1RP8A

Crystal structure of barley alpha-amylase isozyme 1 (amy1) inactive mutant d180a in complex with maltoheptaose
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLAFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type 1 isozyme
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rp8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rp8A01
1EQCA 3UCQA 2G3NA 1PIGA 4LYRA 1B1YA 1D7FA 2G3MA 3FNDA 2XYLA 1R86A 1T0OA 1UR9A 1Q6GA 3L4XA 3HU7A 1MXGA 1GW1A 2J7FA 2BVYA 2E8YA 4IPNB 2PBOA 1W1YA 2J74A 4JKLA 4GZEA 5IHSA 3BAJA 1UASA 3MI6A 1QI5A 4GO9A 2DSKA 1KGWA 3ZR5A 4P7RA 1W9XA 1UKQA 4D6GA 1B90A 4CVWA 3DHUA 4H8VA 3AIVA 2GSJA 2C8NA 3WBAA 1MQRA 4D71A 3BVTA 4BCEA 1WAWA 5BXPA 1HKIA 5EMYA 3BAYA 3HG5A 3AISA 2VVSA 3AXIA 3WY3A 1TQUA 1UQYA 3LMYA 3WH6A 1CGUA 1V0KA 3L4WA 4BQ4A 2D3LA 4D6HA 4HTYA 4PCTA 2FHBA 3SEPA 1E15A 3ZSSA 2X2YA 5ABFA 1JZ5A 3S5ZA 1UR4A 5DF0A 5BROA 2YIHA 4CVUA 1XRVA 1BYAA 2OSWA 5D8ZA 1UYQA 2VTFA 2WMIB 5BXSA 4DUWA 4H8HA 1E4MM 2YLAA 3II1A 4PCSA 5I5RA 1E1FA 1EDTA 2HISA 5CJ5A 2XWEA 4CD4A 1UKSA 2VT0A 1HN1A 1MW2A 5E6YA 5I23A 2F1BA 2JE8A 1GUVA 1UR0A 2WBGA 3GDBA 1E55A 1H3GA 4B3LA 3BVUA 4P8WA 5HBFA 1TFVA 2WZHA 3DX2A 5FD0A 2GJXB 4PSRA 2WHKA 2XWDA 3FY1A 1U33A 1EDQA 3NDYA 1BAGA 1EHAA 2PC8A 5HDRA 4CCCA 1KGXA 1UR1A 3W82A 2ZUTA 1J0YA 2AOSA 1Y7VA 1JI2A 2V3DA 3GXPA 3RO8A 2XIIA 3WD0A 3KLKA 1CWYA 3CHCA 4QDMA 4W8AA 1X6LA 1MQPA 5LYRA 3CC1A 3IK2A 3A5VA 3GH7A 4TTGA 3TTYA 3TA9A 2WXDM 3VGBA 1OWQA 3QOMA 1ISWA 3VSTA 1H09A 2E9MA 5C70A 3VIOA 1M01A 4HMEA 1UWTA 2O92A 3VD7A 1K9EA 1JYVA 1C8YA 4RE4A 1E4NA 3NSNA 3QR3A 5KZ6A 1H11A 3WMBA 2ZUVA 4KGLA 2QMKA 2C7FA 1HXKA 2BVTA 1OGSA 3FW6A 1OM0A 3OB8A 4GXPA 5CSYA 4HMCA 2XVNA 2CCRA 4WKFA 2CXGA 4JCMA 1K9DA 3RMEA 2F7QA 4RE3A 4LQ1A 2VZSA 4E4PA 1QWUA 2DH2A 4UFHA 4KH2A 4DWSD 1OGBA 4H04A 2W63A 1E73M 3WH8A 5CGMA 1CYGA 1GNXA 5DMYA 1A47A 3A4WA 2YL8A 4CGTA 4J3SA 2OYLA 1M04A 3OG2A 2PB1A 3VDAA 4NXSA 4S3KA 1CGTA 2CITA 1W9BM 3VDBA 2VX6A 4D6DA 4Z2IA 2ZWYA 4P7LA 1ZJAA 4PTVA 4AD2A 3RM9A 4BS0A 3AHXA 4NZJA 1US2A 3WELA 5BWFA 5CZKA 1SMAA 1XV8A 1BG9A 4LX4A 3N18A 1VF8A 3SCOA 1GPFA 3SCNA 4J3WA 2YL9A 4C7GA 3VIMA 1XSKA 2W92A 2CYGA 1BGAA 2FYVA 3ARSA 3PZTA 1KQYA 1B31A 3AIWA 2DSWA 4BZYA 1G0CA 1ZL1A 1E5NA 3D3AA 1U30A 3VGEA 2F7PA 2GJRA 1V0MA 3WQ4A 2WLYA 2OYMA 5JUVA 4MNJA 1CXHA 4M81A 3WQ6A 2E8ZA 3MUY1 5I3DA 3VNZA 2ZUMA 4J3UA 3LRMA 5CLTA 3AS3A 3NUKA 1QI4A 1SZNA 1ITCA 3ECQA 1EIBA 1H5VA 1S46A 3A47A 2YOCA 1JNEA 1KFWA 4PMDA 3VO0A 1V6VA 3SCTA 3LXBA 3H53A 4D6IA 2VC9A 2E4TA 2FDMA 1CXKA 3K4AA 5CPSA 1E1EA 5CLWA 4M8UA 3M07A 4KGJA 4UCFA 3WD2A 2EXOA 3WNOA 3CHFA 2BNJA 1CGVA 2WWDA 3DX4A 1CNVA 4TVUA 4W7WA 2X05A 1E0XA 1V03A 1NWRA 1W9DM 2PI6A 1QPKA 1VAHA 2JFEX 1R46A 1WNOA 4Z2HA 3OGSA 2VZVA 1J10A 4C7FA 4DO5A 5A95A 4MJ2A 3RPMA 5AC4A 3CZSA 1NP2A 4D6JA 2RGMA 2ZX6A 3AJ7A 3AOFA 3EBVA 1B3VA 1ISVA 4QCFA 2VCBA 3LX9A 5M17A 4B15A 3D5HA 1E6ZA 4JKKA 1HL8A 2J7GA 2CHNA 3MO4A 6A3HA 3DX3A 1RD6A 3MMWA 1WCGA 1GOIA 2WANA 1BYCA 3KL0A 4ZE5A 3CIVA 2J7HA 1C92A 5GNZA 1K9TA 1OCQA 3WFLA 4GZIA 2VR4A 4MNMA 2X0HA 3WD4A 1LWHA 1FH9A 4EKJA 2A3BA 4JCLA 4PMRA 3ZIZA 1E71M 4FNUA 4R27A 3ALFA 2VI0A 3ALGA 1W1VA 5E1QA 4PTXA 5LA1A 3CGTA 4Z2GA 3A21A 1W32A 3IANA 3AHZA 2WMKA 3AMGA 3RIKA 3ARPA 1JF5A 1JXKA 3D52A 3AS2A 4U2YA 4FF5A 4WSKA 4JZ5A 1FA2A 2PWEA 1H1NA 4Q22A 3SUWA 3KL5A 1QI2A 4OGZA 4W5ZA 6TAAA 4NSBA 1CEOA 3ARXA 1V3HA 1XCWA 1DWIM 1CDGA 2UY3A 1QI3A 5HOSA 3EJUA 3A4AA 4GI8A 4P7QA 3WF4A 3VD4A 4V28A 4ZEPA 1QNOA 2D1ZA 1QNRA 3UG4A 3VSUA 1W1TA 1UOKA 5E0FA 2EPOA 1ZBWA 3NCOA 1G5AA 3LRLA 2WVUA 1NOFA 2DDXA 4HZ6A 3WSUA 2NT0A 4FNTA 1V6UA 2WC7A 4AZCA 4OIFA 4CU8A 3OA5A 2X2JA 1AQ0A 3CMJA 4PEEA 1GOMA 4J3TA 1HP5A 2CEQA 3TONA 1OBAA 3O2LA 3IJ8A 1XD1A 4AD4A 3WNNA 5C8BB 4UFMA 3T2PA 3SCPA 2XGBA 4EE9A 1ZBVA 1Q6CA 3PZQA 3PZIA 3NSMA 2ZX5A 5A6AA 5BYWA 4HA1A 4ACYA 1K9FA 2WLZA 1PIFA 2J78A 1CXLA 1HKKA 3WD3A 4ZFMA 1UWQA 4AWEA 4M80A 4U5KA 1GOWA 5HNNA 4HU8A 4OJYA 1O6IA 3BUPA 2VQTA 1QVBA 3HJEA 4UZSA 5CGTA 5A8NA 3OIHA 3VMNA 1ODZA 3BMWA 5LA0A 2FGLA 2VCCA 3AROA 4D1JA 1VENA 2A3HA 2DIJA 3AIUA 1B3YA 1V02A 3FXYA 4CD8A 3BVVA 3DC0A 3PHAA 2EQDA 2FGZA 1KGUA 3AMLA 1WDSA 5CQ1A 1PX4A 1XH1A 4UQBA 3CUGA 5JBFA 4BF7A 4BQ2A 1CXIA 1DWHM 2Y8KA 2VURA 4CD7A 2DT3A 1EO7A 3A23A 7TAAA 4AXNA 2EACA 1JDDA 2YA1A 2ZXQA 2ZUWA 3WQ8A 1FP9A 2OLHA 1NOWA 5FCZA 4LYPA 1ECEA 3M7SA 5C71A 3VIFA 1O7DC 3EDKA 1TQTA 1EQPA 1EOKA 3SCWA 1HP4A 4U31A 1GQIA 3WF0A 5D9NA 5A69A 3N11A 1A3HA 3WN6A 1WKYA 1GQJA 3LXCA 2W4XA 3L4VA 1W3HA 3L4TA 1KTBA 3OLGA 1HJSA 1EXPA 1IT0A 1HX0A 2O9RA 3EDDA 2RGLA 1UKTA 3BUBA 1V6XA 4AW7A 2UY4A 1IZJA 3POHA 1W3LA 3WY2A 1NP0A 3NDZA 1CIUA 4AEFA 3UESA 3WEMA 1M53A 3FHAA 4H41A 3I3BA 2WC4A 4N42A 3U7VA 3D4ZA 1GOOA 1XH2A 1JF6A 1E3XA 2WVVB 1TVNA 3BSHA 3BUDA 3WY1A 1E6SM 1OB0A 3WDIA 4HOWA 4H7VA 3ARZA 3T0BA 1HKJA 2G3IA 2BHYA 3T0AA 4AZIA 1AMYA 3AZRA 4AZBA 4MAVA 4CCEA 2XM1A 1HJQA 1CTNA 1TA3B 1VBUA 4JHZA 1N82A 3SCVA 4B9YA 2DSZA 4MB1A 2Y8VA 4XZBA 3GXMA 2O9OA 3AXXA 1BVNP 4FK9A 4KRUA 1BPLB 3VX1A 2A3CA 3GBEA 4NI3A 1QX1A 1FFQA 2BVDA 1NWSA 4IUGA 5GNXA 3B8SA 3CHDA 4J7RA 3THDA 1GVIA 2IXVA 2CNCA 1V3KA 2EJ1A 1ZJBA 4CN1A 1VJZA 5GPRA 1IZKA 2O9TA 4AD5A 1XHGA 4GZJA 1UR8A 3WDPP 4P8UA 1JZ3A 4JFVA 2WC3A 4AIOA 2XFFA 3DYPA 1CLXA 2EO7A 2VRKA 4R5EA 4HZ7A 3WDJA 4ML4A 1C7SA 4W7VA 2WNWA 1XH0A 4PSPA 1DWGM 3W81A 1V0NA 1ISXA 3W38A 1KBKA 1G9HA 1Z32X 1UQZA 1JNDA 2EPLX 1HL9A 3CZLA 2CIPA 3VIGA 3CZEA 2YL5A 3SURA 1LJYA 3ZO9A 4W89A 5GNYA 1AQMA 4PUDA 4GKLA 1ZBKA 2F18A 2JIEA 3CZNA 4NF7A 2VNCA 4MADA 1KR0A 4D6EA 1R8LA 4NRRA 5M03A 3VOCA 3L4YA 4P7NA 2GDUA 3GXNA 1HT6A 4U3CA 1UR2A 2VZUA 1CPUA 4QAWA 1UZ4A 1PX8A 2WB5A 2XTKA 4AMWA 2JEQA 3KL3A 1P6WA 2BS9A 3L4UA 3N9KA 5JIWA 3WQWA 2XHYA 1UD6A 3SCSA 3OGRA 1KXQA 1TVPA 2NW0A 3BLPX 1SYTA 3H55A 3WL0A 1Q6DA 4PMXA 3DX0A 2BY2A 3AICA 4MAZA 3MANA 4XUYA 1US3A 4N0RA 1MFVA 2MANA 1JFXA 2QPUA 2ZUSA 4YPJA 2ZX8A 3F5KA 2YBUA 1O7AA 4HA3A 5A8OA 5ABHA 1PS3A 3WF3A 4FLSA 3W26A 5BCAA 3DDFA 1NARA 2VVNA 4A4AA 3A24A 1DEDA 3OLIA 1VEPA 2X1IA 1J12A 4U33A 5HXMA 1RPKA 3VIPA 4QP0A 3W24A 3WEZA 2CBIA 3AQUA 4AMXA 1OGGA 4PMQA 1WZMA 3WDQA 5D9PA 2QPSA 3OLEA 3T2QA 1CGWA 2D3NA 4AY1A 1WB0A 1OINA 3PZVA 1G1YA 1H4PA 2OWWA 5CSUA 2PWGA 3MU7A 1K6AA 5A3HA 1V3IA 2BY3A 5ABFB 1JYXA 3IJ9A 4JFSA 4AIEA 2XVPA 3AXHA 4C7DA 1L0PA 1E72M 2XN0A 1X6NA 1CXFA 2OWXA 3ARTA 4EANA 5A2AA 1E6QM 4UQAA 4WLCA 4OBRA 1QI0A 2OSYA 4PMVA 3SIMA 1V6YA 1XYFA 1C90A 3T2OA 4AZ5A 1DWAM 1GONA 2E0PA 2G3JA 5IHRA 3CUHA 2JF7A 1ISZA 5ABGA 5I2UA 2UWFA 2WMJA 3BCDA 5DO8A 5A6LA 2J7BA 4GI9A 2YJQA 3PZOA 5BXRA 1H0GA 1KWGA 3K46A 3SCQA 1UWIA 4ATWA 4FNPA 4JL1A 4U2ZA 1HKMA 3GH4A 2DGAA 1JYWA 1QW8A 1UA7A 1UZ1A 4UOJA 2ZUUA 3WBEA 3TTQA 4P8XA 1QNQA 3CZGA 1PZ2A 3VU2A 1CLVA 3SUTA 2V3FA 1V02E 1EH9A 5A2CA 1WZKA 4HU0A 3FAXA 1VFFA 1NQ6A 1UD2A 4B9ZA 3KE0A 4J27A 1VFOA 2OW6A 1U2YA 2V3GA 2DH3A 7CGTA 2WCGA 1JD7A 1XYZA 1LQ0A 3WH5A 4A3YA 1ZU8A 4M29A 3WQVA 2Z1KA 1WDPA 2F8QA 4CN6A 5E0CA 3N04A 3RCNA 2J62A 2WKGA 1MWOA 4J3VA 2EPMX 4XX6A 4D72A 4HPGA 3LPGA 3EJSA 1JFHA 5CXPA 4AEEA 3FHQA 4UFLA 2VRQA 3CMGA 1JG9A 1DWJM 4LPCA 1GOQA 3GNRA 3UR8A 2WZIA 3WH7A 3WQ5A 4QLLA 1WDRA 1HTYA 1GQKA 4NX0A 1C91A 4D6FA 4EAMA 3IAQA 4B3KA 1J0KA 3A6OA 5BRPA 8CGTA 4OUEA 1NWUA 2WBKA 2C0HA 3SUVA 2WSKA 3HN3A 4KWUA 4V2XA 4DWSC 3WUGA 2UY5A 2CKRA 4GIAA 2WHMA 3VINA 3KWXA 2X09A 3CUIA 3HMCA 4E8DA 3J7HA 1VFMA 2OSXA 1LWJA 3AMDA 1JZ4A 3WNKA 4AZGA 4A3HA 1LF1A 1D3CA 3GXIA 1UWSA 5DT5A 4W84A 1C8QA 1JXJA 3QHMA 2WM0A 4UFJA 3ARWA 3MUAA 1QHPA 2IUZA 1R87A 4UQEA 1QWNA 3ZOAA 3BGAA 3W29A 3ZR6A 1J0ZA 5A2BA 3HG4A 1OT2A 4W86A 2WCAA 1LL6A 4PN2A 4BA0A 1XSIA 4H2CA 1KB3A 1JZ7A 1PPIA 5AC5A 3WL1A 3EYPA 3MSDA 3U7BA 2ZX7A 4D6CA 2EEXA 4ACZA 1W3KA 1UH2A 1H41A 1JGIA 3MMDA 4JAWA 5DEZA 2DIEA 1GJUA 3BUQA 1E3ZA 1BTCA 5FIPA 4CUCA 2FHFA 4F79A 3SCUA 4UOQA 5DT7A 1TUXA 3EDEA 4GI6A 3W25A 2J47A 2GFTA 2ZOXA 3GZAA 1CGYA 1QOXA 3PTQA 2XFRA 3WF2A 2WWCA 1J18A 1HF6A 1UKPA 4OZOA 2AAAA 5EFDA 2EABA 4W85A 2VX4A 3UR7A 1EGZA 5ECUA 3S5YA 4W5UA 2B31A 4U3AA 1R7OA 3KZSA 4FLRA 3T0DA 2VR5A 5A6BA 4J28A 4MPKA 3CZKA 1VJSA 1G01A 1HXJA 1PEZA 2TAAA 5A94A 2XVGA 1JIBA 1HIZA 1ITXA 2W66A 3K8LA 2Y2WA 4X0NA 5FL1A 1TCMA 1VEOA 4PMZA 4PTMA 1BHGA 3CLWA 2VOTA 1M03A 2AMGA 3VGHA 2XPKA 4W7UA 3L2MA 5IDIA 1VRXA 3VSVA 2CPUA 1E6RA 3WUFA 4PTWA 4W87A 1E70M 2D20A 1V0LA 5A6KA 2XIBA 1HWWA 1PAMA 3OZOA 1UD8A 2F1AA 3PZ9A 2YLLA 4ZXLA 1KQZA 3CPUA 4AYSA 2IXUA 1R7AA 4P7OA 1BLIA 3VMOA 4WK9A 5HPOA 4ZXOA 3RDKA 2Y5EA 3VTRA 4DWSA 5AY7A 1WP6A 1TMQA 4F9JA 1HVXA 1QNSA 1WDQA 3WF1A 3L4ZA 1GCYA 2ZXDA 2J7CA 3QHNA 4IM4A 1F4AA 3JUGA 3VVGA 2DT0A 4DO4A 3PZNA 4F8XA 1LL4A 2GK1B 2DT2A 3VPLA 2V3EA 2ZXBA 2EPNA 1AVAA 1ZS2A 4M56A 3BXWA 1QHOA 3ZJKA 3AHTA 3BVXA 3BVWA 1C7TA 1TR1A 2PF0A 1WE5A 3PTKA 2WKLA 4E8CA 2G4FA 1UUQA 2YKKA 3IJ7A 1E0WA 2XG9A 3F4VA 4K68A 4AZCB 4AD0A 3AZTA 3VGFA 1HVQA 3N12A 4JL2A 2ZXAA 1OIFA 2BXYA 4H8UA 2D23A 3VIKA 1ISYA 3APGA 3AIEA 2XM2A 3MUIA 5E9AA 3N1AA 3EMZA 2OW7A 1JZ8A 3B9AA 2OYKA 4AD1A 4ZE4A 1GZJA 1J9YA 4BQ5A 3EMCA 1FOBA 3MS8A 5A8QA 2OWCA 1UWRA 1HJXA 1J11A 2CHOA 1NWTA 4JFTA 4LGXA 3WY4A 4DM2A 2QLYA 2W67A 1VBRA 1B2YA 1DTUA 1UD4A 1XCXA 4UQDA 3W37A 4TX8A 1B9ZA 5D4YA 3GM8A 5A8PA 3VGDA 2J8FA 1E6XM 5M5DA 1R75A 3ZSTA 2D73A 2VRJA 4CU6A 3K4DA 2PWHA 3PZMA 3AIQA 2X8RA 4GQQA 5JBDA 1HJWA 2J7DA 2V5DA 2FH6A 3BAWA 2QHAA 1WPCA 1ZB5A 2DEPA 3ZQ9A 2VCAA 1SFSA 1I75A 2DSUA 2W91A 2WYSA 4U5IA 3GBDA 2D0FA 3EJRA 1JDAA 2ZE0A 3WDRA 1Q4NX 1UH4A 1E6PA 2WMIA 3WMCA 1Q6FA 4GPNA 2VZOA 1CGXA 2EADA 4NZFA 1QW9A 3I3EA 1W2VA 4XV0A 4AZ7A 2J4GA 1V6WA 1QNPA 4JFWA 3AHVA 1E43A 3CUJA 2X0YA 5A6MA 1D2KA 3NIYA 3AYRA 2GJXA 1BGGA 3AIRA 1MXDA 5JBEA 5ABEA 1CENA 1BFNA 3K1DA 1UA3A 2ZX9A 1WO2A 1B3XA 3O9NA 3ZM8A 1V3JA 1WZAA 4UOZA 3EDFA 4UNIA 5BRQA 1FH8A 4S3JA 1QBAA 1NOUA 3D50A 2QMJA 3FN9A 2W5FA 4FLQA 2CETA 5M3WA 4IPLA 1W9UA 3NJ3A 2W61A 2Z1SA 2NSXA 1W9VA 5EB8A 1TQVA 1WZLA 2YDQA 3CZJA 3WNPA 5A6SA 2VZTA 3EJPA 4WSJA 3RILA 1NH6A 1EHNA 4AC1X 5BXTA 3LPFA 2Y24A 4YHGA 1FHLA 4TOQA 4J3XA 2J75A 4AZ6A 1BF2A 1BSIA 5FKYA 1KTCA 1EO5A 3W0KA 3GYCA 3M6DA 3TV8A 1UKOA 4OKDA 1FP8A 3DYMA 2YA2A 2XGIA 2GUYA 4QLKA 1J0IA 4RL3A 1B3WA 4PYSA 3CUFA 1JI1A 2YA0A 2V5CA 2O9PA 2VMFA 3VX0A 3S6TA 3SUSA 2XN2A 2XVLA 4HOXA 1GHRA 4TVDA 5FL0A 2VUYA 2E40A 2YDRA 3WEOA 3VGGA 2E9LA 2G8ZA 4CN4A 4WIWA 3TTSA 4MDOA 3M46A 4JHOA 1MW0A 2JF6A 2GDVA 1UWUA 9CGTA 3TP4A 4CU7A 1JAKA 1YHTA 4X9YA 2V38A 3D51A 3CBWA 1I1XA 2VJXA 1R33A 4FNSA 4AMCA 2YFOA 1B30A 1HJVA 1VEMA 3LRKA 2WW5A 5D9OA 3U5UA 1TQSA 4UFIA 5A6BD 2BY0A 2BHUA 5GQBA 5CPQA 1W3JA 2E3ZA 1EOMA 5I77A 3VIJA 3N13A 2VL4A 3BCFA 3CO4A 4HZ8A 3VIIA 1TQWA 3WKZA 4AISA 4W93A 1AQHA 8A3HA 3VDCA 4PMNA 4PRWA 1MVYA 2E9BA 1W2PA 3W6MA 3OZPA 4KRTA 2WSPA 1UD5A 4MTVA 2ESCA 4NXKA 3QHOA 4PUEA 1TZ7A 2GJPA 1L8NA 3AI0A 1F4HA 5AYBA 5FOOA 1BYBA 2J25A 2VO5A 4UQ9A 2WMHA 1J0HA 3TOPA 3ARVA 3W4RA 2A3AA 3ZJ8A 4ATLA 3ZT5A 2Q8XA 4UTFA 2BHZA 4IISA 1LL7A 1SMDA 2J7EA 3UG5A 1QHZA 1XGZA 5HPCA 3PZUA 1CECA 4W88A 2XSAA 3PZGA 7A3HA 5DFAA 4EK7A 3UETA 1JZ6A 3F5LA 4Z2KA 3GXTA 2PWFA 1B3ZA 4YN5A 4ATDA 2D22A 1C8XA 2JALA 2CERA 3I3DA 3GTNA 4L4OA 4HP5A 5F7UA 4Q7NA 3A3HA 3THCA 3G6LA 3VDHA 3VD3A 1GVYA 1W1PA 3PBGA 3RM4A 3EJQA 1XC6A 4V27A 1E6NA 3VUPA 1G94A 4LXFA 3EDJA 3AS1A 2ZIDA 4NRSA 3OGVA 4CD6A 1H0IA 1E0VA 3ARRA 3MV11 3D4YA 1VIWA 5IFPA 5I24A 1KCLA 3HG3A 1JZ2A 3ARYA 4QLJA 3WUBA 2BXZA 1JAEA 1BYDA 4GINA 4XZWA 1E56A 4DO6A 1J01A 2CESA 1W91A 3VILA 2DQXA 2J77A 4MNKA 2ALWA 5A8MA 4HMDA 4CD5A 3ARUA 1KR1A 3LPOA 2W62A 3DECA 5AYIA 3QGVA 5EBAA 3BUIA 3WD1A 5TD4A 3T09A 4MNLA 2WZEA 2GVYA 1TE1A 2D2OA 4DUXA 1MFUA 1DP0A 1KWKA 1SR0A 3VIHA 2D0HA 4MB4A 2J79A 4URIA 1GHSA 3A22A 5IXEA 1OIMA 1HJUA 1E4LA 5LA2A 2BFGA 1FH7A 1RP8A 2WVTA 1UHVA 1B0IA 4HPHA 3AMKA 4M24A 3MMUA 4PMYA 4E2OA 4TX6A 3MSGA 4X0VA 3CHEA 1CZ1A 1VFUA 2X2HA 3BAIA 4Y7EA 3GH5A 1KXTA 1DWFM 2CBUA 2Y4SA 3N15A 4MB5A 2VX7A 2A3EA 1ODUA 3DX1A 2EBNA 4DUVA 3O6AA 1UG6A 2J8GA 5D8WA 1J0JA 2F7RA 2F61A 3U57A 3WENA 3KEHA 2F7OA 3MKKA 3PTMA 2D24A 3BAXA 4LYQA 2EPKX 5E09A 4JKMA 3LPPA 1PJ9A 2WHLA 3U5YA 3W53A 3A4XA 1PZ3A 1OSEA 1GORA 4OOUA 4FLOA 3WDHA 2WCSA 5EFFA 3POCA 4CKQA 4PMOA 3ZT7A 1E40A 4UZUA 3VD5A 2F2HA 4M1RA 2WAGA 4TVCA 1EA9C 3OBAA 1W9PA 2ZUNA 5JIPA 3L2LA 2EAEA 1KBBA 2DSVA 3WH9A 3AIBA 1FHDA 1H2JA 3DYOA 3CZ8A 4HOZA 1KCKA 3HZ3A 1IV8A 3MUZ1 4ZENA 2WHJA 3AZSA 1NM9A 1X1NA 2YFNA 1GJWA 4NZCA 4L4PA 1OD0A 2XN1A 1E9LA 2GK1A 2XJ7A 4TTUA 3B9EA 2WK2A 1JL8A 4BQ3A 3PN8A 1XD0A 2YDSA 3CH9A 3BLKA 1YQ2A 3SCRA 3ZMRA 1EDGA 4QCEA 3KLLA 3VD9A 1DHKA 3F5JA 5IFTA 1R34A 3RJYA 3E1F1 3RM8A 4FNRA 4Z2JA 4M82A 5E70A 2CBJA 4TUFA 2PWDA 5A6JA 1TG7A 1OD8A 3QOKA 2G41A 1JYNA 4UQCA 4ACZB 3WUEA 4WKAA 2JIWA 1RP9A 2YBTA 4PMUA 1FFRA 1RH9A 1LLOA 3NSXA 3GXFA 2FHCA 2PBGA 3SUUA 2WMGA 2CKSA 3AHYA 2QV4A 2FH8A 2BY1A 4MB3A 2IGTA 3G6MA 4MDPA 4HA4A 3FAWA 3ARQA 4P8VA 2D0GA 3IAPA 3N17A 1GQLA 3OLDA 1I1WA 2VX5A 4W8LA 2ZWZA 5KEZA 1BQCA 1XSJA 1BVZA 3AYSA 4TXEA 1R47A 1C93A 3W6LA 4AYGA 3VM7A 3DDGA 1LG1A 5I6SA 4Z2LA 3ZT6A 3TTOA 1V3MA 2FE0A 3BSGA 2WVVA 3WNLA 1MW3A 1V08A 4KMQA 2JEPA 1H49A 4UFKA 1PBGA 2VQUA 4RE2A 3WMSA 3AFBA 1ESWA 4F9DA 5I79A 1TA3A 3WIJA 2XVKA 1JD9A 1HNYA 5A1AA 3GXDA 3RJXA 3WFZA 2CBVA 2DT1A 4MJ4A 3BMVA 4B16A 3K8KA 4WF7A 1Q6EA 2BV9A 4D1IA 2YL6A 4YHEA 1V3LA 3EJTA 3B9DA 1KXHA 2ZICA 1BG4A 3VNYA 3K8MA 3UERA 1R85A 5CPTA 1MYRA 2HVMA 5CG0A 1M7XA 3ZJ6A 3IGUA 3AS0A 6CGTA 4OOZA 4GQRA 4GO8A 3GNPA 4QFUA 3W28A 4DWSB 2WMFA 2QF8A 1C3FA 3VKKA 2XSBA 1ZBCA 4UR9A 4FMVA 4DM1A 4WJXA 1CXEA 3WNMA 4AZHA 4XB3A 1GOKA 3GNOA 4AIUA 2XFYA 3S2CA 1KXVA 3BAKA 1MW1A 1PX3A 4CCDA 3CTTA 1LG2A 2WPGA 5D9MA 3H54A 1E4IA 3T08A 5I0DA 4PBGA 1CBGA 3MV01 4F66A 3CV5A 3HG2A 1E5JA 5E6ZA 1QBBA 3BH4A 4JIEA 3DHPA 1OT1A 4FNQA 5I78A 2NT1A 3UEQA 2DPEA 3VMPA 2UY2A 4JFUA 3NYDA 2X2IA 1UD3A 1UH3A 3AMCA 4W8BA 3W27A 3UG3A 2WVSA 3BLBA 3EMQA 3VM5A 1VB9A 1MQQA 2XUCA 4WKHA 3ZJ7A 3BC9A 1JDCA 3LXAA 4OBSA 4AD3A
chains in the Genus database with same CATH superfamily
1EQCA 4DJDC 1PIGA 3MREB 4RIRA 3HKZA 4PJCB 1MRCL 1RIVH 1XISA 4P2RD 1TX0A 4NFBA 2VISA 4D9PA 4K3JL 2I5YL 4NSKB 2J7FA 4CSZA 4Q3MA 3NG5A 4ECNA 2EYRB 1EBGA 4L4VE 2PBOA 3WG7B 4JKLA 3MI6A 4L18A 5KYYA 4GO9A 2DSKA 1RURH 1W9XA 4D6GA 3QFJD 2R2BB 4OV6F 3G1RA 2BXVA 4OVVA 4MJJA 3QH3B 2MJWA 3DJZA 1EYEA 3HG1A 1WFMA 3WH6A 1CE6B 5F96L 2FBOJ 4XPFH 2PP3A 3U0WL 1OP5H 3SJVE 1E2ZA 1AJ7H 1BYAA 2J1YA 3O6CA 4FXJA 1W2KT 4RGOH 1O9VA 1NOLA 3II1A 2BBFA 4R3UA 4LRTA 2E9WA 2YBVA 2X9ZA 5KITA 3DFSA 5L2JB 5G2IA 2JV6A 3H8AA 3UPRA 3DX2A 4PRPA 4DF0A 4HHLA 1MDLA 3L81A 4GIYA 3ZVHA 4QHKI 2FECL 5T5FL 1GOGA 5DJZA 3IMUA 4TLSA 3LCFA 2Z7ZA 4QDMA 3ZDYB 1AKPA 1SOSA 2EC9T 4YU1A 3DMMA 3O16A 3BESR 1PVNA 3A5VA 4DVBB 4TTGA 1RI8A 1AS7A 3EKGA 2KLSA 1OWQA 3CFKB 3SO3B 3ESOA 2V7HA 3O0KA 2NNRA 1E4NA 2GC4C 5BQDA 1YECL 3EZ8A 4PG2C 3GG1A 43CAB 5EUKB 4FS0A 2CGYA 3QNXA 1JJKA 1SM3L 3BQUD 1Z9AA 4FI4A 3G1AA 3QKZA 5MI0C 5CGMA 5EB9A 5DMYA 2DMCA 5G4HC 1VYPX 2OYLA 2BVOA 4M61A 5G1MA 3PL6B 4EPKA 3AREC 4WEBL 3L3HA 4W4QA 1C5CH 2ZZUT 5TE7H 4PH6A 2WM1A 4U1HA 3B3DA 1FN4B 4J1OA 4GSUA 4XBMA 4Q0XL 1XV8A 2J8HA 3CLEL 4N8UA 4LX4A 2MH4A 3TX9A 1WAAF 1AGFA 2ZAIA 3CFCH 1TEFA 1QR1B 1HOCB 5ELIA 1VPXA 4BWUA 5SWZB 2F7PA 1DN0B 4NUGH 4CJ0A 3UJTL 2PRLA 2AK4B 4NNAA 4OIIH 1Z8AA 2KBGA 3MUY1 2X7LA 2XU9A 3PBMA 4UBDD 4U3XA 3FOLA 2GGGA 2ZKHL 3PNWB 1IGJB 3NUKA 3U9WA 3NZRA 4OLUL 2VD9A 4G6FB 4CKVX 2ZKXA 4TUKH 2VC9A 2BSDA 2QDHA 2DUZA 3M44A 1LK2B 2OOGA 4QRPE 2PEVA 2Z8WC 1FBIH 4H19A 2KX9A 1VAHA 2JFEX 4G7YH 4XRCB 4HQQH 1DFBL 2VZVA 3TW7A 2YXVA 1EAPB 5LNEA 1OX4B 5HY9A 1A4AA 4B15A 2OMZA 4R7JA 3VXTB 5IROD 1SXBA 5CF3A 3KL0A 3SGDH 1FL3A 1A3LH 5DHMC 3BT2L 3WTWA 1AS8A 2CIKB 4J3OC 3A13A 2BWQA 4QCIB 2VR4A 4W9CC 1BIIA 2PTVA 3ZIZA 4FNUA 1AFVH 4QXVA 3CVIL 1WUFA 2GTZA 2HKHH 2VEMA 5J1SC 3R7QA 3MCYA 4WKZA 3TW6A 4ZVJA 1B4LA 4UTIA 4XAZA 4Y5YB 4P7QA 4CW1B 3QRLA 5D33A 4K6AA 4S1RH 3IXAB 3D39B 2HJKA 2GFBA 4Z3IA 3IUHA 3Q4DA 1A7OL 3THUA 4XVUD 3QUMH 2VDQH 5AVYB 1RU9H 4M93B 3WBWA 2EICA 5AVZB 1I1AB 1T03L 3THML 4G5DA 3V5CA 5L2KD 3RO6A 4JDTL 4Y7MA 2PO6A 3O6KL 4DGIL 4KY2A 3MVIA 2H1PH 3TAKA 4GG6F 1QRNA 2Z8RA 5AB2A 1XF2B 2FGLA 4D1JA 1YIXA 3O3AB 1WT5C 2CWNA 4LKXA 2P45B 3S97C 2EQDA 3NL3A 3AABA 3BPLC 2QDGA 3AMLA 4BEIA 2XZ7A 2X7WA 2F5BH 1PYWB 4OTKA 1NCCL 1CDJA 3ZMEA 3NSCA 4RE0A 3W85A 1UJ3B 3M7SA 1PDZA 1I85C 1BPVA 3X1GA 4K8RL 1GQIA 1H3TA 1MIMH 3WN6A 3VXPB 4ZBCA 1G4MA 4Y9CA 3OLGA 1PG7W 1V77A 2HX8A 4RRPA 3IWVA 3ZXAC 1NLBH 1NP0A 1MI5B 1J1PH 2OJZH 5G4MA 4DXXA 3WLMA 1AMYA 4HUNB 4OUUA 5JUEH 2XV0A 1WKEA 1IEWA 3ATZA 3JWDH 3AXXA 4R7NB 5CR1A 4UIMB 5KYWB 3HEIB 5DRWB 3KGSA 2ADJB 1J5SA 4G8GA 4TUJA 5JMOC 4YX2L 4QE1A 2GOUA 4FPSA 3S3CB 2QCGA 4CN1A 1VJZA 2NQDA 3QXAA 1KSRA 4AD5A 4P5MA 5HI5D 1NDMA 5MEQA 4OZGE 4S1QL 4D0BA 4PJIB 1EZSA 1LUCB 5C09D 5F9OL 2C3VA 1MJJB 2QJGA 3C2RA 5JTWA 5DEGA 3WS3A 3UPMA 2PDLA 4RUBA 1FO0B 4JFDE 3NABL 3DGGA 4XPHH 4I9AA 2BOBA 3FO2B 4AMWA 3IS1X 3QUHA 2O5XL 1AGEA 3F12B 3DETD 4XP9H 3MUJA 1I2NA 1D7CA 3D85D 5F7NC 5J6GB 4MXVE 5AW7B 1PDYA 1AO7E 1E4KC 1NEYA 3W01A 1WBYA 2YBUA 4HA3A 4P4KC 2BOFX 5BCAA 3FONB 3A24A 4OZIB 3VXOA 2XG5A 3R94A 4JM4H 2XPGA 1JNHA 2AQOA 1IT8A 3VIPA 1IKNA 5KJ4A 4YE4L 2CZVA 1KFAL 4X5QA 2ZWNA 3QJUB 3CPGA 4U3HA 3PPCA 4B5VA 3OR6A 1X5ZA 3PABB 1RBAA 1E9PA 3PZVA 1WFJA 3MU7A 3UADA 4RMBA 3I6EA 5LDUA 4BBWA 4F24A 3H56A 2Y7EA 1E1CA 3CK0H 5C08E 2INZA 1DORA 3AWEA 2G3JA 5DI8B 2J88H 2VR6A 5ABGA 3MODH 3IPFA 5AOMA 3KPOA 4XISA 2CLRA 3EZ4A 2EKGA 1UWIA 3MQTA 4E38A 1YRRA 3E8UL 4O2CB 2A79A 2ZUUA 2YCEA 1TWZA 2E6PA 4X80L 2EXYD 1CLVA 3B3IA 3RWDB 1EH9A 4M4RB 3VFNA 5HYJE 3EA1A 3QA3B 2QR0A 3DUUB 2DH3A 3UTPE 2B7DT 3UJJH 1HHIB 2REQB 1NJJA 4EZKA 3RYMA 2J62A 1SVZA 3IMRA 5IMOA 4PW4A 1J88A 5GRJH 1TIMA 1H6FA 3N40F 1KCXA 4WW1B 2WZIA 1KCVL 3EWCA 2MCPL 2PDUA 4PJ7E 4D6FA 2E25A 1FY6A 2PTDA 3EX3A 6REQA 4KJPC 4QHKJ 4OUEA 5CJXC 1U8NB 3UC0H 4HAGA 3IUIA 3VWKB 2FQGA 5D03A 3J7HA 1OABA 2OFQA 2O93L 1T20A 3S36L 3L3GB 4F9LC 3VVWA 4BH7B 2PU1A 3D9AL 1IC5H 3BH9A 1C8QA 1AZRA 2WM0A 4ZQOA 2F53A 1YVLA 3TWBA 3LH9A 1RIHL 2XKNB 3TM6A 2C1OA 4P9MH 6ALDA 3IU3B 1M2VA 4XKYB 5KSBF 2Q8BL 4PBWD 5IFHH 3NA8A 3ULVC 32C2B 2DJXA 2IBBA 3KJ6L 4FXFA 4KKAC 1RLWA 4X99A 4F79A 2H9GB 3ZR4A 2DL9A 1KGCD 2GFTA 5DLML 4DNLA 3EOTL 4PUBL 2AQ1A 3WLKX 4C4UA 4WUUE 3TJXA 2BC4A 1W37A 1S5MA 1A9EB 3JZYA 1XDTT 2DY3A 4O14A 3KMDA 4MS8C 5GRVL 1JERA 3LKNB 5DHVB 5AW0B 3S5YA 4RWYL 3CSPA 4DI8A 1SEQH 5GS2H 3N5AA 4LLDA 1HL2A 1OWRM 5DT1H 2EDTA 3HFML 3CMOL 7PAZA 2XVGA 4IG2B 2Y2WA 4X0NA 2W9EH 4XSLA 1DOSA 3SN1A 3PJUA 2EYTA 1O7DE 3DO4A 3CG8A 5A2JH 4DCQB 2V5BA 2RTTA 3P9WB 2V9TA 5T1LA 1BV8A 1UD8A 3FSZA 3KOZA 1CQKA 1BX2A 2GJ6D 4JAMB 3DTXB 2DQFA 4NZRH 2PTYA 1A5FL 5CILL 4AM0Q 2FNWA 3CHVA 3WS6C 4XPTL 4XWGH 2BVQB 2W95A 4IM4A 4NERA 2ESVB 3GI8L 3IUDA 3E3QE 1IBZA 1TR1A 2PF0A 1OP9A 4IMLA 4TPRH 4BM7A 4Y4HC 4IRSC 5IVXA 4PD4J 3F4VA 4AZCB 3SRFA 3DUSB 2I17A 4XCYB 2HT4D 2KZKA 3QY8A 4PR4A 2XN9B 4KRZA 2P28B 4AD1A 4J3ZA 1OAQL 1GZJA 5CJOH 2WLMA 5T3XE 3UTZA 2ZF8A 4P46B 3PJLA 3F6JA 4U6TA 4CVZA 2CHOA 3KZPA 5CU5A 1OYCA 1Q9KA 1KCUH 3SGGA 4KNTA 3W37A 3WFBL 1YEIH 4Q4IA 2EXWD 4WFEE 3GM8A 2YW4A 3GMRB 4G9FB 3LZRA 4V1DD 5JPNC 3ELQA 2CGRL 5I1EH 3VB9A 5JBDA 2DFAA 1FCBA 4XOBA 4Z7AA 3FX4A 1WS8A 1SU5A 2EGZA 3QG6A 3GO1L 2J6EL 5C55A 1FUYA 5L6UA 3LTVA 1EVUA 2EADA 3MUHL 3VG0L 4JO3L 3M5YA 2TODA 5D7SL 2OL3L 5A16B 7FABL 3NZHH 5TPWL 1H3WM 3OKDB 1XGEA 5GS0C 3AYRA 2GJXA 1FDLH 1DQML 1FV1A 4PWGA 3RTLA 5HUPA 2R91A 2MRYA 3S8WA 1A5OC 5IR1B 2POZA 4G1MA 3TH4T 5T33L 4IOIB 3QPXL 4YVPA 4RNJA 2KKQA 3HR5A 2OX1A 3NIDF 1JNLL 2YPKB 4Z0BL 3V4LA 3S6CA 1GVSA 3ATYA 1BA9A 1IM3B 4FFZA 3QDMA 1C5BL 2VDGA 4NHVA 1GTFA 4Y2DB 4GABA 5KBKA 3ULUC 1ND0B 4YHMH 4OKDA 3UTSB 4YLBA 3TN0C 4PGCA 4ERSH 3SPIA 1CL7H 4RMTA 1IFGA 2MOVA 4WK4B 3G04A 1TWIA 1JSYA 2BHFA 4GBDA 3CDGB 3VX0A 3OMNB 5H6HA 2ZOLB 4IIQA 3VI3A 3EBAA 5C2CA 1K02A 4PUWA 4JVUA 1MW0A 2O5YH 2V69A 1ZLVK 3LEVL 4FABH 3WL9B 1JAKA 1O1ZA 2D7MA 4D3CH 2FIRT 4AMCA 4NRXB 5BPPA 4MIMA 4HV8A 2VUNA 3VZYA 1KN2L 2GVGA 5CPQA 1RJLB 1ZTXL 4KRPD 2A2QT 4GE8A 3T6WA 4ZMWA 3T4AC 5IHZB 4TF4A 2G3FA 4JX5A 4ZMGA 4IOTA 5I9QB 1F4HA 4JM2A 3BGJA 1SSDA 4JO8A 5D7LE 1IC4H 2VW6A 4YHKL 1G87A 2HFGH 2BHZA 3UX9B 2X9YA 4LDEB 3UIZA 3QRGL 3OZLA 5HD8D 3AT8A 3PZUA 1I1FB 1QMLA 1XDJA 2DWSA 4ODTL 2BNQB 1NMCB 2GVEA 3I3DA 1K3UA 5E8EA 1GMEA 2VP8A 3AY4A 1QNVA 4RA0C 4I9WD 2BSCA 5DD1L 3EDJA 3H9ZA 5JO5A 4AY7A 3WJLC 3NK4A 1NDYA 5MENA 2H8PA 2I1OA 3Q01A 4DO6A 1D6VH 2R4RH 3GM0A 4PJXA 3WZ0E 2R0LL 2EIZB 4D94A 3QT2A 2QAPA 1SQ2N 2QUNA 3ECUA 3T09A 4L9LC 4HCHA 1WWCA 3A22A 4HCLA 1HJUA 3NQCA 2WZTA 3GIYA 2DQJH 3TUUA 1NJ9B 3OMAB 3QIUA 4M5YL 1CT8B 3FUMA 5D71H 1UPPA 1XVSA 4MB5A 2D9QB 4RDYA 2YB1A 1N8ZA 1QUNA 1EJSC 4QXIA 1LD9A 3EPNA 3HTLX 1K8CA 4WW2F 3Q7JA 4MWAC 2WTOA 4NVTA 1RHHA 3LPPA 2FZDA 4M5ZL 2B7PA 2C1PB 1EJRC 3CFJA 1T40A 4YGVA 5A2FA 1W1A1 1F3EA 4E5TA 3NAVA 4KBPA 2BB0A 4Z3HA 1YDYA 1N0XL 1EA9C 1ZJHA 3IVSA 2OCZA 1FAKT 1U92A 2HVNA 5LIXX 4L5FH 2BSEA 3CYJA 1TPXC 4PP2A 1A1MA 4YO0B 3G1XA 5DQ9B 3G3MA 5J5EA 2BSTB 1E9LA 1TPC1 4BQ3A 3HG1E 2HPMA 1OEPA 3ARDC 4QCEA 3P11H 3ES7A 4K15A 4FNRA 1NFDF 4CVXA 2Z31A 4LU5L 4G42A 3IJEB 3X3GH 4EI5C 1JXDA 1W31A 2F84A 4G6CA 2WWMD 3DHMA 3SQOH 5E0KA 4EUPA 3ZHDA 1WXJA 5MI0B 3SUUA 2ATPB 1LT8A 5T8GA 3OVPA 2COQA 3G6MA 2BP5M 2DY2A 3B2VH 4P2AA 4ROPA 3AREB 1PKQB 4N9CA 4WX2A 5SV4A 4JPKL 1RZ8A 3ABMB 3OLDA 4PRPE 2HFFA 5CJBA 5I1HL 1OAUH 1OSPL 1LO4L 1IGFH 3ZT6A 4RGND 5KSAB 1FYTD 3OEXA 1MW3A 3LNPA 3WQGA 1LEKB 4QITA 4LE8A 3E5PA 3C56A 3RJXA 1I1YB 3JWNG 2CBVA 2HVBA 3FEQA 3UU0A 5EWIH 3LHUA 3QEHB 1K8IA 1A4LA 4BHUI 1ME9A 4IQJA 4QF1A 3VYNA 3TL5A 1YZZA 3FO9A 1CK0H 2XSBA 3CBRA 3RNKA 3JZEA 1UM5H 3F6IA 4WJXA 4FJZA 3HIZA 2NY0B 4JO2L 1SZEA 1CD9B 5IQNA 2EH7H 2FLMA 3KHOA 1OCOB 4QRPA 1YEYA 1PG7L 1DUZB 3V18A 3TYCA 4LP4A 4RV3A 4KCUA 4EWJA 5FC9A 2ITFA 2Y85A 2YUZA 1U3HA 5REQB 3A0OA 1VQTA 1NIEA 1GQNA 5FX3A 2AJ3A 3HZMA 4LAJH 5F0PB 2J6XA 1HSBB 1QSVA 3LLDA 2I9UA 2ZKWA 2ZNXA 4TOYH 2XYLA 4BH8A 2XFXA 5ECGA 4IPNB 4A7VA 2D03H 2E27L 1G7HA 1H1YA 5CFHA 4AGMA 4IK6A 3B40A 4HK3N 4LO9A 5EBLA 2C8NA 5HVHB 5D1QE 2JQAA 1WAWA 1KJVA 2YXMA 4JPGA 4JNYA 4P23A 2C7UB 3NQ8A 2VELA 4RK8A 3HGSA 3PDOA 2V2TB 3OX8B 3ZSSA 3SDCD 3S5ZA 1BM3H 5C3LD 1TPFA 5L6YL 1FA4A 5I06A 1RIUL 2K7QA 4MY8A 5JXAH 4QDPA 4M5PA 4N6RB 1BXVA 3BYYA 1F2QA 2YEZB 1MW2A 1NCIA 4G8FB 1T6WA 4X8XA 3PR2A 3ECBA 4G80B 3EPOA 1IT9H 1MRFL 5E8DL 1XG3A 3BPLB 1M6OA 2VDPH 1T22B 1NPUA 1JI2A 1G4RA 3RO8A 2ZOUA 5AKTA 2LABA 3IETA 5CS7A 2PXYD 3NVTA 2XA8H 1CFNB 2XRAH 4KY1L 43C9B 1M1BA 1E2WA 1H5YA 3KYNB 3TTYA 4F2EA 1HC1A 4LF3B 3VGBA 1UZHA 1BP3B 3MOAL 5CSZA 1W5QA 3MRGB 4L23A 3Q45A 1EJTC 2BNRE 4AY8A 5JW3L 1S2VA 4PRNB 4H0LC 3ABZA 1NFKA 1TO5A 2I7OA 2R1WB 3QZEA 3RLGA 5EZOL 1D9KD 4NDMA 2XXFA 2BP8B 1K4DA 1EWEA 3UOAB 4NXSA 4XXDB 4N8CH 3L7RA 2CITA 1TTRA 4S3EA 5I66B 2JKPA 4P7LA 4RNIA 2HVOA 5K1NA 2Y25A 4L3EB 4BS0A 4ZUWB 5F1OB 1WWWX 3CCHA 4MKTA 1XUZA 1GC1H 1U41A 2YCJA 1GSMA 4FHJA 2E75C 3TNMB 2YL9A 3T4YA 3H24A 1XSKA 3SYQA 1H62A 4IW4C 4ENEC 1KCSH 1F18A 5G4WA 1G0CA 1Z5HA 4N2AA 1U93B 1QFWM 1NLDH 4QHMB 3VNZA 1UYWL 4XSMA 1K2DB 3NR0A 3C5ZA 2XV2A 4OZGA 4E36A 5J3HC 3CVHB 3QUYA 1FNEA 3V1PA 2IH8A 1E8YA 1EO8H 5IMKA 1L7TL 4ORIA 3WD2A 3T0EC 4TVUA 3TQ0A 1THFD 4QRNA 1S4IA 4JFDA 4ABQA 3UJIH 4CNTA 2VQ1B 1OARL 4DAIA 3BKMH 2AL2B 2QQLL 3HI5L 3LX9A 1I53A 5M17A 3T07A 1YPXA 3U4EA 3U25A 1MSSA 3QY6A 3DX3A 1WCGA 4P4KB 2OP4H 3TZVA 3VXNB 3X1NA 3QYNA 3LH8A 3DTUB 1SW7A 4XP1H 3SDDB 2NY4B 2PCEA 3RPKA 4CNNA 5I73C 2QVFB 1AO7A 4HF5H 2FB2A 1IM9B 1L9RA 1J05B 5FUCC 5B4MD 5DRNB 4EI6A 2O4MA 1MCFA 1GKPA 5IUCA 3DI1A 4AYEC 5DCEA 2OGYA 1NUGA 4H6RA 1QNRA 4S2SA 1DHPA 2IQAB 2DOCA 3TC7A 2WC7A 2YD4A 1INQA 1DZBA 3BFWA 2X2JA 2XCMC 4CC4C 4X6BB 1IT7A 4U1NA 5C08A 1FDJA 4IICA 4AQLA 3TIDA 3WNNA 4UM9A 3FT4A 4G9DA 3OMZA 4MD5B 5CGYC 3UPBA 4A04A 4M1GL 3PE9A 1HKKA 3ROOA 4XTRC 5HNNA 4HU8A 1L4IA 5F7EH 3HJEA 2I27N 3Q13A 1VENA 4JFYB 4K4KA 3DN5A 1GR7A 1KGUA 1YN7B 4FG0A 4BK4A 3FQ1A 3NZUA 4NNPL 2JTYA 2QZ5A 3G5VA 3WHE1 2UYLB 3JWNH 1KTLA 4TNVF 3RA7L 3DVNA 4BCZA 2JMRA 1EOKA 3SCWA 3MACH 4U31A 3F2CA 4MZ2A 3BANA 5LNRA 4ZFFA 4GRWB 1A3HA 4IBVA 1OZMA 1CBVH 1W16A 4PJ7A 4PJGB 2P8MB 3MAWA 2D9CA 3UZVA 3WY2A 5FGBC 2AEQH 3WEMA 4GVHA 3KXFB 3FHAA 3HNSH 4H41A 1QWGA 1ZHBA 3FQWA 4QEHA 5CGQA 3LXUX 1ODAA 1KB9K 4HUWA 1UWXH 4AC4A 3EOUA 2GTWB 4HIJB 5C0GB 2E5CA 4Y2OA 3GBEA 2J12B 3TDFA 3B8SA 4X2UA 3THDA 4PCPA 1P84K 3SM0A 3WLSA 2WN2A 3WLWD 2X42A 2WSDA 3S4SB 3HZYB 4GZJA 4K8EA 3GNDA 4ZO9A 2EO7A 2WQWA 4PW9A 4R5EA 4J6RH 5FDWB 2AITA 4HZ7A 1PL3A 4ZAKA 1T6BX 1GJIA 3W38A 1HO1A 1N7KA 1SEBB 1UQZA 3C8FA 4AC7C 2GAZA 5C9RA 3LEYH 4LTSA 3ZO9A 4WUUA 5EGRA 1XINA 1RFDH 5DK2B 5EU6E 4FX6M 2PUZA 2ZSVB 1MKFA 3GTTA 5M03A 3DV4B 1G9EA 3DFYA 3EX6A 3T77A 3KYOB 2IC2A 5F3HA 1C5DA 1CPUA 1VPYA 1Q13A 1N3NA 4XNBA 4NZ8A 3WQWA 1S3HA 1BIHA 2GQHA 3GR4A 1YAIA 3SDAD 3IMBA 3S0PA 1US3A 4YDKL 2QPUA 4IP4A 5GRUH 3W11D 4HSNA 2Q7YA 4FQQA 1FWBC 2X6UA 2DBLH 3GFXA 2WTRA 4QHUB 1DN2A 3L16A 4XCNA 4E3VA 5JDJA 3L08A 4WHTB 3EO0B 4LCVA 1I8LA 4CLMA 3BGMA 4TQIA 3W84A 3AXHA 3AITA 3ARTA 1DYSA 1A9BA 2QJNA 4EANA 1FORL 2C6QA 4XCFL 1ESOA 5F7DB 1S2WA 2CFFA 3BZ5A 3DU0A 1BQKA 3TVMA 2P5ED 4GEJA 2UWFA 4OLZH 1TV5A 5A6LA 1OTSD 3SECA 4Y4KD 1QW8A 1H8NA 2GVJA 3S8GB 3N2OA 3OQ3B 1OP4A 4XVDA 4NYUA 1T2QL 3ZQWA 3KNBA 4JG0H 3V5OA 4UOW1 5EBGA 1UXMA 2OBGA 1TVLA 2DUXA 5E6ID 4UNVA 4WHYH 3KLAA 5D6DC 1WAUA 4FMFA 4JFEB 1CLYH 2OK0H 4FZEL 4D72A 3HPLA 3B05A 1VFAB 1PZ5A 3CMGA 2APWA 1PY4A 1L6YA 4K9EH 3W7IA 3VOJA 3H9SD 3CV2A 3R79A 1GKQA 1UM4H 4CQ8A 4KNQA 3Q5YA 4LHQB 3KD4A 2VGBA 5GJSH 3JV6B 3OAUL 4C6BA 3NDZE 1BEYH 3WUGA 1BVLB 3M0VA 3U6WA 3MRQB 5FYLD 3DURB 5G2HA 3FT2B 1OB1B 3LZLA 5CCJA 1XCQB 1LWJA 3U9IA 4Z7UA 3BD4A 4IZGA 3EYOA 3CN4A 5IHUL 2HN7A 1N4XL 4IHBA 3FLUA 3EFOB 1MAMH 2EDHA 3GVGA 2E6JA 5K9OA 4KRMB 1R87A 3BKCH 4P2OC 4U6HB 4NN7B 2OODA 4E41A 4PWEA 1JZIA 4F7MA 2J66A 3BUYA 5DFWH 4KXAA 1B9BA 3M8OL 1W5PA 1RCXB 4ACZA 2FIKB 4JKWA 2UZYB 5DD0L 3UFYA 4EVNA 1OO2A 2B14A 3SB3A 1RJPA 1Q7QA 4UB0H 1EJ8A 2HUHA 4GUOA 3IEBA 4IRJA 3FTGA 3D07A 5D7JC 5E2UH 4QRSA 4IX2A 2CLOA 4ADJA 4ODUA 2CQVA 4GD0A 1QPRA 3U4BH 3OPUA 5EY5A 4DQOH 2NLIA 5ECUA 5EBUA 3FNKA 1UB3A 2B31A 4FLRA 3BDYL 4MNHA 5HGDA 3R0MA 1V7NL 5IWLC 3MLZH 4KUZL 3ZYJA 3QI9D 3UDWA 1E5UI 2ZCHH 2FQEA 1TV3A 3WUFA 1ZT1A 1E7UA 3GMPA 5FF7A 2VZ1A 4ZUTB 3DHDA 3VXUB 2OL3B 2Z1VA 3K81A 3UZJA 3KBSA 3U1QA 4WK9A 3QK0A 3Q8AA 5D7LA 1NC4B 1QNSA 5ERWB 1RALA 1NWOA 3VI3E 2GK1B 3K2GA 4A3UA 1IFHL 3NPSC 5DJXA 4N2FA 4WV1A 4A63A 3BVWA 2Z27A 5BMWA 3QCUH 2YPVA 3AQZA 4M3KB 5IW1A 3C2AH 1T2XA 4J6IA 3R7MA 3RNDA 5IJDC 3VWJC 1J8HA 5KETA 2NY7H 3BP5A 4FTVD 1BZ9B 2V63A 3R8BB 3TYBA 3HZVB 4IQLA 2XM2A 3HI6L 3HC0B 3MDJA 4ZJ9A 5EEWA 3NFNB 3PP3H 1GWJA 1LLAA 1WXZA 1GGIL 2R59A 4KH9A 2Z4GA 1FOBA 4UTCA 1OE2A 4LAZA 2X89A 1EP3A 1LP9B 4NYLB 1ZT7A 3MCLL 1AZUA 1A6AB 1C12B 5H1WA 2VR2A 2O4EA 1SXSA 3VGDA 1CLCA 2GK0A 3N42F 3PUUA 4QT5A 3HS0A 1OW0A 1G6CA 2A6DA 5F8RC 3IDYC 5F1UA 4WGHA 4MWAB 2IANB 1Q0EA 1MRDL 2JJVA 3IS0X 4LLAA 5CPLA 1TPUA 4FHKA 2GYSA 2D31A 4KHXL 2P8LB 5KYXB 4FXGC 1ZAGA 4NQCD 1LWRA 4HT1H 4GPNA 4ES9A 2Z29A 3DLQR 1QW9A 2PP7A 5HHQA 3LBOA 1U3JA 5F4XA 5DX7A 2DQCH 2QCEA 4X0KB 5EZIH 4OM1H 5CD3A 4NC1E 3QYMA 1D2KA 1TPXB 4YEFA 4FC3E 5GSVA 1YEDA 1DQQB 3MV9D 1U0QA 2F2KA 2I85A 2H90A 1SUHA 1IR2A 2CDGB 4LVBA 2YZRA 3O41A 5AVXB 2DN7A 3IWUA 3GSRB 3LQLA 5IM7B 4GAGL 4KWVA 1EGJA 4OIAA 2W61A 3ETSA 4OLVH 1TQVA 1C9SA 3QHTC 1A4MA 2W79A 1S9YB 1Q94B 3C0SA 4XQ6A 3LPFA 3WFEL 4YHGA 3KBVA 3LZNA 4JFFD 4TOQA 1EF3A 1FP8A 1W6LA 3IKKA 4GRMA 4NJ9H 4FYRA 2XH0A 2B1HL 1A4CA 2VWEE 4JQ2A 4Q89A 1U8JA 1QJWA 5FL0A 3CDZA 5HJXA 4JTJA 1JZDC 3I4KA 3M16A 3UJ2A 5EUOB 2RJMA 4JFQA 4HCRL 5MP6L 3MUGB 1CF1A 5EKYA 3ZE1B 1FXPA 4F37K 4FNSA 5JW4N 1YN6B 5DK0A 2Z26A 4JQIL 3D3VD 3HIJA 3BUTA 4RQQB 4PBEA 1J8VA 3AO0A 1GYUA 2HMIC 2CGZA 1VA9A 4XH2B 3H4GA 2WSRA 2HRHA 4PUEA 2ZZ3A 1L8NA 3C75A 1I6NA 5L4IA 1OJXA 4O51B 1E0UA 4BWWA 4Q6IC 2EDEA 1RQHA 2EXSA 3PDGA 1ZOXA 2CG9X 2FWOB 1AGCB 2WBJA 1AKJB 5LN8A 3BOVA 3QUZD 2NX3A 4FYSA 5H2BA 1MCSA 2Y62A 3FQRB 3MXVL 7A3HA 3CYVA 1EEUA 2PWFA 4QRFA 4GQZA 1C8XA 5AVNA 3O3EA 3A4JA 4I77H 1BM7A 4XNUH 1QFWI 3FN0L 3VDHA 3E2SA 3PBGA 3HQPA 4UAOC 3DX8B 4IBWA 3AS1A 2OG9A 4JFZL 3P30L 2ROXA 1J5CA 5I3FA 1RA0A 4WGKA 4DYKA 1BYDA 3BIAX 2NNFA 1HGYA 2EVJA 3L67A 1H3PL 4J3BA 1I8KA 3I9GH 3R0UA 1GA2A 5L8JB 1HCFX 2F74A 2F58L 4PJCE 2FMNA 4DWDA 1F3WA 4XTIA 3TSDA 1RPUA 5LA2A 3BMXA 1W72A 1UHVA 1B0IA 1VERA 4M24A 4XNDA 4MF4A 3F7JA 4R97C 3VXMD 3QPEA 2WMPB 4XBKA 4N26A 5D1QA 1F8TL 2XV6B 3GH5A 3UVAA 1F00I 1MLBA 3ALXA 5DJAA 5M1TA 3VFMA 1J0JA 2A1WL 4OSUH 4HLEA 4UTWA 1F86A 4ALDA 5F9WC 3BAXA 4LYQA 2PLTA 3NJIA 2AQVA 2DLIA 3N1GC 1HAUA 1HCVA 1PJ9A 4QEGA 3KLDA 1WYJA 1OLZA 4H25A 4M7KL 3O6FA 3HGJA 3ZYZA 1QYGH 2V5MA 1E3FA 1Q0YH 1UVQA 4QGTA 3EOSA 3LSBA 4GYPA 4TIMA 1FPTL 1XQKA 1HHJA 3L2LA 4HOZA 5E5UB 1K8XA 4Z7VB 5DUPL 2JJUA 1CI1A 3D0AA 1X1NA 3EAKA 5CZJA 2W88A 4NKOB 1NCWH 4PJAB 2XN1A 3B9EA 1AHWA 3ZDYE 4PJ8B 5FA3B 2R0KL 4C5YA 4DJFC 4M7LL 2H45A 3BICA 3L6FB 4YSPA 1OT4A 3T0VA 2BG5A 1RSFA 4WU5A 3BX7C 2K9UA 1V5JA 2BNRA 3KBPA 4PMUA 1QPNA 1ZV5A 1OD9A 2F38A 4JY8A 2WMGA 3QWQB 4B5ZA 3OKEA 4JD4A 2YSWA 1I2QA 5E5MB 3V6BR 2K9FB 1A6ZB 2CK2A 2XU2A 1UWEH 2DVXA 1OAXL 5K3VA 1Z89A 4S3AA 3G7TA 1DQJB 3VM7A 3CVHL 3TTOA 4UIKL 1KJ2A 1XIFA 2LU7A 2QPDB 1JPTH 3QDJB 5DMNA 2JEPA 3AWFA 1SLUA 3FU5A 2R15A 5INCB 5HHNB 2NV1A 5FCUL 4J39A 2YQ3A 1PZBA 4X8CA 4N0FB 3VFPA 1PDKB 4MMXB 1DBTA 5SWZE 1CUOA 4RZCA 4I6VA 3IGUA 4WO4D 2G60H 5GHWL 4NP7A 2X4UB 1E5AA 2IQTA 2X4SB 3T0EB 5D38A 2CO3A 3P8IA 1NPNA 3RFZC 2IPKB 5IEKB 4Q4PA 1KXVA 4NI8A 1R0AH 2QKFA 4AEIH 1LNUB 3KWWB 4LCUA 1GHFH 2HRWA 1LM1A 4PBGA 3RFAA 3QBUA 1ZHKA 3TT1H 4EIGB 2Q3ZA 5IIEA 1BVKA 1SJXA 1KNOB 4W9HC 5FUOL 5FEWA 1NBVL 4UQIM 5I73B 3BN9C 1YEWA 3TBTA 5IV2A 1X5KA 4NZTL 3GSWB 5EC1B 4TQHA 4N90E 1D7FA 3DOHA 3TWCH 2F54A 1PUDA 3SN0A 2Q3OA 1AH4A 4LPTA 3CU2A 2X4OA 3OVRA 1DBJH 2YD1A 3P9MA 4JLRA 3CLFL 2A7PA 1KGWA 3D69B 1MJ7L 3W7HA 5IMMA 1A4JA 3IVKA 5F0LB 1W0WA 3EOLA 5DURB 2NOYA 3BAYA 4H5SA 4B5WA 2Y7FA 3DX9B 5DRZB 2ZYSA 4HUVA 2Z92A 2AAVA 3W07A 2HQAA 2ARJQ 1DVFC 4H8HA 2GIMA 2FVNA 4IIEA 1NBCA 1UKSA 2DLFL 2LLGA 1FE8H 3JV5A 4ZFGL 5CPNA 4XMTA 3BEWA 1BQGA 2WHKA 3S96A 3N85H 4ZMZA 4K7PH 3NJVA 3CFDB 3PXHA 5BQ7B 1ONRA 1E4WH 3SRKA 1NDZA 1Z9PA 1XGUB 4GIPD 1RUAL 1YX1A 5DS1A 3CHCA 5DJCA 1X6LA 5CC3A 1CFSB 3CC1A 3GH7A 4K38A 3EWUA 1XLAA 3IJSA 1D5ZA 4F48A 5GRWA 3Q3GA 1IJ9A 4X4KA 5HHOD 5D9SB 3WMBA 2Y06L 4ODVL 3ULVL 1OEZW 2V37A 1ZLEA 4D9LL 1AD0B 2BVTA 5C0EB 4NQQA 3BQ6A 2NCEA 3EH5B 3OB8A 3QZWG 4HMCA 3QEQD 1AQDA 3V5DB 2OMUB 2Z1WA 2O61A 2CXGA 4UU9A 4AF0A 1S7XA 4OGXH 1XCTA 1OM3L 3N2TA 3TF4A 2P24B 4H04A 3B0PA 3ITYA 1BWWA 5I8KL 4UMBA 1MI5E 3WLLA 1D5MB 2VLME 2W9DL 3BPOC 4ELKB 1KB5L 2F15A 3U48A 2TRYA 1BBJB 4P4RB 3L3KA 2GUOA 1PTGA 4ZMYA 1TTBA 1U5VA 1T1YB 4ZMNA 1BJMA 2C4FT 2Y69B 3SCOA 3VH8B 3WLHA 3SFKA 1E27B 4IP5A 2OCFD 2VDLH 1M9SA 5ID0A 2FX9L 1GIGL 2DSWA 4MAYB 4L5ZA 4GZ7A 3LNHA 4E2VA 4OJEH 3U9UA 2HAZA 3A9IA 2WLYA 1LO2L 5JUVA 1CXHA 4M81A 3A6BL 5EA0L 5B39B 1UP2A 4OVXA 2R1KA 1S46A 1E9IA 2P80D 4XWUA 2H9AB 3DGCR 4K2SA 3GIVB 1AYOA 4PP1C 4M8UA 4KFMA 2O7SA 3BPCB 5EU6A 1VLXA 4Z2HA 4HMNA 3B6SB 1LQSR 1GG1A 3RPMA 1K7FA 4P9HH 2ZX6A 2ALAA 1B3VA 2VDKB 5EMUA 1OG0A 4XVJH 3CMFA 3DDMA 1T66D 3TZNA 5B7EA 4IU3A 3STGA 3L3OC 4XCEA 1HXMB 4G3YH 2HA1A 3EGSB 3KWTA 3TO4B 1FTXA 5AOZA 3ZWTA 4EKJA 5J1AB 3ALFA 1TENA 4OZIE 2L8AA 4ZS7H 3SPGA 1U8HA 2EKSA 1L7IL 4FQ1L 4G11A 3MLTB 1FA2A 3BLLA 4V1YA 2B77A 1I7TA 2R29A 2IOMA 2A6JA 1GEQA 3A4AA 3GK8H 4CADA 8TIMA 4L8BA 2A9MH 2IKJA 1VF5C 4GPVA 3NCOA 2VN5A 2WVUA 2DDXA 2GG1A 4E2DA 4ZMPA 4OIFA 3GRWA 3OA5A 1AQ0A 2KZHA 2FWSA 2GABA 3MXWL 2CEQA 4XNZC 3CDFA 1OTTD 3PREA 4Z77B 1KRCC 1N7MH 3CSYA 1QPXA 4WY7H 2ZX5A 4AYFA 1K9FA 1E30A 5GS0L 1PKMA 4GBXC 1T4KB 4Y16D 4G8IB 5F2IA 1F8MA 3NCYS 4A2RA 5A8NA 1HQ4B 2I9TB 3VZXA 3KW3A 3K7UA 3LRSB 2Q01A 1VGEH 2X4TB 2BS8A 3U7WL 3HVNA 2RJHA 4TUOB 1IGCL 1NIDA 4BQ2A 3MVSA 5C07B 4NHUB 1TQBC 5I1AA 1W8OA 5JZ7C 4AQEA 3L7EA 2NQHA 4YWSA 4MX7A 1P5UC 2ID5A 3GINA 3EDKA 2CJTA 2V9QA 3ULUL 3W88A 3Q05A 3CC5A 3KDMB 2CXKA 1KOAA 4D9RE 1A1NB 2VXTH 3C5SB 2FEEL 3L4TA 4OD3H 1YXYA 2BVPB 4P5TB 3F7PC 1V6XA 1A6VH 3M7FB 3S2JA 1RUSA 4QNWA 1ZS8B 3NP3A 3NDZA 4YCPA 5AG8A 1SBBA 4DGVL 4PJEB 4Q56A 4P2OB 2OMAA 1SXNA 4WFGD 3PVFA 3BSHA 2F19H 5JW5B 5I30H 3WHXA 1ZGLP 3ERPA 4IT1A 4H2AA 2NSOA 4OY9A 3ZHLA 4PUKA 4LPXA 4LEXH 4PI0A 4RZ4A 4R26L 2BVDA 3IV8A 4IUGA 4L0ZA 1JCNA 4F4RA 3H4WA 3H70A 2EEAA 1F3DH 3NQFA 4YR6A 3Q1EA 3FB5A 2XFFA 2A9DA 1HH9A 3LMJL 2F68X 3INUH 4OLYL 4TKWA 2AJYH 3PQYB 5JHAA 3IJDA 4P59H 3TEXA 1VGAA 1Z32X 4UV7L 2DQTH 3E6FA 3EYFA 3G5ZB 2OSLA 3VIGA 3TBCA 4H26A 5C0RH 4QTGA 4ZSUA 3U6RB 4Z7UE 2BERA 5EIIG 1MHCA 4ZPVB 2VNCA 3VTAA 4L8SC 4WNJA 4DZ8B 2Y5SA 1QMUA 1TFPA 4WUKH 3QXTA 1YBQA 3TWAA 3P84A 3N41B 5HVWA 2VZUA 5I1KH 3BSMA 3V0DA 3HPXA 3HPSA 4E41E 1RZFH 3MZGB 4G6KL 4JY4A 5JIWA 3BI9X 2D2JA 4P5UA 3F65A 2XJKA 3H55A 3WL0A 3U0PA 2VDNL 3AICA 4FFYA 3U36A 1KGIA 2ZUSA 3BG5A 5LG1A 2KQMA 1MHPL 3BSZA 4MTMA 2D7TL 1NARA 2VVNA 5CG7A 3R0DA 2Q0ZX 1ZRUA 4LCSA 5BZDA 4JPVL 2C1IA 2HH0L 4X8JA 5D7IB 3IAGC 5FA4B 2EJAA 4HWBL 5E08H 3K80A 2FVLA 4AMXA 5EZLA 5IVXF 5ENWB 1UUOA 3TFCA 1IGTA 2A77L 1RUQH 3VWJB 1TO3A 2D3NA 4OT1L 4JX0A 4JY6B 4ETYA 4X9FA 3WIFB 5DJ2B 2PDIA 4FNLL 1CBJA 4YXHL 4GRLC 4AZ5A 1ADWA 2E0PA 2PRMA 4GMSL 3BG3A 2XN9E 4D8ZA 4H9UA 3VXSA 3RWEB 4QIRA 2H26A 5CN1A 5HJ3B 1Q6QA 5BXRA 1KWGA 5E5CA 4XP4H 4UTBH 3FCTB 3ESMA 1A8JH 4WWKD 3V10A 4U1IB 3GGWA 1QNQA 3CWNA 3GKWL 4WQ6A 1POJA 3GHUA 4NO0B 2MQCA 3H9YA 1YTDA 4FA8A 4G9FE 2B39A 1OTUD 1GXEA 5CEZD 1ZLWK 4AG0A 2BP1A 1EWDA 2IH3B 5T3XH 1WDPA 4FXGB 4F3FB 1J8HE 4BFIA 4JRWA 4YHYB 3BZDA 3QULA 5AD0A 3PB0A 1I4FA 3KPLA 1EUTA 1SYSB 2YDAA 4KWSA 5AB1A 4FEMA 5BOJA 4NX0A 1AGDB 4NS0A 8CGTA 3MRCA 4MLIA 3NH7H 1NCUA 4LL9A 4OZHB 3HN3A 1B6DA 4E42A 1ZVHA 5DVPA 5K4ZA 1BFTA 1KRBC 1VFMA 2FMOA 4YSSA 5C54A 2X10A 1Q9LA 3DSFL 3UGUA 1KLGB 3JYCA 2CSPA 1K4GA 3BLIA 2NY5H 2XT1B 4R3SA 3RKDC 3OZMA 3UZYA 5CINL 5I8EB 2HLFC 4WI5A 3HG4A 1LL6A 2NUTB 4GX8A 1MZHA 1KB3A 4KCTA 2K1MA 2AQ3A 3RVTC 4ONOA 3U7BA 2ZX7A 3T3MF 1W3KA 4NPJA 2V6AA 1JPHA 1OCRB 3S3JA 2NXZD 4TVPD 2DRUA 1AZCA 1EF2A 1AIFA 3VFOB 4RX0A 2EYSB 4M6OL 2UZIH 3STBA 3UTSE 1TIWA 3ARFD 1JXGA 4PUJA 3VVVA 3DGRA 4GI6A 2YSTA 1SRDA 2J47A 5CP7B 2FEJA 4UM8B 4TMBA 4UCGA 3ZY7A 1XF4B 5CN3A 3PTQA 3QYSA 1RZJC 3PV6A 4FR1A 3SRDA 3D1MC 4X98A 3FRUA 1BVWA 1DTNA 3A6CL 4GOSA 1CT5A 4Q6YA 2IALA 3QEGH 5M7QA 3WD5L 4J28A 1JRHL 1Y8BA 4HKJA 5ICZA 4NQTA 1ITXA 4CCZA 1ACYL 2YBRA 1TCMA 5T8IA 2VGLM 3CAQA 1UBSA 4JM2F 3DBSA 3AG2B 5A6IA 1V54B 4LUSB 2IAMA 3P0XA 3HZKA 5TH2B 3KHQA 4Q6IB 2A74A 2Y22A 3KPPB 1AYRA 2F1AA 3SE8L 4PRHE 3SOBH 1XS2A 3MJ8B 1Z3GH 5DJDA 4EN3C 4DWSA 1DXEA 4QWWC 1NEUA 1JPDX 4OU1A 4LY4A 3BIBX 5FHAL 3W7DA 3BIKA 3UNTA 4JX4A 2MUCA 1QSEB 5BOOA 5PTDA 2ZZ2A 1EMTH 1SJEB 4E0RB 2BNQE 3RGBA 4F93B 5CZTA 2R9HD 4UTTA 4FULA 4E8CA 4XZ4A 1KIUA 3NQVA 4QRAA 2DQ6A 1HNGA 1G9NH 1FQ0A 3N12A 1R3JA 2CA4A 4PJXF 2C5DC 2R8SH 3PRZA 1ES0A 1VCVA 3VXRD 1I9CB 1PEWA 3I6RA 2PD5A 3N1AA 2Y5QA 5ILTL 5RUBA 4R7WA 4BQ5A 3MMTA 4RETB 1HJXA 3MREA 4PJCA 4OF5A 4MWFB 4DM2A 4L4TD 3HOJA 4YNYB 2QGDA 1A7PL 4NSKA 2YPVH 3RBSA 5FSDC 2EYRA 1B9ZA 2GK2A 1BXXA 3FDKA 4KTDH 3SY1A 2CKBH 2R2BA 3K4DA 1H63A 4IOSA 5D55A 2YC1B 1XFBA 6XIMA 5F9WB 4U6VH 4B5XA 1Q7ZA 4PBFA 4LLWB 4XPGH 4HH9B 5GZOD 1B3JA 1CE6A 2EIJB 2QGBA 4RRPG 4CSTA 1SFSA 1I75A 2WYSA 4U5IA 3H2AA 3H2EA 3CXDL 3PAJA 1XIHA 2WV8A 5I1IH 3IFLL 3K2IA 4IYKA 4D9QD 3I3EA 5L2JA 4A7UA 3U8GA 3C6LC 2J4GA 4MM1A 3WX7A 2VXVH 5IEHB 3S3GA 4GJ1A 5DVKA 3ARGD 1LP6A 3LLXA 1DQXA 4M0XA 1F02I 2PMQA 1JVOA 3TPKA 4GACA 2XZCH 3D50A 4Z0XB 2FJFB 2CRZA 3GB7B 4DVBA 4PRAB 3B2UD 3BL3A 3TBYB 5LO7A 2YDQA 3WNPA 3CFKA 3VOFA 2QEJA 5BXTA 3UYCA 3QJVB 3V7AE 2FFCA 5A7EA 2J75A 1H5BA 3X13B 3GMQB 3OXSA 4H8WH 3HBLA 5EUKA 1I9EA 1Q1JL 1W8EA 2ZXGA 3WEXB 2E74C 2E56A 1PKQE 1KT2B 3ZQXA 1EGJH 3ILPB 1T1XB 2XN2A 5AW1B 2I24N 3B4UA 3ZKMC 3WEOA 1OSZB 1HEHC 3ZRFC 4BFJA 3PL6A 2MFNA 2GDVA 3QPQD 4G7EB 4PTDA 3BP7A 5D1XD 4OJFH 4NNYB 1FN4A 3TJ4A 3O9WD 1B30A 3LRKA 3S1UA 5K9XA 5CSBA 4S11A 1TCRB 2DW5A 2XGZA 3G8EA 3BWUF 3HF3A 3N13A 2VKXA 4GMEA 3RLHA 3C5JB 1QR1A 4AISA 1MUWA 1NGWB 4PMNA 1HOCA 3GBMH 4Z1CA 5SWZA 3R4DA 1N5YH 1DN0A 1N8OE 3IIZA 1BYBA 2AK4A 3FSVA 3ITLA 2V17H 3W4RA 4FS9A 2FR4B 3ZJ8A 3PNWA 1IGJA 4IM8A 2HE5A 2X7VA 4KROC 3US0A 3B9VA 2DV6A 5HMDA 2YQGA 3MTXA 2PR4L 1LK2A 3NFSL 2OR9H 3GXTA 1H8OA 2VCOA 3WIHL 4QJ1A 2DZTA 4EXPX 4XRCA 2M8XA 3H7UA 3CZFB 4PG9B 4JNMA 1EAPA 5JQ6L 1OX4A 1AZ2A 4LL4A 1CFQB 5FF4A 1P1ZB 3DH7A 5PCYA 4E9YA 3VXTA 2GKIA 1W91A 3JUYA 4DY1A 2NXYC 5LGXA 3OMIB 2WO4A 4IKKA 4LLQB 4KO5A 3LPOA 4JN6A 2E67A 1OZUA 3S36X 2CIKA 1BQUA 2XKSA 4QCIA 2EG7A 3CQHA 1KJMB 2IG2H 3U9PL 2IKHA 1I7RB 1AIZA 1CLOH 2QZRA 4O50A 1E8WA 5CEWA 4XBEH 5HYSB 5BNXD 4OF0A 4RX4A 2FIQA 1ZGLB 3TN3A 1CZ1A 2VLKB 4X2PA 1HAWA 4G6JL 4LHUB 4LSUH 3OG3A 3F62A 2VX7A 4CW1A 1DVFB 2YKLH 1UG6A 2EZ0D 3IXAA 3U57A 1ZMYA 5GJMA 3PTMA 1H50A 2XZZA 2Y9RT 4TLTA 1OQXA 5DY3A 3LM3A 2NQ3A 5EORL 1I1AA 1GZGA 3GK0A 2F2HA 1GTNA 2F54E 3OBAA 3EO9H 1R3WA 2ZCZA 3VGAC 4A22A 5DQDH 1A0EA 3AIBA 4XZIA 5MEOB 5H94B 2GIYA 3QYQA 2WOBA 3MUZ1 3EUDA 1BDYA 5C0FB 1NM9A 1XF2A 1O5DT 1ILUA 4IMKA 1NL0L 4TTUA 3BKYH 1YMMB 3THAA 1GEHA 5JA9A 1PYWA 3U0TB 4I7VA 3E1F1 5F7AA 4Z2JA 1QEWB 1TZOA 3GJFB 4GXWA 3N2MA 3FQUB 3LS4L 4NZ3A 1BD2B 1N68A 5FUZL 1Z69A 4OCXH 2JLPA 5IHLB 4EE2A 1UR3M 4XP6L 3VYLA 3CHRA 2FH8A 3VXPA 1IKOP 1OM9A 4M8QB 4BFKA 1ADQA 4XC3H 5J6SA 4ANUA 1NMBH 3OSVA 5KEZA 1KC7A 1XSJA 5B4MC 3AYSA 3CUPB 1MI5A 3FFCB 5DHYB 3QO0A 1AFSA 3FT1A 4HEME 1II4E 1IIGA 4AZUA 1A25A 4L3EE 4PM1A 2AV1B 1ESWA 5CEYB 2IDSA 4F7PA 1JD9A 1J1OH 2H41A 3MJ9L 4YXKH 4R7NA 4UIMA 5KYWA 4PODA 3PHOB 2VC6A 5DRWA 2ADJA 4E9SA 2VDKL 2PDBA 4OZGF 5CPTA 1GY1A 5KS9B 1RUPL 1F6YA 2P42B 4PJIA 1O1HA 4AZHA 2ZRWA 1LUCA 5FAAA 2VXQL 3X2QB 4IKNA 4C1NA 2NY2D 4PU2A 3GHEH 4ZMXA 1MJJA 1DBAH 2RBLA 1FO0A 3UXIA 4FG2A 3HG2A 3PHSA 4IIDA 3L3OB 2FK9A 4MRCA 3FO2A 4L1XA 1NMAH 2X2IA 4MXVF 2OKOA 4W8BA 3L9YA 2WVSA 3F12A 3GG8A 5I1LB 2NX5B 1VB9A 1EXGA 2A6NA 3BC9A 4HS8L 5AAMA 1SBSL 4Y89A 3ZKNC 2QT6A 5J6GA 1RAMA 1EZ2A 3HU7A 4G6AC 4OT7A 2Y2TA 3R0NA 3FONA 2OEMA 1UASA 1MCJA 4OZIA 1GGBL 1KB5B 5E9DB 1UKQA 4MG4A 2JCCB 1X1ZA 3CQJA 3BQ5A 3HC3L 4G82A 4A2GA 1DBMH 1V7ML 3OF6D 2E4FA 3SE9L 4US6A 3MMEB 3PABA 1QLEH 3E9TA 4XNZB 3LQGA 3SYPA 1E15A 1JZ5A 3OYZA 4RAHA 1H0DA 4PTUB 4BK9A 4PB4A 2VTFA 3IRDA 5E9XA 5FW7A 3S9DB 3ENLA 3ERXA 2X40A 4GBXB 3E7JA 1BZOA 2R83A 4XI5D 3K6IA 1WFIA 3BVUA 5AZ2L 5E2TL 3EOAB 4MSSA 4ANKA 2CWXA 1KGXA 3CN3A 2ZUTA 1N2RA 4XZUB 3DHFA 5EYWA 2V3DA 2HTMA 4M7ZC 2AQRA 1A9VA 3KLKA 4AXWB 3RWDA 4LH8A 4W8AA 4M4RA 2UXVA 4Y4HB 1NUFA 2IDUA 4IRSB 2R69A 1KBGH 3CFIC 3QA3A 3DUUA 3OD3A 2FJUB 1JCVA 3TR2A 3QOMA 4B90A 1HHIA 5C0ND 4N9OB 2REQA 1AOZA 5LZLA 2IAAC 1ZALA 4PJ7F 3QORD 4UDTB 3FHEA 4GXPA 4A67A 3REWB 4U7SA 4GRWE 4N2IA 1KTKE 4WW1A 2KT6A 2F7QA 1E5BA 4FZIA 4KH2A 1U1UA 1U8NA 3VWKA 5AYTA 1I2OA 3WFHB 4HOMA 5JPNB 3W1ZA 2QELA 2GVLA 3J27A 4M1CC 3L3GA 2J4WL 2I16A 4BH7A 4F40A 3V16A 5I09A 3B3BA 1ED3B 2V33A 4AL8L 1AI1L 1H7RA 4F15C 1DXIA 4PGZA 2YR1A 3NM3A 1M7UA 2XKNA 3ZRSA 3PZTA 3AC0A 2Y7SA 5D7EA 1YEGL 3WO4C 4MVBD 3M17B 5IQ9B 2GJRA 4XKYA 2J8UE 2OYMA 4MNJA 35C8H 4JCWA 32C2A 5HMEA 3MV7D 2ZUMA 4Z42C 5DC4B 1P48A 1ITCA 2NWRA 5FSEC 2H9GA 4UANA 2Y3AA 4FKHA 2E4TA 3ANUA 1P1VA 3CVCA 3EF4A 3MZ2A 4HHMA 1DSFL 4YTRA 3CHFA 1A9EA 5LUMA 3ELAT 1MCOL 1GOFA 1NWRA 5EEUA 2PI6A 1BQLH 4MMWA 3LKNA 5DHVA 4O4YH 1MJUL 1R9YA 1GKOA 3W1LA 2LU5A 1TETL 4QCFA 2EDDA 5C0BE 4DBUA 4I0PD 1UJPA 6A3HA 4KI5E 1NBYB 3B2DC 3TN0B 2DZBA 4AW4A 2BDNH 3S7GA 1K9TA 1OCQA 3MHUA 1GTEA 3E2VA 2YAHA 3CL7A 1RCYA 1E71M 3DTXA 3L5XH 1E4HA 1PSKL 3TQVA 3AHZA 2QADD 3JXAA 3RIKA 2QCFA 2BVQA 1JXKA 2CJUL 4DXVA 3NIGE 1QI2A 1XIWD 2ESVA 4S23A 4QXWA 1SJMA 2NY3C 3VKAA 4EOWL 3VD4A 2ATMA 4HXAL 3VSUA 3PU7A 5BVPL 3T4AB 2CDEB 3WKNA 4AL8C 1LK3H 4FNTA 4AZCA 4RISH 2R23B 3DUSA 3NL2A 5MHSE 1A22B 1USQA 4XCYA 5C2BL 1N26A 2XN9A 3T2PA 4MZ3A 2Q3AA 2KL6A 1ETA1 4JRYD 4XAKE 2I32A 2J78A 2YX0A 4WKXA 4P46A 4XAWH 2CM5A 4U5KA 4I88A 1YTEA 1O6IA 2FJKA 3P7YA 2MHAB 3T9PA 5KN5B 2AJUH 5GGRB 3VFCA 1Q8MA 5JLZB 1ACXA 5EFIB 2DJUA 4N9GB 1AGBB 4GUHA 3BVVA 3GMRA 4EUPG 1BREA 4I4WB 4G9FA 1WDSA 2L7QA 4JDZA 1G7MB 4Y9BA 1MUCA 4YL4A 4GOAA 4S1DD 2EACA 3D30A 4QRTA 4LLMB 2YD7A 5ID1A 4AKQA 1ECEA 4UNKA 2VDNB 1AR2A 4IQDA 3O6ML 3GNMH 5AVHA 3VXSE 1WKYA 3QV6A 1KYFA 4L9LB 12E8L 4BXSV 1UKTA 5A16A 4Z7UF 1CLKA 3HQNA 3JBG7 1HL4A 1NANI 3OKDA 4QJ5B 4FXKC 4N42A 1TV7A 1J5TA 2ZBTA 1E3XA 2BLFA 4CQCA 4H7VA 2GQ9A 3ARBC 2G3IA 4OFIA 5IR1A 3CHQA 2AVFA 1KYUA 4LK4A 4LSPH 3R7RA 2DSZA 1Q6OA 3KHDA 2G2NA 3NZGA 1RH8A 4N9BA 1ORQB 5DK3A 1BPLB 2R94A 2YPKA 2E1DA 3W86A 5C0JB 5BS0B 1J8RA 4OLWL 4UQ2B 2EJ1A 1IM3A 3QC0A 2PR9A 3ASOB 3VFGH 5IBXC 2WQXA 5T3ZH 2GY5A 4Y2DA 4R4ND 1FI8C