1RP8A

Crystal structure of barley alpha-amylase isozyme 1 (amy1) inactive mutant d180a in complex with maltoheptaose
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLAFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type 1 isozyme
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rp8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rp8A01
3PTQA 4RE2A 6TAAA 1UQYA 4Q22A 5E9AA 4P8WA 4ACYA 1UR9A 2ZUTA 1E40A 4NRRA 4AIOA 5E09A 4BF7A 2DH2A 4WKAA 1WPCA 1E73M 1MW3A 2X0HA 5IHSA 2V3GA 1Q6CA 4C7FA 1CLXA 2WPGA 4JFVA 5CGTA 3LPFA 2E3ZA 1CGUA 1CNVA 3FY1A 3VD3A 4JZ5A 4OOUA 4D71A 1Q6GA 4PTMA 1US3A 4U5IA 2WZEA 2BY0A 4HA3A 1DWIM 4ACZA 4H8VA 4OBSA 5I6SA 1LL6A 3CHEA 1Z32X 3CHCA 3N1AA 3F5KA 5A8QA 4LXFA 1JF6A 4UQCA 1B9ZA 4MADA 1CXLA 4IPLA 5BXPA 4D6CA 2D3NA 5BXTA 3D50A 2CETA 3NDYA 1TVPA 3FNDA 1PS3A 2Y8VA 3T0BA 3EJSA 2QHAA 4E8DA 2WC4A 4X0NA 1E9LA 3W38A 1E6RA 3TA9A 3O9NA 1WDPA 1JIBA 2VRQA 4JHOA 1BVNP 4UQEA 3VX1A 5A94A 1CXIA 2E8YA 1C91A 1EH9A 1GQLA 1UH4A 3WIJA 4FLOA 3CUHA 2PWFA 2JALA 2FE0A 1B1YA 2EPKX 3BVUA 1BYBA 3SCRA 2XJ7A 1M7XA 4AISA 1ISZA 4CCEA 4PN2A 3GBDA 3ARYA 2WZHA 3MUAA 1UYQA 3VGDA 3I3DA 2J74A 2WWDA 1FOBA 4YHGA 2WVTA 1VENA 1GOOA 4BA0A 2F7PA 1SR0A 4MTVA 2ZX5A 5A95A 3EDEA 3VMNA 1MXDA 1G0CA 2J4GA 2QV4A 2W66A 2OSYA 2F7OA 2EQDA 1VFFA 2DSZA 3CZEA 1WDRA 4FNQA 2ZOXA 4TTGA 1JFHA 4W89A 1W9UA 2WC7A 3PTMA 1JZ7A 2DQXA 1RP9A 4AZ5A 1BAGA 1H4PA 2JFEX 4H2CA 1E6XM 4HOWA 4PMVA 1H0IA 5I77A 1MW0A 3MMDA 3N17A 3EJTA 1XRVA 4GXPA 3AMDA 1C3FA 4TVCA 1ZS2A 4U5KA 1Q4NX 1UD2A 1KBBA 2E4TA 2VOTA 4CUCA 2PBGA 1HT6A 1UR0A 2GJXA 3SUSA 3VGEA 4OOZA 4TX8A 4A3HA 2CKRA 4UFKA 1HJWA 1CXKA 4E8CA 3POCA 4AZCA 3WD3A 1ECEA 4P7RA 1E70M 3WBAA 3WD2A 3A4WA 1VIWA 4D6JA 3SCSA 1VFUA 3WUFA 4CGTA 2G3NA 4M56A 2XM2A 1LF1A 1Y7VA 1E0WA 4RL3A 2WB5A 4GZJA 3IAPA 1KTBA 5GPRA 4P8VA 3VD5A 4BS0A 1E71M 2GSJA 1WB0A 2VZSA 2OSWA 3ZT7A 5A8NA 4HZ6A 3RM8A 5LA1A 1GQKA 2XVLA 4AD0A 3D4ZA 1R7AA 2J25A 2Z1KA 4W86A 1OD0A 2A3AA 5D8WA 4MAVA 1VFOA 1JNDA 3MV01 3GYCA 3N04A 1JF5A 1B3VA 4AD3A 4A3YA 2VX7A 3SCUA 3W25A 3VX0A 1ZJAA 1H3GA 3RJXA 1HP4A 3ZSTA 5CPSA 2VZUA 4LQ1A 5LA0A 3CGTA 4B15A 4TUFA 3BMWA 1JZ3A 5A6SA 1OGBA 1TUXA 4XUYA 3TTQA 3WDPP 4PTXA 6A3HA 1QNQA 2ZX9A 1JDDA 2WBKA 3M07A 1UH2A 3EDJA 1QI2A 2EEXA 3NSNA 1AVAA 3WEOA 2QPSA 2YFOA 3ARZA 4MNKA 1H09A 4PMXA 3UG4A 1GUVA 1E0VA 3MSGA 5IFTA 1C92A 4B3LA 4ACZB 2A3CA 2CNCA 1NOFA 3QHNA 3WNLA 1BG9A 1V0NA 1CBGA 1SMAA 2EXOA 2CYGA 2UY5A 3CMJA 1R34A 2TAAA 2OWCA 1DP0A 3AMGA 3UR8A 1CGVA 1ZL1A 4UR9A 1DWHM 5TD4A 5A3HA 1GNXA 3M46A 3D4YA 5I5RA 1QW9A 5ECUA 1SFSA 3W29A 1UKTA 3M6DA 3AHXA 1W9BM 1BG4A 2GK1B 2GFTA 4QLKA 3H54A 2J7FA 1HNYA 1JYXA 4H7VA 1XCWA 2Y5EA 2D73A 2J7GA 4GQQA 3AI0A 2WC3A 4PYSA 1GJWA 3EMQA 3AIWA 2OYMA 3U7BA 3GM8A 1V6YA 3MS8A 3L2LA 4QDMA 3AJ7A 4MNMA 5BRQA 3UR7A 2VCBA 5LA2A 4PUDA 1RD6A 1UZ1A 1NP2A 2FHBA 2ZXAA 3AHTA 4Z2KA 5ABFA 3AHVA 5CQ1A 3GZAA 1UWRA 2WMHA 1E6NA 5DO8A 4E2OA 3MU7A 4L4PA 2VRKA 3WNNA 1J10A 1JZ8A 1XD1A 4UQ9A 3AZSA 1MYRA 1UWUA 4OZOA 3DYPA 3ZIZA 2UY2A 4BQ2A 4MB1A 1DWAM 4WK9A 2V3EA 3AIRA 1PX3A 3T2OA 4UFLA 3BVWA 3LXCA 4MB5A 4OGZA 5CLTA 4HA4A 2YBUA 1OIMA 1H1NA 4JHZA 1V6UA 4N42A 2F1BA 5DT7A 4F8XA 3MKKA 1K9EA 1E6PA 3HG5A 2PWGA 1UD3A 1MW1A 2YL5A 2Q8XA 3CTTA 3AIQA 4F9DA 3IANA 3VIOA 5AC4A 3TONA 2AOSA 2VC9A 1HJXA 2WW5A 5M03A 2W5FA 4HZ8A 4M8UA 3F5JA 3GNPA 5I79A 4J3VA 3KLLA 1V3LA 5D9MA 1QPKA 1KR1A 3VSUA 4W8AA 5IHRA 1VJZA 3A22A 4FLSA 3RCNA 1UHVA 1R7OA 2BV9A 4PMOA 1LG1A 3GXTA 1HP5A 1GOKA 1J9YA 3VGHA 2WCSA 2A3HA 1J12A 1GVIA 3LXBA 1UWQA 3DX3A 3KL3A 2XIIA 3W28A 3L4ZA 3ZO9A 1JI2A 1KXVA 4WLCA 4CD7A 2DSKA 2AMGA 3S6TA 1I1WA 1PIGA 4MDOA 4BQ4A 5E6YA 4FNRA 5E1QA 3OB8A 2OWWA 1UR2A 3CZLA 4HMCA 4KGJA 3EYPA 1W1VA 1WZLA 1N82A 3WDRA 3SUVA 2WKLA 4NZCA 2G3MA 1WCGA 1WO2A 1BGAA 1LL4A 3DDGA 1CGWA 1C90A 2PC8A 4WSKA 4AZHA 1HN1A 3VM5A 2VZVA 3CLWA 3D51A 3AS3A 4GO8A 5D9PA 1XSJA 3GXIA 4J3SA 4FF5A 1VRXA 1SZNA 3ARRA 3AMCA 4DWSB 1E1FA 1DEDA 2YA1A 4FNTA 1TFVA 2CITA 3WSUA 4PMQA 1V6WA 1H11A 2VQTA 3PZIA 1HTYA 3L4XA 3WNPA 3GH5A 5I78A 3F5LA 1HKKA 3PZOA 1QVBA 3BLPX 2IXVA 2VZTA 3L4YA 3WH5A 3VGFA 1IZJA 2VTFA 3KE0A 5CZKA 1W1TA 4CKQA 2JIWA 3MMUA 4H8UA 4W7WA 2O9RA 3WH8A 3FW6A 3WQWA 1WE5A 5CJ5A 1W1PA 1NP0A 5DT5A 1ZB5A 4C7DA 2XN0A 1QI3A 1EOKA 1ITXA 3MANA 2CBJA 3W82A 4DM2A 3IGUA 4OKDA 4UOZA 1FA2A 2CERA 1XCXA 3I3BA 1EHNA 3W24A 2YLLA 4MPKA 1CGTA 3ARXA 3WEMA 1GW1A 1UR1A 4AZGA 3QHOA 2BXZA 4XV0A 4XX6A 3VSVA 1UKSA 1QX1A 1PX4A 3LRKA 5LYRA 3JUGA 5DEZA 3SCOA 3WELA 4Z2GA 1OCQA 3HG4A 3A4XA 1JFXA 1RPKA 1EIBA 1BGGA 3SEPA 4HU8A 3A6OA 1J11A 5IFPA 3WF2A 1W1YA 3WQ5A 1UD6A 3SUUA 2NT1A 4F66A 2ZIDA 3BUBA 4DO4A 2BHYA 2J47A 1U33A 3LXAA 5EB8A 3AISA 4CN6A 3EJPA 3MUIA 5BROA 3PZGA 2DPEA 1WNOA 1QNRA 1RH9A 3PZUA 2D0HA 3WN6A 5FD0A 1XSIA 5JBDA 4AZ7A 3AQUA 1LL7A 1TMQA 4GO9A 5E6ZA 1XH2A 3CHFA 2JIEA 5BXSA 3AROA 1ODUA 1E0XA 1O6IA 1KWGA 1MQQA 3RDKA 1LG2A 2PWDA 1EA9C 2X2YA 3W37A 5FCZA 3ZR5A 3WF0A 3ARSA 3GXPA 2O92A 5GQBA 2ZUNA 2ZX8A 3KLKA 2OWXA 5D9OA 2DT3A 1V3IA 4GI9A 4GIAA 1MVYA 2BY2A 1BLIA 4AZ6A 1OB0A 3AOFA 1IT0A 2DT2A 2EJ1A 2PBOA 4WF7A 2WYSA 4FMVA 3J7HA 3TP4A 3FHAA 1NARA 3VIKA 3BUIA 5CPQA 5M5DA 4M29A 1HL9A 4GZEA 2CPUA 4GPNA 4AEEA 3PZMA 2WLYA 2PF0A 2WCGA 2BXYA 1H0GA 2DT0A 1KXQA 4UCFA 1EDGA 3WH6A 3AS0A 1GCYA 4JKKA 3A4AA 2XN2A 5A2AA 2GJPA 4S3KA 3WUBA 5HNNA 1LLOA 3GBEA 2W62A 1PJ9A 3WL0A 2XUCA 1ZBCA 4U3AA 4EKJA 4JAWA 3THCA 4DUWA 3QGVA 1DTUA 1V6XA 3AS2A 3LPOA 5CGMA 4UZUA 1E3XA 3BCDA 4M80A 1JYWA 2F7RA 5BYWA 3LX9A 1UOKA 2WAGA 5I24A 3WH7A 4JKLA 1MFUA 1L0PA 2VQUA 2D23A 1BVZA 5EBAA 1E6SM 4J3UA 1HJVA 5I3DA 3K8MA 3UG5A 4DO5A 3G6MA 2CBIA 2GK1A 4CD4A 3L4TA 3CH9A 1CYGA 2VT0A 3BVVA 1PX8A 1R33A 2VZOA 1JZ6A 5D8ZA 4YPJA 5JBEA 3IAQA 3RM4A 2BS9A 3BAIA 3T2PA 1TQWA 4PMRA 1ISVA 1HJUA 3ZJ8A 4V27A 4WIWA 1OGSA 2YJQA 3W26A 1HKIA 4GZIA 5F7UA 3OA5A 1JYNA 4P7LA 3WL1A 1E15A 1ZJBA 5A6MA 4CVUA 4V28A 2VO5A 3PZNA 2WK2A 1GHRA 4P7OA 2A3EA 3POHA 4URIA 1EDQA 1UZ4A 5HXMA 3LPPA 3ZOAA 2YA2A 2V3FA 3N18A 1VB9A 3EDDA 1QOXA 4AIEA 1CENA 1OGGA 2W4XA 1I75A 4NZFA 1H49A 2D0GA 2FYVA 2DDXA 4UQAA 2J7DA 1UD8A 4JFWA 4H04A 2WKGA 2WMKA 3WMSA 1GJUA 1D7FA 5AY7A 5FL0A 1E55A 3T09A 3SUTA 1OBAA 4UTFA 3BCFA 4TTUA 4CU8A 3HU7A 2EACA 3GXMA 3ARTA 3APGA 4U3CA 4DUVA 2J7CA 3AYRA 7TAAA 4AMCA 5KEZA 1M04A 1CEOA 4OBRA 4D1JA 1B2YA 1Q6EA 4DWSC 2FH6A 5E0CA 3ARQA 5BXRA 2V3DA 3WQ8A 3VMPA 3N12A 1UQZA 4DWSD 4ZENA 2RGLA 1OT1A 2BFGA 2ZICA 1E4IA 1P6WA 4CU7A 3MO4A 2OLHA 1HVQA 3UEQA 4P8UA 2BVDA 2Y2WA 3IJ9A 2GVYA 4QCEA 2VX4A 2XGBA 2DH3A 1JYVA 5HPCA 1CPUA 4QAWA 2BY1A 3O6AA 1TQTA 1W3KA 4KGLA 4MB3A 1KQZA 1TR1A 2BHZA 3HMCA 3OLEA 3SCQA 1B3XA 2J8FA 3N13A 1F4HA 1XH0A 3KZSA 4M24A 3A47A 3MI6A 1G9HA 4OUEA 1MFVA 2WMGA 1ISXA 2D24A 3NSXA 1HL8A 1EGZA 4NX0A 1FFRA 3WQ6A 2XIBA 1TQSA 2G41A 4TX6A 2J79A 4IUGA 3KEHA 2QPUA 2X1IA 2C7FA 3BSHA 2WVSA 5GNYA 1UH3A 2VI0A 4FLRA 4H8HA 3TV8A 2WZIA 2E40A 1G5AA 1G94A 4ATLA 5GNXA 3FXYA 4Z2HA 1QWNA 1QWUA 4X0VA 3VD4A 4RE4A 5M17A 4DWSA 3AICA 4UFHA 5A8OA 3VIHA 5IXEA 4F9JA 2VL4A 3D52A 2G3JA 2D20A 3WDIA 3SCPA 5FL1A 4PBGA 2PB1A 1VBRA 1FH7A 3VIMA 5A6AA 1XYFA 1JZ2A 4AD5A 4W93A 3N15A 1UASA 2DSVA 4IPNB 4LX4A 4W85A 2WXDM 2W61A 1B90A 4ZFMA 3VD9A 1OIFA 3FN9A 5A8MA 3GTNA 3VIGA 3UESA 4NXSA 1W32A 1TQUA 1FP8A 4AWEA 4EE9A 4CN4A 1J0JA 1EHAA 2XGIA 4UFJA 4Z2LA 1M53A 1KGWA 1HIZA 3B9AA 5HOSA 4D6FA 4AYGA 3WD4A 3ZJ6A 1XH1A 2OYLA 4CU6A 2FGLA 4UOJA 4M81A 4MAZA 1B3YA 1UR4A 1HXJA 1EO5A 1OT2A 2W91A 4N0RA 1UA7A 1DWJM 3WH9A 4MB4A 1G1YA 3GH4A 3H53A 4QCFA 3T08A 3SCNA 3ZQ9A 2OW7A 3PBGA 3DDFA 2XG9A 1QI4A 1NWRA 4B9ZA 2VRJA 1LWJA 4CD6A 5JIWA 4EAMA 2VCAA 2JEPA 1U2YA 1TA3B 3IK2A 4A4AA 2X8RA 2X09A 3BLBA 1SYTA 2IUZA 4AIUA 3AXIA 3CBWA 2BVTA 1JI1A 4BQ3A 3WQ4A 2NSXA 4UFIA 1ISYA 5D4YA 1HWWA 2FDMA 3VSTA 4BQ5A 1R46A 2VR5A 3LRMA 4PTWA 4KRUA 2ZXDA 3EJQA 1JG9A 3VGGA 1JNEA 1QNSA 3VOCA 4TXEA 1JD9A 3DHUA 1T0OA 6CGTA 5I0DA 2WHMA 3U7VA 3RMEA 4X9YA 1V6VA 4CN1A 1NOWA 2F2HA 1QNPA 1KFWA 1HJSA 3HZ3A 3BSGA 3WUGA 4UQDA 3AXXA 1L8NA 5DFAA 3ZMRA 4P8XA 4U2YA 4ATDA 2D2OA 3CC1A 1XYZA 2E0PA 1UWTA 5CG0A 3K4AA 2ESCA 3OLGA 1QI5A 3AMLA 4Y7EA 1CXFA 1C8XA 3SUWA 4TVUA 3BAYA 1K9TA 1JXKA 2ZUUA 4GI8A 4AD1A 2DSUA 3CZNA 1CLVA 1C8YA 1CZ1A 4UOQA 3A5VA 5A69A 1W3LA 3CMGA 3MUZ1 4UQBA 1E5NA 1MQPA 5D9NA 2O9PA 3WDHA 2YIHA 3WQVA 3AS1A 5A6JA 1TZ7A 1M03A 2WHKA 1HJQA 2X2IA 3MV11 1US2A 2YOCA 1MWOA 4B9YA 2WMJA 2UY3A 1UG6A 2W63A 3KL0A 3ZT5A 5DF0A 3CUJA 4OIFA 3OZOA 5BWFA 4UNIA 2ZUMA 4P7QA 3IJ8A 4OJYA 3WY4A 1MXGA 1NH6A 4MNJA 3K8LA 4D6IA 1BFNA 1VF8A 3BMVA 1VEOA 1PEZA 3WNMA 2A3BA 1D3CA 3BXWA 1TVNA 1W2PA 1W9PA 1PAMA 2VX5A 3SCWA 1EOMA 2WVVA 3I3EA 4Q7NA 2DSWA 2VCCA 4WJXA 1V02A 2WMIB 4NF7A 3DYMA 4W88A 2Y8KA 1R85A 3VDBA 1C7SA 1QHZA 2YDSA 1E4LA 4MJ4A 2QMKA 1FH9A 1V02E 1FHLA 1R75A 2GDVA 3ZR6A 4PMZA 5EFDA 4D1IA 4PSRA 3LMYA 1CGYA 1Q6DA 4WSJA 1XC6A 1R87A 5HBFA 1FHDA 1UD5A 1VBUA 5CLWA 3L4WA 1PZ2A 3G6LA 4K68A 3RM9A 3UETA 1V3JA 2PWEA 2F7QA 3ARVA 2MANA 3N9KA 1NWTA 2JF7A 2BVYA 4W87A 4JL2A 2CHOA 4QFUA 1KGXA 1BF2A 2XM1A 3CUGA 1E43A 3GXFA 1UKPA 4ZXOA 3WD1A 4AC1X 4W8BA 3UG3A 1WZAA 2XPKA 3W6MA 4KMQA 1GVYA 3BVTA 2BY3A 3DHPA 4NZJA 3OG2A 3VILA 3ZJKA 2YL8A 3NCOA 2EABA 3DX1A 2QF8A 1FH8A 3BVXA 3VDHA 3UCQA 3OLIA 3SCTA 2G8ZA 1FP9A 2F1AA 3WDJA 4J7RA 2WCAA 3EJUA 4AYSA 3BH4A 1J0HA 2WWCA 8A3HA 4J3TA 1G01A 2XVNA 1GPFA 3D3AA 2ZUWA 3A21A 3SURA 1A47A 2QMJA 2ZXQA 3ZJ7A 1K9DA 4Z2JA 1HX0A 4GKLA 2DGAA 3MMWA 2J77A 1PIFA 4PCSA 2EO7A 4PMUA 1WDQA 2ZUSA 3CUFA 4C7GA 3DYOA 2IGTA 2IXUA 1E4MM 3TTOA 3VDAA 3KL5A 1TG7A 3RIKA 1CDGA 3VU2A 3O2LA 1OWQA 1C93A 3NDZA 3PTKA 2CKSA 3WNOA 4NXKA 1R47A 4W5UA 3WF3A 1GOWA 4PRWA 3L4VA 1WKYA 1UD4A 2CXGA 2WBGA 1KCLA 1H41A 1XD0A 5BRPA 2EBNA 4R27A 1F4AA 3K1DA 2ZX6A 2D0FA 1C7TA 3BLKA 3WDQA 1QBBA 3WKZA 4FNUA 4YHEA 1HKJA 3NSMA 1QW8A 3VMOA 3QOMA 1VFMA 1QBAA 3VUPA 4JIEA 3IJ7A 1ESWA 3PZVA 2VJXA 2WANA 3AFBA 1W3HA 4AW7A 1E6QM 3ZSSA 2VNCA 3FAWA 1KQYA 3ARUA 5EFFA 4NI3A 3M7SA 2X05A 3W4RA 2J62A 3WEZA 1HXKA 3T2QA 3WY2A 4UZSA 3AYSA 3B8SA 3GDBA 5EMYA 5I2UA 1H5VA 3AZRA 1BYAA 1GHSA 1X1NA 2DIEA 1W9DM 4HMDA 5HDRA 1JD7A 3W27A 1VEPA 1X6LA 2PWHA 3PHAA 3BUPA 1E5JA 4XZWA 3HG3A 3NUKA 1UR8A 3WMCA 1UKQA 3S5ZA 4Z2IA 4ZXLA 3SCVA 2D22A 5I23A 4FNPA 1K9FA 3K4DA 2QLYA 8CGTA 3ALFA 3GH7A 2WVVB 1R8LA 1VEMA 1IZKA 2ZWYA 2YBTA 2OSXA 2CCRA 5C71A 2OW6A 3BAJA 1KBKA 1B0IA 4AMWA 4HOZA 5IDIA 1E3ZA 2BHUA 4XZBA 2EPLX 4MJ2A 1W9XA 1KGUA 4QP0A 3B9EA 2YKKA 3H55A 5BCAA 2X2HA 2VVSA 3S2CA 1CTNA 4JL1A 3VGBA 3OLDA 3EMZA 3F4VA 2E8ZA 1DWFM 1WP6A 4JFUA 3T0AA 2ZXBA 4RE3A 4IM4A 1CXEA 2VUYA 2CBUA 3ALGA 3HJEA 3GNOA 5FIPA 2YL9A 1U30A 1JAEA 1TA3A 1EQPA 2GDUA 2WNWA 2AAAA 2D3LA 1JZ5A 1TQVA 3W81A 3KWXA 3TTYA 3U5YA 2D1ZA 3VNYA 1GOQA 1HKMA 4MNLA 2CBVA 2O9TA 3E1F1 3DX4A 4U31A 4HPHA 4QLLA 4DO6A 2W92A 2EPMX 2Z1SA 3B9DA 3WFZA 5M3WA 1OINA 3VTRA 3CUIA 1B3WA 1JDAA 2XVPA 3U57A 1ISWA 2EAEA 5CSYA 1E4NA 4PTVA 3LPGA 3WF1A 3BUDA 5E0FA 2XFYA 1VJSA 3OBAA 2WM0A 3OGVA 2GJRA 1EDTA 1MQRA 3VINA 1KWKA 4AEFA 2XSBA 3VPLA 3N11A 2DT1A 5ABHA 2XFFA 1OSEA 4NRSA 2XTKA 1OM0A 2WHLA 2E9LA 2J7EA 1C8QA 5A8PA 1UKOA 3AMKA 3A23A 4MDPA 4NSBA 3VD7A 2UWFA 3MUY1 2X2JA 2EADA 4CD8A 3II1A 2RGMA 4PEEA 9CGTA 2YLAA 4AZIA 4F79A 2EPNA 1ODZA 3VIJA 3W0KA 5JIPA 1W2VA 1J0KA 3PN8A 4QLJA 1JAKA 3TTSA 1NM9A 1LQ0A 3CIVA 1QHPA 4HZ7A 3PZ9A 1V08A 3VO0A 4GQRA 4GI6A 5CSUA 1KCKA 2V5CA 4J27A 3WBEA 1TCMA 1GQJA 4JCLA 3AXHA 2GUYA 1WAWA 1W91A 3EDKA 1SMDA 1EQCA 1HF6A 1YQ2A 2HISA 4PUEA 1S46A 1PPIA 1I1XA 3PZTA 4BCEA 1EO7A 3ECQA 3WNKA 1W9VA 4FK9A 4UFMA 4D6DA 1XV8A 4IISA 2F18A 1R86A 3WMBA 1BYCA 1AMYA 1CWYA 2WMIA 2V38A 4W84A 3GNRA 3OZPA 3WY3A 4GINA 1JXJA 3AHYA 3HN3A 5GNZA 2UY4A 5A1AA 5AYBA 1IV8A 4HTYA 2V5DA 4LYRA 4HP5A 4FNSA 1H2JA 1X6NA 5HPOA 4P7NA 2J7BA 2F8QA 5A6BD 2VURA 1V3MA 2B31A 3CHDA 2G4FA 4W5ZA 1BPLB 3VIIA 1B30A 4PCTA 1QNOA 2VX6A 2YDQA 3EBVA 5A6LA 3BAWA 2XVKA 3HG2A 1PBGA 1FFQA 4AXNA 2W67A 1GQIA 4D6GA 5JUVA 2XSAA 1UWIA 1W3JA 1AQHA 4E4PA 7A3HA 3BC9A 3UERA 3AIEA 4CVWA 4PMDA 2HVMA 1TE1A 1BYDA 1XGZA 7CGTA 3CZGA 1NWSA 4M1RA 1NOUA 3BAKA 4M82A 1NQ6A 3L4UA 1M01A 2WHJA 1ZU8A 4U33A 3RO8A 3DC0A 2VMFA 4U2ZA 2ZE0A 4KWUA 4KRTA 4BZYA 1J0YA 2WVUA 1B31A 4LYPA 5CPTA 2FH8A 2JEQA 3CZKA 3CZSA 1BQCA 3GXDA 5E70A 2FGZA 2VVNA 1WZMA 1E56A 1JL8A 3WY1A 1GOMA 3NIYA 2F61A 5JBFA 4EANA 1QHOA 3PZQA 5ABEA 1GORA 1AQ0A 2YA0A 4HOXA 3ARWA 5A6BA 2FHFA 3AIVA 4J28A 4W8LA 4DUXA 5FKYA 1HVXA 3EDFA 2XWEA 2Y24A 2C8NA 1GOIA 2XFRA 2GJXB 1J0IA 1XSKA 3VIPA 4YN5A 1VAHA 1O7DC 2WSKA 1OD8A 1Q6FA 2XHYA 3ARPA 4JCMA 3NYDA 2YDRA 4AZCB 2CESA 1BSIA 1KB3A 1XHGA 1ZBVA 4CD5A 3D5HA 4HU0A 4H41A 4AMXA 1CXHA 4J3WA 2DEPA 1LJYA 4CCCA 4V2XA 3K46A 1V0MA 1KXTA 1E72M 3QOKA 1ZBWA 5A2BA 5KZ6A 2ZX7A 3AHZA 5ABGA 4TVDA 4ZEPA 2OYKA 4HMEA 1CGXA 3T0DA 1CECA 4JFSA 3OIHA 2E9MA 3ZM8A 3DECA 2BNJA 1ITCA 3S5YA 1BTCA 2JE8A 2EPOA 1WZKA 2XWDA 4WKHA 1J01A 4PMYA 2Y4SA 3A24A 4PMNA 3U5UA 2CIPA 1KXHA 2J8GA 1V3HA 2J75A 4D72A 2C0HA 3AZTA 3VM7A 4D6HA 4KH2A 4AZBA 3LRLA 2YL6A 1KTCA 1CIUA 1E6ZA 2CHNA 5AC5A 3L2MA 4LGXA 1V3KA 4PSPA 3OGRA 4JKMA 3CZJA 2J78A 5A2CA 3VVGA 1JDCA 1UA3A 4HPGA 3RPMA 2JF6A 5CXPA 4XB3A 1LWHA 3FAXA 3K8KA 2NT0A 2PI6A 1D2KA 1ZBKA 4L4OA 3WFLA 1RP8A 3BUQA 1A3HA 2XVGA 5AYIA 3BAXA 3EJRA 4AD4A 3RILA 3QHMA 1WDSA 3NJ3A 2WMFA 3THDA 5DMYA 2G3IA 3RJYA 1YHTA 4WKFA 1NWUA 2CEQA 3CPUA 3AIUA 2J7HA 4J3XA 3CZ8A 4EK7A 4B16A 5A6KA 3WENA 4W7VA 2YFNA 1DWGM 3FHQA 4JFTA 4FLQA 1V0KA 4LYQA 2ALWA 3VIFA 4HA1A 3OGSA 2E9BA 1O7AA 2NW0A 4TOQA 3VKKA 4DM1A 3GXNA 3WF4A 1V0LA 3QR3A 5C70A 2WLZA 2VR4A 3DX2A 5ABFB 1JZ4A 1KR0A 3SIMA 4R5EA 3W6LA 4ATWA 1EXPA 1GONA 4D6EA 3A3HA 2ZUVA 4ML4A 1B3ZA 3BGAA 2XYLA 5C8BB 1E1EA 1J18A 3CV5A 3W53A 1AQMA 2XN1A 3MSDA 4S3JA 3DX0A 3ZT6A 1BHGA 1V03A 4W7UA 4B3KA 2DIJA 1DHKA 3VNZA 1K6AA 3WD0A 2FHCA 1J0ZA 2WSPA 4CCDA 3EMCA 4AY1A 1UWSA 3AIBA 1QI0A 4ZE5A 1UUQA 3WUEA 2O9OA 4ZE4A 2ZWZA 3TOPA 3CO4A 1GZJA 4LPCA 5FOOA 2X0YA 4AD2A 1MW2A 1JGIA 1PZ3A 3VDCA
chains in the Genus database with same CATH superfamily
4M7ZB 4XVJL 2WJ5A 1AI1H 5C8JB 1G7MA 4NIRA 4AYID 1A9BB 2V8ZA 3WLOA 4JN2B 5F1IA 3C4UA 4BF7A 4LVHC 4BSVA 3MBED 4HALA 3O3BA 1QMLA 1T5WA 3LCFA 3KDNA 3TYCA 5I71C 1PYMA 3UP8A 4X9FA 3Q7JA 2ZZ5A 4NENB 5GRXG 4BSWA 3MACH 3O06A 2QS8A 1MY5A 2HT3D 1BD2D 3C9NA 1DVFA 2WZPD 2AFNA 3UTTB 1JF6A 4N6RB 3VXUB 4CC4C 4F20A 1DO5A 3CUZA 3FNDA 2AKZA 1E6RA 5HHXH 3TA9A 1A14L 1FH2A 1J5SA 1ZT1B 3D3VE 4PCKA 4FS9A 1H19A 4BZ1H 2R14A 2JALA 3KXFD 3T2NL 5AKQA 1XHHA 4CCEA 2WN2A 2XKSA 3DK0A 5J12C 2HT2D 3MUAA 2FDBP 1ZT4B 4POZD 3OV6A 4AK2A 3ARGB 5A95A 5JW4Q 1MXDA 3IVKA 3FOKA 2EUVA 6ALDA 3ABQA 1TJRA 2CZ5A 4YSPA 4DNLA 1I1YA 3GTIA 1UB6A 4OUUA 3L13A 1W9UA 4HJ0D 2XTJC 4RGND 4PMVA 2WD0A 4G80B 3SRDA 5ALBL 2ZYFA 3FQUA 2E9WA 4HETA 1LOQA 4CUCA 5EOCL 2X5PA 4TX8A 2BWQA 2G5BA 3FUFA 3W39B 5LN8A 3ZDXE 3Q2CA 3SGEH 2CIKB 4HS3B 2YBRA 3OMZA 4V2CB 4IMCA 4XHQA 5I06A 2Z7WA 4D9LL 4DPQA 2DS4A 3NGBC 4WO4A 4BS0A 4FZIA 4LL9A 4ACPA 5A8NA 4FZ8L 4P2RB 1TTRA 3CLMA 1KCUH 4IOFC 1OC5A 5IB4B 4KZCA 3VFGH 2ORBL 2R94A 3W1LA 1LP6A 3EEZA 3JV4B 3SPHA 4MD4B 1LDPL 3SCMD 1DQLL 2WWNA 3NO1A 1JP5A 2LTQC 3KPLA 4EI5D 2DQHH 3C2EA 3G1FA 2G75B 4F7PB 7TIMA 3L5WB 2QHRL 1S2WA 4Z7QF 4YHKH 4L48A 4P46C 3KLHD 1J9SA 4XBMA 4N9GB 4IMKC 3S9DB 5TD4A 4WW1A 3V0VB 1SGKA 3LLXA 3I50L 1MN4A 2ERJB 5BMFH 3ARDA 3L9BA 4PYSA 5CBJA 2G50A 5I1IL 3H0TA 4Y5YC 4EIUA 1GC1C 3VFNB 4I18B 4N2BA 5I19L 2VL5B 1TPB1 2WMHA 4G82A 1HJCA 3F2BA 4XNBA 3CN2A 3U8GA 5DZPA 2OT1A 1XD1A 1MO0A 2B5IC 2R2CA 3JUZA 1KFLA 5IESH 1A7QH 3HMXL 2YWZA 2RH0A 1TMLA 2I5QA 1MCKA 3TJXA 3UTTD 3BVWA 1OIMA 4C4KT 1JGMA 3VXUD 3VE9A 3MNWA 4AW4A 3CUXA 1UJ3A 3P3SA 1HSAB 3CTTA 5KBMA 4R7JA 4F9DA 4YHLH 3T0CA 4MA7L 3MLWL 2AF2A 3AREC 3UL4A 1D5XB 3SKOB 3T4YB 3RWGA 1W8NA 4HK7A 3VA2C 4TQTA 5DD1H 4HAGA 4PA8A 5EO0B 1K8XA 1CC3A 1FF5A 4M7KL 1IILE 1UP2A 3DX3A 4BK8A 5H4YA 4WI2A 4OCYH 2Z0UA 4LRNH 1LO0H 3ARGD 1I1WA 1SHSA 4I9AA 3NQ6A 1BFVH 5CGBA 4PGBA 1HHJB 4R7DB 4U6YA 3LDVA 4M5ZL 4PBVC 4HG4J 1YXYA 3L5XL 5CN1A 1S9WA 1WCGA 3DBSA 1ZHKA 1XM3A 1HN1A 2P80D 5E6IB 3BAEH 3D51A 4XPGH 3M8OH 1SZNA 3TVMB 4FQXA 2QJDA 2YA1A 1A7RL 4KKLD 5HJ3B 4CC0A 3L4XA 3BLPX 3THQA 5AD0B 1ILSA 4RNFA 4LP5A 2JIWA 2ZYSA 3RUGA 4JHBA 2BCKA 3CXDH 4KJWC 2ZUYA 5MI0B 4XHJC 3ROLA 3Q9QA 2C9SA 4P2RD 3D25B 2VITA 3GBNH 3T3PE 3CN4A 4N3TA 1A4KB 1HNGA 4L4TB 4XX6A 4JGUA 2E5BA 5LYRA 3CAWA 1JPDX 2I69A 4OJAA 1DJIA 1XLFA 4R33A 1W1YA 4RMWA 2L04A 3QSKB 3B6SA 1A5KC 2OMWA 4IT1A 3MUIA 2LGNA 2DPEA 1DBKL 3WIHA 3DTDA 1ZHLA 1PFOA 4H20L 4AZ7A 1PVHA 1TMQA 4PRBB 3JVAA 4K7PL 1O6IA 2ZTJA 1PY9A 5AB3A 3UXFA 4QLRA 3CK0H 1NCJA 3BEWA 4GIAA 3MJMA 2GTWB 1ZT7B 4BDVB 4R8WL 4WI8A 1QR7A 2WYSA 1MZYA 1NARA 3HF3A 4WI9A 5F3HB 4NHUA 3ELQA 4FFVD 4GX9A 5GIRA 2DV6A 5BZWA 5CSRA 1UOZA 1TFHA 5AOZA 4HHLA 5A2AA 2H26A 4G6KL 4X4YB 3HEIB 4DIXA 1YEWA 4JM2B 4ZW8A 3W84A 4UWMA 4ICXA 5CGMA 1KCVL 2X4TA 2OTUA 3RA7H 1I6NA 3VNMA 1IIIA 1X97A 4OU3A 3VXNB 2MFNA 1BVZA 1URIA 4JANB 2VZOA 4YPJA 4E42B 2YXFA 2X2UA 3BAIA 4WZHA 3GUTA 4OIBA 4YDNA 4V27A 4NX5A 4FN0A 4MQ7B 4X6CE 4CW1A 5I2IB 2G30A 1F45A 3NCYP 2DUZA 1DVSA 4FQPA 3ULVH 3EDDA 4WCYH 4YSQA 4PJGE 5DRZB 4ZRGA 4KKZA 1OGGA 5FO7B 4OVXA 4XO8A 5KSBE 2D0GA 1PZUB 1FC2D 1B9KA 2SEBB 3DVFA 5C6TH 4BI7A 4PWHA 3V5KB 5E6ID 4GG6A 2H32A 2QJIA 3ESPA 4D1JA 3URAA 5EN2A 4PJAB 1AZUA 3HN8A 4FX5A 1DBMH 3E8UH 2HTMA 4FTVA 3TVMD 3HBQA 4WWKB 1U6AL 3ZXWA 3IPBA 1P9MA 5C0ND 1U8PA 3GK8H 2GOUA 4NYLA 4ENLA 4Y4FA 1KQZA 4Z7WE 3IJDA 3QYSA 4Q97A 2YMOA 1MFBH 4E9WA 4L4TD 3A47A 1G9HA 3VCCA 4QMEA 3KCOA 3KRSA 3W7JA 1I2NA 2HH0H 3DFQA 3BN9C 2J79A 1PL9A 4JY8A 5DHDA 4JTRA 3VSQA 4ANKA 1AIZA 4MNQE 4WGKA 5GNXA 4G43B 5IG7A 2FQEA 1ZSHA 3GHBH 2C1PA 1FZKB 3CMFA 3D52A 2FIKB 2DVUA 5EO1B 5DJDA 1O95A 3RX8A 2Y69B 5FUOH 4LEQA 3OAUH 3U7AA 2B9AA 3HI6L 4YZFE 2Z2BA 3N6QA 1K02A 1GW6A 2WXDM 2HSAA 3VVVA 2HG5A 3G7TA 2Y88A 4E9SA 3DX9B 3RWIA 1XH3B 3RPIA 3V8CA 4EE9A 2Y7DA 2GJJA 1M53A 4JAMB 4AQAA 5HOSA 4D6FA 2UX6A 1H5BC 3AAZA 3MC0A 4W1TA 3EKLA 4Q6XA 2FLIA 1AD0A 5I1JH 3OP2A 5I00A 3AADB 1UA7A 1G1YA 1T8QA 2Q8AH 3EX3A 3YPIA 3MA7B 5MEQA 4JQXA 2R24A 3U6RB 4JM2D 3RRAA 3FU7A 4HQVA 2XG9A 2VGFA 5AZ2H 5AW8B 1H0DA 1YEFH 4NQXA 4L0PB 2IANB 1TA3B 3IK2A 2X8RA 3QPXH 3CQQA 2APWA 1VZWA 2HN7B 3RVXC 3VI3B 3JWDC 4UFIA 1ISYA 1OTSC 4PLOB 2ISFA 2BSRA 1SLVA 2ZXDA 2AEPL 4IIGA 4AZUA 3VRIA 3ILDA 2OLSA 4GXMA 1V6VA 2IQ9H 4F2FA 2NLYA 3E6HB 2J6VA 5T9CE 5HI4C 1B0RB 1D5ZB 1JMXA 3I9IA 4WAFA 2AJVL 1TVBA 5BUGA 1XYZA 3VI3F 2X0VA 2HT4D 3U0TB 2QKIA 6TIMA 1A4MA 2JH2A 2N59A 1RK5A 1QVOA 4N0UA 3G1SA 5D9NA 4MCNA 4ZX5A 1A9VA 4B9YA 2WMJA 4XOBA 4UTLA 3L7FA 3LOWA 3FX4A 5XIMA 1YVLA 4LSUH 3LQAC 1OPGL 1A1NA 4OJYA 3H2AA 3P8JA 1PEZA 4WWKD 3BXWA 1US0A 4MSWA 4B9KC 1PVNA 3LQZB 1T0MB 2CRMA 2J7LA 4TYUA 2EIDA 1UCBL 4YX2H 1PLGH 3QGKC 2J12B 2OELA 2QMKA 4NLHA 4EP8C 2CHDA 2OXNA 1G7PB 3SRFA 3LJ3A 1BQLL 1G9MC 4PSRA 2CLOA 4K2UH 4C57C 3UETA 3QEGH 3ARVA 1QD0A 1YJDC 2Z1PA 4ELKB 4FFZH 5C0GA 4O19A 2GSEA 3Q8FA 5DJ0A 1UKPA 1Q8MA 1OP5H 3P4NB 1G7UA 2J73A 3DHPA 2H3NB 3ZJKA 4E41E 1A21A 1PD0A 2OI9C 1CGSL 4B5VA 2VWEE 5ENWA 3WAKA 3DX1A 1FH8A 1L9MA 4G56A 4XX1E 4JG0H 1GOGA 3EJUA 1A6WH 3ULUE 2FJGA 1XGDA 1U3ZA 1UQSB 4XGZB 2XVNA 5GRUH 5DQ9B 1YXDA 2JKAA 3SURA 2JKTM 2ZXQA 7ODCA 2YD4A 4LV4A 1K5NA 4GKLA 2UXGA 4XOEA 5CJOL 4Q32A 1E2WA 3F62A 3KJ6H 1T1WB 3DYOA 1GZHA 5LAXB 2HEJA 1OWQA 1ETZB 1GL4B 4W9DC 2YCLB 1DBBH 1PKQE 3NA4A 2CXGA 5LIUX 2XWBA 4H9VA 3OJMB 1Q9WB 3AAMA 3WDQA 3QDJE 3U46B 5BV7C 4KCTA 2VJXA 3SBFA 1Z3GH 4JFHE 1KEMH 4I0PA 3ZSSA 3TN6A 2IAND 3O2WH 4MFDA 5JXEA 5B21A 3WEZA 2Y7QB 3EBGA 1CU4L 4OF0A 1A5FL 3N44B 4G8IA 3U9PL 1R3HB 1E5JA 1DYZA 2AKRA 2P10A 5G4WA 3L1OH 4H8WC 3NCYS 1RA5A 3ME3A 2OP4H 1Q7QA 1KBKA 1B0IA 3SO5A 3L3KA 4LS0A 3H21A 1AKJA 2FFIA 3T0AA 2ZDSA 1PEWA 3UPRB 3O6KL 3CC5B 2PUZA 2D3LA 2AXGA 4PTTB 3VH8B 3HJ0A 1IC5H 1HH6B 1A1MB 3GDTA 3N6YA 3T8QA 5I8OH 1PYFA 1ZLEA 3WKML 5M94B 4L0ZA 2WWKT 1RLWA 1R5WA 2EAEA 3NQKA 1H7RA 4PTVA 1NDVA 1TZIB 2UXFA 1CMOA 5EU5B 5MENA 2FWOB 5GRVK 3PUEA 1VCAA 1E4KA 3GHPA 4K94C 2X2JA 2CPCA 3BZFB 1N64H 3B34A 1IGWA 3W2DH 2R4SH 5J6HA 3MV7E 2DLHA 2MCPH 5C0BB 1BOGB 3ENLA 3PZ9A 1AO7B 1BLNB 1ZLUK 1K2DB 1ZLPA 3CFKB 1N26A 5T1DH 4M5TA 2UX7A 5E00A 4X9SA 3BJTA 4GFSA 4UNLA 5CILL 3X3GH 3H23A 1IAIL 4XCNA 4TR9A 4CNNA 1AR2A 4JFEB 4C6MA 4PUKA 1S7SB 2PN5A 1F8IA 1JWUA 1F1AA 4HD9A 4LYRA 3KOXA 3O7UA 4HP5A 2UZ9A 1TJ2A 2F8QA 1ZPUA 2O5YL 3DMMC 3QR1A 2P28B 4R4BB 1X5MA 1TITA 2XIQA 1E5CA 1TQJA 4AXNA 2DM4A 3B2PA 3MGTB 4D6GA 4QLWA 3HGJA 1TSIA 4LKXA 5HGHB 3GSVA 1OJXA 4AZ8A 7CGTA 3CZGA 3DPBA 1Q7ZA 2VC7A 4M1RA 2WCPA 4KX8A 4TTDC 5IROC 4RGMB 1DUYB 5IMKB 1CDBA 3IS1X 5IDZA 1ZHNB 2ZYRA 1X5XA 1JNLL 2CHRA 1HEZA 5I3GA 3STEA 5KJ4A 1SEBA 3H9ZA 3GXDA 1MUJB 4GW5B 4BFBD 3HS8A 2AV1B 4ZQTA 1TETH 3L3JA 3H7RA 1NFIA 2FHFA 4J28A 4AVKA 1QSFB 2A4EA 3TJPA 1I9IL 2C8NA 2Q7AA 4FP1A 3C75A 2WINB 4IEFB 1KTJA 3RVWD 4S3AA 5I3JA 5FYJD 3WQGA 1VLWA 5LB1A 1MNZA 5ANMB 2PPCA 5CR1A 2F54A 3NXFA 4EI0A 2DEPA 4CCCA 4V2XA 3K46A 5BO1L 3HAEB 2NNAA 5ABGA 1N8OE 5CSGA 1FV1B 4PI0A 4IBYA 1FYHB 4OQTA 3TBCA 1KXHA 4FJYA 2IWFA 1TSHA 3LRLA 1KJMA 4PSPA 1AKPA 2VB5A 1YEKH 2QUMA 4X8JB 1UWXH 4A22A 1HOCB 4FG4A 2Z8RA 3FAXA 2JK2A 2HCVA 3RU8H 3WFLA 1J93A 3S4SB 5GGSA 3NIDE 3CD4A 1UIPA 3GMOB 1T7YA 2E5EA 4DKFL 4QNPF 2J20A 3RGHA 1WDSA 1XQKA 3S35H 1YYML 1SW7A 3S3SA 4WKFA 1MWAB 2Y06H 5T1MA 1Q6QA 2IPTL 3PWPA 4Q0XL 3CXOA 5C0BD 2CRIA 4NERA 2ALWA 2WKJA 2VFDA 5FHAL 4XWUA 1AO7D 2IIJA 4U6HB 1NKRA 1QBMH 1QEWA 4N0YL 4AQLA 3DIVA 3LKQA 1J7VR 4JDVB 2WPBA 5AYQA 1XGTA 3FQRB 1ZSDA 5GJNA 4B53A 3WLIA 4MJIA 1F3RB 3MY9A 5C8BB 1GIGL 1M6UA 3QWRD 4NFBA 4XZUA 2ESVE 5FSDC 1CYXA 4JFED 4HKJB 3VNZA 1IBZA 3GSRA 2WSPA 1UWSA 4CMHB 4E2DA 2O9OA 3LHYA 3HG1B 1RCQA 3TR9A 5C9UA 3E7JA 4ZTOL 3T4WA 3MNVB 1PZ3A 3CFMA 4IMAA 1Y6NR 3O15A 1CFTB 4XSMA 1II4E 3FU0A 1CK0L 4NWTL 4F57H 5E2VL 2G3ZA 2GYSA 1TB3A 2QT6A 1FL5A 4CSPA 1H63A 5EBUA 3BHBB 5DVOA 4QITA 4U3XA 4IHCA 2AC0A 1EUTA 3I6EA 3KPRE 5EBWA 4R5VA 4R4NC 1CLOH 5CEZH 4CCZA 1Q6GA 5KYYB 3WLHA 3E0IA 2C1IA 2PYEA 1US3A 4K8RD 4K5LA 3CDGA 5L7XL 1CF1A 3F5KA 1W0VA 4J4KA 2YGNA 4IBUA 1SBSH 1JQVA 4ODUB 3QG7H 3QCUL 2J8UB 3QUMH 3NDYA 4U1NA 4X0NA 1PW3A 1NDGB 1QSFD 4P4RB 1AQ8A 4ZTYA 1N59B 4NO5B 2N1TE 1QR1B 1K8DB 2LFGA 2DQCH 2NRDA 3TU9A 2W80C 4W9FC 3W1TA 4V33A 3TFXA 3P9MA 3ATZA 1FVDA 1UM4L 4MX7A 4PN2A 3ARYA 2HJLA 3KLAB 4WO4C 1GOOA 2XNAB 4O1AA 3F12B 2J8UF 1T03L 4YR6B 1FORL 2FD6L 3HIJA 4E9XA 5BWAA 4IIEA 4CVXA 1KPUB 2XICA 2Y07L 4KJPD 5C9ZA 1MREH 3V1HA 5KOMC 4E4FA 2OCJA 1BD2E 1H4PA 4H2CA 5BUAA 3EGJA 5FFOA 5AHFA 5HGDA 1XRVA 3VRJB 2L5HA 3GE7A 4HS8H 2IOIA 5DK2B 5HA7A 3OKMB 4P2AA 1PZ5B 4JDYA 4U1SB 5GJTH 4ELMB 4PGEA 1QO3B 2DDQH 3B8WA 3KXFE 1XEUA 1C29A 1UJTA 3P60A 4WJ8A 4RL3A 2WB5A 2A6DB 1P2CA 2V17H 5LA1A 1GQKA 3FRPB 4AD0A 4Y1AB 3ARDC 4PJHF 1H60A 1R7AA 5LGXA 1C8VA 1IBYA 4G8GA 4M3JA 4LSVH 2I9TB 1E7VA 3BDXA 1DTNA 1ZJAA 3NZHL 1OZMA 1T4KA 1H3GA 2OMVB 2YGPA 5HHME 5C09E 4GSDL 5E1AA 1NANI 4KTEH 1KY6A 3N50A 1T1YB 4PS3A 5JZ7D 3WDPP 3OKKB 4KK9D 4MCZB 4RGNE 4FQQB 5K33A 2VW4A 2YC1A 4X6EA 1BVWA 2DWYA 1C92A 4D3CH 4H0IA 4HJIA 4BFGA 3VNLA 2H6OA 4G9FE 5D72H 4WQ6A 5A3HA 1YHPA 2PTYA 3O6FB 3HG1D 3MSPA 1AZ1A 2X70B 3N3EA 1H6UA 4ZUVA 1FLRH 2IAMA 4HUUB 4S1SH 4KZ0A 3EMQA 4I48A 4NN5C 3MS8A 4DGYL 1OSPL 4TLTA 2QGDA 1VYSX 4XMLL 2ZXAA 3MP4A 3Q9PA 3FO0L 3PF3A 3HPSA 1QCWA 1EGJA 4M1CC 2IWEA 2OJEA 3SGGA 3AZSA 1GZQA 3UEZA 4LY8A 2WZAA 3MA8A 5AYTA 2DMCA 3RWHB 4Q52A 2K8MA 5CPOA 3ZTJH 1V6UA 4EBQL 4IIQA 4JTFA 5D2LE 3F5WB 5ADPL 3M1CA 5I1LA 3V75A 2BWIA 3DJRA 3MKCA 5D05A 2BVUA 1NGWB 3TONA 3UMTA 4CBPA 4DEFA 1FE8L 4ONFL 2R29H 2EDXA 2H4EA 1UP0A 4MBRA 4RBPK 1LG1A 4WDWA 3QXAA 3DERA 1GOKA 3WTUA 1SJMA 3CVHH 3W28A 3L4ZA 2ICWI 3PJXA 3SIKA 5DVKA 1M7JA 2A83A 4JO3H 5E6YA 1HHIA 4LCWB 5SWSA 3EYPA 5AC6A 4P3DB 1V77A 4YIWA 3BH9B 3BDYH 4LT7A 4X4KA 3TCXA 4LLMA 3IBOA 3UTTE 3U3HA 1TJXA 2V2HA 1EXUA 3VXUE 3DURB 3TCSA 2GVEA 2WHVA 4FNTA 5J1AA 4C6EA 3KYNB 2P7TA 3AQYA 5AAWC 3WNPA 3MBFA 1QVBA 5DJAA 3BW9A 5CZKA 4YL2A 4D8PA 3U4EA 3BXNA 3CNYA 1R3RA 3N42F 2R59A 1A0QH 1NFDA 5BJTB 4UOZA 5A2KH 4Y1AD 4BKSC 4A67A 2ALAA 4UTBH 2J3SA 3QIBC 3QEUB 2OL3H 4Y5VA 1JFXA 1HZHL 1N5YL 1RPKA 1F2QA 2IH1A 4U1IB 3LAFA 3WQ5A 3X3FL 4NKDB 4F66A 1KPRB 3LXAA 2AJUH 4RRPA 1CDJA 2G2PA 3UADA 4S23A 2QZRA 1YEIL 3PZUA 5M2FX 3V6ZB 3GBLA 4KUZH 4MPQA 2FTYA 5IB3A 3EYQC 3L1GA 3AQUA 1FFTB 4ZPTA 1HZYA 5D7JA 1R5VA 5FA4A 1I7TA 1E0XA 1LEIB 4JHAL 3O9WC 3ZTJG 4Y8FA 5L2KE 4XBGB 2GBUA 3VNIA 2X4OB 3V4UH 3DESA 3O6FD 4FO4A 1BLIA 1S2UA 1DE5A 4JPKL 1CBVL 3P4MB 3ZLQC 3IDUA 4DVBB 2I17A 2GZXA 3VIKA 3W07A 1NGPH 4Y2DA 4AYFB 3LG3A 3TN5A 2YRZA 1DZBA 2PO6B 3MHUA 4ESKA 4HIJB 3U2EA 3TO2A 1P7QB 1G84A 5LXXA 3QMRA 1GYWA 5H1WA 3EB4A 1MFCH 3C2FA 2W62A 3Q6FB 1JPHA 3EOTL 4BELD 4HTBA 1KYOJ 3OXRA 3N29A 5F8RC 3BG3A 3KH3A 4Y8EA 5F4WA 4XT1C 1NWPA 2Y25A 3S88L 2N4IA 1M7PA 4P57A 4PH6A 4ZTEA 3P67A 2Y23A 2BP0B 2YGQA 3O3EA 3JW7A 1S2VA 5FF3A 4IOIB 3MR9B 3LTSA 1DJZA 1REQB 4AX7A 4JIQA 2NWSA 3NJJA 3PZNA 4D0BB 1AGBA 1QRQA 2H8PA 2A3EA 2YDAA 1EDQA 4PJCB 3UPAA 4UIMB 1ODAA 3BIAX 5E23A 1F74A 3R1GH 3ARBA 4LCWD 3FIGA 1P4UA 5C9JB 2P76A 3WMSA 2BVQB 3CAQA 1GJUA 2P43B 1R6VA 4WI0A 2FO8A 1OFQA 5DJZB 4TTUA 2CZNA 4CU8A 2D03L 1BA9A 3W1NA 4JNXA 4CQ8A 2UZIL 2R0LL 5IMLA 4PJCF 1TRDA 5C92A 5C2UB 3FB6A 3LQAH 1EXHA 3G5XA 5BXRA 5CD5D 4QYOB 4AG4L 4GB9A 2ZICA 4MDJB 5PTDA 5ADOL 3KXQA 4PY8I 4MA1C 5TE7L 4L9XA 5D1ZA 3CLFH 3DHDA 5AW7B 1WHPA 5SWQB 4KKBD 4EVNA 4OLWH 4L9LB 5FKAA 4U1HB 3ITVA 2HPOA 2IKIA 4LLUB 3NH7L 3VU1A 5DT1L 2VD9A 1G9MH 2X1SA 4M24A 4HIHA 1TYJA 1MFVA 5J56B 3MWCA 4NX0A 1A5MC 1NLDL 3RKDC 5EG6C 4HISA 3AUVA 3QZEA 2OX5B 2ZC1A 4X6BA 2YJLA 1S2TA 2HRLA 3JXAA 1QWNA 5ANHA 3MCLH 5IMOA 1GGBL 4YDJB 4KC3B 2MTPA 5FL1A 4CMMB 1N4XH 4XPAH 2XXGA 2ZSVA 2H2PC 3BPWA 1XYFA 4G5ZH 4W93A 4GUQA 3O2DA 4P59L 2OXGB 2ED6A 1S5HA 4PUJA 5EF0A 1LP9B 4NUGH 2XJLA 3FSOA 4KWSA 5ABTA 2KZBA 2YXGA 1YRRA 4XZLX 3X11B 4L4TE 1SVDA 4LSTL 1FVEB 4UOJA 2PO6D 1CZ8H 3Q6GL 3LBOA 1RLCL 3VG0H 3ILQD 1P7QD 3SKNA 4KRMB 3SCNA 4UT7H 2DUAA 1LP9F 1MCEA 1RUAL 1VA9A 1K03A 1KUMA 1FGNL 1S78D 3WIIL 2VLJA 1DUZA 4XP4L 5SX5H 5BV7H 1VSCA 4FP8L 3OKYA 3GQYA 3O0RL 4C4UA 3LRGA 4HDIA 3RIAF 4IICA 3ECBB 5ALCH 4IP5A 1OLZA 4GXUM 3QUXC 5FM5O 4P3WA 4I8YA 3FONA 3V9FA 5F71A 2CHWA 3D39B 4RQQB 1IGML 4H6KA 1E6OH 4RRPG 3OGCA 4XPTL 4TMPA 1PTZA 1PO9A 2H90A 1I3GL 2VLMD 2XSKA 5F4XA 4OJFL 3F83A 3WUGA 1L9TA 4UQDA 1P5VA 3I6LD 4P23A 3WFAA 3EH5B 2VP8A 2G60H 3G5ZA 4GIEA 3B9KA 4GCAA 4Y7EA 1I9RL 3QLDA 3KTCA 2MJWA 1X1ZA 5CMAB 4UOQA 2VKXA 5CEXB 5AVXB 5LNVA 1FN4B 5IV2A 4UQBA 3V4VH 4JLRA 4OTXL 2PU1A 1AGEB 2YBGA 2IH8A 4QUOA 4YDLB 2XIDA 4TNVK 3TC9A 5FSEC 1NDYA 4YTQA 2WIMA 5DF0A 3CUJA 2J71A 2N0KA 3EO9H 4EACA 3TDFA 4Q9QH 5DGRA 4MNJA 3G77A 1CDCA 5GSRA 3EOAA 1MCRA 3UBFA 1TVNA 2ARJB 1VPYA 1EWHA 3G04A 1FL3B 3SY5A 1PF3A 1MCIA 4DPBX 5DFVD 1WKEA 2WMIB 2Y8KA 1KIQB 1DDTA 5ID0A 2X44D 1J9RA 1CD8A 4DEPC 3NJIA 1FHLA 2GDVA 2Y7GA 5JU6A 3RWDA 1HKFA 4L4JA 2ZUQB 5BS0A 4CNTA 4BM7A 3MTXA 1OEPA 4ZQMA 3IETB 4E9QA 4K68A 1KIRA 5E5RB 4P5MB 5AN7A 3FH7A 2XFWA 1T1ZB 4F80A 1ZLVK 1Z66A 1D5IH 3R0KA 5I07A 3GJFH 3H26A 4ZA0A 3BVTA 3T4AA 3BOVA 3N19B 6XIAA 1XLCA 1F18A 4I0PC 4TNVF 1XCTA 4H5SA 4PJAE 4QF1A 2IBGA 1QSEA 5FECB 5JXEC 1FP9A 3E0VA 4H9UA 4J7RA 3W7DA 4U7KA 2Y72A 1JERA 2R1PA 4B5NA 3WCZA 4AL8C 3PGFL 4R26L 3TTOA 5IB5A 1KIPA 2APFA 2CKBL 3EIFA 1KN2L 3W57A 1XLIA 3NQMA 3FSWA 3VXMA 1MNUL 3LH2L 4PRWA 1WKYA 3BV7A 1O6TA 5ETUA 1H41A 1JTOA 3VUSA 4UYPA 1R3KA 5BRPA 1KBIA 3QQDA 3QV6A 2D2JA 5C6WH 1KXTB 3VMOA 3GEWB 3GVVA 1GT8A 4JIEA 4F8NA 4O52A 1EEYA 3CFCL 3MLTB 3SGJA 1OFAA 1PTDA 5EPMB 4XNDA 4O50A 3U2CA 1DYSA 1LT8A 3R10A 4YHZH 4L3EB 4YSAA 2XPZA 4MYWB 4MS6A 3LI0A 1VEPA 1PHQA 3D39D 3HG3A 3PABB 3UYRL 4YUEH 3VTAA 2Q8ZA 2FBOJ 3KJ4C 4YH6A 3L5JA 1FFOA 4QRPE 3G22A 2WLHA 4KKAD 1WUZA 2A7RA 1Q72H 1Q7MA 3ATFA 4OZGA 2JK5B 2W8CA 1R3VA 2YYTA 1E4KC 2B8OT 4EDWL 1W9XA 1KGUA 2D9CA 3M9YA 4E4UA 3ELAT 3O6DA 1WP6A 3IE9A 2EXYC 3VGAB 1RUKL 4P5TA 3B2VL 4PUWA 5DUML 1KD0A 4B9PA 4OCXL 1IEQA 5J6SA 3TCLA 3WMPA 2D1ZA 5KZMA 4HLZG 4B7LA 2FEDC 2LU3A 2HZGA 3MLRH 2EIZB 4LSRH 1IBGL 3VFSB 3ETBF 4IX0A 5C1MB 5BPPA 1Q0XH 1AGDB 3SE4C 1SJDA 1MCFA 2P47B 3OJDB 3TU6A 4PVNA 3OKEB 3P30H 2XTKA 3IKCA 3CV1A 4MDPA 4NSBA 4NEHB 2KQNA 3MCOA 2NW3A 1X5HA 3O6LL 1DOSA 4KXCA 4PEEA 4DJDD 3TJ4A 1FUNA 2IEPA 4CNOA 3VWKC 4KK5D 1N12A 1MF2H 4DELA 3TTSA 1Y5XA 4EN2A 3FMGL 4NZ5A 4Z7QB 1H8NA 5B39A 1UMYA 3K74B 2DQEH 4HSNA 4HJEA 3BWUC 5GGVY 5K9XA 3GIVA 1KJ2L 4KY1L 1E27B 5I6LA 1S46A 3UTZA 1DSFH 3FQXA 4DN4L 3WNKA 4X5WA 4Y2WA 2VMEA 3US0A 3IIVA 2CLEA 1MHEA 3LH9A 1BBDH 2AEOA 3C5ZA 2GGJA 5LCVL 4NDMA 4JO5A 3Q67A 1C5DA 5FA5A 3OSVA 2IBZY 2DWDB 2JMRA 2B31A 1JGEA 4PJIA 3PJSA 4JUTA 2HLFD 1S1PA 1NCUA 3UCCA 3Q4DA 1OVZA 1LTXA 3FU9A 4AV4A 2EE6A 4EKXA 4NYUA 4PMDA 1JNNH 4M7LL 2FT7A 2ABBA 4Z3JA 3ZHKA 5GS0D 2GJLA 4AU0A 5E7FA 2MHAB 1U92B 5DY3A 5FW6A 1WIPA 3NFPA 1WFJA 3PWNB 2JEQA 5B3NA 3HN5A 1J5OH 3D1MC 3AB0C 4L3ED 4ZS6D 3LRSA 1OGTA 1RZKC 3N0PB 3SDXE 4HUVB 4CVZB 3RVVD 4IRSA 4LVDA 4GKTA 1UC4A 1E4HA 2FX8H 1IWBA 4OM0L 3G9VA 4OCNC 1UMLA 1R2TA 2Y2YA 1TCDA 1Q6FA 1FWAC 4CC1A 2XSXA 3DI1A 2ZKHL 5H94B 3TYBA 5CGYD 5DRIA 1XX9C 1YMHB 4OVUA 3H4WA 4OIIL 4TPRH 2C91A 2VXVH 1ZBWA 3LN9A 3ULUL 3I6GA 4FERA 5DEFA 5JOFB 1BEXA 1FNGA 3IU4L 4ZEPA 1VBGA 2AEQL 3P3TA 1JVOA 3SD5A 1MDTA 4JFPB 3SGDH 2OPJA 2FGWL 4NCC1 4IBWA 4DQAA 2GJ6B 5A43C 1P5UA 3CFQA 1KM2A 2VGGA 3MKGA 3RZCB 5FB8A 5DO2D 3L2MA 3M0VA 3QIWA 2ICWB 2I9LA 4DP5X 1EC7A 4JKNA 1UA3A 6PCYA 3QDGB 3FFCA 1MKFA 1XLHA 2Y5SA 3UJTL 4PRHA 3FTUA 1ZBKA 1EWDA 2DVTA 3S36X 4TS6A 3OF6D 4RFOL 4AMKL 3OHXB 1OE2A 4Y9CA 1QT1A 5FF0A 5I1HL 3NOYA 3PFRA 5CEWA 4JO8A 3LEVL 1TVDA 5BQ7A 4I9TA 3GC4A 5CIPA 1XG3A 4B16A 2K9FB 4W7VA 4NZ4A 2YFNA 3V5HB 1JPTH 1A64A 4N5UA 4QS6A 5BW7A 2DM2A 5K9QG 3H85A 2H9GA 2NZ9C 1XUZA 5C0CB 1SJCA 4P99A 4JGDA 4MDIA 5IBUG 5DXWA 1JZ4A 4JRLA 2LU4A 4TUJA 5BVPH 1A5NC 2DQMA 4G7EA 2QDGA 3U0HA 3LV3B 2BIMA 2AL2A 3H42L 3PP3H 3WU1A 2F6AA 1QABA 1JXGA 4B95C 3PWUA 1R9YA 2DIJA 4GG8A 3QAZB 3FO2A 3DV4B 4G70B 1MIMH 4K9EL 4NZRH 4O02L 1W72L 4U1GC 1J0ZA 3QCTH 2XWJB 1DJWA 3QW9A 5GS1C 4JN7A 1G7IA 2QGBA 4GA8A 5I30H 3U1PA 2N7SA 3LN3A 5CLZA 2AS5M 5I3FA 5TDNB 2FVKA 3G5VA 3EOYG 1TJHL 4A2LA 4NQCE 5C0BE 4OCSH 1DJSA 3NQBA 2DJXA 1ACCA 2IDSA 3N9SA 2DZXA 1Q6CA 3OR6A 1MFAL 3LYRA 3Q1SH 4NUJB 4NKOB 2OZ8A 1M6OA 5G1TA 3SQOL 4OUIA 4AJVA 1DWIM 4I1NB 1GHFH 1N2RA 3ES6B 1G4TA 4JFEE 3MLYL 2X1RA 3CDCA 5K9DA 3FQNA 4FI8A 4OLYH 5I1CL 2QHAA 2WC4A 5I75B 5IJVB 2VRQA 1JFQH 3TFKC 5A94A 2Y36H 1EGVA 1RK0A 4OV5B 2VDKH 1KFAH 3BVUA 4WKZA 4OCWH 1XF3B 4FG6D 4ANXA 1EJUC 3QQ0A 3MBXL 3NABH 1RFDL 4AISA 1ISZA 5DD3L 3OO2A 3MRKB 3RWFA 3EGDB 2WKOA 1UYQA 2ARWA 1X7IA 3KS0H 5CSSA 2Y7EA 2HRPH 4IFRA 4APXB 5K9OB 3ULSB 2F7OA 5C0EB 3UJRA 2DSZA 2L4OA 3CV6A 4PUUA 1UXWB 4W89A 2XG5A 2E1WA 4C56B 2GJ6D 3MRRB 1K8CA 1P84K 3RZCD 3DTXA 4IX2A 1FWCC 4C6IA 3MV9A 2HFFB 9XIAA 1UR0A 1RPXA 3MXVH 3ZMNA 4TRPH 2VDOB 3QDGD 1Q3NA 2LOEA 4LRIA 1QSFE 2L7QA 3WIHH 5DX7A 3OPZL 1AQKH 3WD3A 1DVQA 4FB7A 3WD2A 4ZVJA 5EF1A 1AS8A 3D69A 3BTNA 4M56A 1ASPA 4GZJA 2XV3A 1YPFA 4P8VA 2PYFA 2VGLM 2ZOLB 4JFXB 2OSWA 5C9RA 1LEGB 4AHOA 3BP4B 4O10A 4W86A 1OD0A 1VFOA 2IAMC 1JF5A 2FSEA 3TH4T 3SCUA 3AG1B 3GMLB 1LNUB 1HP4A 5E8OA 3ILEA 4PWFA 4NRXA 4B15A 5C0CD 4MY9A 1RZJL 3M07A 1N5AA 3G3LA 4W4NA 2X89D 4QNPE 1ZD6A 4M61A 3UG4A 3WQFA 1UWEH 1QUMA 2DFAA 1MFDH 2DORA 2W9EL 3IJYB 1N0LA 1K4GA 1NOFA 1EVTC 2F7IA 2YAEA 4JPVL 2FLRT 2XINA 4NZUH 5FAGA 1I4FA 2XY1A 3QG6B 3HHSB 3PR2A 3UWVA 1JZGA 3SBRA 4UOW1 5I5RA 2PW1B 5ECUA 3MGAA 3IDMB 4M48L 2GFTA 1AD1A 1WITA 2QQLL 3NG3A 5A40E 1GJWA 2JB5H 4YVPA 3L6FA 5IFJA 3AIWA 1R3JB 1F3DH 3BKJH 3AJ7A 4IPIA 4PJ9B 1OK8A 4J3OF 3AHTA 3B2DC 3RU8X 4LNYA 1H50A 2J72A 4KZEL 2PDFA 2FB4H 3TH6A 1JHTB 2XWXA 4F2MB 5E2WH 3T65A 3QA3A 3HNVH 1C12A 3KPMA 4ODHH 3S35X 3UAFA 1ZGLA 1TWWA 4NHCL 1MG3C 5JUEH 4ERGA 4LLQB 3WEAA 4HA4A 1I7ZB 1H1NA 1U95B 3TA3A 2V2TA 1XI3A 2ZRZA 3BW4A 1PZSA 4MMXB 4OZFA 5C07B 2LAGB 1MW1A 4U6VH 1OF6A 4Q4KA 2H32H 3HG1E 1C16B 1P53A 2V8MA 5I79A 3UA4A 2BSSB 1D8CA 2WLIB 3QY8A 3LDBB 4L1XA 1O0VA 5ACLA 3S48A 3FKUS 1IGYA 2VLRE 2K6ZA 3GF8A 3LEYL 5C2GA 1OC6A 4ZOAA 1F42A 3KL3A 2AJZA 3IVTA 3V7AE 4U0RC 2WQAA 4I8DA 5CFAA 4DVOA 2Q7NA 4LANA 4GMTH 4C56D 3H2QA 5SX4I 3NNTA 1J5TA 3VM5A 4QE4A 5RUBA 5D9SA 4QTGA 1XPYA 3E1ZA 3RTQA 2J8UE 4UILH 1I31A 1A6UH 4L37B 3VZYA 2CDGB 1E67A 5D7JC 4WHDA 4A68A 2M8XA 1LUCB 4F2BA 3GH5A 4MMZB 4KTDL 2OO6A 3EYUH 4FABH 4CKQA 2OXHA 1JV2A 3CSYA 1PWMA 1PG7H 5DT5A 3EO1B 2PTUA 1ILUA 1TTUA 1XRTA 1XCXA 2MH4A 3AJXA 5HHVL 4AZGA 3QC3A 1UKSA 3LOTA 4IDJL 3HG4A 4OD1L 4GP8B 4N8UA 3ZVIA 4UNKA 2V82A 1M42A 1OABA 3MP3A 1UD6A 4F0KA 4ZMTA 1NEZB 4HU2A 3HE6C 1WNOA 3V4BA 1EJOL 3DKLA 1MRDL 4HSCX 3SO3C 3OVQA 2AQTA 3BP5B 4J3OD 2A9NL 2WO3B 1FWJC 4ELME 3GXPA 3C86A 4Q2ZA 4EQ2A 3X1NA 2K0RA 4GI9A 1DLHB 3LIZH 4LSPH 3MKVA 3MCNA 3O4LB 3QUZA 2NQ9A 4DP1X 5FEWA 2DQTL 4M29A 1HL9A 4OT1L 4PJ9D 2Y70A 3I02B 2PF0A 4L8SA 4GKSA 1KBGH 1EDGA 3QSTA 4I2XB 5LBSA 2VE6A 4G5DA 4G6AC 3WUBA 5EUOF 5EMLA 1KXQE 2BIIA 3SDDB 1EANA 1PJ9A 3ARBC 3UAJD 4BGDA 1JPFA 1S8DB 1KTNA 4UZUA 5E4OA 2C7UA 3F8UB 1J9QA 1NCBL 3QUKB 4CQAA 4MAUH 2OJPA 1PKYA 1YN7B 1E6SM 1WLHA 4GLRI 2PUQT 3UG5A 3L4TA 5C07D 1F02I 2VT0A 3C09C 1XIEA 5C0AB 2B59A 5DQDL 3RBSA 1SYVA 1JZ6A 2NYZA 1GYMA 2C4FU 3HPLA 3HFFA 3B8IA 2XISA 1S7TB 1ZJBA 2XC8A 5D1ZC 5IHHA 1HXYA 4RPPA 1IEAB 3VA8A 2V2DA 1A1OA 4KJYA 3SE9H 4L3CB 2PDXA 5L88L 1Y0EA 3S6OA 2FWUA 3WAJA 5IW6A 3QI9A 2WKGA 3TAKA 1J1OH 4WU5B 5EO9A 5LSMA 5DYOB 5DXXA 3DROB 4QHKJ 5E2UH 1MRAA 8XIMA 1OCCB 2NQZA 5A16A 2Z92A 2OZ4A 4FRWA 4I77H 3U1SH 3MA9L 3MRGB 1M2OA 1NBZB 1QUNB 1R3LA 4Q8BA 3M0XA 4UV4H 1I1AB 3KUMA 1H7NA 3SDCB 3PWGA 4OZHB 1K4CA 2XGBA 5C0QA 1S9XA 4OR1A 4QAWA 4RZKA 2Q3AA 3CQIA 1K77A 1B4JH 2PE4A 2XWTA 1RBOB 3X12A 3P0VH 5GISL 1TR1A 1T7ZA 4GVFA 3GRWA 4KCUA 2ZP9A 2K3TA 1OB1A 4LCWE 1FQ0A 3U6XA 4K73A 4X98B 4OZHF 1FXPA 3ZQXA 3M1OA 5I5JA 1UH3A 2WZIA 4IM8A 4ZMGA 5ID1A 3ZPDA 4HZLB 3AU1B 3F04A 4E0RA 4Z2HA 4UZGA 3STBA 3KPNB 5IXEA 1JNHB 4AY7A 2WXLA 5DANA 1R1CA 2PB1A 2I26N 1UM6H 1IGCH 3QWNA 3VXOA 3KBJA 2C9UA 3B7SA 5HTSA 1TO5A 1KJ3H 2GK0A 4DNMA 3LKRA 1Y18B 1AYOA 5CP7B 2IWKA 4AL8H 3W7NA 1PNCA 3O4LD 4M03A 3FYIB 4NJHA 2YD3A 3DBXB 2VIRB 2W3ZA 3INUL 4LNRB 4FQHB 4CU6A 4M6UA 5MEPA 4NC1C 3SE8H 3KZPA 4HQQH 2YXOA 7FABH 4CDHA 4JY9A 1YNLL 1MLBB 2ATKA 2VSDA 4Y9BA 1WBHA 4YFDB 4M1DH 3SDDD 2Z31A 3PBGA 4MNHA 2G0KA 1WEJL 4GQZA 4HT1H 5J3HC 5AWNH 1AFVL 4UBDD 1RZ7H 3QHFH 5AW2B 1UC6A 1KKRA 1DQDH 1TUFA 3WQ4A 1G7QA 3R8BB 2I27N 1XBRA 4YEEA 3C56A 1JD9A 4MJ6B 5C0AD 4L9DA 4P2OA 3F2LA 1BXBA 1B0WA 3PWJB 3U7VA 3B0UX 4Y4HC 3FK4A 4RCAA 5ICUA 3KCLA 4JDZB 3HPXA 1K8IA 1KM4A 1JGLH 2F84A 1T0NA 2ZG3A 4PB0L 1UWTA 2WQ8A 3K4AA 3EWXA 1ONWA 4QEEA 4YFLI 1HKLL 1LCOA 2ZUUA 4AD1A 1LD9B 2VXTL 3PG9A 3A5VA 1OX4A 1FO0H 1JCMP 5I3IA 3RPTA 1IXPA 1W37A 1J6PA 1MSPA 4F1SA 4LP8A 4PCYA 4N2KA 1XB3A 2ZUMA 1FPTH 3VI4A 1WH0A 3CAFA 4MCMA 4OLVH 2PW2B 3QFEA 4PJDF 4EOWL 3PHOA 3QIUA 2INEA 1R0MA 5K4XA 1PDKA 1WWBX 5LGJB 1I1AD 3A3YB 3SDCD 5A2JH 3TO4A 4MG4A 3I6LE 2PPGA 3CDZA 4GW4B 1WZ1L 4DCQA 1A0DA 3DVNA 4PLKD 5EFDA 3V5DB 3AGWA 4PJCE 2DI7A 2BVPA 4PGLA 3K6NA 4E9RA 5F72S 4UB9A 4JL2A 2XBDA 3S2AA 2IH3B 1IM3B 2CA4A 1A3XA 3G18A 4XP1H 4XNZC 1XYMA 2B08A 1W8OA 2POTA 1FDLH 3NGFA 4RDBA 1VYPX 2FJFB 3B05A 4QDGA 4PI2A 2VUNA 5F7MC 3B3DA 3B7UX 5LDUA 3TVAA 2GTZB 1DVFC 3QNZA 4TQEL 3D3AA 4OJCA 3P0WA 2WBJB 5JIMA 4MXWH 5D7SL 4R7XA 5KAQF 4N0CC 2DZTA 5FYJU 4X7DC 4Z1YA 4GRLA 3PTKA 3NDZA 3QY6A 4MBOA 5CPLA 4QJ3B 2UY6B 1LTDA 3P8IA 1Q94A 1KTDA 3UGVA 1F1GA 2ACRA 4LEOA 2AI0H 4BFFA 1SQMA 4RNRB 3BPNB 4KI1A 2V5RA 4JPIA 3WJMA 4FNUA 4XNQB 4HH9B 4ASTA 1HKJA 3NSMA 1QW8A 5ECGA 1QBAA 4FXGA 2V68A 4QPEA 1ZIAA 3TYZA 1S7XB 2WW8A 4NI3A 4APQA 5JORA 4AVHA 4PRAB 1UWFA 2FGBA 5DDHB 3TURA 3W27A 3B0PA 3BYYA 5EH1A 1RZKH 4D7BA 3PV6B 1UR8A 2AXFA 2UWEE 4EWND 4PV1C 4GQ9H 5T5NF 1IAMA 2D2GA 2E9JA 3FKKA 1TQBC 1KPVA 3RL1A 4X5LA 1NLBH 4RZBA 4ONHA 4Y9PA 4HWBA 2X2HA 3S2CA 3UQNA 3H7BA 3KGSA 1LMIA 1P0NA 2B2XL 2A9BA 2XPGB 3GNOA 1NCGA 2CKBA 1YPIA 5KSAA 4BK4A 2A7BA 1G0XA 2D8KA 3RFZA 1HKMA 1OT4A 2V4LA 5F1KC 1LO2H 4E9VA 1ZY9A 3BIKA 4UU9A 4BQ8A 2IOMA 1KCSL 1UB3A 1F13A 2Y1ZA 4PJHB 5FHBL 3D39E 1KV3A 2MUCA 3FN0H 2OGJA 3B4YA 1UZ8A 2GGIA 3DGBA 3AMKA 4GC3A 5D2YA 3SD2A 3T4CA 2ZAGA 2VEGA 3N85L 2Y5JA 4LS1A 4MFHA 3TX9A 3A6BH 3BT2L 4G6FB 1IAKB 3WUWB 2ZE3A 3NPZB 4KNSA 4Y19B 3W0KA 2HB0A 3BZ4B 1P5BA 3MV8B 1BP3B 3JV6A 4MXVF 1LQ0A 1IM3D 3ERPA 1G4SA 4PRDA 5IVNA 4BV1A 4XN4A 1OOWA 5CSUA 4G6ML 3PU7A 5HYJB 1WAWA 2EDOA 4KT2A 4KV5F 5KVMC 1EO7A 3S8FB 4MJJA 5JPNA 3DOPA 1ZMYA 4XMTA 3E2VA 2C14A 1CWYA 3OZPA 4YDZA 2UY4A 4A8RA 4W9GC 5AYBA 2BASA 3PIQB 1T21A 3C8FA 2WBJD 3CQKA 4ETQB 2Y22A 4IRSC 1OZQA 4RWYH 2VURA 1V3MA 4B3EA 5T5FL 1NTHA 1UJ3C 2ZZ7A 2VX6A 3EBVA 1V7NL 3I9AA 5ACZB 3ZKNC 4FQ1L 4PY7A 2C3ZA 1U8IB 2HVMA 4Q4PA 3VOJA 1LE5B 1NQ6A 3MOQA 4C83B 1L6WA 4IPPA 3CU7A 4KKNA 1ZXKA 3OMNB 2WVUA 4K07A 1HSBA 5B4MD 3QUHA 4B2DD 3D85A 3V0EA 1E56A 3HC0B 3BQUB 3CU2A 5T9BG 4GKZA 1P5UC 1AQ0A 4PULA 2YA0A 5DMIH 3KVJA 5A6BA 2YD5A 3E0LA 1O7SA 2AANA 5CCHE 3TN4A 1Q38A 2Y24A 4LFYA 2NNFA 2C3HA 4DZIA 1J0IA 4DGVL 4ZX6A 1BW8A 4FQXC 3ARPA 1U91A 3G6AA 2CESA 3CIXA 4X8XA 4FA3A 4CD5A 1AH1A 3OAYK 4N3UA 3UA3A 1I1RA 2NR6D 4GSRA 2GBVA 3D7PA 5DA4A 3QS2A 4NNBA 1E9PA 1UYWL 2XWDA 3NQDA 1THFD 2DM3A 4QRRA 3LHZA 1GGIH 4UDTA 5H91A 1CFSB 2ZCHL 3BPCA 4NSKA 2KMWA 5I6PA 2PCEA 5IEKA 4F8PA 2VC2H 3W88A 3N42B 3LHWA 1JRHL 5HGBB 3BWAB 2BMKB 1X7QB 2P24A 4U6XB 4XB3A 2JSFA 4RVBA 4ISVB 3LKPA 3P9LB 3HMXA 3WKPA 4L4OA 4YWGL 1ZAGA 5CN3A 4EXBA 3CX5J 2XVGA 5JW3H 2OB3A 5L6YL 5KYWA 3N4AA 4C6LA 2CUIA 4G6FD 1KV5A 4L56A 4FXFA 2ZAIA 1QFWM 2J7HA 2J4WH 1XIWB 2R1YA 4EZKA 3NACH 4Y19D 3MV8D 2FK9A 3GDRA 3Q43A 1FWNA 5IR1B 2BTMA 1V0LA 1NUGA 2F08A 5HYJD 2B7OA 1GVEA 4YHPA 2VDGA 4NOBA 3FXIC 2GIYA 5JQHC 2NY3C 4ZMXA 2GT9B 1LO4L 1EGJH 3UZJA 3A3HA 4OGXH 4PRNB 3NFSL 1OGAB 1U8KB 1I85A 3IFPA 2PF6A 5FWQA 5DWUL 3WCYA 4M19A 1N8ZA 2P45B 4B3KA 2QDDA 3WLBA 3U9UB 5IP4A 3TOPA 4MVBC 4NN7C 2R9RA 1TEGA 4JRXB 2QCGA 1R3YA 3LS4L 3VDCA 4B9FA 3BQ5A 2PCPB 3OKLA 2HKHL 1CICB 4P2RE 1M3UA 2PP9A 3RI5K 3ENEA 4MHHI 1JCTA 1UR9A 5EOTB 2Q7YB 4NRRA 2OULB 2AVGA 1VPOH 4Q8TA 4NYYA 2Z1VA 4Z7QE 1G9NL 2MNJB 2V3GA 5CCKH 1RIHH 5IJBC 1ML1A 4YBLC 3W0WA 2EE0A 1JWSA 2B0SH 2E3ZA 2P26A 1DBJH 3FB8B 4Z78B 2C6QA 2PPEA 4XCFH 1EFXB 4AVNA 4PTMA 1JK9A 2CGYA 4NM4L 4B50A 2BY0A 2RFXB 1X4XA 4RISH 1DR9A 2BWDA 4LL1A 5HYFA 4N6EA 3BQUD 2W60A 3TBVA 4PWKA 4NAFB 3TF7C 4Z7UF 4UINH 2JV6A 3LCYA 3V6OA 3WFDL 1BX2A 1A6TB 4PB9L 4FI6A 4FDWA 3TOYA 1FWXA 3GNMH 1B2WH 1P9MC 3DJTA 1V55B 2HX8A 5AHEA 1SJEA 4O02A 5TQ2H 2NSOA 2OV0A 1AZNA 1D3HA 4YHGA 1CX9A 3SN0A 2F7PA 1FBIL 4Y4FC 5IK3A 4GRMB 3RI5F 2EC9T 1V8HA 3HZVA 4XE0A 5E8DH 4GFIA 2QGEA 4IP4A 2DLIA 4EXPX 1A49A 2HTLD 4GMEA 4OIAA 2X10A 4KFMA 4Q6YA 4AZ5A 3FJLA 4HUKB 1E6XM 3CPRA 2PRHA 3LV6A 5D4QA 3MMDA 3G5WA 1PWLA 1R3SA 5DUPL 3UVIA 3IJLA 2XOTA 3EX4A 2C1OA 3DHJA 3BP7B 4ZXBA 4PJBA 1IZCA 5C7ZA 3QHTC 4O5LH 4HNLA 4XO9A 4P7RA 3PXLA 3FCSB 1SOKA 4EZJA 5LGYA 3HZYA 2WJFA 4Q8VA 1WXJA 2EYSB 3QORA 4KQ3H 4IKJA 1BF8A 4DLMA 4MASA 1MHCB 4XVEA 1HE8A 4DJED 1MDAA 2EDDA 3ZT7A 2ZAHA 3D4ZA 4Z17A 4G8EB 2J55A 2BS71 1XIWD 2ZPKH 3BP6B 4XNXH 5KG9B 1BIHA 2EDNA 1UURA 4ZZFA 1RV8A 1I8KA 1ML0A 1BCIA 1S5WA 4JFYB 4HJGA 4L05A 3I65A 4EUPA 3BD4A 3GS7A 3STFA 2GJ6E 3RGVA 4U3SB 4A37A 3HPJB 3KNBB 1HO4A 2DYSB 2WUBL 4Z1PA 2Q86B 1SHXA 4LH8A 4M7JL 4L4MA 4JQXC 2KZHA 3SYAA 1OGAD 4IGSA 1IIKA 3QDGE 2PP3A 2EDJA 3D4YA 3OHMB 3NM3A 2D7OA 2COVD 3UIYA 4OCRH 3R43A 4JPGA 1P69B 4JRXD 4H7VA 4URTB 5G4MA 5EWIH 3NCBB 4P2QB 3GM8A 1CICD 3HI5L 5EBLB 4UWQB 1U1HA 1BXAA 2VCBA 4LGSB 4BHUI 4AGLA 3M5YA 3WTVA 4X9BA 1MY7A 4G1NA 3KTSA 5C0CE 2HCZX 2QKIC 3C60B 4IOSD 5D33A 3D6NA 4X22A 1EFXD 1IJ9A 3ANYA 4P5RA 2MOGA 1DWAM 2B3RA 4UMGA 2XIMA 4BF5A 4HIIA 2VDQH 3GFZA 4JHZA 2XZAH 4ES8A 4HWUA 2G2RA 2Y1VA 3L3OB 2WJEA 5JXQA 2Q8XA 1G4EA 2IDFA 5D2NA 3H2MA 1XZ0B 2W5FA 2EXWD 3V1PA 1WVZA 1UHVA 3P2BA 3PGDB 2A6KA 4LU5H 3IJHB 2DZAA 3TBTA 5HGAB 1E4XI 7ENLA 4MDOA 2OWWA 3N9RA 4K3JL 4YYCA 5JXAH 4KVCL 2DKMA 1XBDA 3SYQA 2QR0B 3WDRA 4U1MB 2ZC8A 2M26A 3KS0J 2P44B 4NZCA 4MNGA 1ANUA 2UVFA 5I1GH 1A6VL 4K3GA 3AS3A 4ALAL 4KFPA 3RLHA 3M16A 2BNUB 3W2KA 3FO1A 1S5MA 1TFVA 4AQOA 3BVNB 4FALA 4GRWH 2GEQA 4MY1A 4XBEH 1X5FA 3F2DA 2VZTA 2F8XC 1IZJA 4XC1H 3L0NA 3AALA 1PSCA 1TJ0A 5C0DA 5F96L 1W1PA 1QASA 3O2DH 1FDYA 1OCJA 4YFLF 2R8SL 2CBJA 4WU7A 5LWYH 2D4FA 3CDFA 5KZEA 4MPKA 3QUZC 1UR1A 1RZ8B 1GZHC 4PW9A 2YPKB 3UMNA 1L2QA 2P1YA 3ILPA 3L5LA 1NCDL 4L8SC 5SV4A 4HU8A 3C2YA 1KLGB 3G0UA 1RY8A 3ME0A 3DO7A 1ZK5A 1REIA 4HLZH 4C56E 3QQ4B 3VFOA 2HTKD 1JUFB 1URZA 5EB8A 3RIFK 1TTFA 4XCYB 4CN6A 1I3RB 4KQ4L 2R2EB 5CBEA 4IIDA 4GXVH 3VE7A 2D0HA 1FQ9C 1F58L 1CFNB 1XH2A 2JXMA 3AROA 4A7TA 1ODUA 4GKNB 4KXDA 2CUHA 3KFTA 4OCMC 3V0SA 5GQBA 1S6NA 2M2DA 1TXKA 2BY2A 2DJSA 4CLMA 3IDXH 5H4ZA 3A67L 4YDKH 4K8RL 3L0GA 1NGYA 2OMZB 5AENA