1RP8A

Crystal structure of barley alpha-amylase isozyme 1 (amy1) inactive mutant d180a in complex with maltoheptaose
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
b'HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLAFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type 1 isozyme
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rp8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rp8A01
3RPMA 1RD6A 2O92A 3CHEA 2WVUA 4QDMA 4HZ7A 2CKSA 3L2MA 1L8NA 1J0IA 2C0HA 1V6YA 3MUY1 2WC4A 2VQUA 3GXPA 1W9BM 1GOIA 2WMIA 1V3KA 4GQQA 1EO7A 3CZKA 1CLVA 3WF3A 2BY0A 3IGUA 2F7PA 2BVYA 2J7GA 2WMIB 3BCFA 3PZMA 3ZR6A 1CXIA 2XSBA 5DEZA 1WZAA 2ZUMA 5CGMA 1TR1A 4U5KA 3OLDA 1JF6A 3GH5A 2BV9A 1PJ9A 1B3XA 1W2PA 3NUKA 2J7BA 3F5LA 5IFPA 2VX6A 1ODUA 1ZBVA 1W9DM 4MTVA 1W3JA 3W27A 3VDAA 3RCNA 1R33A 3RJXA 3IK2A 3VPLA 1HF6A 4FK9A 1BVNP 5FOOA 4KMQA 1MWOA 3SUUA 3CZLA 2FHBA 3WBEA 5D9PA 1LQ0A 4AISA 2BY3A 4LQ1A 3BGAA 1KWGA 1VRXA 4PMDA 4X0VA 2GDVA 2DT0A 3VD7A 1GORA 2J75A 1C8YA 3SEPA 2D73A 1FP8A 3BAIA 4CN4A 2VI0A 1QBAA 4HOZA 3M7SA 4NRRA 3ZOAA 2XFFA 1XRVA 4TVDA 1GJWA 4IPNB 2W67A 2WYSA 1R34A 4TUFA 3SURA 3WQ5A 3CZ8A 2XG9A 3VD5A 5CQ1A 1BGGA 3CUFA 2CBVA 5EFFA 4W8AA 1B3YA 4AC1X 2V5DA 5I24A 1EO5A 1E6ZA 3VSUA 4GZJA 1JDCA 4DUXA 5A6BD 3MSGA 1NWTA 2F2HA 3WY2A 1X1NA 1OGBA 1OSEA 4GI9A 1HJWA 1VEMA 1W9UA 2QLYA 4BQ4A 5ABFA 1DWJM 3CLWA 1H11A 2C7FA 4D1IA 1KGWA 4HU0A 5ABFB 4AXNA 2X2HA 2YIHA 1FP9A 3I3DA 1IZJA 3H54A 1UWUA 2XJ7A 4JFWA 1DTUA 1H0IA 2WZEA 1LLOA 1G0CA 2W91A 4AEFA 4M81A 3WDIA 1QHOA 4MB3A 3UERA 5F7UA 2EACA 4AZCA 3HG2A 1J11A 1EDGA 2V3EA 5BRQA 3GYCA 3SCSA 3CUIA 4A3HA 2J77A 3CMJA 4FMVA 2FGZA 1M01A 2XVGA 4ZE5A 1UH3A 4AZCB 5IHSA 2J7CA 4JCLA 4V2XA 2EJ1A 1JDDA 3EJSA 4UFKA 3MO4A 2WC7A 3AHVA 3SCWA 5A2AA 1HNYA 4C7GA 2VZOA 3BLPX 1WKYA 1Q6CA 6TAAA 4TVUA 1DHKA 2MANA 2QHAA 4CKQA 1G01A 1OWQA 4W5ZA 2DSWA 1NARA 1HKJA 3HMCA 5CPQA 1HKMA 3O9NA 2VO5A 2WWDA 4W93A 2G41A 4C7DA 1KBBA 1VFMA 2X0YA 1CPUA 1DP0A 4HPGA 2CCRA 4E4PA 4U2ZA 3ZT5A 1EOKA 5JIPA 3N04A 4NZJA 1C3FA 1TG7A 5A8OA 4B3LA 4MB5A 1E0VA 1BYDA 1H49A 4PMQA 4CCEA 7TAAA 2GJPA 2QPUA 1Q6FA 2WHMA 4KRUA 3AXXA 4WJXA 1RPKA 4TTUA 1CXLA 3RM9A 4D72A 1OINA 2J4GA 1MQPA 5A94A 3IANA 3GXDA 2D24A 5GQBA 1US3A 1V02A 3DDGA 3MS8A 2DT1A 1E6SM 3FHQA 2WCGA 3A5VA 3CIVA 3ARQA 5A6KA 3LPOA 1JYXA 3LRLA 4AIUA 4CVWA 4R27A 1E6PA 1KGXA 1BTCA 4WKAA 1BPLB 2DIEA 4GI8A 3KL5A 2EQDA 3PZVA 3SCTA 3VIFA 4UNIA 4GPNA 3VINA 4CD4A 4MADA 4AD1A 1WB0A 4X9YA 1J10A 1HP4A 5HOSA 4A4AA 3G6MA 1JL8A 1WAWA 3NCOA 4B16A 1W2VA 2ZUWA 1UKPA 3LPFA 1BG9A 1UD8A 4MAVA 2YDRA 5D4YA 3TA9A 1CGUA 1R7OA 4JHZA 4KH2A 1GONA 4J3UA 4BQ3A 3N9KA 3WY1A 1DWHM 1QOXA 1ITCA 3BAJA 5AC5A 2GJXA 5CSYA 2VZSA 3GH7A 1FOBA 3SUWA 5A95A 3WL1A 4WKHA 4AMXA 1ISXA 2GJXB 4AIOA 1TQUA 1UR8A 1E0WA 2F61A 2Z1KA 3BMWA 2J74A 4NSBA 2Y5EA 2EO7A 4DO5A 5C70A 2E8ZA 4IUGA 2ZXAA 1US2A 4IM4A 1HT6A 4NI3A 5C71A 3WDQA 1XSJA 1QI5A 2HISA 2VZTA 4PSRA 3AIQA 3SCPA 3POCA 3HU7A 4ML4A 5ABGA 2O9PA 1SYTA 3KL3A 3VM7A 1M04A 4UOQA 1R87A 3CHFA 1TVNA 5IXEA 4LGXA 5I0DA 1NH6A 3TV8A 4K68A 4OZOA 1ZBKA 2V3FA 3RO8A 1KTBA 1KQZA 1OB0A 1HL9A 2G3MA 3L4UA 3GM8A 4P8UA 1OCQA 2DH3A 4JKKA 3B8SA 3DYMA 4PMZA 4XUYA 2W4XA 3BVUA 2VRKA 3WEOA 1H0GA 2WVVB 4GQRA 4Z2HA 5CG0A 3W28A 4D6GA 1QNPA 4DWSD 4DWSC 2JALA 5KZ6A 5LA0A 1IV8A 3IAQA 3PZIA 3WMBA 3BXWA 1W91A 3CC1A 2PWFA 3RILA 3ARZA 1O7DC 4HP5A 1E9LA 5GNYA 3AMGA 2WNWA 2QF8A 2UY4A 2CESA 2OSXA 3U5UA 1XD0A 3ALGA 3AHXA 3AIBA 5DT5A 2V3DA 2PBGA 4E8CA 1BG4A 3W4RA 2J8GA 1PIGA 4P7NA 2WVTA 1HXJA 3FW6A 2EPMX 2DGAA 3VD3A 1GPFA 2J62A 5E6ZA 1TA3A 1RH9A 1QPKA 2A3BA 3F5JA 1QVBA 1KTCA 2VURA 5C8BB 1V0MA 1W3HA 1CYGA 1TA3B 3AIVA 3VIGA 3GBDA 4HMDA 2V3GA 3AI0A 3VVGA 5I77A 1BYBA 3L4TA 3WELA 4UQEA 2V38A 2BVTA 5A8QA 4CD7A 1V08A 2ZUNA 3BAKA 2F1BA 2X8RA 3RMEA 3SUVA 1V6WA 2J78A 4PCSA 1MXGA 4QAWA 5M17A 4CN6A 3MUZ1 1TVPA 1R47A 4QLJA 3CPUA 8A3HA 4W87A 3OZPA 1NWUA 4OUEA 3NSXA 2PBOA 1JG9A 2E0PA 1GQLA 4H8UA 3AISA 2PWEA 3FNDA 2WC3A 1VENA 3LX9A 3WQWA 1UHVA 2BXZA 3L2LA 1KCKA 4BQ2A 4XB3A 1Q6GA 5D8ZA 1HWWA 1E1EA 3D5HA 4OBSA 1NOUA 3VO0A 1TFVA 4UFLA 1KXQA 4QLLA 3OIHA 2YBUA 4JKMA 5A8NA 4PMUA 3DX2A 4KGJA 3QHNA 3QHMA 1JI2A 1UA7A 4V28A 1I1XA 3UG5A 4HZ8A 3LXAA 2ZUSA 2XPKA 5EMYA 2XUCA 3AZRA 3MANA 1I1WA 3BSHA 3L4XA 3W53A 4UCFA 4TTGA 3WD1A 4AZBA 1W32A 2D20A 2JF6A 4UOJA 1R8LA 4W85A 5HPCA 4PUDA 3SCQA 3GBEA 1C8XA 4M24A 2BY2A 2CIPA 4P7OA 1X6LA 2VX4A 4MJ2A 1E71M 5JBFA 4U3CA 2FYVA 1E15A 1JZ3A 2ZOXA 5CJ5A 4J28A 4KRTA 3KEHA 2NT1A 3BUDA 4F79A 4H8HA 4R5EA 9CGTA 1E4MM 3WH9A 1PIFA 2WHLA 2ZX8A 2IXVA 2XTKA 2E8YA 4AIEA 1EQPA 3OLGA 3GNRA 4AZ6A 4UZSA 4Z2JA 2BFGA 3WF4A 3KZSA 3OZOA 1V6VA 3D4ZA 3A4WA 5ECUA 1UWTA 7A3HA 2X05A 3KLLA 1W3KA 3W25A 4JKLA 1CWYA 1GQJA 3O6AA 3LXCA 3S2CA 2D22A 2DT2A 4F9DA 1J01A 3BSGA 2WSPA 1H5VA 4L4OA 2UY3A 1HTYA 4IISA 5E1QA 1UD2A 1H09A 2GVYA 1FFRA 4GZIA 4PSPA 1I75A 3DECA 4ZE4A 2XHYA 3BUPA 1B3ZA 1FHDA 4D6CA 3FAWA 3PHAA 3AXIA 1BYAA 5AYBA 4ACYA 1NOWA 4Y7EA 1PX8A 4GXPA 5LYRA 4KWUA 1LL4A 2WMKA 1DEDA 2CNCA 1CEOA 2WANA 2W92A 1BHGA 1J12A 3S5ZA 4M29A 3PBGA 4XZBA 5I2UA 2WLYA 4EANA 3EMCA 1BFNA 5A6SA 3N13A 1QHZA 4HA1A 4GI6A 4B9ZA 4FNSA 3BC9A 1E6QM 1VAHA 2PWGA 1QI3A 3BUBA 1QHPA 4PMYA 3U57A 4MB4A 3SUSA 1WP6A 1D7FA 1PZ3A 2IUZA 2QMKA 4PEEA 4XZWA 1NOFA 4AZGA 2F8QA 2IGTA 2Y8VA 2JIEA 2OWXA 3VGGA 1B3VA 2OYKA 5A1AA 3I3EA 2CHNA 3WENA 2D3NA 1V0KA 2BNJA 2CBIA 1VJSA 4TX6A 3UESA 1ZS2A 2EADA 3CH9A 3W0KA 2EEXA 1EQCA 4P7QA 5BCAA 4JL1A 1GZJA 5M5DA 4J3TA 1CXHA 1EDQA 3WF1A 3QHOA 1QNRA 1DWFM 1GOMA 2ZUUA 3BVXA 2ZICA 4HA4A 1JDAA 2CXGA 3VMNA 5HBFA 2CBUA 4GKLA 3BH4A 4EK7A 2YFNA 3K8MA 2VR4A 2XIBA 2XVLA 5DO8A 1V3LA 2X2IA 2ZWYA 3AIRA 1FH7A 1EH9A 1TCMA 1XH2A 1LF1A 1O6IA 4QCEA 1UASA 5CZKA 2O9OA 3AICA 3L4ZA 4J3SA 3T09A 2IXUA 4RE2A 5A6JA 2XWDA 2GSJA 3AMLA 3FN9A 3LMYA 3ZT6A 1ZB5A 3II1A 1QWNA 3H55A 2BVDA 2VCCA 4D6IA 3WQ8A 1HVXA 3NYDA 1E6NA 1HXKA 1WE5A 3K8LA 4AD3A 5E9AA 3T2PA 3UG3A 1F4HA 4PMVA 3PTKA 5AYIA 3LXBA 3W37A 2VL4A 2G3JA 5E0CA 1U2YA 2ZX5A 3UG4A 1JNEA 2RGLA 1UWQA 3TTQA 1KR1A 1J9YA 3AIWA 1B1YA 3TP4A 2WKLA 2OWCA 4HOXA 1NP2A 2Y24A 1XYFA 1MW3A 1E5JA 3S6TA 3RIKA 4AD5A 3BVTA 1J0JA 3WNOA 3CUGA 3ARWA 4PTMA 3WUBA 1A47A 1D3CA 3VD4A 4FNRA 3NDZA 4ACZA 3GTNA 1TQWA 1JZ4A 1C7TA 2XN0A 1XV8A 4L4PA 4BS0A 3T0BA 5BWFA 2XN2A 1XCWA 4LYRA 1ZJBA 4ACZB 5M03A 4CN1A 1W3LA 2QV4A 1XC6A 1FFQA 4H2CA 5IDIA 2Q8XA 1EHNA 1QNOA 3DC0A 3HG5A 3WKZA 3WNLA 5GNZA 4D1JA 1PAMA 1UQYA 4PN2A 3UR7A 1W9XA 3CZEA 2JFEX 2DSUA 2BXYA 1V3MA 4JFUA 1DWIM 2ZE0A 3LPGA 2D2OA 4UFHA 1V03A 3AFBA 3WMSA 1HIZA 3AYRA 3K46A 4FNUA 1S46A 3U5YA 2F18A 2OYLA 1JAEA 1ZJAA 1KGUA 1WZMA 2OSYA 4WSKA 3VU2A 1WDQA 2EAEA 3PZOA 1AQ0A 5EBAA 4BF7A 1HKIA 1LWHA 2VZUA 3BAWA 3THCA 2A3HA 2VNCA 2XN1A 3HJEA 3JUGA 1HX0A 4W7UA 3WL0A 1M7XA 1WNOA 1JNDA 4AY1A 1CBGA 3WDJA 3B9DA 1VB9A 1L0PA 2EBNA 1CENA 1MQQA 3MI6A 2C8NA 2W63A 1PPIA 4ATLA 1GHRA 3SCOA 1R86A 5IFTA 1VBUA 6CGTA 1B90A 3K4DA 4B9YA 4IPLA 4H41A 1H41A 1K9FA 1JYWA 3S5YA 3EJUA 5A6AA 4A3YA 3UCQA 4N0RA 3VD9A 2YL9A 1TQTA 3N12A 1E43A 2ZIDA 4JL2A 1E40A 1MFVA 1MQRA 2WZIA 4YPJA 3VIJA 5I5RA 4WF7A 4RL3A 1CZ1A 1WZKA 4W89A 1EA9C 3HG3A 1BYCA 2JIWA 2PB1A 4MAZA 3WUEA 1EGZA 4DUVA 2XSAA 3AZSA 5DF0A 3WUGA 1G5AA 1UKOA 1UR0A 3G6LA 2VRJA 4CGTA 2PC8A 1FH8A 2ZWZA 1GJUA 1H3GA 3SCRA 3AMDA 4W86A 4X0NA 4FLRA 3WDRA 2YDQA 1ISZA 1UR4A 1UZ1A 2V5CA 1E3ZA 1E1FA 3GXTA 3AHYA 1E5NA 3K4AA 4CU6A 1JZ8A 2NW0A 3WFLA 1GUVA 3CTTA 4TX8A 1MXDA 1E4NA 1B2YA 3A4AA 3WH8A 3DHUA 1MW0A 2YA0A 1BVZA 3A47A 3L4VA 2A3EA 3SUTA 1PX4A 2XYLA 1U33A 1W1VA 1W1PA 4WLCA 1HL8A 4OJYA 2X0HA 3BVWA 3N15A 4AYSA 3T08A 3EJPA 4YHGA 4BA0A 1VEPA 1V3HA 3WN6A 2VCAA 2WWCA 5BROA 1TQSA 1NWSA 1EHAA 5EFDA 2AAAA 1BAGA 4W88A 1VFOA 3WY3A 3AS1A 3OGRA 4MNJA 1QX1A 3AROA 1KQYA 1OBAA 5BXSA 1UWSA 3TONA 4Z2GA 3CUHA 3WEZA 5A2BA 2EXOA 4MNMA 5BXPA 5A6MA 3DX4A 1F4AA 2DSKA 2YLAA 2XVKA 4MNLA 3CHCA 3ZSSA 3ZT7A 3APGA 4UQ9A 2G3NA 4PBGA 1QNSA 2RGMA 4F9JA 5BYWA 2EPKX 4U3AA 2YL6A 3AIEA 1ISYA 2PI6A 1VFUA 3RM4A 3MMUA 1AVAA 3ARSA 2YL5A 4NF7A 3T0AA 3PTQA 1GVIA 4LX4A 1E4IA 1QI0A 3D50A 3VMPA 1WDSA 2CETA 2Y4SA 1E73M 3EDKA 1OGGA 3EYPA 2ZXQA 3NSNA 2DQXA 1QW9A 2OSWA 3WQVA 1CXFA 4CCCA 3QOMA 3WD3A 4UR9A 1Q6EA 3WD4A 3VM5A 1B30A 2BS9A 1E3XA 3CZJA 4AD0A 4OIFA 1A3HA 3EMQA 2XFRA 1OT2A 3AJ7A 3EDJA 4EE9A 3VGBA 2DIJA 5CSUA 4UZUA 2OWWA 3D3AA 3CMGA 4FLSA 3WH7A 3W81A 4UQDA 1V6UA 4MB1A 1CGXA 3VX1A 2WVSA 4W7WA 2E4TA 4UQAA 5EB8A 4UTFA 3BAXA 1TMQA 3BVVA 3M46A 2X09A 3A6OA 4MPKA 4Z2IA 6A3HA 3WEMA 3FY1A 5I3DA 2E3ZA 4P8VA 1V0NA 3LRKA 1JZ5A 5CLTA 4HA3A 3ZJ6A 1HJVA 2WCSA 3GNOA 3PN8A 2F1AA 1K9TA 2WAGA 4J27A 3ZR5A 3RM8A 4FLOA 1M53A 3W82A 4F66A 2E9BA 1CXEA 3AS0A 3DHPA 2XFYA 4FF5A 1JYNA 3WBAA 1TE1A 4D6JA 5M3WA 2OW6A 1RP9A 1UOKA 2F7OA 2JE8A 2VOTA 2YDSA 1FA2A 1KXHA 5A6LA 2CHOA 1LG1A 1OM0A 4TXEA 1QW8A 1PZ2A 3MUAA 1QI2A 1XSKA 3AMKA 3TTSA 3WH5A 2ALWA 1UR9A 2QMJA 4D6FA 1QWUA 2DSZA 3VUPA 1BQCA 5A8MA 2XGIA 3EDFA 1JFHA 3OG2A 4OGZA 2A3CA 2VUYA 1P6WA 4EKJA 3WNMA 4CD5A 3ARPA 1X6NA 1JD9A 3K1DA 3D51A 4ZEPA 5BXRA 4OOUA 4CU7A 5FIPA 4FNPA 5CPTA 4AZ5A 1UKQA 1GW1A 3WSUA 2G3IA 5A8PA 1JD7A 1FH9A 4AMCA 5GNXA 1HN1A 1E72M 2YLLA 1DWAM 3OLIA 5HXMA 4RE3A 3D4YA 5ABEA 3EJQA 3DX0A 4PRWA 5IHRA 1NM9A 1HJUA 3U7BA 1E0XA 2WBGA 3CV5A 1G9HA 2EPLX 1QI4A 3VNYA 3DDFA 2VX5A 3A4XA 3WD0A 3KL0A 3QGVA 3D52A 2BY1A 4D6EA 2J8FA 4GIAA 1IZKA 1UD6A 2J7DA 3CHDA 5CPSA 3MMWA 4B3KA 2VR5A 2QPSA 3N18A 5I78A 2WCAA 4UQCA 3B9EA 4QLKA 1E6RA 4CCDA 1AQMA 1XGZA 1BGAA 2FH8A 4PTVA 4D6DA 3T0DA 3LPPA 1AQHA 3O2LA 4AD2A 3EDDA 3WFZA 4PYSA 1ISVA 1H2JA 3DX1A 2BHUA 3H53A 1UUQA 3EJTA 1CECA 3ALFA 4CVUA 2X1IA 2Z1SA 3W26A 2YA2A 4MDOA 1K6AA 4GO8A 3WQ6A 1W1YA 1WCGA 3VX0A 1U30A 3VIPA 1B9ZA 5D9OA 1UWIA 3VDCA 1XHGA 3VMOA 1VBRA 1E70M 4ATDA 3ARXA 4Q7NA 3W6MA 1WDPA 5AC4A 4PTXA 1HJQA 3MKKA 3ZIZA 2VX7A 4JFSA 2AOSA 3VSTA 4UFIA 3CZNA 2ZXDA 1N82A 3AS2A 2F7RA 1B3WA 3F5KA 1CDGA 1OGSA 1PEZA 3PZ9A 1GOOA 2ESCA 2DEPA 2VZVA 3GNPA 1UD5A 3WH6A 4F8XA 3N17A 5HPOA 5A6BA 5FD0A 2WZHA 2NT0A 3UEQA 3CO4A 1ZBWA 3ZJ8A 3WUFA 1JYVA 1HJXA 5HDRA 1VIWA 2EABA 1GCYA 2WHJA 5ABHA 4U5IA 4AW7A 3PZUA 5LA1A 1TQVA 2CERA 1B0IA 3AMCA 2W62A 4EAMA 3GDBA 4ZXOA 1UKTA 4AWEA 3VGHA 3OB8A 1LL7A 1UYQA 2DDXA 2JEQA 4J3VA 2FE0A 4LYPA 2YOCA 3U7VA 2WK2A 3VGDA 4JAWA 2WBKA 1E55A 2D0FA 3A22A 1NQ6A 2PWHA 4MNKA 2CITA 1CGYA 2YL8A 3WY4A 5DMYA 1ZBCA 1JZ7A 4DM1A 3POHA 3GXFA 3BAYA 2E40A 1GOKA 2A3AA 3SCUA 1MW2A 3MU7A 4NXKA 4S3JA 5D9NA 2ZXBA 1GNXA 4HTYA 2W5FA 4AD4A 3HN3A 1JF5A 4HPHA 5E6YA 2O9TA 3A23A 3MV01 1EDTA 3SIMA 1V3JA 5I6SA 3RJYA 2Y2WA 5D9MA 1GHSA 2WW5A 3KLKA 1SFSA 2DT3A 4V27A 3WIJA 1VF8A 1R7AA 2VVSA 1SR0A 2GFTA 1BLIA 4AZ7A 1HVQA 3NIYA 4UFMA 1ISWA 4FNTA 4GINA 3IJ8A 1GVYA 3W29A 1GOQA 1OD8A 3HZ3A 1LJYA 3L4WA 1UWRA 2X2YA 1OD0A 3VIKA 2FDMA 4YHEA 1UD4A 1RP8A 2WPGA 1G94A 2YBTA 4HU8A 1KXVA 3IAPA 4JFTA 1XH1A 1V02E 2CBJA 4DO4A 3UR8A 5JIWA 1W9PA 3VGEA 3AQUA 1DWGM 4TOQA 2D3LA 3T2QA 3TTYA 4P7LA 4MJ4A 5I79A 2J25A 4YN5A 3PZTA 4NRSA 2XVNA 3ZJKA 4ATWA 4J7RA 1HP5A 1CNVA 2WM0A 3ARVA 2ZX6A 1WPCA 5HNNA 5FL1A 1XD1A 4QP0A 2BHZA 2WSKA 2BHYA 2F7QA 3AIUA 1EXPA 4N42A 3ECQA 3PZQA 4PTWA 1SMAA 4DO6A 1HJSA 1CGTA 1CLXA 3VIHA 4W8BA 1UZ4A 5JUVA 2CEQA 2WMGA 2D23A 3TOPA 5FL0A 1YHTA 8CGTA 4WSJA 3L4YA 3IJ7A 1KB3A 3GXIA 1NP0A 2JEPA 3ZMRA 3T2OA 2XWEA 4GO9A 3DX3A 1R85A 1LWJA 5KEZA 4OKDA 5E09A 4CUCA 1UKSA 4NXSA 1ZU8A 3ARTA 1J18A 3VIIA 2XIIA 4C7FA 2YJQA 2EPNA 1VFFA 4M80A 4JCMA 3M6DA 2YFOA 2WHKA 4KGLA 4WIWA 4AZHA 2NSXA 2CKRA 1MVYA 4RE4A 4AEEA 3N11A 2WB5A 1KCLA 2WXDM 4XV0A 2YA1A 3ZO9A 1C92A 3VGFA 5DT7A 4TVCA 1G1YA 3VIOA 1HKKA 4QCFA 1KFWA 3DYPA 2WMFA 1JFXA 2D1ZA 1XSIA 2XM1A 2J79A 1K9DA 2D0HA 1QNQA 2XGBA 3E1F1 4GZEA 2O9RA 2D0GA 1H4PA 3VTRA 2VTFA 3MSDA 4FNQA 3W6LA 5BRPA 3DYOA 1JXKA 4D6HA 1CXKA 2G8ZA 3WD2A 4CD6A 4H7VA 1OIMA 3BCDA 3J7HA 3M07A 1V0LA 1JZ6A 4ZENA 1SMDA 4LXFA 1XH0A 4ZFMA 4JZ5A 1K9EA 1UD3A 4W84A 4M56A 2UWFA 4HMCA 4HZ6A 4MDPA 2W66A 1M03A 2OW7A 4NX0A 1V6XA 4M8UA 1J0ZA 1VJZA 2J7HA 4WKFA 3QR3A 4QFUA 4DWSA 5E0FA 2J47A 5A3HA 5BXTA 2J7FA 2VCBA 4AZIA 1WDRA 3QOKA 3HG4A 3ZSTA 2FHCA 5A69A 4PMXA 1CGVA 3NJ3A 3ARYA 4AMWA 1J0KA 3RDKA 4DWSB 2UY2A 3WMCA 2WVVA 4J3XA 3ZQ9A 1BF2A 3EJRA 2DPEA 1D2KA 2DH2A 4NZFA 1KWKA 1JAKA 1UG6A 1UH2A 3FAXA 2OLHA 3WQ4A 5LA2A 7CGTA 2W61A 1W1TA 1MFUA 1PS3A 2B31A 4Q22A 1JZ2A 3VOCA 2WKGA 2CYGA 3AS3A 3UETA 5I23A 3MUIA 2Y8KA 3I3BA 4OBRA 4DM2A 1AMYA 1V3IA 2WLZA 3WNNA 1ITXA 1JI1A 1C93A 3FHAA 4FLQA 3OLEA 3WDHA 4W8LA 4U2YA 2TAAA 3VILA 4PMNA 1YQ2A 2UY5A 3F4VA 2GJRA 1UH4A 4JFVA 3GXNA 4PMRA 5A2CA 5GPRA 3TTOA 2FHFA 1J0HA 3GZAA 3ARRA 3EBVA 3AHZA 4NZCA 4B15A 4UFJA 3ARUA 3BMVA 3VDBA 3CGTA 1IT0A 2OYMA 4UQBA 2E9LA 3MMDA 1UQZA 1NWRA 3VDHA 1FHLA 4URIA 1UR2A 4E2OA 2JF7A 3A3HA 2AMGA 5CGTA 4HOWA 1MYRA 3W38A 1C7SA 3WNKA 3BUQA 2VT0A 3OGVA 2VRQA 1OT1A 4UOZA 4M82A 4WK9A 1JIBA 2VMFA 1O7AA 3ZJ7A 4JIEA 4BQ5A 4P7RA 1MW1A 2ZX9A 1TUXA 1E56A 4E8DA 4W7VA 3ZM8A 2CPUA 3THDA 3CBWA 1R75A 2HVMA 4U33A 1EIBA 2ZUTA 1XYZA 3BLKA 3VNZA 4HMEA 3CZSA 4H04A 4BCEA 3CZGA 3B9AA 4CD8A 3GH4A 2WMHA 1B31A 4H8VA 2PF0A 3VIMA 1Z32X 2XVPA 5TD4A 3CUJA 4BZYA 3VSVA 4P8XA 5JBDA 5CLWA 3PTMA 2E9MA 4S3KA 3K8KA 5AY7A 1LG2A 1UR1A 3WDPP 1JGIA 5D8WA 2FH6A 1ECEA 3NSMA 4Z2KA 1QBBA 1GQIA 2PWDA 5CXPA 4DUWA 1PBGA 3A21A 3LRMA 2GDUA 3BUIA 1VEOA 4ZXLA 4P8WA 5FKYA 4PUEA 1SZNA 1Y7VA 3AOFA 1CTNA 3GXMA 2VVNA 3WF0A 1E4LA 3NDYA 2FGLA 1GQKA 1LL6A 3OA5A 3OGSA 4JHOA 3KE0A 1ODZA 4XX6A 3EDEA 1C91A 1KXTA 4PMOA 1W9VA 4LPCA 3VKKA 1H1NA 1CIUA 4D71A 1ESWA 3BLBA 3N1AA 1KBKA 3IJ9A 2DSVA 4PCTA 3EMZA 1Q4NX 3AXHA 3MV11 5FCZA 2VJXA 1J0YA 2ZX7A 1ZL1A 3A24A 1OIFA 1XCXA 2EPOA 4J3WA 4LYQA 1E6XM 2GUYA 2YKKA 1C90A 2G4FA 1C8QA 1R46A 1CGWA 3SCNA 1Q6DA 2XM2A 3WF2A 2X2JA 1T0OA 2ZUVA 3PZGA 3KWXA 5JBEA 1JXJA 4U31A 4AYGA 1KR0A 3W24A 3FXYA 1TZ7A 3PZNA 2VQTA 4OOZA 2J7EA 1WO2A 2GK1A 3AHTA 1WZLA 1GOWA 3AYSA 3OBAA 4W5UA 1PX3A 3SCVA 2VC9A 4CU8A 5DFAA 1EOMA 3AZTA 1UA3A 2GK1B 3WNPA 1BSIA 5E70A 2WMJA 4Z2LA 4M1RA
chains in the Genus database with same CATH superfamily
2J44A 3ZRSA 2WVUA 5IG7B 3FT0A 5DUMH 3T2NL 2ADIB 4FXLA 2V2WA 1QLFB 2VC2B 1I1AA 4KCWA 1ZA3B 2X4RB 3I6KB 2WMIA 3BLIA 1NDZA 2ZRWA 4WR3A 2W9EH 5AHMA 3IGUA 5FA3A 1INQA 2C6QA 5I09A 2EXTA 4GBDA 4B6ZA 4PMEA 1TR1A 3NIDF 2JB6B 3JTBA 3DUUB 3WXWH 1MFEL 1HF6A 3OXSA 5DJ8B 1S8DA 3RB5A 4PJEA 3B0YA 1DVSA 2VXNA 1ZUAX 1XZ0B 7REQB 4E41E 4ZXBC 3NOYA 3D3VE 1YSOA 4HFUH 1XF5A 5F0PB 2Z2BA 1F58H 4PY7B 2W67A 3RI5F 1NDMB 3G6AB 4OD3L 3GYRA 4UUIA 5LBVA 3I6TA 2XG9A 3AQXA 1ADQL 3B0XA 4P2QE 4PTTA 1W5PA 3MFGB 1XGPA 2WYTA 5GRXG 4MTMA 4E41D 1W8EA 5MEND 2NNCA 1OGBA 5TNVA 3F3HA 1HJWA 3USZA 5KSAD 5CN2A 1G4SA 4MLRA 1I7ZA 2KS0A 3UPBA 2C7FA 4FQIH 5CUSL 2Q20A 4MJJA 3GW0A 2FB3A 1XIIA 3H54A 1G7QB 3U0TB 4WEBL 2KLRA 2V7NB 4I48B 4RFOL 4MB3A 3MO7A 4JG1L 3SBRA 1QUMA 4FMVA 2FGZA 4F2TA 2HJKA 4IT1A 4K7PH 5CILH 3V36A 4UFKA 3BDBA 2YBRB 2NX5A 4GSRA 4XMKH 1GZ1A 1WKYA 2N59A 3K2IA 4QNEA 3C60A 3QIUB 3GC2A 3ZYJA 5FO2A 5ABDE 3WNIA 2YZ8A 1KZYA 3ZT5A 3KHDA 5HGHA 1PNCA 1TQBB 4TTDD 2FGBA 1EFXD 1BFOB 2QTVA 1GZQB 1T7LA 2HT3D 5FPIA 1TG7A 43CAA 4B3LA 3FN0L 2ZYFA 4NZ1A 3JYCA 1Q6FA 3FU7A 5ILTH 3VFMB 1G7LB 4WXZA 4HQQL 3DDGA 1LO0H 3COTA 3NTCL 1E6SM 1R5WB 4X7DC 3I9GL 1KD0A 1NCGA 4L37A 3O45B 5BV7H 1BPLB 1D2OA 3SFKA 4Z7OE 4EXBA 3CL6A 2MMXA 2R91A 4R7WA 3FB5B 1JK8B 4L8BB 4X9YA 3RWCB 1MNUH 4BI6A 4N0CC 2ZAHA 3MNZB 3ZL2A 3UP8A 2P4AB 2RCSH 3W7QA 4DN3H 4C60A 4LH8A 3SUWA 1PE1A 3LKPA 3S35H 1U3ZA 2EO7A 4TRPL 2ZXAA 4OCXH 3WDQA 5D2LA 4ZTYA 3THUA 4JD4A 2CE6A 3DBNA 1PZAA 4LGXA 3A6CH 4K68A 1JXGA 1NEZA 4XO8A 3QFJE 4E9QA 1HL9A 3MV9A 1TX2A 3K5XA 3ARGA 3KRUA 3M44A 4QE5A 3H7BB 4P2OB 2CLZA 1HOCA 1FNGA 4O54A 4MLIA 2CUAA 3MLRH 3QIWD 4ZQRA 1TTPA 3ARZA 1QSEB 2VR3A 2QF8A 2CESA 2KAUC 4E5TA 3Q44A 1AANA 4JNZA 4EWJA 3QFJD 3ZE1F 3GUTB 2V5RA 2JXMA 1XDMA 2GSIA 3GNNA 4JY4A 2C9VA 3GBDA 5MKGA 5BZAA 2J1ZA 3F4DA 4C56A 1E1CA 4K0OA 2J78A 5EZJB 2ZVIA 4OZFH 1CT5A 3H2PA 5C07A 3S46A 4JGDA 2E27L 3NSXA 3MUUA 4M6UA 3QCVH 4EBQL 2PWEA 3ALWA 1NU5A 5BOEA 5E1IA 1WK0A 4ZAKB 1L9TA 3X14A 4WZHA 3BIBX 5D2TA 2QCNA 4KKAD 1U3JA 1Y65A 3IVKB 4OT1H 1E50A 1G7PB 4Q56A 2E9WA 2B1AH 5HHXH 3QHNA 4KJWD 1Z5YD 4OLWH 3TFKD 3UG5A 4GMTL 1G9MC 3FQNA 3A4FA 4OLUH 1NJ9A 5IVZA 2D20A 1QPNA 4PODA 3RDTA 4PCYA 3GJFA 1DANU 5DUPH 5IW6B 5CJ5A 3KEHA 3NIFB 1KPRB 1E4MM 2C3ZA 1JZFA 1OADA 4XD3A 3TO4D 1M7IA 3VXRB 1QOQA 4OQVA 5EPMA 4X5RA 5DMMA 2WPBA 1S9VB 4FP8L 4DKTA 2R0LH 4N25A 4WTZG 3TW6A 4KFZC 2Z31A 4G2AA 1LEGB 3VJ6A 4L4OA 4S1QL 3QORC 4TPRH 1WXZA 1URZA 3MYOA 1B3ZA 1MRDL 3ITCA 2ALDA 1QMUA 4JM0A 1FLRH 4NPYB 3NPXA 5LYRA 1E4JA 1Q3NA 5KZEA 3O6ML 2WLYA 1HNGA 1NMCB 4M03A 4KY1L 1FVEB 4PVNA 4AE1A 4PJ8D 2M83A 3OAYH 1MCPL 3DZ1A 3QPYA 4UV7H 3U9PH 4XZWA 1GIGL 2AS5M 4WO4A 4AF0B 3JV6B 4CGUB 4YHLH 2FECI 3CPRA 5A1AA 2J88A 3JWOC 3UTTE 1EGJA 5EHFA 1FDZA 3H7VA 2AP2A 5ICUA 4L1DA 4D9QD 2VDNL 1ZIAA 2Q3XA 3DGGB 1DWFM 3R0MA 4U1IA 1XB6A 3ZLHA 4MD5A 2YFNA 3GNDA 3R25A 1WFJA 4GXVL 2AXFB 2XVLA 3LQAC 3SAZA 1EH9A 1RV6X 3O6KL 3HA1A 2QR6A 2WW8A 4PJBF 1XICA 2OKTA 2GCYB 5I75C 4XZ4A 4MSWB 3RURA 1D8CA 2EC9T 3G0XA 2WUCH 3MLVL 4GC3A 2P5ED 4K5PA 1A1NA 1E4WL 1RAKA 3M1BA 4C6KA 1E6NA 2A1WH 4OV5A 4OLZH 3EFOA 3VXSA 1PSKH 4N2BA 5JA9A 4YL9A 4LBRA 2E9IA 2PDFA 3APDA 5C2CA 3CX5J 1JZEA 1UWEL 3DGCR 3P9MA 2MNWA 1XYFA 4KX8A 4XO5A 5H2BB 3RIKA 2CDGB 3FMGL 3DX8A 5F7EH 5I07A 4KI5F 6XIAA 2FIQA 1Z7AA 1LWRA 3G6JE 3LB0A 2XH2A 2J5LB 1XCWA 1N5YH 3CQKA 4XCFL 3T77A 1R2SA 5KSBF 5KVGL 2OLDA 4B53A 3HAEH 2BXYA 3TBSA 3K46A 6PAZA 3I74A 4K71B 2KERA 2VDGA 4NRXA 1WDQA 2EAEA 4FDWA 4LLYB 1F76A 5JR1L 4MQSB 2R1WA 4PJCE 1IEWA 1OSPL 4W70A 1U42A 2AJSH 3C4UA 2XWXA 1P4UA 4XBSA 5DCEA 3D85D 1B4KA 1A4KB 2FIRT 3AAZA 4K23L 1U92B 4MNQD 1S9XA 5F71A 3TBTA 5DD6B 1C9DA 1H41A 3ME0A 1HI6B 3KCPA 3UZVA 3KOYA 1FTXA 3VD9A 3N12A 1MHHA 1GOHA 1MFVA 3WE1A 2QCLA 3PFRA 2ISVA 4FJ6A 2AJ3B 3NG3A 3QCUL 4K8EA 4LCIL 1EGZA 3AZSA 5DF0A 5I1EL 1Q9OA 2QSCL 3G6LA 4GRSA 4ADSA 3AMDA 3IKCA 4LASH 1E8WA 3ZZLA 1VIZA 2J9YA 1E3ZA 3L9EA 1AH3A 3LM7A 1ZHKA 1GUVA 4FE9A 1WZ1L 4JO3H 1W8GA 4DK6A 2MCPH 4CKVX 4ANXA 3ZMEA 5SWZE 3CC5A 2A3EA 3KRZA 2XYLA 3KBHE 3QUMB 4WV1A 2YLHA 1K8DA 4Q32A 3PQYA 4J3BA 2P28B 1Z9PA 3C2SA 1OGAA 4O1CA 2IDCA 2YZ1A 1UWSA 4R4FH 1Y8BA 3CUHA 2DKMA 2CZ5A 3PV6A 1DQDL 2HK0A 4UTHA 4MNMA 4G5AA 3RG6A 1OD9A 1A3ZA 5CJBA 4IBSA 1L5GA 3MJ9L 5E4EC 3ZSSA 3ZLFA 1SOQA 4JPVL 3QBUA 3DVIA 1P84J 3L1OL 5GS0H 1AGFB 1OCCB 1AVAA 1S38A 2VDOH 5FOBA 1J05A 3VMPA 1JQXA 2VLJA 1G43A 4LF1A 4PJ7A 4XO9A 4ZMXA 2PDLA 2KMWA 2EKCA 3WQVA 1KV3A 2BINA 1OK0A 1J5DA 1DL7H 5BQ7A 3VGBA 5ANME 3QQNA 1FBIL 3KCWA 4MHHI 4PGDA 3TEYA 1V6UA 1HZHL 3AACA 4FZEL 2P53A 4JN8A 3M46A 4A6YH 4ATTA 4ONGL 1SO3A 5I3DA 2E3ZA 3S88L 4FS9A 3WEXB 4B5NA 1B88A 1QASA 4L8DB 1XLBA 3PN8A 1K9TA 2C3HA 3RM8A 2YR3A 6PTDA 4WGHA 2RACA 1OFAA 3SGEI 3TBBA 3QH3A 4QF1A 5AKQA 3ARFA 4KC3B 3KPLB 3DVGB 2D7PA 5AW7B 3QEGL 1U22A 4LBEA 4NQXB 4IJBA 4FEIA 4CC0A 3HB9A 5A8MA 3JZYA 1MVFA 1OP9A 1GTEA 5DXWA 4Y4HC 1FYHB 2Z92A 2ZTJA 2BP0B 2VFEA 1O66A 4CNOA 4V1DA 1GW1A 1JD7A 3ZHNA 3IGAA 4FTVA 3QRBA 2Y1AA 1N2VA 2DBLL 1NM9A 4M1CD 3L3JB 1NBZA 4YHNB 3CV5A 4OCSL 4JM4L 1NLDH 3A4XA 4PV9A 3KL0A 2IPKA 3H3BC 5DJXB 3KPSD 3R7QA 4D8PA 4GIAA 3T3MB 1JNNH 4FXGB 4QTIL 2GQ3A 3N18A 2WCAA 2ZT9C 4H01A 4AT6A 3T07A 3FC8A 3T0EE 4H0LC 5K9QI 5EC1A 5EEUA 4JHVA 3IJ6A 4RA0C 4W9EC 4HSAC 1H2JA 1XF0A 1N59B 4HDIB 1NDYA 4H7ZA 4LARL 1U30A 2WBJA 1FCBA 3JWNH 5BS0E 5EBLA 4JYFA 3ESMA 5K1VA 2F6XA 4L7ZA 3CN0A 3FQWA 2QADD 5ANHA 3LEPA 3T0ED 3VFPB 2W07A 1E9OB 5GGSY 2DTML 4ICCX 2OTWA 5JTWA 2P42B 4N9GB 4DZ8B 4H9YA 3CO4A 1JUEA 1ECYA 4LPTA 1AFVL 1JYVA 2VW6A 1VIWA 1BF8A 4PJ7F 4AH2B 4AVKA 4W68A 5DS8B 5I6NA 1P7QA 4Z95L 3QWRD 1FO0H 2A77L 1W6TA 3GK8H 3VGDA 3A22A 2XN9A 1JZ7A 3T1GA 3KPPA 2P46B 3POHA 4HPHA 2VXVL 3ELAT 3QZBA 1N6QL 1IGTA 2Q3AA 4BRVA 1Z5HA 2QIWA 1T5WA 1XBDA 4NG3A 3SBWA 5DC2A 1JS4A 2DQJH 3ARBC 3HRPA 1G94A 4KNTA 4P9MH 3OF6D 3EYFB 1XRFA 3QJHA 3UR8A 3LG3A 4A2DA 3T2QA 3PP3H 4P7LA 3V6BR 3CFCL 4OF7A 2WQUA 2HMIC 2NTSP 3UWEA 2ZX6A 3US0A 2OSLB 1WPCA 2VD9A 2VL5A 4K7FB 1QDSA 4IIGA 2Z6IA 2PDNA 1DORA 4DO6A 5G1MA 3T7VA 3GMOA 5I3GA 4LNRB 4ZS6C 3GSNA 3S83A 2NXYC 1LTDA 2HZGA 4PJAE 3CFBA 3L13A 2RQ8A 1LJMA 3GC5A 2YJQA 5J5EA 5DZAA 3M6DA 4H3DA 3V4LA 1DVFD 4ZX5A 1FE8H 3NP3A 3DXIA 3I4KA 4GFIA 1FORH 1S78D 1W6LA 4WJ8A 2CHZA 5AYXA 3DHFA 1GC1H 3C5JB 4A7SA 2HBXA 4K94L 2J79A 2K8QA 5HWJA 4MUZA 3KXFE 1IE7C 2B2XL 3O6CA 3CIXA 2EZ0D 4A7VA 4KJPC 5FDWA 2N1TE 2DU2A 4ZENA 1A9EA 1DSWA 1J9QA 4KMTL 4XVJH 4E2VA 2B5IB 4HWEL 4W84A 5SWSB 3NZ1A 3VGAC 2ADJB 1S7QB 1NOLA 4JGJA 4NX0A 4BZ1A 2F5BH 1EDYA 3Q2LA 3QOKA 3KXFD 3TIEB 3GMQA 1P4LB 3TJEL 4XKYA 1RHHB 3LEYH 1A49A 3D0CA 1RUKH 5CAKA 1NELA 1W1IE 2WKGA 4BFIB 5B38B 4FCHA 2YN5A 3CV2A 4ZD3H 4NQEE 2WLZA 3D39A 3LS5L 4PJDE 1J2WA 5K9XA 2C9UA 3O0LA 1YQ2A 2Y1ZA 3MHZA 1OAXL 4N8VA 4GMSL 3GKWH 4LP4A 3CUXA 3PUCA 4OFPA 4DF9A 5BJTB 4FLHA 3HC0B 4B5XA 2WB1A 3C8NA 2E68A 4RNRA 3OHMB 3BMVA 3RBGA 4MKNA 5CPOA 5J8LA 1LE9B 3MMDA 4HCRA 3SDAB 1HL5A 3T0XA 1Q5MA 1UR2A 2A83A 4F37F 1C7SA 5K93A 3GAKA 3BUQA 4M82A 4X99A 2HG5B 2YWYA 2GBUA 4EOUA 4YSQA 3S1UA 2CR6A 4P7RA 1X7SA 5TGBA 3CBJB 4Y90A 1LDCA 2G0WA 4GCAA 2DVTA 2PO6D 2VLRB 4WO0A 4LRIC 1RK7A 3W7NA 4KHXH 4GRLA 1QFWL 5T1MB 5TD4A 2A9NL 5IIEA 4WW2F 2H6OA 2RA1A 3RFZB 5CXPA 3B3DA 1KG0A 5CHNB 1KEGH 4ZXLA 5KSVA 4QGYA 3UPRB 1RCXB 1KJ2H 3TQKA 4H7CA 1X9QA 2CLVB 4B7LA 4ZFFB 3EDEA 4PMOA 5F6IC 4PD4K 3VKKA 4YHKL 3MV8B 4XP9L 1OWRM 4ZB2A 4KUCF 3UGVA 4QRAA 4JANA 2BHFA 2ZX7A 4LMQI 4KBPA 1GMEA 3PFMA 1BEYH 3RTQD 3V10A 4K8RL 5JBEA 2MJWA 1JXJA 5AHEA 2EDBA 5LNEA 3H56A 5TAOA 1DSYA 4OTKA 4DEFA 1CVRA 2DQTL 5C1MB 1PX3A 1ZV5A 1YEFL 4YDLB 1FN4A 1UA3A 5TDOB 4LGRB 1ROCA 1TZHB 2HLEB 4HZ7A 3LZNA 4Y4FA 1ZXKA 3PFUA 3FUHA 1AP2B 3W71A 1RJLA 3OKEA 5CSZB 2V7HA 3OZKA 4KCVA 2ZG3A 4AGNA 4FA6A 4GUPA 1FWBC 3GU9A 4TNWK 1SFJA 3NGFA 1W9DM 3AXMA 3S37X 1LORA 4AB4A 4DBWA 5FOOA 3H7LA 3LSCA 1WUZA 1K3UA 5C8JA 1U8OB 4AISA 2BY3A 3MA7B 4M3PA 2VDQB 4JM2B 4RDQG 2OULB 1CDCA 2F8OA 1BIIA 5IQOA 3V5KA 3BAIA 3O6FD 5AVQB 4CN4A 4RSYA 4JFXB 2ICEB 4YGAB 2RAGA 3ANVA 3QDJB 2P43B 4TVPE 1L9SA 1R34A 5AYZA 3SURA 1DFXA 5DCDA 1OFRA 4AX3A 3CZ8A 1ZK9A 1KRCC 4DH2A 3TN5A 1I0DA 1A1OB 3S4SA 4N1CA 5EH1A 3RWGA 1W72B 3BPOC 1E6ZA 3VSUA 2WOQA 3IFLL 3LVEA 1SNRA 3LIZL 4ETQB 2Y61A 4V2CB 5FHBL 4S10A 3D4GA 3DTXB 1VEMA 1P7BA 2PLCA 4P5RA 1SBSH 5C2UB 2AAVA 1PQZB 1A4JA 3W11D 5CZXD 1UWUA 5AVNA 4IJCA 1UUNA 4M81A 4YHPA 1JWMB 3IE9A 4NNYA 4LQFL 1WFNA 4EUPB 1R3LB 3OZMA 3GYCA 4PWJA 5AYUL 2FX8H 4ZTXA 5F1NB 4BHUA 3F2LA 1SJEA 4V2XA 2GBAA 1PKNA 4JFZL 4D8AA 1ZLEA 1IJ9A 3I68A 4C1NB 3DJRA 3AZUA 1TJHL 4XO6A 5HHNB 3K6NA 4TNEA 2ZOTA 4QO1B 2ITCA 5I17B 3FONB 2ORBH 3FFDA 5IESH 1PV8A 5JW4N 2X0YA 2BS71 4XAFA 2WXLA 1E5BA 1JE6A 1OTUD 2CWXA 3T6WA 4X7TB 1W3IA 4DJMA 3VXNA 5HINA 4ZOAA 5KAQF 2CBPA 2R9HD 1POJA 3AXXA 4M1DH 1EF3A 2J8UA 1LDSA 3V0VA 5KJ4A 2X41A 3K4ZA 3SCMD 2DT1A 2XTJC 5KS9F 4A63A 3LGGA 5GJTL 4OCYH 3CIVA 4CSSA 2BO0A 4S1DC 4Q74A 2FEEL 4IRSC 1DXFA 1EJXC 5DTFA 3SCTA 1IAKB 1FCCA 2Y36H 2LAAA 3SDDD 2O6EA 4F0SA 2K7QA 3F04A 1XG3A 4DI9A 4XD6A 1CGUA 4J3UA 3N9KA 4O1DA 4NYLB 1F1DA 3FRPB 4FQJL 3WL1A 1WGOA 4U4MA 3TH6A 2W94A 3SPIA 5E9XA 3ABLB 1Q0XH 3QJXA 4NI3A 3MRDB 3UZJA 4HIXH 4PM1A 1M6OA 2G96A 3DXAD 2H32B 4QRPA 3LLFA 1M56B 1R30A 2YPLE 1NH6A 2A9ML 1D7BA 1J8HB 4EI5C 5CBEB 1ZDQA 2DD8H 1KTBA 1MCQA 1KQZA 1SO6A 2BOEX 1OB0A 4F3FA 1H50A 3GM8A 4P8UA 4JDYA 3KCLA 1VLWA 4HIPA 5F7YC 2JF1A 1VHNA 1HHGA 4D6GA 3BGFC 3GINA 4HKZB 4C6LA 4XZNX 4DI8A 3C52A 5JQ6L 2YPLD 2Q86B 3RZCD 2F8XC 3PTDA 3S1GA 1AZBA 4KZCA 3AHXA 4JYEA 4BHUI 2FMOA 4FG4A 3RUGB 2PGRA 3RYMA 1N26A 3UABA 1NL0L 4NJGA 1NWOA 1TA3A 1RH9A 3N44B 4F9PC 3QUXD 5C8BB 1NEZG 4C83B 4Z3IA 1QQDB 4OGYH 3L66A 1I9RH 2X4QA 3KDMA 5K9CA 1SVBA 2ZUNA 3SUVA 3MDWA 4PCSA 4YVXA 5CGBA 1KN2L 4UMAA 3APNA 5CPLA 1R9ZA 2E0PA 3B5HA 4LRIA 1GGYA 4FHKA 2JK5A 3P77B 1PLAA 4GAYA 4ZFQA 1OF2B 3VO0A 1KPVA 8PAZA 1HO4A 4G43A 4UDTB 3D0VA 4DETA 3FL7A 1BWVA 4M5ZL 5D71H 4IP5A 2X6CA 3ITGA 4JFQB 3BSHA 1WTGT 1FNLA 1WD9A 3NCXA 4LSQH 2EDKA 2X53A 1S3HA 1YLBB 4QTHA 2EG7A 2PDJA 4P7OA 4DP2X 3FGCB 3QZEA 3M86A 4U3CA 3ZL4H 1Q6QA 3GSQB 4M7JH 2XUWA 1N8OE 2A7BA 3RGVD 4M9OA 1USQA 4OGAC 3U2JA 4Z7OF 3QVAA 4DNMA 1GVRA 4QRRB 4ZNCD 4HH8A 2P8PA 3HPAA 3GNRA 1VACA 1JPFA 1RVFH 3WF4A 5HHME 3H2AA 1RZJC 4ACPA 1ZGLM 2CNYA 2HLAA 5F2GA 1TYEB 1P4BH 3D4ZA 5E6IA 4A8NA 4KX7A 1P5VA 3GTVA 4I5BA 3I7RA 4Z7QE 1JEZA 1SXNA 3U46B 1J01A 3BSGA 1MIMH 2H5UA 3LCWA 1T99A 3WQEA 2GVYA 1DYSA 4PRID 1GPWA 3ULUE 4HVXA 1FHDA 3PHAA 3GC3A 5HHMD 4L29B 1NBYA 3VXQA 4Z1YA 4NZUL 4EO5A 4P3WA 2W92A 1EWHA 4HBCH 2D2HA 4LWWA 3I7QA 3O3AA 2ZCKH 4JFEE 2HJLA 3IDNB 3N14A 4Z6AT 3FB8A 1E0UA 3BLDA 1X8FA 1GS7A 3ULUD 3ERPA 1WP6A 3CDCA 4PEEA 2NTFA 4DW2L 2JIEA 4W4QA 4LF3B 4QRUA 2P9RA 1UWXH 2XBDA 1JP5A 4M7LL 4JL1A 1Y5WA 2MQCA 3KGRA 1T40A 2ZUUA 4ZTOL 3BZ4B 4EI0A 1NLBL 3S3CB 5FF2A 1TCMA 2XT1B 5A6JA 4ISVA 1Q6RA 5E8PA 1OAQL 3LMYA 4I88A 3JV4B 3UJTL 2PU1A 6XIMA 3VU1A 4M19A 4JFOB 2WKOF 1NCWL 4U4IA 4OFQA 2EC9U 5H4YA 1IBFA 3VA2C 5MEPB 4MD0B 2I25N 3P02A 3I4EA 2VYRE 5LXGH 1XLGA 3FU8A 4HKPA 1JNEA 3AG3B 5E0QA 3UJ2A 3N2CA 3L5AA 2SEBA 3CEPA 5DZJA 1XGDA 3WUBA 3NDZA 5T1KD 4BS0A 2PMQA 2ZAIA 2XN2A 4LSPL 4F8NA 5CCKH 4ODBD 3C60C 4P4RB 4HQVA 1KXVC 4RGOH 4DN1A 2MPAH 3B9NA 3W7JA 3U2EA 1NGWA 1DWIM 1G0XA 3LPGA 2H6UA 3AFBA 3WMSA 3BP4A 3O05A 3P4OA 1JAEA 5GRVL 2UUDH 4JRXE 4O2EA 5D7SH 1LWIA 5CJQH 3SZ6A 4FFZH 1LO3L 2GUOA 1OTSD 4Q9RH 2NY0D 4QNPE 1GPOH 1S7RB 4YVNA 1ZLVH 4EX4A 2OEMA 3B9DA 2WIIA 4GZ7A 3PAVA 4LEFA 2W95A 1PLCA 4H41A 4XIMA 3LH8A 4JRXD 4WU7A 1JYWA 3BGMB 2WQRA 4EXAA 1I1FB 3P14A 3C3NA 2KDGA 3LNEA 4I0PD 3URQA 5CD3B 1E40A 2APFA 2BGQA 4L8CA 5IFJB 1EA9C 3RF9A 4RMUA 4HU4A 1EEZA 4W9LC 4CW1B 2QAFA 2VDRH 3RJQB 4MBRA 2HAZA 2YKLL 2AJUL 2WMPB 4LCUA 2VR2A 3L5XH 2EDYA 3VYPA 2GJ6A 5BO1H 2WCPA 1ZTXH 2VN3A 4TX8A 1MXDA 1CTMA 5HYIA 1MW0A 4F7KA 1UC6A 5I6OA 1QJWA 2R2BA 4AYSA 1RZFH 1OLZA 2JWYA 3ARGC 3VQ2C 2R0WH 1MJUH 2NNAB 3ULVL 5I2IA 3T65B 2JJTA 5EFDA 1K6WA 2X4OB 1E4XI 2OFQA 4XPGL 3LCYA 1SSDA 2NW3A 4PTUA 3QEQE 2VWTA 5I1KH 2EXOA 5FJUA 1ZGLB 2OQYA 3W0WB 5F7AA 4BSVB 3FB7A 2VGFA 2A74A 2E7MA 1PKLA 1EEYA 4F9PA 4Y9PA 1UWFA 2E6YA 3LEXA 2ON3A 4Z1BA 4WRHA 1FL6A 5KW9H 1W2KT 1T20B 2Z64C 2OJPA 4OKVB 4X80L 1ONXA 1R5IB 3GIPA 3RRAA 4N2YA 3TT3H 3QHFL 5CAHA 3SJVB 4CCCA 5BV7B 3QOMA 3CZJA 4HPYL 3GMNA 1EHLL 5AZ2H 4O5LH 2VH5H 1AE6L 1TPVA 5K9QG 4CAGA 3OO2A 4EIVA 3GNML 1IC4L 4J6RL 1PTDA 3QQWA 4P8VA 4P59L 3LTYA 4NNCA 3BVNB 4AYBA 1U41A 2WCSA 3R7RA 2QUTA 4XVSH 4HHLA 1T80A 1OM3H 4M43L 3KLDA 3SDCB 3PGCA 2PEVA 2JE8A 3HKFA 4MLSA 4TSAH 1WC7A 3RDTC 3TTSA 1UTDA 2C15A 4J12A 4GXUN 3DBPA 4HUXA 3GD1C 1XKJA 4HSHA 3TZFA 3B9KB 1RZPA 1A7BA 2BTMA 4OGZA 4E68A 3GG1A 2VUYA 1FWEC 2NY4B 3QV6A 4HNUA 4GFTB 1E72M 5HXMA 2O61A 3N6HA 5AAMC 2EPLX 4KS0A 5JDSA 1QABA 3STBA 2Z31C 1OAZH 4NCC2 4TUOA 4RGNE 4D6EA 4YEEA 5CPSA 4UT6H 4LDLB 2NY5L 2Z6FA 3HC4H 5I78A 3IWUA 4A8LA 5E03A 3ZE2F 4KQ4H 3S36H 3WUWB 1RZIB 1VESA 1XGZA 5AKTA 1BGAA 3DROA 4AD2A 3CVDA 3PSVA 4OZFB 1WYJA 1WYIA 4O58H 3WQ6A 3NZSA 1S7TB 4JVUA 5EOTB 3QG7H 4XOAA 5F96L 3GLZA 1AXTH 2WD0A 1E65A 4NQCA 4MQXD 5FJRA 3ARXA 3HGSA 1YPZA 4G9FE 2VX7A 1FGVH 1GAFL 4WO4C 3FO2A 1TSRA 2R69L 2AABH 1GOOA 1EVUA 3H9SA 1ZAGA 3KCOA 2C9QA 5HDRA 4HIQA 3KWWB 1MEXL 1TQVA 4KFNA 1VLXA 2J3SA 3REVA 5DRZB 3GDBA 5DJ0A 3D3VD 5D72L 3TYCA 3J2PA 4WD0A 5DUJA 4AGLA 1KY6A 4DGYL 3PWJB 1F6AA 1OK6A 4X5QA 5DMYA 1AD0B 1ZBCA 3GXFA 1ZOXA 3SCUA 1Q0YH 2FJKA 4P2QD 4LUIA 3A23A 3GLDA 3L5MA 1A5FH 3RK8A 5KMYA 3S2JA 5BZDB 1XGQA 3W9EB 3QA3B 3UYIA 5GSVB 3V35A 1C12A 3OF6A 4E6MA 5CKSA 4G8GA 1FWHC 5J3HD 3MMEA 3N41B 2XNAB 1X9LA 2E7HA 5KBMA 3VE0B 4D0DA 4R26L 3MBEB 4X5XB 2Z8RA 1KXVA 1TJ0A 1MCDA 4TLUA 2H1LM 5L2KB 2CBJA 2FEDD 1YNTB 3AQUA 4DO7A 2V30A 4HXBH 2Y0SA 2O6DA 3QCTH 3ZJKA 4AVOA 4GYBA 2OI9B 1MHEB 3BW9B 5J11B 4GSDH 5FL0A 4ORZC 3UPAA 5JHLL 3IJ7A 3SIZA 4R9XA 2CGYA 1XR8B 1OX5A 5K2ZA 1UKSA 4YS4A 1KTDB 2XDHA 4XNDA 1VFFA 1XDJA 3QXDB 3TNMA 4ALAH 2EGZA 3GXUB 4KGLA 1DCLA 4IBVA 2V5YA 5C7XH 4RE4A 4AEEA 5C0IA 4HZLA 1SM3H 1P7TA 3VCLA 2X4NB 1KBPA 1U1JA 1D8WA 5FJOA 1JFXA 1XSIA 3PBVA 5ID0A 3OYXA 5L88H 3KYMA 3V5FA 2PRLA 5E93A 1QSVA 2IEPA 4ZQKA 1XLDA 3L5JA 3UNTA 1YPZF 2HTLC 4YVUA 2B77A 2G8ZA 2KZHA 2WO2B 4XVUC 3EJZC 3L7EB 2CRMA 3MBWA 3IJHA 5EU9A 4E4FA 2FMNA 1FC2D 3RGTA 4G6KL 2PDMA 2D03L 4WKFA 1WDRA 3FULA 2MRYA 3H9HB 3UG8A 2UY2A 1JCMP 3TYFA 1NEUA 3RPIA 2DM2A 2BGNE 1N8ZA 1JZ2A 4GP8B 2G97A 4EDXB 4NPKA 4WV1C 4PB0H 2HP4A 2ISSA 1C5DB 4GNKB 5DRWA 2YSSB 1BBJA 1C93A 2ZDSA 3F4VA 3HAEB 1NC4A 4G8FA 4DNLA 1H7XA 1OQXA 3VFGL 2OZ4H 5SV3A 4ODVH 9RUBA 1CL7L 3Q3GA 3ZE0B 1BQHB 2OYMA 2P8CA 2NLJB 1KM4A 3RVWD 4XCNB 1BX2A 3B7SA 5CGTA 2DQEH 4FFYA 5T5FA 3EGXB 1CDUA 3QDMB 4BH8B 3EADA 2E59A 3NYZA 5J6GA 3MRBA 3CH1B 1P0EA 4FQXB 4JIEA 4W7VA 2X9XA 3V5DB 3THDA 4XPAH 3V52H 1VKFA 5EEYA 3RVVC 4HMEA 3CZSA 4F2BA 4JDVA 1HQTA 4NILA 3MRHA 3AYTA 4HJGB 2B1HH 4PJBA 4JRWA 1QO2A 1AHWB 2Q9OA 1A53A 3OKKA 3TWCL 4N8VG 1HAWA 1PBGA 4P8WA 1SU5A 3P4NA 4G6ML 2NY7H 4PUEA 5C0AE 4MX7A 1XFBA 3UWUA 2BP8A 3F65A 1INDL 1CFTB 1GQKA 4J3OD 3G1DA 2ZXEB 1C91A 5PAZA 4F8PA 4YSOA 3II2A 3QQ0A 2ZNXA 2VFGA 5I1LA 3NACH 4PJAF 3SD2A 3A24A 1LBLA 4PRHB 3AFLA 1FNHA 1QNIA 2C14A 4LAKA 3ARFC 5LAXA 4KZDL 1BKHA 3SCNA 4ODTL 3GBNH 4Y4KB 3NQ7A 1O60A 1XSOA 5KSBA 1IGCL 4UMGA 5D2XA 4RNIA 2Z4QA 3REWB 5FYLE 3FYYA 4NERA 3SGGA 1HQRA 1H62A 3TFBA 3QFWA 5AAMA 5IF0B 1R3IL 2IALA 1HU8A 4M1RA 5JQ9A 2COVD 2VQ4A 4XBPB 3RL2A 1WDWA 2WC4A 4JB9L 5KOVC 3W7CA 1W9BM 2V2XB 1GOIA 1B4EA 1CLVA 3Q05A 2DIAA 2AVFA 1XR9A 5FYLD 3P8JA 1Z9SA 1WDDA 4DESA 3AUWB 3IUHA 4UM9D 3QY7A 1W3NA 1KCUL 2IKHA 4P4KB 1F7BA 5IZ7A 2VDOB 4GUHA 4UOW1 2QULA 2B16A 1VFSA 3MWAA 5KSWA 3WBEA 1EC9A 4C6BA 4R90L 4GLRI 4FJYA 3PAJA 5H2ZA 1UXSB 1BVLB 4HNLA 3FTUA 5LO7A 5I6LA 2HNHA 1KFLA 5CU9A 5HP5A 3P74A 2J75A 1W17A 1XYMA 4XPHH 5IFHL 3NCYS 1UYWH 2WBJC 4NRRA 2XFFA 4OD3H 4GB9A 3GLAA 5HI3C 4N2LA 2WYSA 1ADQH 1DSFL 3BDYH 3GPEA 5GGTL 3CHVA 1BFSA 3G5WA 4H20L 3CUFA 4APXB 3AAMA 3UYPA 2EC8A 1PDKA 2V5DA 2W8CA 3N2MA 3WKNA 1EYWA 5LNRA 2Z4GA 5CUSH 3NPZB 1WICA 2GYSA 4F0RA 3TH4T 3AYVA 4RPQA 3W1QA 2X2HA 1W1B1 3B40A 2DJMA 3L2NA 3UTTD 4R7LA 1QMLA 4TIMA 2W91A 1YRRA 4NN6C 1SXSA 1T22A 2R0ZL 2ODOA 2XINA 4PJIA 2XZQH 5ALCH 3DI1A 5F2IA 3I84A 5EO1A 3S4SG 2E77A 5AG8A 2VZOA 1Q6CA 1U3NA 1WAPA 3IJYB 1DHKA 4R3SA 1L9RA 5FM5O 4P57A 5BU6A 4X6CF 2IF7A 4PGCB 5EUOE 3SBWC 3PJWA 4C7DA 4U2ZA 3FXIC 3FTSA 3BVDB 1AO7E 4UIOA 4NZJA 3WFCH 5AZUA 4HGKC 4YDZA 4MB5A 3FBKA 4R4NC 1A5SA 1VRSA 4PS4L 3GJEA 3GTXA 3SRFA 3RM9A 3SJ3A 1QLRA 1YAIA 1X4XA 4DF0A 4X4ZA 1U83A 3ARQA 5C08E 5A6KA 1AO7D 1PCSA 1JV2A 1YBQB 5EU4B 1NFKA 4OD1L 3E8UH 1KYOJ 2Z91B 2EQDA 3KL5A 3VIFA 2MQ3A 1Z48A 1BZOA 4NX5A 3SN1A 4OB5L 2UWEB 3AITA 5EZLA 3QO1B 1R7OA 3WHXA 4MY8A 1ONWA 4AC7C 3O3BB 4NKIH 2CKNA 1NAML 3AW5A 4PRPA 1IXNA 4DUOA 3FT2B 2A4CA 4YVVA 4OGXL 3DX6A 2J72A 1Q66A 4TRPH 2Y5EA 1FO0B 3SKOB 4IM4A 4DT2A 2PGWA 4MCYB 2IOOA 3AIQA 2IPGA 4XP1L 1P5UB 1AMXA 5T1JA 3VM7A 2H2PC 1S7SA 1D9KB 1OCZB 4FXKB 3KPRE 3QPQC 3MLYL 2P5WA 1E27A 2UXGA 1WBJA 4L2YA 4YDIL 5C9JA 5AZ0A 4NS0A 4NFBA 2C26A 4OZIA 2ENJA 4JX6A 3QHZL 3B8SA 1IBYA 3W07A 3ABXA 3M45A 4X8JA 1MH5A 3OB0K 2EXSA 2QR0A 3D34A 2EO1A 3USBA 3M8OL 1A1MA 1D5MB 3GRWA 3V0HA 1YN7B 2BMKB 3DJTA 3OMAB 4UV4H 5HNUA 4NC0B 4O19A 1OAYL 3CNYA 4ZA0A 3URNA 3IRCA 1G9NC 2Q2EB 3V5HB 1PYFA 3KG5A 2DWTA 3PVFA 1R2RA 1NGXB 2H6RA 3ES6B 4PJIF 1KLUA 1VR6A 5SWZD 4LB4A 3OKYA 1R3KB 3U36B 4XMVA 4N2FA 1A4CA 5C3TA 3AIVA 5ESAA 2JI1A 2Z1XA 2GBVA 2OR9L 1PW3A 2V82A 3AXLB 2YQGA 1SW7A 5I1HH 4EBQH 3ZKXC 1TTAA 5E9DE 5K9KA 4FZ8L 4IMLA 4L4VE 1L9MA 2CO7B 4HBKA 1A5OC 4IKLA 5KETA 2IANE 3CPGA 4OIBA 2HSIA 1KXQA 3GDKA 4X7EC 5HGDB 5AVZB 1T0MB 3DX2A 3KPOB 2CLHA 4J4PA 4GRLC 2OMBA 2K1MA 4N22A 3YPIA 2GY7B 4M7ZB 2XPKA 3AZRA 2XTSA 1TITA 4DEPC 3PIQB 2X4TA 5D32A 3IXAA 4ZSUA 3LCXA 5T3ZE 4HIEA 1X6LA 4ODSL 4DGIH 4E9WA 3UYRL 1WIOA 5E95B 2ZOXA 4O2CB 2XOTA 3KM2A 1TJ2A 1IWBA 2A73A 3O41A 4UANA 3BDKA 3SKNA 1I4FB 4R5EA 1BRLB 5HQLA 3LY6A 2ZG1A 1Y1UA 1I8MA 5TQ2H 2MCAA 1D5ZA 4FP8H 1O5KA 2BP1A 1D6EB 2BVPB 3F7VA 5HGBB 4NWUL 1KIRA 4Z3TA 4YBHA 3IIPA 2GBTA 1ZT4B 3FLUA 4DP5X 1YRKA 2EYSA 4HWBA 3VB9A 5DX7A 3ALPA 4XWOD 2WSPA 4XBEL 3LB6D 2VWEC 1MRDH 3QO0B 1EZVX 4OR1A 2JIXA 5FEBA 3NL2A 3WS3B 4BGDA 2JLPA 4OZIF 3WIFB 1NOWA 2V4LA 4KWUA 4Y4FC 2WMKA 1DEDA 3UWWA 1YZZA 2H2SD 4RAUB 4Y19B 1SF5A 5FCUH 1U8MA 3N13A 1HH6B 4FMKA 3SSGA 4KTEL 3VTMA 1F18A 3D2UD 1E6QM 1MCPH 3B4YA 1QHPA 4XAWH 1NCJA 1GIGH 3G5XA 4ZX4A 2VN4A 1D7FA 1PZ3A 3ABSA 2PAJA 4HK0A 2IGTA 2KZ1B 1OPGH 3VXUE 3L3OB 2R29A 3NK4A 3VFTA 3TWAA 5HHQB 2VDNH 2NUPB 3MGOA 2XV2A 1GXEA 5BCAA 1DLFH 3QEUB 1GVQA 1NCHA 3NPSB 1KJ2B 4HUKB 1QBLL 3E3QC 1CICB 1F6LL 5GGVY 5B4MC 4PJ5B 3HG1B 1BVKB 4ZUSB 3FFSA 5BS0D 3BWUF 2PXYD 5IMMB 3E0WA 3MLVH 4YNYA 3D06A 4QT5B 4M7SA 1G7IB 3TNOA 4HC1L 4MJMA 4FL4B 2YAFA 1WE5A 1ZHNB 5FFOA 1IXPA 1RUPH 4WCYL 4PI2A 3T2PA 2Y63A 5DEGB 2QCHA 1MJ8L 4NKMA 5IJDC 2R9RA 3WN5A 2R2HA 4DGVH 2VFIA 4ZDHB 3QZWA 3TP4A 3UTZA 3H6JA 5ENWA 4LEOB 3F64A 5C7VA 3HFTA 3OA3A 1JZ4A 2OLAA 4XCFH 5HYSG 5BWFA 4UBDD 4TTDC 4EPSA 4HJWA 1F86A 1U5JA 4KRPD 1QNOA 5A2KH 4NUJA 4ZR8A 3WNLA 4P2RA 1Q0EA 4XBGB 1V03A 1L6SA 3QJVB 3G8RA 4JDZB 3FTYA 1RZGA 1YE6A 1FWAC 1ONEA 2OYLA 1ENUA 4GG8B 2WXJA 2CXEA 2ZSVB 4WW2A 4TSBH 2F54B 4BF7A 4N86A 2QCCA 2P49B 3DRTA 3JUGA 3MC0A 3WL0A 2AK1L 5HR6A 4Z76B 3EX3A 4HYVA 4K23H 4IRJB 2ZXGA 4JO5A 2CKBL 1L0PA 1EHXA 5IB2B 1PPIA 3DETC 1RJCA 1GHRA 3STPA 2Q7YA 4R84A 1XGYH 5IFTA 4LSRL 3G24A 1TWSA 4KKRA 5AL8A 1QYGL 5D4JA 4JZJA 1XB3A 3ATZA 4MQ7B 4N9BA 4PJHB 4WW1B 3UAAA 2Y7DA 1LD9B 1B4LA 3ZGIA 3EH4B 4UQ2A 4NAEB 1HSAA 4B9KC 3V9EA 1ID2A 5SX4H 4JO8A 5I1EH 3SGDI 2QSCH 3FA4A 2DDQL 1JVOA 4DUVA 3OJVC 2EVFA 4UAOB 4BK9A 3SCRA 4EXQA 3SSJA 3VH8B 3VFRB 5E4OA 4I90A 4A7TA 3E6HB 2XZ9A 2E9GA 3QNYA 5BMFL 4M5YH 1KNOB 3FFOA 3JV5A 3O81A 5EIQA 1UENA 3PF2A 4C8XA 3VWKD 2H6PB 3BKJL 2WUBL 3WIIL 2OV0A 5E08L 4LFHG 4NNXA 4AQOA 2AAAA 2E7BA 4TLSA 4DYEA 3UCRA 3AWGA 4LVHB 4MZYA 3MZGB 1QOKA 1QX1A 3LZPA 5I3FA 1DQDH 2RHEA 3S3JA 2F84A 1XLFA 3RHWF 1TRIA 4CVZB 1TU2A 1HGYA 4YQXL 4XVOA 2BNUA 1PG7L 1NPUA 3W2LA 4KEMA 4DIXA 3NJVA 4IOIB 4TMPA 1J9CT 3KAAA 3G5VB 3GTHA 3P0VH 3BP6A 2YL6A 3SYPA 1AY1H 1VFUA 2YC1B 3L45A 3W72A 2IOIA 4NQED 1FVCA 1OC7A 3KBVA 3PL6D 1CXFA 2CO3A 4LPWA 4AD0A 4KKAC 3ZVVA 1QNVA 3INUH 3NZHH 3TKFA 4IFRA 5JHDA 1YPIA 3D69B 1HEJC 2IPUG 4P0DA 3V7AG 3CMGA 1GW9A 1DDHA 1VCBC 1FUNA 3URBA 4KJWC 3S88H 1TMQA 4HCIA 4DJDA 3H4FA 4XNUL 6A3HA 3TA4D 1JZ5A 4G6AC 1I9JL 5DHVH 4A29A 3BWAB 5CM1A 2PW1A 1PO9A 4H88L 5IB4A 1IZCA 1K8XA 1A64A 4Z78B 3EO9L 1JRHL 3QEGH 3VXTA 4A8RA 1RSCA 3MUAA 3PPGA 2IW0A 2LU4A 4MNGB 2W80C 5K1JA 3BI9X 2HVBA 3TO4C 4JPIA 1VC4A 2E75C 2NQHA 4X5PA 1P6WA 5F4XA 4QRFA 4WY0F 2FJGB 1VS1A 4OOUA 1IEAA 4AMCA 2DBLH 3IBOA 4JAMA 3G1YA 1WBZB 2XQ0A 3CHSA 3H2EA 1L2QA 2B4CC 4M3HA 4LGSB 2J5WA 5E6IC 4UTAH 3N06B 3DDFA 4O2FA 2I5GA 4NUQA 3G1SA 4J8RB 2O6PA 5KS9A 4QTIH 1G69A 1WWAX 5FUZL 1X5FA 1JPSL 4AQ1B 2J8FA 3AWFA 1UD6A 2QSVA 4HUUA 2VR5A 4X6DB 4RRPA 4RW5A 5B7FA 1N0LB 2ALRA 2DI9A 1A0CA 1AQMA 2B1OA 3J07A 3EDDA 3LH2L 1KFAL 2BHUA 3H53A 3EJTA 4CVUA 4MDOA 4G1EA 1IGIL 3BZGA 1RUML 5LBGA 3R18A 2IAAC 5BUPA 1HJQA 1ZENA 4BZ2L 3SY0A 1WBXA 1YEKL 3CZNA 2DTMH 1N82A 3AS2A 2FZMA 3RPBA 2GW5A 5I73C 2PWUA 2ZC1A 1FRGL 3HE7B 1AFVH 3WLBA 4E41A 4F91B 1K7XA 5MENA 3JTSA 1R1CA 1OHZA 3SOBL 3RX9A 5KSAA 1CGSL 4Z95H 2PDGA 4D7BA 1TWIA 3SO5A 3MRCB 3QJFA 5JIKA 2A77H 1ZAJA 3VGHA 4AEOA 1TIUA 3T4CA 2HN7A 3EF7A 5DO2D 4Q0XH 1YNPA 1VFAB 4MNKA 3FU5A 4EPEC 4TVPD 3WY4A 4DXVA 4LAZA 3LTPA 4N6RA 3BAYA 3S8FB 4OI8A 3NAAH 4FFWC 4LLQB 5HDOA 2R59A 1EMTL 1XO8A 3RDJA 2VAAA 1UQSB 1XKYA 3CZFA 3DFOA 5DLCA 3TLQA 1SR0A 4FP1A 3QY8A 4KFPA 2FPYA 1G6RA 3GVWA 3LN9A 4GKSB 3C5ZB 4X2RA 3ETBF 2IQAA 4YTSA 4NJ9H 4PRBA 1OD0A 5KSUA 3MRRA 1EFXA 5F1SA 3IWPA 1LO2L 5DQJA 4DO4A 2AXJA 3Q48A 1DWGM 4HIIB 4B3ZA 1KPUA 3K72A 1CUOA 5EU5A 4ATWA 1T1WA 4OVXA 4R9OA 1UZHA 3WL9B 3SPCA 1ERNA 3AIUA 3SPHA 4N42A 3WXVL 5F88B 1OQFA 2WMGA 4GISA 3IWVA 5HJ3B 3H42H 2YB1A 4X6FA 4OKDA 4L1GA 3E6FB 5D7IB 2V67A 5AZEL 2X1QA 4ZW7A 1FWGC 4JCMA 5I18L 3C9NB 5TE6L 3DTDA 1MVYA 2GIXA 3T3PB 3F7RA 1N6UA 2YA1A 2XRAL 4TVCA 2WXNA 2CA3A 3D0LB 4FQLH 4RZBA 1T83A 5A2FA 3M4HA 1XX9C 3GO1H 5FYJE 2K78A 3W83A 4U1MA 4DBDA 4L0PB 4IMFA 4X98A 2FJFB 1G9ML 4GG6B 1YDPB 4X2UA 3MRKA 2OR8A 4GZEA 5AW3B 5I76B 3WUZA 4GQPH 4J39A 1T2XA 5CNHA 1JXKA 2R7EB 4J8QA 3N5AA 1H5BA 2AJYL 1JZ6A 1V0LA 5INCA 2L7EA 1SMDA 4Z7WB 1UP2A 4M5PA 4ZK8A 1RFDH 4N6QA 3UBFA 5TF1L 4EE2A 3O0RH 1FKXA 5KG9A 2WM1A 4ERSH 2EVGA 4QRTB 2VCBA 3O63A 3QIWA 3L3GA 3ARYA 4HCDA 1I31A 2XFXB 4E0CA 1RK0B 5CFAA 2NXHA 1ULVA 1JAKA 3DBXA 5LA2A 3QFJA 3I2CL 2FNWA 3U7YH 2VITA 1PS3A 1V51A 1N2RB 3NBNA 5ID1A 3LS5H 1J48A 5E9NA 4PRTA 2D7TH 2YAMA 2GVJA 5F3BB 2Z7KA 1LRNA 1RZKH 2IXQB 2JJTC 1K70A 5E94B 3ZW3A 4GNVA 4GMSH 5JZ7C 3OWRA 3CXHK 1H1YA 3VVWA 3BOLA 7FABL 3QAQA 4M7KL 4P06A 3QZAA 2A74C 3TNNA 4XHQA 1TV2A 3Q5OA 2TRYA 1JGUL 3VDHA 4NQQA 5FB8B 3VI4B 2AMGA 3CS2A 1JCNA 1Q94A 2VT0A 4LHUB 3DSNB 4BSWA 5C0EB 5CSGA 4BSJA 1BMGA 4LIQH 3ZJ7A 2FATH 4E8DA 2VGGA 2CPUA 3BOXA 3WE6B 3RNDA 1RJZB 5IEKB 4NUGL 2X7LB 2A6KB 4F2EA 2RFGA 2QHRL 1F3EA 2EECA 1JFQL 2YARA 1Z32X 3Q58A 4P8XA 4WUUB 3NJLA 3SDYL 5CLWA 4PJFE 2OMWA 2OMVA 1YYMH 3S9DB 3WBYA 1GQIA 2QBWA 4P5KA 3N3EA 3BE1H 1LILA 3IDGB 3LRMA 2WKOA 3EXRA 3C12A 3LQAL 1XF2B 4G7EB 2FGLA 4OFKA 4YHKH 3VXRE 2BWIA 4XP9H 4EF8A 2VDRB 2DMBA 2ZUYA 1X44A 4K9EH 2NYYD 3R1GL 1BCIA 1DQIA 5I0XA 1MFMA 2GSMB 3CMOH 5I74C 4D2NA 3TO4A 1EEUA 1LQBC 4K8RH 1HZYA 2G4FA 3CPLB 1R3TA 3PNRB 3KS6A 2X2JA 3F84A 5E0KA 1EZLA 2FZNA 4Y1AE 5DRXA 2DQTH 2WYIA 1A7NL 4XVDA 1O9ZA 4YO0B 1HSBB 3NEOA 3X13B 3V8OA 1GOXA 4Z3GA 4FABL 2NW2B 2YGPA 4LP5A 2L7UA 4LK4A 4PR5A 2WSQA 4APQD 4RISH 3LU2A 1Q9KA 2KLSA 3RPTA 4Y1AD 1HIMH 5ITBL 3S3SA 1YMMB 5EDXA 4H6QA 4MG4A 3ZR6A 1CXIA 5T3XL 2BV9A 4PJ8A 1PJ9A 2ICWB 3LGDA 1AOHA 1GW6A 5HVGB 4KMQA 1W15A 4HPXA 2DV0A 4LSBA 4WFFE 2R1XA 3TBWB 2CJUL 2A9AA 2IH3B 1RUSA 4DK5A 2V81A 3NFSH 1RZMA 1FGNH 2PKDA 3MJ8A 1MNZA 3GDCA 1U8KA 4QOKB 2EJAA 2AXHA 4PJXB 1DJNA 4JFED 2NY6C 1LUCA 4RMVA 4N0UE 3TOYA 3UTTA 1NWTA 3UP6A 3CVBA 4M0XA 4FEZA 4WIQA 3IRDA 4YLWA 3W1MA 3PUDA 35C8H 2XKUA 4D1IA 2P5EA 3WI9A 1KGWA 3NEVA 4NRYA 4JPGA 1D5IL 2Y9RT 1T2JA 4J3OF 2WZ0A 1BYPA 3MLUL 4DQOH 4IHOA 7ENLA 1QHOA 3ID7A 1HHKA 1KBWA 4ODXB 3Q4DA 2LGNA 3PWVB 4A3HA 2XVGA 1B6DA 1FWJC 3R13A 4HK6A 3QLDA 1XAUA 3EJSA 4YIQA 1TJHH 4C7GA 1NGYA 3LTVA 4ZMPA 5AYQA 3LHTA 3M0ZA 2MSPA 1OARH 3C6LB 2OJ1A 3IS0X 1FSKC 1T5XB 1ZHLB 3PDDA 4NO0B 4MAUL 2GQHA 1ND0B 2C19A 1FC1A 4EXKA 2DQFA 3P81A 3H70A 2QPUA 5FHAH 3G6JA 3IFPA 2X42A 3OKNB 4JTKA 2NV1A 3IANA 1U8QA 1XCTB 5GJTH 4Z7NE 2FUQA 5AW0B 3N3TA 1HHHA 5TJWK 2Q7NA 3D85A 3A5VA 1N3NA 2LHAA 8FABB 4MNQA 5I66B 3G3DA 5K39B 4QYOB 2CLMA 1BJ1J 4PJ9B 2N56A 1IEBA 2VC7A 3U2CA 4F80A 1TKWA 2HS6A 4B16A 4PJCA 4P3DB 3W85A 4FQJH 4JHZA 4Z8FH 3B43A 1RPQA 4J2PA 1QOXA 3LMJL 3GH7A 2JSFA 4RDWA 1I9CB 3P2VA 4RGMB 5EU7E 2FUTA 5MERA 1HT6A 2X4SA 5IUSA 2Y7SA 2XYCA 5K7JA 3HU7A 3DURA 2ZCLL 1M04A 1IGSA 1ME7A 4MHHG 1RURL 4NDMA 1ZAIA 4A68A 2F53E 2DH3A 5FSDC 1MFNA 4H6RA 1AW1A 3R4IA 4D3CH 1AXSB 3ZKMD 4AQZA 2ZOKA 2BRRL 2YB4A 4I9AA 1JK9A 5D1ZD 4O50A 2DTSA 2PDIA 4I13B 3APMA 4A66A 1Q9LA 1QRNE 3FCGA 1O7DC 1TPH1 4HP5A 1E5CA 3O6YX 2MQ0A 4H26A 4X4YA 1N12A 4JY5L 4JTHA 4QHNB 2A6JB 4DFHA 3W4RA 2F53D 1NL0H 1PIGA 4C59B 3QAZB 4KVCL 2WVTA 4GVFA 4JG9A 2QCGA 4WOZA 1QVBA 4MY9A 3MRLA 3GZOA 2V3GA 2BSSB 3K6SA 1QRND 3GSWA 4GRMB 4AUJA 4KRZA 2V38A 1KN2H 4DWHA 4XE5B 1V08A 4FXTA 2F1BA 3F83A 4ZO8A 4WNJA 2V5JA 1RALA 4W6XB 2XSXA 3QEQD 5F7HA 3CPUA 3G22A 1RXLA 2HLFD 4BH7B 2PO6C 1JG9A 3AISA 4ORIA 1T7YA 1EWEA 3WQWA 2WWMC 1JUFB 2ZADA 3D5HA 3G6JF 3OQ3B 3PB0A 4MZIA 5GRZA 4M5ZH 2HCZX 1Q6LA 3FU9A 2ZUXA 4KKLD 4TOYL 3ZHLA 5C7ZA 3LXAA 4YHIA 1I1WA 2D3VA 2HTKD 1IX2A 3VDGA 1R0AH 1JPMA 4WNQA 3CWGA 5HPCA 3I50L 1T6WA 1JWUB 2P24B 4JTUA 3D6NA 3T4YB 2FVKA 5AVVB 4AX6A 3DKHA 2GYIA 3UPMA 2FYVA 4XAYA 2VSMB 5D5ME 1M7DA 4PJCF 3MI3A 3RTQC 3OVQA 4ZQNA 2DUZA 2JFCA 4JX5A 3WEBA 2WHLA 5H37H 4QHMA 1M2OA 1B0RA 4KI5C 3T3ME 3SO7A 5KVFH 1YX1A 2QVIA 1QLEL 2KX9A 2WLMA 3V4BA 1FCUA 4P23B 3BP7A 1THFD 4JN1L 1MPAL 1UD2A 3KPSA 4HLZH 4I18B 1UUOA 5C9RA 1FWSA 3DK0A 2JQMA 1TSIA 4O28A 3N4EA 1L0QA 3AXIA 1IL1B 1MFAL 4GXPA 4AL8L 3K2UH 3C2AL 1SJBA 1J87A 3BISA 5ICZA 5IMKA 1F11B 1MNNA 2VLME 1VCAA 3TR2A 4DW2H 1Z3GH 2YD6A 5EOCL 1CDJA 2IUZA 2V17L 4UUJA 3T0EA 1FX6A 2H9GA 4RGND 4IGMA 3OZYA 2GGGA 4IDJL 5XIAA 1AQ8A 3UD6A 3WENA 3EOYG 2XPGB 3UR2A 3LN5A 3M17A 4NZRL 2EEXA 3HRZA 3K5SA 2UZIL 4LVFA 5JIIA 1EDQA 5EGRA 4LL1A 4GC4A 2X70A 1NLBH 3QWRA 4MJIB 1X4ZA 3HMXA 4HYTB 1YEIH 2VR4A 1Y0LB 1PSCA 1FLTX 3RWJB 5DUBB 1ZK5A 1XH2A 3ESVF 1O6IA 3T4AA 1UASA 5FAJA 5DYOB 3CBKB 3UJTH 4G9FD 3AMLA 5EOCJ 2J6VA 5CZXC 2YD3A 3WIHA 1EUNA 4KEUA 2R27A 1JJUA 3F4CA 1K8CA 3QXAB 2ADFL 1ZSDA 4AKPA 4HX1A 3E3HA 1DQJB 3TCSA 3T2LA 5DJ2B 3OAZK 3BJLA 4TQEH 1EO8H 4Y9GA