ZUUA 2J62A 3L4ZA 3BLKA 3HG3A 2FHFA 1CTNA 1JAEA 4LXFA 3BCFA 5KZ6A 3AXXA 3TONA 1UOKA 4WF7A 1O7AA 2UY3A 2VR4A 1E40A 4OOUA 4Z2KA 1J0IA 5A6BD 3W0KA 4W8AA 1V08A 3VU2A 4OJYA 4FNQA 1BG4A 1HKJA 1NQ6A 2OW7A 3WN6A 2VX5A 3VD4A 1ZB5A 3PN8A 1J0ZA 4HZ7A 1GW1A 3ZSSA 4UQAA 2BHZA 3SCQA 3MMDA 3BAYA 1VFMA 1H2JA 3G6MA 1VEOA 5D9OA 4XZWA 4YPJA 3ZSTA 2DSVA 4AMCA 5BXTA 3APGA 3OZPA 1QHZA 3NSMA 5CZKA 4QCEA 1CDGA 4R5EA 3MO4A 1UWTA 1DHKA 3OLEA 4LGXA 2PWHA 4PEEA 3AZSA 3PTMA 4TVUA 3VD9A 2D23A 1VEPA 2OLHA 3DX1A 1V0KA 4Q7NA 3WFLA 1PZ3A 4WSJA 2GFTA 2VQUA 8CGTA 1TA3B 4J27A 1PEZA 1MW0A 3PTKA 1GQKA 3SCRA 3WUEA 2DGAA 3ZJKA 4GZJA 3OA5A 3WQ8A 4D6CA 1PX3A 1GOQA 1JZ3A 2DH3A 2G41A 1KXTA 1OWQA 3K8MA 1WO2A 3BVTA 5IFPA 1J0JA 2D3LA 1B1YA 3WUBA 1E6RA 1VBUA 5C71A 1UASA 3BUBA 2O9TA 1G9HA 1TQWA 1FH8A 3MV11 2BFGA 3PZNA 4TVDA 1NARA 3KEHA 1GZJA 1RD6A 2WVUA 1E0XA 1LF1A 4XZBA 4NI3A 3FY1A 3RCNA 5CPTA 3WD3A 4F9DA 2A3BA 1EXPA 3FHAA 3N11A 2PB1A 2WMJA 4JHZA 5C8BB 2J7BA 3SCTA 3ZO9A 1UR1A 1TQUA 4NZFA 2BY0A 1ZBWA 4F79A 3MUY1 3LPGA 2WWDA 5E6ZA 1PX8A 1ODUA 3AXIA 4U33A 3SCNA 4AD1A 2WZEA 4H41A 3CZEA 2E9BA 4D6HA 1R34A 5ABGA 1Y7VA 1BYAA 1UR9A 3RMEA 4EKJA 3HG4A 2JIEA 1R7OA 5CXPA 1CECA 1HVXA 1PJ9A 2YLLA 3WENA 3WUFA 4MDPA 1GVIA 3N12A 3WF1A 2YOCA 3BSHA 1KGUA 3CZGA 1PX4A 4F8XA 1E73M 4AYSA 4FLRA 3RPMA 3AIVA 3WH8A 1JZ5A 1VEMA 1E3ZA 2FGZA 5D9MA 5A8QA 2GJXA 3HU7A 3ZOAA 1M01A 5M17A 2XM1A 3VDHA 3NSXA 2NT1A 2V38A 2VC9A 4LQ1A 2CIPA 2A3EA 5FCZA 3KLKA 1OGBA 3B8SA 3A4WA 1WPCA 4HP5A 3GNRA 2VRKA 2WMHA 1PAMA 5JIWA 1GQIA 5E1QA 1ZJAA 2VCCA 1DEDA 4PTWA 3W6MA 2PBOA 1MFUA 4ACYA 1JL8A 2PBGA 4UZSA 3BH4A 1PS3A 1GOKA 1TQSA 3PZUA 4GIAA 1SR0A 5TD4A 5I23A 2E9MA 4QLKA 2YA0A 1PZ2A 1IZKA 3TTSA 2EPLX 2DEPA 2X2JA 3AMGA 1V3JA 3LRKA 4XUYA 2Y8KA 3AMCA 1JDAA 4GI8A 4HOWA 2XVLA 3CHFA 5CPQA 1CPUA 2YJQA 5HNNA 4GPNA 5EMYA 3DX0A 3W26A 5A69A 4H7VA 3UESA 2EXOA 4W8LA 3AI0A 3GXMA 3GDBA 4QCFA 2C7FA 4B16A 2JEQA 4AIEA 5C70A 3LXBA 1UKOA 2CCRA 1E4MM 3BLBA 1QW8A 3ARQA 2ZE0A 4CVWA 3D51A 1LG1A 4U3AA 3DDGA 3AYSA 2UY5A 3CZJA 2WWCA 1JGIA 3WQ6A 3VO0A 4KRTA 3OGSA 3VMPA 3WQ4A 1UHVA 2YKKA 3VVGA 1D7FA 2RGMA 5JUVA 3GXDA 4AZHA 1H11A 4BF7A 5A6BA 4C7GA 4D6FA 3A22A 2WZIA 3NIYA 4GZEA 1EDTA 3I3DA 1QNSA 4KGJA 1FHLA 1UA7A 3ECQA 1K6AA 3SUUA 1NWRA 4BQ2A 2IGTA 2G3NA 3SCSA 2VX7A 2E9LA 4D71A 1MXDA 3CH9A 3O2LA 3GXTA 4UOQA 1GPFA 2F18A 5E9AA 3D5HA 1WKYA 1WDRA 4P7LA 1LWHA 3LPPA 2CHOA 1FA2A 5IXEA 3DX4A 1B30A 3VIMA 2GDVA 3A6OA 1C8YA 2DT2A 4OBSA 1BVNP 2VVSA 3MMWA 3MMUA 1E4NA 4Z2IA 4HMCA 2NSXA 3VILA 1B90A 1EHAA 3DC0A 1CXIA 3NUKA 4GO8A 2F7OA 1BSIA 3TOPA 2XHYA 1J0YA 4IM4A 2HISA 1GVYA 2WM0A 3BMVA 3LRMA 3MV01 1IV8A 1Q4NX 4ATWA 1TR1A 4H04A 1VF8A 1BVZA 1V6XA 3DHPA 3GXPA 1E72M 4EANA 1TG7A 2FH6A 1UD8A 3H54A 5IFTA 3KZSA 3EYPA 1R8LA 3PZOA 4BCEA 1TFVA 1XYZA 4UFIA 3GNOA 3KE0A 4AW7A 1UA3A 1HXJA 1W9DM 3ZQ9A 1OD0A 2BS9A 3PZQA 3BAKA 3WDQA 1JZ4A 4AEFA 4CN1A 4TOQA 3W24A 1VFOA 3N15A 4EE9A 3HMCA 1R46A 2XYLA 1XH1A 1V3KA 3PZTA 2Q8XA 4PTMA 2OSXA 1UZ4A 1MW2A 2EEXA 4UOZA 2VTFA 4X9YA 5A94A 1D3CA 3A4XA 1F4HA 1CGXA 3DECA 3A23A 1AMYA 3BUDA 3ZMRA 1E6PA 4JFWA 1B3VA 1FP8A 4PBGA 1HJXA 4AZ5A 4DM2A 2YLAA 2D73A 3A47A 1GCYA 1JD7A 1SYTA 2D2OA 3K4DA 2FYVA 5EB8A 1V3HA 2W61A 4W87A 1SZNA 2RGLA 4CCEA 1CGYA 4GKLA 1UR2A 1LG2A 2OSWA 4UQCA 3H53A 4FLOA 3UG4A 1R7AA 4P8XA 3VIFA 5HDRA 1ZJBA 2GUYA 1OGSA 4DUWA 3VGGA 4FNSA 3EMCA 3N04A 3OZOA 4M82A 1V0LA 2XUCA 4BS0A 4AZ7A 1C90A 2PWDA 1QNRA 3AIWA 4TTUA 2V3GA 3TA9A 4FLQA 2J7GA 2O9PA 3SCOA 1B2YA 4JFSA 2O9OA 1QI2A 2YDRA 1FP9A 2ESCA 4MNJA 3W25A 5D8WA 4GQRA 1J18A 3VIKA 3SCUA 1AQ0A 1JG9A 4F9JA 1LL4A 1Q6EA 3WUGA 4FNPA 1WE5A 4ZXOA 4ZENA 1HN1A 1ZBVA 3LMYA 4AZCA 4AD4A 3ZR6A 4UQEA 1TVNA 2BHYA 3RM8A 1EIBA 1MW1A 3WBAA 1I1XA 1E55A 2BNJA 4TX8A 2F2HA 2WCAA 1CWYA 1V6UA 3AISA 1XH2A 2OYKA 3UEQA 4MAVA 1R86A 5ABFA 3WL1A 4UFHA 4DM1A 3BGAA 1GOIA 2BV9A 2J78A 5FKYA 2WMKA 3ARPA 4HPHA 1PIFA 1EOMA 3WNKA 4JL1A 4AZGA 1VB9A 3F5KA 3FXYA 3AZTA 4NXSA 4CVUA 4GINA 1KFWA 4C7DA 5IDIA 4PMYA 4CU8A 1C7TA 1HX0A 1JDDA 1FOBA 4TUFA 4M8UA 4D1JA 3UG3A 3CMJA 5JIPA 3KWXA 3VPLA 1HXKA 3VX0A 4IPLA 2WVTA 1OD8A 2F1AA 2ZX9A 1OB0A 1OM0A 2CPUA 1YHTA 4ZE4A 5LA0A 3LPOA 3ZJ7A 1K9DA 4MPKA 3WBEA 5AYIA 1T0OA 4DWSB 3VGHA 1XSIA 2JALA 3CGTA 1R87A 4DO4A 5BXPA 3KL0A 3G6LA 3EBVA 3VIHA 3VTRA 3GZAA 4WSKA 1TQVA 1R75A 2QHAA 3T0AA 1CXFA 3GXFA 4L4OA 2DIEA 3MANA 2VOTA 4PMQA 2ZXBA 2XWEA 2XTKA 1MQQA 1W3LA 4X0VA 2WMIB 1UKPA 1JFHA 4AD2A 1JZ2A 3RM4A 4GO9A 2WW5A 3VSTA 4W89A 3WY2A 4FK9A 4QFUA 2YDQA 4AMWA 4URIA 2ZX5A 3ALFA 2EAEA 3WH7A 2OWCA 3VNZA 4H2CA 2C0HA 1US2A 1UH3A 4E2OA 1EO5A 1BFNA 1TE1A 4HA3A 1KWKA 2CEQA 1AVAA 3F5JA 2DIJA 3GTNA 3MSGA 4BZYA 7CGTA 2BY2A 3IK2A 3PHAA 2YA2A 3CUHA 4D6DA 2G8ZA 4R27A 4J3UA 5CQ1A 4D6GA 5IHSA 1WZKA 3ARVA 1ISVA 2J47A 4CKQA 5BYWA 1DWGM 3VSUA 3WD1A 5BWFA 4UTFA 3TTOA 2XN0A 2XVGA 3DYPA 2WYSA 2QPSA 3WF0A 4HOZA 1HIZA 2W91A 3K46A 1QWNA 3SIMA 1W9VA 2QMJA 4U2YA 4GXPA 3AOFA 4JKLA 2ZXDA 2QMKA 1PBGA 1H4PA 4CUCA 5DFAA 3MUIA 3WMBA 2Z1SA 3SUTA 1EO7A 2J4GA 5GQBA 4PTVA 4B9ZA 3DYOA 4CD8A 1BAGA 4LYRA 3VDCA 3CLWA 1E6NA 5ECUA 2E4TA 4UNIA 2AMGA 4U5KA 1HJVA 5A95A 2G4FA 3AFBA 2F7PA 3BVUA 1C3FA 3RM9A 3AMKA 1CLXA 1ZS2A 4KWUA 4HMDA 1TUXA 4WLCA 2CESA 5HOSA 3POHA 4W85A 4MAZA 3QHMA 4E8CA 3TP4A 4WKAA 1BQCA
chains in the Genus database with same CATH superfamily
5EH1A 1A22B 1CT5A 1EAPA 1UJPA 2VZSA 1G67A 3WTTA 5D05A 3SO5A 1XCQB 4MNHA 1N8ZA 5BXFB 5JPNB 4NC1E 5DVOA 4EDWL 3PY2A 1JGEA 1RBOB 4FFZH 5LZLA 2IXUA 4XPHH 3U6RB 2WMFA 3MV7E 5FM5M 1OQXA 5LKNA 5CKSA 1C9WA 1IT9L 3TO4C 1E71M 1GOWA 4GIOA 2Z91B 2YZ8A 3N55A 2F1EA 4MXQC 1D5BB 2V8LA 4PV8B 1LO0L 1E1EA 3HRZA 2K70A 5DD3L 5BRQA 4B91A 4OAWB 3UFYA 2IKHA 1SXCA 4QISA 1Y07A 4GPVA 4JFYA 25C8H 2WLLA 2GSHA 4MFEA 5JHDD 3OJVC 3ELAT 3DX7A 3H4GA 3B05A 5FJTA 5GJPA 1IWPA 3T6VA 3AJ7A 1E5NA 5AB1A 1EUAA 3FYPA 2QV4A 3C09B 2HTKD 4J4PC 4N1EA 2XVPA 1WUFA 4LCQA 3BT2L 4R85A 2BP5M 2CRMA 1ZGDA 2VZTA 5C92A 2ICWB 4MDJA 7ENLA 1Q9OA 1NCOA 2ZXGA 2H3XC 3JVFC 4XMWA 3ZRFC 5ALCL 5I24A 1MYRA 1Y8BA 4URKA 4ANKA 3H7VA 4L4MA 1IWBA 1D2OA 3MW7A 3FDWA 3BD5A 5D70H 4OLXH 3WJLA 4ZAKC 4FTVA 2GZXA 2FQDA 4FFTA 1K7FA 3PBMA 3RJXA 2F53A 1CD1A 4HWZA 1K3ZA 2UX6A 3OMAB 5D7IB 3V4PA 3TNOA 5B80A 3DKJA 5I76B 3P61A 2F54E 2Z8WC 3M5YA 2VN7A 3MGAA 1ZNNA 2NY7L 3I74A 1FFNB 5E6YA 4HA1A 4JTTA 1G9MH 4R4NC 1VR6A 1IGCH 1OCWL 2P8BA 1R3IL 4EAMA 1LO5B 3GZPA 3V10A 4PUUA 5JOPE 4XD3A 1RK7A 1BA9A 3HBLA 2OW6A 5AZ0A 1EPXA 1GIGL 2LAGB 1HKKA 4I18C 3GFXA 4M93B 5M5DA 1GTNA 2I5GA 3NPVA 2UVEA 3NBNA 3L4WA 4R7LA 4GC3A 3EA3A 5JIDA 4GVIA 4WUIA 3TYZA 3FFCA 3U25A 4HNUA 4Z3GA 3TH2T 5FA5A 4N2CA 4B92A 3PWIA 4YO0B 3RRQA 2X9ZA 1YQVH 3QZBA 2RQEA 3VX1A 5JW3L 3OX8A 4JG1H 1PB0A 3B9DA 2ITCA 2CXEA 4ZUSA 3V5DB 5B21A 2HPTA 3NCXA 3S1GA 5DZLA 1XIBA 5D8JH 2DT3A 3ZJ6A 1TR7A 4XCYA 4E41A 1F61A 4XPFH 4UQDA 5BRPA 4GY1A 5CBIA 1UWRA 1RR2A 4XB3A 4ICXA 1AO7A 4NSKB 2WOBA 4BK9A 3FSWA 2OEJA 3MDJA 5D9SA 1RZIA 1XGTA 1MI5B 1H9DA 1SO4A 2YYUA 3MJMA 4EPSA 3TMQA 1KV7A 4L65A 4F8QA 1IAOB 1KT2A 1DDTA 4R34A 3BWAB 3MXVL 5F9AC 1GQNA 5C07D 3P40A 4DPAX 3S83A 1OK6A 1ZIBA 1PSCA 2IXVA 3TTYA 1A6TB 2ZG1A 1EK3A 1DJXA 2GW5A 3PABB 4I3RL 2A9NL 4GXUM 4HB7A 9XIAA 1I1AA 4F37K 2R2EB 4LUTB 1A5SA 1DN2A 1MAKA 4X7FC 4K7PX 3AHTA 4DHLA 3C6SA 5FECB 2BIQA 1G7PA 1G9MC 1KG0A 1QNZL 3TT1H 4G6AD 4ZUWA 5IZ7A 2I32A 3CT7A 5J8LA 3W00A 3LTPA 2O4MA 3PUOA 4EACA 1TA3A 1VKXB 2VDKH 3LNHA 4Y2DB 4MZYA 1JZ8A 1GHRA 1KRMA 2MANA 3ISRA 4AGPA 4DAGH 2CWXA 3MSYA 4F57H 2Z1VA 4KK5C 2G3IA 1A7RH 5JIMA 4PTTB 2HKHH 5GNYA 3KHQA 5EBWA 1SJXA 3TOYA 4LVFA 3G08A 1UM5H 4LOFA 2FWUA 4HK0A 1IC0A 4XPAL 2J1XA 5IT2L 5B38G 4I0PB 3NEEA 2D3NA 1A0QL 2Y7MA 1GUVA 1ORQB 1S7UB 3Q8EA 2HXTA 4KH9A 1KO0A 3H24A 1E6JL 4GBXA 4U3SB 3WXVH 5B3SB 1DANU 1JXJA 1BJ8A 3FO0L 1XUZA 2DT0A 3WHE1 4TTDC 5IKCB 4AMXA 2PYED 3TJLA 1CLKA 2J8UA 3W1PA 3LPWA 4FXTA 4LESA 4MS6A 3W0WD 3O3DA 5E23A 4FA6A 5C0EA 1HIMH 2IBZX 1KXVC 2O72A 3D2UD 4GQ9L 5D4JA 3WELA 4F58L 4GQ0A 4F7TA 4TPRH 3GKWL 4XN1A 2MSPA 3VAVA 2DSKA 2VDRB 1FZKB 4KHXH 4JL2A 1J12A 1O7SA 2ZXAA 4XCNA 1TPB1 3GSOB 3VXMA 4EOUA 1EDQA 4EKXA 1C8PA 1EGZA 1S6NA 2V3FA 2XU9A 3O0RH 3U4EB 1AJ0A 2E7FA 2Z31A 2H4EA 2MHAA 2YPVA 4R26H 1V0MA 3VNIA 4X4YA 3VGEA 5DVNA 3NZHH 1BD2D 4NERA 3G24A 4PEKA 3A3WA 7ODCA 4AQ1B 1U1UA 4X98A 5E2TH 1A3RL 1BW8A 2VL5B 2DQCL 1QTPA 1BFSA 4WI0B 4A3UA 3QZWB 3F2CA 3BPLB 7TAAA 5CZ0A 1G84A 3UZJA 3P3UA 5ADOL 2QQQA 2D2JA 3S37X 2FD6H 3LSOA 3TEZA 4EVNB 4C56B 3TVAA 3FMGH 2NY0C 3PIQA 4JR9L 1ACYL 4MF4A 5F4SA 2QQNL 2OULB 4UIKH 5CP7B 2ZJSL 2PLJA 3U0HA 4N90D 4QI3A 1OIFA 4D9QE 5CEWA 1E1FA 3H8NA 2GDUA 2R69H 3LNFA 3S3JA 1EKOA 2XN1A 1OK0A 2FIKA 5CLTA 3TBCA 1AGBB 1J9CT 4QG6A 3FYOA 4HIBA 3IWPA 3HN3A 2C1HA 1R3HB 3KVQA 4QRRB 4IFKA 1ZLPA 1GYVA 1P7KB 1I8KB 3TN4A 4NCC2 3NO5A 3B1TA 4M24A 4B7IA 5EZLB 1YMMA 4XKYB 1OF2B 3ABKB 3B4NA 3RE0A 4FGMA 4N2YA 4F7EA 4YUEL 4Y0GA 3JW7A 2ICWJ 2EVGA 3WY3A 3WJZA 1MCEA 3UY8A 1T21B 3L81A 4IDLA 2VZUA 4FXKC 4KDWA 5TDPB 4AK1A 2WLZA 4QHLB 5MEQA 1LLZA 2OP4L 2JK5A 2X38A 1JYVA 1OXYA 4FE9A 4ECNA 1Z5LA 2X88A 4O0KA 4FXFA 1FE8H 1FIGL 3QIBD 4Z7WA 3VI3B 4CNNA 4X4ME 1AIZA 2AK1L 1W3JA 1U3YA 4UFKA 4XZMX 2F53E 3UP8A 1JGVH 3HNTL 1NBZA 3KYOB 3PY9A 3C6LC 2V6AA 3CHPA 3AIQA 1RUKH 2M2DA 2Z1BA 3PG9A 1NINA 3RX4A 3HUJF 1N6VA 3QUMH 4PGDA 3D4ZA 5CEXA 1XLKA 4NYUA 4XIAA 3QIBC 1BRLB 1TFHA 4MB3A 3R5EA 1SW0A 1MFBH 2JGYA 3TJHD 4S38A 5J1AB 3VWJC 1SJEA 3FA5A 1CR9H 2APFA 2LU4A 5EA0L 5T9CE 4I0KA 1X5XA 1SJMA 3L3IB 1BIIA 3NSDA 4GEIA 4IJ3B 4GZIA 2PCFB 3UCDA 1K4GA 4UYPA 1L8NA 4XCCH 2XWTB 1DCLA 3VJ6B 2BFVH 3QEUB 4L4TE 4HU2A 4KO5A 3CDZA 4Z0XA 1PCWA 4I77L 1ET5A 4CGUB 5A6KA 3DSFL 4P57A 3SRFA 1PYWA 2WV3A 1A3HA 4PMJA 4XNQA 2P0IA 5SWSA 3L0NA 1TYEB 2Y7FA 3D3FA 2HK0A 3ECWA 2J8TA 4I1NB 4KKLD 4XD6A 4KGLA 5C0RH 4FMKA 3OW1A 3VFTA 3WDRA 5LXVA 3VIGA 5IB5B 2Y2WA 4ZX5A 5KVFH 1UD5A 5KBKA 4XTDA 1H3XA 2J4WH 3WCYA 1FIEA 3FCSA 1A6AA 2Y62A 1BQKA 3E1ZA 3ECUA 4X5WB 3V7AG 6FABH 3F1QA 2VAAA 1VF5C 1E8ZA 4FDWA 5IW1B 1CX9A 5G4WA 3JWOH 1M56B 4KJWD 3UAJD 3NK3A 5TJWK 3CHQA 4MJHA 4XCFH 5H6HA 5AHLA 3UYCA 1KRCC 2W0FB 5F71A 1XBRA 3VKCA 1YPZA 5LGJA 3W2NA 1CVSC 1PL3A 3LDBC 1GT8A 5AW4B 3SE9H 3T2LA 4ZUUA 3EDDA 4YHKH 3W7IA 1GXEA 2B20A 2DEWX 2DQEL 2XKNB 1UFUA 2DZVA 1AHKA 4G6KL 3T65B 5I5RA 4PY7B 2Q86B 2YB4A 4AY1A 1ZVYA 1NAMB 4HIJB 4Y5XA 1IGSA 4KI5D 4JFTA 5K9JL 2VFEA 4PR5B 4AIUA 4H2AA 1GONA 3HM7A 4JGMA 1A4CA 1ML0A 5IUSA 2XBZA 5E8OA 1MHPL 1H8LA 4IOIB 4GABA 1JF5A 1NMAH 1IM3D 4LASH 3U0PA 3NFPB 3ZGHA 2ZUVA 2WAQA 1Q6GA 1KEML 3N41F 4JEGB 1Y18B 1E9IA 3DGRA 2YPLA 4HS8H 2VLRE 4R26L 3ZJ8A 5K9QG 4N8VB 1XLLA 1MAMH 2HLEB 4MXWH 2NY3C 3IFOB 5DT1L 5IW3A 1F4YL 5I18L 1P7QD 1H0IA 4M93C 4Y5YC 4IG2A 1VFLA 1G4SA 1U58A 3B37A 4UNKA 3B0XA 3J7HA 4XD5A 5DJXA 3SKMA 4NKMA 4G83A 3PQYD 2VB5A 2WXMA 1OBAA 3U7WL 3FTVA 4JHWH 1GVRA 3THUA 3KX6A 2NX5A 4JO8A 5SWZD 1AQHA 3UNTA 5BO1L 3D3AA 5I2UA 2EQDA 2CWNA 1VFFA 1P84J 1YJDH 2A6DB 1E42A 4M80A 4P07A 1LNUA 4DESA 1EVTC 1E6XM 1THFD 3LCHA 3ME0B 1FWDC 3U2OA 5LGJB 2E7BA 4XGZA 1MJJB 1YPZB 1PCSA 2MCPL 5TPWH 1K03A 2EVIA 4KCUA 4QEHA 2I5YH 4G9DA 4MD5B 1QFUH 2BERA 3RVTD 1F6AA 4BZ2L 4XSMA 4JRYB 1X9RA 4M7LL 3OEXA 5E94B 4TQPA 3Q2WA 4AXWB 1DBBH 3C12A 4EBQL 3FCTB 1PWLA 3PUGA 2BOLA 2OZ4L 1Y0LA 1QW9A 2VCOA 5GRYA 5I8KL 4YMPA 4C54A 5KSBF 3VD0A 3JTSB 3NZ8B 3MJ8B 2J8UF 3NYKA 3HF3A 3L3OB 2YD0A 3OGCB 4GAAA 5CG0A 4L1WA 4N5EC 5GSRA 3PAUA 3DBNA 2FE0A 1I7UB 3SFWA 4TSCH 2E0PA 5F8QC 2J8FA 3MP4A 1X9UA 1P53A 3TBYB 1ASPA 1FC1A 1HH9A 5LGYA 2X3CA 1V0NA 4ZQOA 1L5GB 4OCRL 5EDXA 4AD3A 4GJJA 3IXTB 3HTWA 3G6DH 4XMLL 4K8RL 4AIOA 5E0KA 3E8UH 3UZXA 4HH9A 3FUDA 4LSDA 2D22A 4K15A 5AFDA 3BANA 3P11H 3C3UA 4Y9AA 3FYYA 5C55A 3BQVA 4L7ZA 5MI0B 4A66A 2NSQA 2XG4A 5T1KA 3WE6B 2O30A 4LQFL 3W5NA 2CLKA 5I1GL 3IJ7A 1C16B 2DJMA 3G7TA 5E8EA 1DXIA 2DQFA 3IUDA 4IKKA 2PI6A 4D2JA 2VMCA 3L0GA 5DD6B 3Q4DA 3RCYA 2VXVH 2P52A 3O6LH 3T8XB 3UJSA 4NNPL 4PN2A 1TVBA 3N1FC 1GOMA 2QAPA 5IBXA 3B3BA 4MCYB 1GG0A 3EMZA 1E43A 4ENED 1AKPA 3GB6A 2MOQA 2YFOA 5CLWA 1N8IA 4Y5VB 3FCBA 1ZBKA 2LU7A 3FCUB 2PDGA 1D5XB 3VA2C 2ZX8A 3ZE0E 2CNZA 4GG9A 1DBJL 4L4VB 1UR3M 2R4SL 4IK7A 2OAAA 2G30A 5LCVA 2XH2A 2GABA 2XZ7A 3RL1A 1MHHA 5DRWB 4R9OA 3GK8H 4JZJB 1Q6CA 3QRBA 3QH2A 2OGJA 4OCRH 2OMUB 4V15A 2Y0FA 3TJ4A 3CH1A 3QRLA 1O9VA 1OO2A 2VKXA 1K8ZA 1W0MA 2EXSA 4EP8C 1M7XA 5C2BL 3CIAA 3E6HB 2JJUA 1P2CA 3SE8H 1T04B 4MB5A 1F97A 2W38A 3WMQA 1HJQA 3UAJA 2Q3XA 5E6UB 4IHOA 5T5FA 3L16A 2AQ2A 4FC3E 4OCXL 1SXBA 1CI1A 1QRQA 1K8DA 3BVNB 2V68A 2NY3D 5FYLH 3QE5A 5GGUA 3XISA 3UWZA 2XNAB 3TASA 2VQTA 3P4NB 1C8XA 4PMVA 1VJSA 2QR0A 4KKZA 2NXYC 1YY8A 3STCA 1OHZA 1EJRC 3E0VA 4GUFA 1IGFL 2DZPA 3ORWA 1Y5WA 5H37H 1D9KA 2W9MA 5FV1L 3EEGA 3BD3A 4QXGL 3H9ZA 3MCMA 4DWSC 5CD3A 3EBIA 1AD0A 1NMBH 4X5LA 3KVLA 3A3XA 1SDDB 4WSGA 4OGQC 1M6OB 3GS4A 4DQWA 2WQDA 4UIMB 1V8HA 4R83A 4U6YB 1IQ8A 5CPSA 1L7IL 4NGHH 5CSBA 4QXVA 5GRUL 2VEKA 2YCLA 3FT0A 3MKGA 1PKQA 4F4RA 5FA3A 3I7QA 1U8MB 1AG1O 5TFSL 4DTGL 1MEXH 3FRUA 4MHHG 3KDMB 2VSMB 1HCYA 4IGBC 1J6OA 3QNZB 2BMBA 3IIVA 4NJIA 4E3TA 1YE4A 4TNGA 1W1A1 4O15A 1K5NB 3WFAA 1I9RH 4JPWL 4KK9C 4QMEA 3RO8A 2FZ9A 1FZKA 4TLKA 4I13B 1OPGH 2DQUL 2XWXA 3TYGL 5A95A 4CC1A 4PCFA 4JTRA 3O6KH 3AY4A 4V1DA 2GHWB 3F64A 4ELMB 1ZJIA 4H8UA 3PB0A 4P61A 4JM2B 1U42A 4TNVK 5FF0A 2FX8L 2KUTA 1DSFH 4PJIE 3L3HB 1RJQA 1T8XA 4PP1C 4LDOB 1XFCA 3N2OA 2IOIA 2PPCA 1EJOH 3FAWA 5DC4B 4PJGF 2I27N 4W9LC 4ROQA 2QBWA 4QQ3A 2EIDA 2YXGA 3RU6A 4DVRL 3FZUD 3D69A 2ZZ3A 4XP5H 3TWCH 1QFEA 1PKOA 4N0FB 4JIQA 4FQHB 12E8H 3THMH 1VZHA 4M43H 5DUJA 4N2KA 4IK6A 2ACUA 5EBWB 4DBDA 1DBAH 3JYBA 5AVVB 2WXNA 3VWJB 3LM3A 3SR7A 1SFJA 1DQIA 5A6SA 3FQ1A 3ZE1E 3MB9A 1FN4A 3HC0A 5CSZA 4NIRA 3CDYA 5D6DA 4IT1A 4OD1H 2GCYA 3CU7A 3F5WB 1XGQA 2DDQH 5D96C 3QQNA 3Q5OA 1KEGL 2BZDA 2V7NB 3GBDA 1TIMA 3U3HA 4PJ5A 2P5ED 3ZXAC 2PDBA 4QBXA 5G2IA 2G60L 1E65A 2COVD 1XMEB 2ABAA 1KTDA 5DO8A 5BRBA 4WEMB 1IQWL 1U2HA 3KOZA 3FC8A 3H9SE 3G1XA 3ESMA 4P48A 1B31A 3B0YA 3EYQD 1A6TA 5KYNA 3FYIB 4P2RE 2O6FA 4LCWB 1TIWA 4AQAB 4QXIA 3DJRA 4UNUA 4MXWL 5DEFB 5DT1H 1KC7A 1KCKA 3G3DA 3BZGA 4Q4RA 4RMUA 1TLKA 4A8IA 1LLWA 4LLYB 5JBEA 4JJOA 4UR9A 2A9MH 3FW6A 2CXKA 2K7PA 2Z31D 4G42A 4PJXA 4FABL 1HGYA 3QZAA 4FQ2L 1W91A 2DTSA 4QHKJ 5MHSE 4DGIH 3W07A 2HXUA 4O12A 4YDKL 3NJIA 4POZD 4YIWA 3UERA 3PL6B 5AD0B 1NDYA 2VGLM 3LDBB 5KAQG 1IHIA 3PNUA 1A7OH 1P7QA 3H6JA 4OT1L 3UETA 4GD0A 2EE2A 4OD1L 5LNVA 3LKNA 4UTBL 5BPPA 3GC4A 4YLWA 5E4IA 5KYUB 5JA9A 4YDJA 2ISVA 1PLGH 3WK3A 4LB3A 1OT4A 3FFCB 1OTSC 2V82A 5C7HA 2E4FA 1T4KA 5I19H 1TENA 5DDHB 3TVMC 1MZZA 4MA3B 4PGCA 4POYA 5LXGH 1R3YA 3FK4A 3NSNA 1WUZA 1XGQB 3QUMA 4XI5C 3TAOA 5M03A 1HHHB 4PREB 2RB8A 2JI2A 4PYHA 3SN1A 1WV2A 1CL7L 3BP5B 3DVFA 5DUMH 4JMNA 5FIPA 4AIBA 2J79A 4F0SA 1NKGA 5GRVL 3UO8B 4PUKA 5C0NC 3O16A 1RK5A 4HTYA 3QO0A 1DZBA 4I77H 3AG3B 3SKUD 1S38A 4HEPG 4OJEH 1DQMH 3NL3A 3I7SA 4PJDA 4P4KA 3U4KA 4AMKH 1BZ7A 1FZJB 1YPZF 2H1XA 4OD2B 1JRBA 3H3KA 2HFEA 2Q8BL 3K81A 1HKIA 4LCCC 1V6YA 2QQ6A 3R6IA 3LGGA 3SJNA 4CILA 1SUXA 4WUUA 2V5KA 4H88H 4WKHA 3HBZA 1BYPA 4DJEC 4NQTA 4ELMA 2XOTA 2WB5A 1QO5A 3AO0A 3AAZB 5CKGA 3AIBA 5FDYA 1JZ7A 3QY7A 2DQFB 3B3IB 5HGBA 5L88H 1E4LA 5DN1A 3CCHA 4JFXA 5D7IE 2VFHA 5DLLA 1IIKA 4R0LC 3O11B 3UXFA 1Z9AA 4NJAH 4WDWA 1KJVB 3G0XA 1T83A 4NKOA 1SM3L 4GIYA 4Z0SA 1MRDL 4JCMA 2E56A 3DAQA 3OVPA 2ZX7A 1NEZA 3QNZA 1KYAA 5AWNH 5IVXE 3CUPA 4FTDA 3L3OC 4JDEB 4Z5RA 3U57A 3QI9B 5B1BB 4JQXC 3TC3A 4C1NA 4J39A 5ESAB 3ZY7A 1JVOA 1RY7B 3DX8A 2CBIA 4PJ7A 4S1QL 3M47A 3VXSB 2D24A 3CASA 5REQB 3S3BB 3BUQA 4PMDA 3E8UL 4XNYL 1S7VA 4I3SH 1FCBA 3V4UH 1G6CA 1UH4A 3ECBA 5IW6A 3LZOA 2Q0ZX 1DQDH 2NT0A 2X4PA 2N7SA 3QEGL 1NSNL 2D9CA 5HNRA 2GITA 3RWIA 3TQVA 1RUPL 4L8SC 3IXAA 4AX6A 3UTPE 5EU7E 3UT0A 5H8MA 5LGZA 4Y88A 5I66A 4BH8A 2ZFAA 4LBSA 5EEXA 4PVMA 4AJVA 2CO6B 2QZ5A 4H1LG 4OZIA 1LNUB 4K71B 2WMPB 2A6DA 1V5JA 2XA8L 2AS5M 3KS5A 5HSFA 4A2HA 2GL5A 1QI5A 4IHOB 1UOVA 1BSLA 2EXWC 5DRXB 4ANVA 3FJTA 4Z7QF 4OTKA 2EO9A 4I8DA 3LD8B 4IKJA 4W81A 4Y5VC 3T77B 5JR1L 1EXBA 1JHTA 3NCMA 3GLDA 3Q43A 1CDHA 1A0EA 3WQDA 1SHWA 6XIMA 3V2AR 3E9AA 5K9QI 4UILL 1KBGH 2JKXA 3T0BA 4E9XA 3EGXA 4NHVA 2H2SD 1GS7A 4OJFH 2OI9B 1XAKA 4ONHA 4X6DA 3V0JA 1TZGL 4JZJC 5C08E 5F6IB 1RKRA 4KUCF 1QTYT 1WFOA 2Y07L 4WEEA 4HUXA 4I88A 3UTPD 4EMZA 4ZMZA 3ITTA 3MYOA 3OG2A 5H8UA 1J8HD 1Q9LA 4KFOA 4NKCA 3X11B 2XWJA 4X60A 3U2CA 2X28A 1ZTMA 4MY1A 1R5WA 4M7TA 1UFGA 3BX7C 1HI6B 1SHSA 1ZK9A 1A6ZA 1YDNA 2ZA1A 4OIBA 1OLLA 2VC2H 1ZL1A 1JJUA 3U7YL 1PQZB 2UY7B 3DHMA 3ZLGA 3DXAB 3HR5A 3O6DA 4NQCB 1FNGA 1Q9LB 5SWSE 3CDGB 4K38A 5FEPA 2Z92A 3MSRA 1FZMA 2OYMA 4IOSA 1YNKL 2YL5A 3WL9A 4NJGA 4ZQCA 4ACPA 2CW6A 1B3JA 2X87A 1Q8JA 4M29A 4UZUA 2EIMB 5B3JF 1WKFA 3QV7A 1CGUA 3PPGA 4J4PA 4J4KA 1SJHB 4P4RA 3VNDA 2VXQH 2BOBB 3D08A 2LLEA 7A3HA 1YECH 3T4YA 5CKAA 3UZWA 4HH9B 5FYJU 4LF3A 4BQBA 4RWHA 2Z1XA 3IMWA 1CE1H 3BZEB 2BNRE 4LAQL 2IFGA 2OR9H 3FUEA 1T2JA 3F00A 3ABXA 4XZ4A 4YHMH 4K1GA 3ZO0A 1L4IA 1LJMA 5KTEL 1FFRA 4MMZC 3DV6A 3DIVA 1A3QA 2BXVA 3FOMA 4TV3A 2D7MA 3Q2LA 4QCIA 1QNQA 1HDMB 1KTCA 3G5XA 3KWWB 3LCGA 3SQLA 1UUNA 3PNWA 1J6PA 4U10A 5TIMA 3WF3A 5HGAB 3V9CA 2YUVA 2WLIB 3A21A 5G1YA 4PLJC 3O3RA 2BVTA 1KCUH 4N2OA 1KPRB 1PFCA 2WXOA 1YEWA 1JGDB 1S7TA 2ALDA 5DYOB 2EINB 1MJJA 1MQPA 2NTFA 1KBBA 3WD0A 5F0MB 2N01B 3QARA 5HHXL 5C2BH 2F5BL 3DX8B 2C0AA 2OMAA 2NY1D 3Q0HA 4DGUA 3TT1L 3P80A 3RITA 3ZVHA 3ZN6A 4C1NB 5DJ8B 3IETB 4OLWH 5J1AA 4OZOA 2Z6IA 2B3IA 2QFRA 5IB2A 1BEXA 2AL2B 1LO4H 1OFEA 5LQBL 4A22A 1BQHA 2O4EA 2ZOKB 4N6EA 3KPPB 5AOKA 3FT1A 3OZ9H 2YFNA 3FJ6A 5G5IA 4NNYA 3V4PH 5DJCB 3RB5A 4E68A 3M0KA 4YZFE 2EDEA 5SX4I 1MG2C 4LSQL 2YC1A 2HJFA 2XQBH 5LBSL 2VD9A 3VAEA 2R9HC 2Y7DA 2ISDA 5JW3H 3WLKX 1Y0EA 4X0NA 2YCKX 5G4MA 5G2NA 4Q8OA 1HH6B 3UJJL 3TIDA 4HS6B 1HXMA 3GUGA 3X13A 3K13A 1CQKA 4PRIE 4LVAA 2DD8H 4DVOA 3L7FB 1EA0A 1F5WA 5D96B 1ZVHA 2WC4A 3ZKXC 4GISA 3QN3A 4JQ3A 1V03A 3VDGA 4CJ1A 4C6PA 2HFEB 1G7LB 1BVWA 1HIML 4ZODA 3EZ8A 1ZT7A 6TAAA 3BFQG 4WRLA 3VXTA 2DDXA 3G04A 1ISXA 4HKXB 2JLPA 2UY2A 2ISSA 1BYDA 3M46A 4PG2A 1YDYA 4LLQB 2ZXQA 2FHBA 2QQLH 1N10A 2V5CA 3FRPG 4EN3D 3PZ9A 2BSCA 1T66D 4ONVA 5DMMA 4Q6IB 3TYBA 4HUNB 3WLRA 3JWNH 3GHRA 1GMIA 1RPKA 4NAJA 5B22A 3R0UA 4AZCB 1VENA 1IXOA 3I6RA 5D9NA 3QUMB 5IW1A 4PGCB 4GOAA 2HH0L 4X7TA 3QCVL 4DP4X 1T4KB 5K5YA 1GOXA 3V0SA 1OINA 3CHRA 5EMJA 1TU2A 2UZXB 3QLLA 2YD4A 3CN0A 2DY3A 2O5NA 2TRHA 2J6XA 3TWBA 2IV9A 4PGJA 4LVBA 1UZGA 1KQYA 3M16A 3ARRA 4WK9A 4NSBA 3ENEA 3A5FA 3APYA 4AUYA 1P7QB 3CNKA 3ITYA 2XN9E 5EUKA 1UR4A 3OBEA 1OFOA 1S1RA 1HINL 1BAFH 1K6QL 4QM1A 4Q8VA 1CGTA 3RGVD 3AIEA 4OLXL 3K4AA 1GGYA 4LK4A 3UAEA 5JW5B 2R0KH 3UZQA 4GJIA 4Z0XB 4U6VL 5JA8B 1JD9A 1CDBA 4QTGA 4YDIH 4EPKA 1Q2RA 4LHUG 3U2SB 4GUQA 1TV8A 2Y9RT 3TFBA 1AZBA 5I1KH 1MHPH 1U9KA 1MLBA 5DY3A 1KCLA 9PCYA 1CENA 3V0EA 4HGXA 2R2HA 5GZNC 1NCHA 4LPUA 1KN2H 1GTEA 1HILB 2GJZB 2VLJB 4B9YA 2IAMB 4BZ2A 2NUYA 2YYTA 3O3DB 3T0ED 5C0EB 1F4YH 1X9QA 4ICCX 4WX2A 3IGAA 4YHEA 1UWGL 2F58L 3ES6B 4XBKA 2C1PB 3WDHA 1DJSA 4J12A 1JR1A 5GJNA 3GSQB 4MA7L 4PGDB 2YDSA 3BGMA 2PLMA 1SUHA 3OKDB 2O5ZH 3MUGB 1BEYH 2NY4D 4YQXH 3QFEA 1UYWL 3QW4B 5C08B 4I0PA 4M8VA 1QNIA 1BXAA 5C0CA 4D9LL 3EADA 1QI0A 3IK4A 3IUIA 5DI8A 4H2HA 4RDWA 5AYUL 1YUHB 4OF6A 4PUBL 3GG7A 5E56A 4AOFA 1EV2E 4EZMA 1LORA 3K6SB 4Q0XL 5D2LE 4MJZA 1VPOL 1Z32X 1BOGA 3LY6A 2C71A 3I75B 3KR3H 4QD2E 3N1AA 3W7MA 5B39A 3AXMA 3KS6A 1JK8A 1RP8A 5FGCB 5HVGB 3ESNA 4R0LB 4Q4EA 3QDMD 3R0DA 5KETA 4YHML 1QMUA 5IM51 1E6OL 5CAHA 1QPQA 1P7KA 3GC2A 1XSKA 4OCLC 4YDVA 2IPKA 1FDZA 5I8KH 2ACSA 1TV5A 3L3JA 4GGHA 4GUJA 1S4IA 1R33A 2AVGA 2FBJL 1AJ7L 2NVCA 3DFQA 1HJWA 1XCTB 1FAKT 2N1KA 3TO4A 4F8NA 2AGJL 1IKFL 3GNML 1V27A 2IWEA 2PDNA 1QNPA 5I02A 5E9NA 4ZQPA 1NCCL 2UZYB 4HEMA 1DANT 3QQ4B 4JB9H 3TSDA 4HXBH 1WBZB 1AZRA 4DP8X 4YXKH 1WTGT 4TXVB 3N2MA 5AVXB 3CZNA 1ZBCA 3U4FA 1KRAC 1D5ZA 2YPKB 3D0LB 3FAXA 1GNXA 4MG4A 5D2NB 4S1RH 2D7TH 4XNDA 1RJZA 2J57A 4AEOA 5LHFA 4QHMA 1FWWA 3CXHK 1QOPA 4LGSB 4O2FA 1J87A 1Q94B 2MPVA 3E49A 3GLEA 4WENB 2YEVB 2OCZA 1BWVA 3UCCA 4NSKA 3BWUF 3DLQR 3MUJA 4AZIA 1RZ7L 5DEZA 3NXLA 1UWQA 3AT8A 1ZDQA 3FK3A 4JFEE 4O5LL 2BDQA 4NAFA 4Z17A 3QQ3B 4Y89A 4E36A 1A0DA 4I8YA 1MNNA 4UUJA 1PDKA 3AWNA 2GVJA 1PWMA 1AS6A 3EOBA 1RI8A 4IU3B 5E8DL 1IL1A 4PGLA 3W4RA 2AAVA 2ISWA 4HUKB 3AY2A 4P7QA 2W65A 3QGVA 1O7DC 1ZT4B 2VQ4A 3G9VA 3BJTA 3VYPA 2JIXB 3BUPA 1G7IB 2Y5QA 4OGAD 2Z28A 3HHSB 3WLSA 5B7ZA 4X6CA 3CFUA 1WJ3A 4KMTL 5ITBH 2YXXA 3MCNA 3QUXB 3SDYL 3WF4A 3VGDA 3WBWA 4CVXB 5AAWA 3L66A 4ZGYA 4QG9A 3GC3A 2VM8A 4G9FA 1OF0A 1PU0A 3KVDD 1UKQA 2FJHB 5IV2A 1FCGA 2Y36H 4F7CB 1BM3H 3UYIA 4PJHE 3IPFA 4M1GH 3EDJA 4LGPB 3MBDA 1G1CA 5F88B 2YCJA 3GH4A 1JNHB 3GBMH 1I7TA 5HYSA 1C9DA 4A29A 2BK8A 3HZVB 2PDIA 2CZ5A 4HK7A 4UNLA 5AAMA 5EC1B 2F53B 1UD3A 4HWZB 5GS0D 4WV1A 4TTUA 2YMOA 1FRGH 1G7HA 3E6FA 1R19A 1S1PA 2WPGA 1OWRM 4AGQA 1CXLA 1KPVA 2VWEE 2CU9A 3B8WA 1PG7L 3WLIA 1KTNA 3E9TA 4KFNA 4R7DB 4OGZA 2F7FA 3FGCA 4QJ4B 3W2DL 4FAAB 3KCPA 1SJVA 5MERB 4ZUWB 2JB5H 3VG9C 2X6MA 3MLWL 4GBXC 4GQQA 2BGQA 1HYRC 3S1UA 2YAQA 3ZM8A 1S9VB 4Y9GA 3P2BA 4CMMA 2NLYA 4LUTA 5F2IA 2R29L 5C2GA 4AB4A 4E2DA 3IJLA 5EZIH 2BCMA 2HRWA 4OV5A 4CEXC 3F2LA 2ZUTA 2E7DA 1XF4B 3O2VH 4Q6YA 4MMZB 3KBJA 4P2QB 4OIFA 4YWSA 2BASA 3UOAB 5DMLA 4A2DA 1FYTD 4MB1A 1KT2B 3M1OA 3MRKB 1OSEA 1WFIA 3QT2A 4JDTL 2QGDA 2XG4B 4EUPH 1U22A 2VDIA 3GTIA 1TCDA 3O3BB 1GGBH 1MI5A 2FH8A 4ZFQA 2P80A 2ZKWA 4ODHH 1E2ZA 4XVSH 4QRBA 3HGSA 4XZ9A 2D4DA 4JRFA 3C60C 4MWAB 3WF2A 1L9QA 1YEJL 3BZFA 1E28B 4E5XA 5DD1L 4F91B 1VPYA 2ZAIA 3H3PH 3SGJA 3H23A 4IMEA 5FL0A 4AZBA 3MZGB 3CZLA 1KN4L 2A4AA 3B5GA 3SW6A 2BSSB 5E00B 5DWUL 5I8EB 3PHSA 2VJXA 3CFBB 4M02A 4QDGA 1TWSA 5C0FB 4K7FB 3ULUF 1XIMA 4TUKL 1TRIA 3QC3A 3MS8A 4NKIH 3KPSB 3DESA 2SEBA 2MOVA 4W7WA 5IFJA 1R47A 3ARYA 2R15A 4JUSA 2GB2A 4FG2A 3ZL1A 1ZTXE 4C56D 2NY5L 3THML 4Z8FL 3W81A 1UGKA 3ZLFA 4CQ9A 1TCRA 2WC7A 4BY3A 4X9HA 4OZFA 1ELSA 3MPCA 1PW3A 2HVMA 2IPWA 1YE6A 1A7NL 3OPUA 3FRPB 3O4LA 4JS7A 4L4LA 3NGBC 5CEZH 1BLNA 4R2GC 3ABQA 1FFNA 4Y2OA 2FBJH 2IH9A 1NEYA 2YRZA 2DVTA 2WXHA 3D3VB 5F7NC 5D7IA 3V4PB 2MIZA 3QHZH 3DZ1A 2H45A 2LQRA 4WW2F 5H2ZA 1T1XA 1OAJA 5E9DE 1PZ5B 4Z7UF 2G3JA 5HR7A 4EUPG 4JKPH 2BLFA 5C0GB 4DVBB 4OE7A 2CXGA 1VP5A 3VFRA 2H7WA 2R4RL 2HKAA 2HRPH 2XC8A 5D2LB 1P69B 3NABL 3QH3A 3RGBA 3VMNA 1UQZA 3LCWA 5KZCD 5T1DH 4QRQB 1JXKA 3HOGA 2ZA2A 4FKHA 4OU1A 1OVZA 2R9RA 2A6JA 2EABA 4JFUA 3BN9C 4D6EA 1L0YA 1BZ9A 5FGSA 1A3ZA 1M6UA 5IBUB 1RUKL 2OMVB 3CUJA 4BZ1L 4Z7VE 1A3RH 1OSYA 1J79A 4L1DA 3KG5A 4AZHA 4HKBA 4BFIB 4J28A 3NTCH 2W9EH 2OWXA 5D93C 5SV3A 4DGIL 3RR1A 2RDWA 4PY7A 5K4ZA 1F3JB 1MH5A 1P5VA 1V7NH 2B1AH 3AQZA 5E2WH 5AHEA 3QUHA 1NF0A 3GRGA 1AS8A 1J5OH 3CJJA 2AXHA 5IQ7L 3ZXWA 4AKOA 1BCIA 2OTUA 1FGVH 3WIHH 4GP4B 1QI3A 4XPFL 5C0BA 5C0GA 2RTTA 4C6LA 5CHNB 1IR2A 1PTAA 3O3AB 2DQDH 3WYRA 2XA3A 5A3IC 4EF8A 5CN2A 3NQFA 2IQ9H 3EJSA 1C08B 3F8UB 4R9XA 1KFCA 1SSGA 2YMXL 1VFUA 1VCAA 3MI6A 1JDFA 3DU0A 3CYJA 1T3FA 9XIMA 1EGJL 3WNLA 2C8NA 4P2RB 2FTAA 2E7MA 1QYGH 1XB3A 4LNVA 2QHRL 4X8JB 3DOIA 1VKFA 2AJ3A 1JV5A 3L0KA 1XIFA 1D2PA 4RFEB 2D7PA 5DJ6A 4EAYA 1TCMA 2IO5A 3ZTJH 2Y61A 4MQ7A 1MJUH 4U3CA 4DSYA 3GO2A 4NP7A 5IQLA 4Y9OA 1TQXA 3D7PA 1QJWA 4Y4KA 3U9UB 1ZEAH 4G6JH 4L37A 3MJ9A 4HULB 4KZDH 3KYAA 1CLVA 3OBAA 3SDDD 3GIPA 4GK8A 4HSHA 3UJEA 5HYSG 2TSAA 3PUCA 1P5UA 2P28B 5JHDE 1KYUA 2VO8A 3VCLB 3VFSA 1MRAA 2GG1A 2HFTA 2GJLA 2XN9D 4XWOD 3OG3A 2ZYSA 3URNA 3DG3A 2PR4H 3B0UX 2AP2A 3EJQA 3VFMB 5GVJA 3AS3A 4Y19B 3S46A 1U3JA 3BZFB 4IRZH 4LLAA 2IOOA 4D9QD 4Y2WA 3CVHA 3A13A 1OE1A 4W7VA 2A99A 3LZFH 3GYRA 4YDLC 1T22A 1QOKA 1XH0A 2XWDA 3NN8B 3FULA 5B1JC 1R3RA 1EHKB 2VDKB 1GWJA 3QKEA 3A6BH 3VTAA 1GVQA 4W9DC 4GXVL 5F7UA 1EC9A 4Q14A 2OTUB 5T3XL 4HOXA 2A4CA 4MMZA 4BFJA 1KNOA 1SOKA 1CT8A 3V6FB 2DAVA 1HQ4B 2H0JA 3HAEG 1GKPA 4HJ0D 2HTLD 4AYBA 3KWVA 3SE3A 1JPEA 3LCYA 2X09A 5G5DA 4BQ4A 3QPYA 4O4VA 1CXHA 1CFSB 2YAMA 3ARFC 4WFHD 1GA2A 3WFDL 3Q65A 1MEXL 1QQDA 2JI3A 2J1YA 1FVDA 3WY1A 1QVOB 1R1CA 5MERA 1EUTA 3IVKA 3T0EB 5D02A 2OMTA 5D2NC 1XD0A 1B9BA 4R7DA 1X7IA 4JIEA 4QEEA 3C87A 4NQCD 3ARSA 3NEVA 1X5AA 4XQ6A 4RDQF 2ZUUA 1NQKA 3UWQA 5M2FX 5CN1A 4WSHA 3A4EA 4K7PL 1NDWA 3BLKA 4X6CF 1AGBA 3KS0J 3ZJAA 3NRQA 5TQ2H 1JAEA 4WY7H 4WXZA 2VXSH 1YO4A 3GBNL 2QCGA 4KRPB 3R12A 3VKAA 1T1XB 2K9FB 1ETJA 4WF7A 4P2VA 2PRLA 4R3SA 3LLFA 4HK3N 3PP7A 5AB2A 3EAKA 7PCYA 1E40A 1UC4A 1ZGLM 4EVNA 2EE0A 2CD0A 4AHOA 1VH7A 5FHBL 1UM4L 2A1WL 2HJLB 5B38A 1TPDA 3MR9A 5DQ9B 4JTAA 2E59A 1OAYL 5C07E 1A5UA 3IDNB 5HINA 3OTRA 5EG6C 5E1GA 2QV5A 3CVHL 4Z7NE 2FCBA 4XXDB 1M41A 3VRLE 3OC8A 3VACA 1FCCA 2HYMA 5C7ZA 3RVXC 3RWEB 2V0AA 3LN3A 4RGNB 4PUJA 5L9FA 2H3DA 5AOIA 2BVOA 4G8FA 3MLPA 1VQTA 2VX5A 2ZF8A 4MDPA 2IPTL 1SO3A 2XH0A 2VDHA 4E38A 2Y89A 4XO7A 5DA0B 3D9AL 1KLFA 2Z27A 1OWWA 3ZSSA 4NN5C 3A4JA 3T2NL 1IB5A 1V05A 4YLQT 1ZAHA 3QQ3A 3BAYA 4EI5A 4U1SA 4S1QH 4BZ1H 3QZMA 4E5XB 4N0YL 4L4VD 1OAQL 4XNUH 3KPRD 2A85A 3A12A 3EXTA 3G6MA 2B8OT 2DIAA 1F4WH 1YNKH 2JWYA 5AVSB 1G0XA 1UZ6E 2NXZB 3IJEB 4GG8B 4JM0A 5DZPA 3VZXA 1PGRB 3HG1E 4RNRA 3OZPA 4QHMB 4DK3A 5BXTA 4FHAA 2BSTA 4XZUB 3H3BC 1R3JA 2OJEA 3MNZB 3QZLA 3IF1B 4LEOA 4MVBC 4AVIA 4UTBA 1NC4D 3BIKB 1QHZA 2B7OA 5JHLL 1TREA 1F56A 4QCEA 4KXAA 3UBGA 3S47A 1DQLL 1CDGA 4GBXB 4M62H 4DKTA 1DHKA 3OLEA 3V0AC 5L4MA 4GVGA 3UXAA 4F0RA 1KCSH 2PWHA 4TOYL 1MFCL 2DV6A 3UIZA 3HA1A 5DEGA 2P3ZA 3SD5A 3HI6H 1N55A 3U1PA 4LKXA 5G4NA 4QOKA 1UEMA 1WK0A 4XVTH 2AI0H 3FB6B 4N68A 4D0DA 2D23A 2AQVA 3M1BB 2WUBH 3TBTA 4NOBA 3ZDYB 4PJ8C 1D7KA 3IVUA 4Q7NA 3T8QA 1T83C 2GFTA 1A9VA 4DBEA 1TA3B 1FL5B 4XB8A 3BKML 3QV9A 3SDDA 1CDYA 4FQ1H 4N86A 1GQKA 3V0IA 1H60A 3SCRA 2FGBA 1G7QB 2BCKA 3ILPA 3OHXB 4FZEH 2WZTA 5G4OA 4FI6A 5EOTA 3TIEB 2CSPA 4ZPVA 2Z26A 4ZQKA 5DI8B 4UMBA 1X9LA 2NV9A 3FFDA 2DH3A 2H1PL 4PLKD 4DXXA 5FK9B 3ECVA 4UOW1 5EUOA 3QRGH 3MUGA 2FWOA 5G55A 4P9HL 2VC6A 3MTWA 3NH7H 4JFZL 1XIEA 4Y9MA 1Y6MR 3W2LA 3T0EE 5C9JA 1J0JA 1DQJA 1P5BA 3IF1A 2BSTB 4XZUA 1NDGB 1JK9A 1T1ZA 5H8PA 4KNTA 3V79C 3GHPA 3BUBA 4JHWL 2O9TA 2A6NA 3S6OA 1VZWA 4P5TD 3G5VB 3MV11 5D4QA 4U1KB 3AXLB 2VXQL 3CFKA 3ESOA 2K3TA 2G5BA 4K73A 1GZJA 2EUVA 3WCZA 4EX4A 3O6FA 4HYWA 3P67A 5HQMA 4MKNA 1LF1A 4RAVB 3FF8A 5KSVA 1TWZA 1AYRA 4NI3A 3TVMA 5B7EA 4HG4J 2YSSA 1RPXA 4F9DA 5KANI 4KKBD 4CSPA 1HZKA 2A3BA 3IIXA 2OMNA 2PMZA 3IDMB 2PB1A 2WMJA 1UIOA 3SCTA 3HC3L 5C0ND 3SBRA 3PJNA 3G77A 1UR1A 1PKMA 1OZMA 1FHVA 4JIRA 4AFYA 1NCGA 3PXHA 2R4RH 1OOWA 4KQ0A 1XG3A 5AAWC 1LRNA 3IRCA 3LPGA 1QWGA 2PTTB 4U33A 1MUWA 3SCNA 1LO5A 1IGML 1XIGA 2WZEA 2O26U 4N4PA 5FJPA 2HJLA 5ABGA 1SVZA 1KCRL 2UZ9A 3FJLA 5I76A 1P0SE 3HG4A 1I9JH 3RRXA 4Z3FA 2VDMB 1YN7B 1XLBA 2FTYA 2YLLA 4B50A 3LZRA 1JGLL 4FTVB 4MQXC 4GUOA 1TJHL 4G7EA 5KSAD 1FAIL 4JFPB 4MJJA 1RUPH 2Q10A 5BV7L 3BDBA 1WFJA 4L3EE 2YOCA 1UB5A 4RH4A 1SW7A 5IM7A 1YNLL 3DETD 1UVQA 4QS6A 1CFQA 1E5AA 4Z1YA 5ICYA 1AH0A 2GSGA 1VEMA 2FGZA 1NBYA 4DJDC 2V9DA 1M71B 1PZSA 3QVAA 1TG8A 1O5QA 1NANH 4TKWA 2F6XA 2GJXA 4JXCA 1M01A 3CLMA 3SQMA 4ABQA 1FWRA 2XM1A 3VDHA 5FCUH 4JPVH 2PDLA 2NT1A 4ZAKD 5L6UA 1ZE3H 3JR2A 3SDXF 2X2GA 1U5HA 2A3EA 3PS7A 5FCZA 3KLKA 5C08A 1OGBA 2Z91A 4YX2L 4BFEA 3H2FA 2YC1B 3KLHD 2FJGA 4G7VH 4HP5A 4G8GB 2QHLA 1XL6A 2XYCA 4QYOB 2WMHA 3GNRA 4I5UA 4XMPL 4N0YH 4TVPH 1XLJA 2OL3B 5JIWA 2ZOKA 3T42A 2KMWA 1E4HA 5FOJA 3HC2A 4FABH 4ORZC 1EHXA 3FTGB 2OTWA 2ICSA 5IBTH 3QHFH 4PJAB 2IAMA 1AW1A 4OZGA 3SJVE 4PS4L 2PBGA 2OPJA 3NQCA 5AC6A 4Y19A 1TQSA 4HNNA 4Z7NF 3HE6A 5BOEA 1UMLA 4H9MA 4JTUA 5AW5B 1IVTA 3CQIA 2ARJQ 2R7EB 4IBVA 1YNYA 2CKBA 4WHBA 4OVUA 1FL6A 5I23A 4L1XA 2F15A 3NIGB 4HD5A 2R29H 3ZE2B 3VFOB 2ROYA 4ENZA 5EMKA 1DBML 4K36A 3NVQA 4F2FA 4XPGL 2RAGA 2FJUB 5FYLE 1YHPA 3VYOA 4QDPA 1XGDA 3PVFA 3FEQA 1T1WB 4YC2B 3GUTB 4WK0B 4FFZA 4B53A 4QHNB 4LFHG 1DJYA 3AMGA 5JYMA 4F0KA 5DO2D 1UEYA 3FBQA 3S8HA 3P02A 1Z2KA 4WWKD 3L13A 5EOCH 1TU2B 2UZXA 3GNMH 4NM8L 2QPEB 5F2LA 2P3EA 5EU3A 1OANA 1LK3H 1AGDA 2WBJD 3LBCA 2D03L 1K2DB 3F4CA 5DHVH 3U6XA 4G7FA 4Z7VA 2XLLA 2PTXA 4B3ZA 4IZGA 1A1MB 3QNYA 5E5MA 5IHUH 5CHNA 1MEIA 5JHDA 4NZ1A 5DS8A 3LNDA 2A4EA 3AI0A 5DBUA 5AW1B 4FO4A 3ZDYE 1OPGL 3W26A 3WLHA 1Q6RA 1QD0A 3O07A 2F58H 2NZLA 3TZVB 1RHHA 4ZFGH 4XN9A 4XKMA 1W72A 5I6NA 3L6FA 2QTEA 5C0JB 4H7VA 3NJKA 4NQVA 1FXQA 3L5LA 3S3GA 2CIKA 3V7AE 5HNTA 3G1FA 4PBEA 2EXOA 1WHOA 1MI3A 4J3OC 4CSZA 2V9QA 3HLAB 5I3IA 2VDQL 4PJEA 3X11A 3ASWA 2D2HA 1WAAE 2DJ4A 1XUUA 3FYEB 1J8HA 4KRNA 1LP9B 4PWEA 1IX2A 4IXHA 2EAWA 4ONHB 1RIHH 3BLBA 4GT0A 1NLBH 3EGXB 1AMKA 1F8MA 5HI4C 5DJCA 4GYKA 4JTIA 5HHOD 5HULA 3WEXA 1K8IB 1OGAA 4B97A 3KPPA 3AQYA 1TQBC 2KERA 4LCUB 3F7YA 4N2DA 4PRIA 3RIAF 3K91A 5HVWA 3D51A 1LG1A 4FS9A 4G80A 1C5CH 4XOAA 3TC9A 5DRXA 3ZK0A 4QNWA 3SBWA 1L2QA 2BSED 3RVUD 1IKFH 5DJ8A 2AV7B 3IJSB 2X1RA 3ZVIA 3SHSA 4KS0A 4Y2OB 3CZJA 5FF2A 2Y69B 6REQB 2FQFA 3BPWA 5I66B 1D8CA 5IFHH 5BU6A 2G4JA 1EJXC 3VMPA 1GZGA 4DN3H 3INOA 3MXWH 2YLKA 4NQ1A 3REVA 2YKKA 5CJQL 1D7FA 4D0CA 5JUVA 5ID1A 1ICTA 4PJGB 5DTFA 4EUPB 3VXME 3QULA 4AM0Q 1Q3NA 1XBZA 2FB3A 4DNLA 3C52A 3NFUA 5A6BA 1CB4A 2Q76B 3NESA 1MN4A 4GUPA 4N3TA 2RALA 1ONEA 5IOKA 4UT9H 2Q6WB 3NIYA 2WZ5A 1QNSA 3DX6B 3QQXA 2HUEA 1IO4C 5L8KB 2PMQA 1DBJH 4JQIH 1WIUA 3IGKA 3KWUA 4QRSA 3N6YA 4ZBJA 3KR3L 2NZ9D 5CBJA 3FT4B 1M2OA 3SUUA 5LNDA 4PJ8D 4Y4HA 3GT6A 3PV7A 1A4JB 3SGKC 3CUPB 5D30A 1KJ2B 1V6TA 3WX7A 4QTIH 3JYCA 3RWGA 3SCMA 3QAQA 2IGTA 1I1YB 2DYPA 1I3RB 2GJ6A 1KJVA 2BOBA 3T0WA 5DFVD 3U83A 5I1AA 1BP3B 1U8HB 1I3UA 4KKPA 4PB0L 2Y6ZA 4TULH 4GXWA 4XN5A 3O2LA 4AQOA 2VC2L 1ZALA 3EWBX 4IL2A 2QCLA 2R0WH 4E9VA 1ICSA 2EG8A 3T8LA 3T9PA 4EE2A 2HVBA 4LF1A 3TNBA 3MVIA 4P5KA 4ZUVA 1SXZA 4A7GA 2OMYB 3F04A 4KTGA 4P7LA 2Z4GA 3FFOA 3I6GA 2OJZL 1AJ2A 4H9YA 5EU6E 5HHOB 3VZYA 1KBLA 5EO0A 1D3HA 1UJTA 3SPIA 3L5MA 4MYAA 1A7BA 3DX4A 3QNFA 4FADA 3OZ9L 1ZAGA 2ATAA 1BVNP 2EKSB 5KYYA 3OC5A 1BQSA 4HUXB 1IJ9A 4MQXD 1QTWA 2GIMA 5D7JD 5HMSA 4S1SH 1AI1H 1IM3B 3GIZH 2XDFA 1AKJD 3DTDA 1T8QA 3FB7B 4LVNC 4G8GE 3LEXB 4R90L 1CXIA 2YD9A 3NUKA 4MJ6A 4OQTL 1QBLL 3F7QA 5ANHA 3SE9L 2WCPA 4DW2L 1WIOA 5KTEH 2L5HA 1EGMA 3GMRB 5FO7A 1HHHA 4LYKA 1GVYA 4HIXH 2WQWA 3T77A 4NUQA 2JNZA 3QDJE 3Q1SH 5KJ7E 5DDHA 3MV01 1VPOH 2PN5A 3HZVA 5F9DC 1EUNA 1Q63A 3PWLB 3TA3D 1Q4NX 2W60A 3P0YH 3WIIL 3VNLA 2JBMA 3S0CA 4MM1A 3CFIC 4X9GA 3SRDA 1TR1A 2CM6A 4F7CA 4X6DE 3R7QA 1WCBA 1S2WA 1YYLH 1VF8A 4IRSB 1BVOA 1HL2A 5I1HH 1V6XA 5TQ0L 4LP8A 2DLFL 3AGWA 1MJ7H 1TSRA 4F33B 2I60H 1TG7A 2WTOA 2B0SL 3EO0B 3MROB 4M9OA 3K2MC 5CUSH 3CL7A 1EJOL 5D04C 3BWZA 1HNGA 3MRJB 4ZDHB 1V8EA 3GEFA 4MA8L 3KZSA 1FHUA 5EU5A 3N91A 4I3GA 1I0DA 2QSCL 5H8DA 1RZGB 4YXGA 1GZHA 5DHVB 4DKAA 3MSPA 1DJIA 4BRVA 1TFVA 4XAKD 1UPMB 1DHPA 4PJ7B 4JIIX 3GI8H 1XCFA 2NY6C 3KE0A 3U4BL 4IX0A 3UTTB 3WFBH 2O61A 15C8H 2K45A 1HXJA 4QAIA 4Z5RB 5DJ2B 1OD0A 4HWBH 4NN7B 1INDH 2UXGA 2HTLC 2ZKYA 4FZ8H 2AJUH 1XH3A 3ABLB 3ZIMA 1G69A 3BTNA 1RJZB 4CSTA 1XH1A 4LVOC 4ERGA 1LQBC 4UM9B 5GS0L 1M05B 1TPVA 4AENB 5I8CB 1UIPA 1A1NA 3M0JA 2VTFA 3JQOB 2GCYB 3NJXA 3QDMB 4PIBA 1IIIA 3KLQA 4F15C 5IVXA 2B3RA 4L8CB 1MMFA 1T5XA 1NAL1 2ALRA 1CGXA 2IDCA 3DECA 2PYEB 4MAYD 4L18A 2HNHA 3TA6A 4XNMA 3QA3B 3BUDA 2H9AA 3KBMA 4W4QA 4TSCL 1WUNT 4KESA 4AZ5A 1HJXA 2E67A 5F2GA 4DM2A 1H50A 2VHLA 1MF2L 4HEPA 1T40A 5HHNB 1CLOH 1JD7A 3S1XA 1GW0A 4ZW8A 4NQDB 3UW6A 1I4FA 3FSZA 5EB8A 2FYVA 3CPLB 4M4PA 2W61A 3EYUH 3U7AA 4HPNA 4W87A 1I8AA 2F5AL 4W6YB 2Y5TA 1H7XA 4HHHA 5LIXX 1AZUA 3GMOB 4NRXA 3E5PA 3MY9A 1H7NA 4GKLA 4XCEB 1V77A 5K4XA 1YUHA 4PREA 4V1DB 2Y7GA 2OSWA 2PEVA 4XBGB 2HROA 3WQEA 2WB7A 3EYFB 4MA3A 1VGAA 1LXMA 4JRYD 2ZCGA 5D71L 1L6SA 1BWMA 1U91B 3IU3A 4CC4C 1FRBA 4N2LA 4XPGH 4NENB 3H4FA 2AJXH 3DPDA 4ZRGA 2C1PA 4YC2C 1RK0A 1N68A 2FYYB 2C9AA 3DGGB 1QUNA 1CFBA 1VACA 2GUYA 2JI1A 3HA0A 1XJBA 3W22A 3AVEA 2PRMA 1I45A 2BB0A 3VGGA 3GR4A 3MJYA 2DQJL 1NCBH 3EMCA 1XPGA 1ZVNA 4HFWA 2CRZA 1EDYA 5BRZA 5ANME 4Z23A 4EXAA 3S97C 5KZEA 3QEQD 2WV8A 1VLXA 4O2CB 3HFMH 2GSIA 4OWGA 2PCXA 1L9TA 2DV0A 2DQ6A 1JSYA 1KM2A 4DN1A 2HA1A 4WVRA 1NJJA 2CLIA 2XZZA 3D0VB 2J7GA 1JTTA 4JQ1A 1CLYH 1MCSA 4FF7A 4RXFA 1EEQA 3TEWA 2O9OA 3V1PA 4C6BA 5E4EB 4YIQB 1KCUL 3U36A 3CK0L 3ZW3A 2JKIS 5JORA 1FP9A 3ZDXB 5DQDL 5D8WA 2BNQB 3H9SB 1G7JA 3LGDA 3UXKA 4WEVX 3IM1A 3SCUA 4M1CC 1AQ0A 1JWMA