1RP8A

Crystal structure of barley alpha-amylase isozyme 1 (amy1) inactive mutant d180a in complex with maltoheptaose
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLAFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligosaccharide Binding to Barley {alpha}-Amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type 1 isozyme
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1rp8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1rp8A01
3HMCA 3W26A 4ZEPA 2GJRA 3CHCA 4FNQA 1XH2A 2C7FA 2XSAA 4PCSA 3ARSA 2WYSA 1PBGA 3MUZ1 1UH2A 1DP0A 1CDGA 1UA3A 4W5UA 4ATLA 2CHNA 2BY3A 4AZIA 3L4VA 3VD3A 2CBIA 2EJ1A 2DGAA 3BUIA 3GXPA 3WNMA 3WDPP 4PMUA 4JAWA 1VRXA 2BVTA 4MNMA 5CLTA 1B2YA 2QPSA 3DDGA 4QLLA 5A6MA 1AQ0A 1EQPA 1W3LA 1CNVA 4E8DA 3VIFA 5A8OA 5BXSA 2YL9A 3CHDA 3WUEA 4GO9A 1W9PA 3H53A 3ARYA 4GQRA 3N17A 3AIBA 3DHUA 3AXHA 3FHAA 2XFRA 3IK2A 3ZSTA 1GORA 2BVDA 3GZAA 3POCA 1WDPA 1IZJA 3SCTA 2NW0A 4FNPA 3WDJA 4AD5A 4K68A 2PBOA 5JIPA 2WC7A 3K4DA 3MSDA 2XVLA 2W67A 3VVGA 3EDKA 4RE3A 2X2JA 3VSVA 3A6OA 3WMBA 2DQXA 3HN3A 1JDDA 2YA0A 1NWUA 1I75A 5E9AA 1W3JA 5JBDA 1JFHA 2F2HA 2G3NA 4CGTA 5ABEA 4AIUA 4W86A 3U5UA 1E3ZA 4H8VA 1U2YA 2UY2A 3WFZA 1H09A 5HPCA 1C8YA 4JFTA 4B3LA 2VUYA 3GXFA 5A6KA 1LG2A 2YLAA 1V3HA 4AMCA 1LL6A 4FNUA 4HOWA 3GXDA 5GQBA 1R8LA 3T2PA 2ALWA 1US3A 3MI6A 1C90A 2YA2A 1E0XA 1X1NA 1MW2A 3PZNA 4AD2A 1XSJA 3AIEA 4PEEA 2DT1A 2BHYA 4GI6A 1H0GA 2Y8KA 3FY1A 4XUYA 3BAIA 5HPOA 3MV11 1G5AA 2WMFA 4P8WA 2IXVA 2YL6A 1R7OA 3BUPA 3WIJA 1HXJA 1BGAA 2ZUVA 1JNDA 4FNRA 4MB4A 4B16A 4MB1A 3VKKA 1C7TA 2VCAA 4AIEA 3HG4A 6TAAA 3WD0A 1VFOA 3N12A 2ZXBA 2XSBA 1WE5A 1CXHA 1CBGA 2WHMA 2WKLA 4HOZA 4AEEA 1WAWA 3M07A 4Z2KA 5FL0A 3GXNA 1TMQA 3KL3A 4JFSA 1H1NA 3BVXA 1ZBKA 3LPGA 1EA9C 1M03A 4AYSA 4MTVA 3GTNA 2FHBA 2X0HA 3GNOA 3TOPA 1X6LA 2BV9A 1Z32X 4M80A 3THCA 2PWGA 3DX4A 4AZ6A 1R33A 1HWWA 4M56A 1E70M 4B9ZA 1HVXA 2GK1A 2IXUA 5D4YA 4P7OA 2CNCA 2D73A 4X0NA 1GQKA 1A47A 4BS0A 2OWCA 3VD5A 4CD5A 2ZE0A 4WLCA 2WMHA 3B9EA 1UD6A 3LXBA 1GQIA 4QP0A 1M7XA 4AD1A 1V02E 3W29A 3UETA 3W28A 3WUBA 4GZJA 2EPOA 1CXKA 1BF2A 3AHVA 3VIJA 2EPMX 1KGXA 4P7QA 2CBVA 4ZXOA 3GDBA 1QNRA 2CPUA 2WXDM 4H8HA 2ZUTA 3WUFA 3NSNA 1CGVA 2PC8A 5HOSA 4UQBA 1J01A 3BUQA 4OJYA 3CMGA 3EBVA 3WF3A 4MPKA 1XYFA 2VVNA 3W6LA 5A69A 2OW7A 1OD8A 3MS8A 3I3BA 1B9ZA 1U33A 4FLOA 2JF6A 3WENA 4BQ5A 3MSGA 4AEFA 1QNQA 2CKRA 3LRKA 1CZ1A 2WLYA 2D24A 3WD3A 2GJPA 1R85A 4PTMA 2WVVA 3EDEA 4P8UA 3SURA 3VM7A 2O9OA 2WLZA 2E4TA 4IUGA 1CLXA 1NOWA 4F8XA 2UWFA 1NWRA 3NDZA 3WUGA 3IJ9A 2D3NA 4W85A 3W6MA 3IJ7A 4WJXA 4XB3A 2V5DA 3K1DA 3POHA 2YFNA 1EIBA 3WMCA 1JNEA 1DWAM 1V08A 3ARRA 3UG4A 2VQTA 5EMYA 2WC3A 2ZXAA 3BVWA 4TVCA 2YBUA 3VIKA 1UR9A 3QGVA 4P8VA 1OT1A 1QI5A 3AIWA 2J7CA 3WQ4A 2VRJA 1KQYA 3VDCA 4Z2IA 1KXQA 4ACZA 2AOSA 3OZPA 4W8BA 4CU6A 1XD0A 5C8BB 1CIUA 3VGDA 1V0NA 4Q7NA 5AY7A 2DT0A 3D4YA 4D6JA 4GQQA 4GO8A 1KTCA 1VIWA 4W93A 4KRTA 2W61A 5JBEA 3KE0A 1RH9A 4XZBA 1NWSA 4KGLA 2JF7A 1GOOA 1HNYA 2F1BA 2QHAA 3VIGA 3DDFA 1FOBA 3MUAA 3WQ5A 3B8SA 1CENA 4GI8A 3OG2A 4PMXA 5I2UA 2XIIA 3MANA 4ZE4A 1UZ1A 3VSUA 1JXJA 2E8ZA 3ZJKA 4UTFA 3O9NA 3T2OA 1JZ5A 4U5KA 1RP9A 4FLRA 4L4PA 5A8MA 2W5FA 1RD6A 1GNXA 4E4PA 3PHAA 1RPKA 2WHJA 1JI1A 4PMNA 2BHUA 3ZJ7A 4AMXA 1ZBWA 1QX1A 1ITCA 3WNPA 3AJ7A 2PF0A 2OLHA 1HKKA 3LXAA 5AC5A 1M53A 4FLQA 4J27A 5KEZA 1FH9A 1LWJA 1R46A 1VEMA 3U5YA 3W4RA 3ZT5A 2G3MA 3WDHA 1QI2A 4MAVA 1MFVA 4QCEA 5A2BA 4W89A 3WSUA 2YL5A 1NOFA 1V0KA 3WEOA 1WKYA 1J0JA 2BS9A 3ZQ9A 1VJSA 1ISXA 1I1WA 3GNRA 3F4VA 3GXTA 2X05A 4D6FA 1P6WA 1EOMA 5CPTA 1BVNP 1B0IA 3AHXA 3L4YA 1GQLA 1BYCA 5A2AA 4UNIA 4U2YA 5JIWA 3MO4A 4IPNB 4ZENA 1E4IA 4FNSA 2WVTA 4F9JA 3VGEA 2WWDA 1HP5A 3K46A 3NSMA 2XVGA 3BUDA 4HPHA 2FH6A 3SCOA 3D50A 4BQ2A 3AMKA 3QOKA 3N18A 4EE9A 2WCGA 3BAJA 4ATDA 4UOZA 3GBDA 2VO5A 4U5IA 1GQJA 3OZOA 1LLOA 2A3CA 4M8UA 2J8GA 4KMQA 5HNNA 1O7DC 3RIKA 2YKKA 3EJRA 3CUJA 1QW9A 1IV8A 1JZ4A 1PX4A 5LYRA 3AISA 1V6VA 4J3UA 1MW0A 3NSXA 4W84A 5CSUA 1CGWA 5JUVA 3BVVA 1H41A 4NZCA 1ZU8A 1JZ8A 3AZRA 2VI0A 3PTMA 4A4AA 3S5YA 2CYGA 4M82A 3T08A 1V6UA 4R27A 3AQUA 1XGZA 3WNNA 1NP0A 5CPSA 5IFTA 4Z2JA 3ALGA 3QHMA 3FXYA 2YLLA 4JKMA 1MXDA 3RJXA 2PI6A 1BG9A 1VF8A 5F7UA 5A6BD 3OLEA 1ODZA 1W91A 5A6LA 5BXRA 3VTRA 4U33A 5A3HA 1E0WA 3N04A 1HVQA 3SIMA 5FCZA 5IXEA 4Y7EA 4E2OA 2FHCA 4V28A 2D22A 3ZT7A 1LL4A 1JAEA 4WSKA 3CTTA 1W2PA 1KGUA 4TX6A 1HN1A 1JD7A 4TX8A 1CGYA 5AC4A 5HDRA 3BC9A 4GXPA 1N82A 2J7HA 2G3JA 3AZSA 5FIPA 2Q8XA 2WMIB 1E6RA 3CBWA 3A22A 4Q22A 3KL0A 3A47A 3TTYA 4CN1A 3BLBA 3L4WA 4LYRA 1XV8A 1Y7VA 4YHGA 3OBAA 3KWXA 3BCDA 4KH2A 3VILA 1E1EA 4QAWA 2WB5A 4X0VA 4C7DA 1V02A 4MB3A 1XH1A 1R7AA 2OSWA 1BG4A 3I3DA 3PTQA 4ACYA 3ZT6A 4H2CA 5A6SA 2WZEA 1Q6CA 4GZIA 3BGAA 1E9LA 1QPKA 3AS2A 1E6ZA 4H04A 3VM5A 2FH8A 4J3SA 4UFJA 1BPLB 1UWQA 3NUKA 3L2MA 3EJUA 1YQ2A 2EO7A 3PZMA 3DC0A 5AYBA 2WZHA 2WVUA 1H49A 3FN9A 3CH9A 1K9EA 1OT2A 4PSPA 4QLJA 1UKTA 3IGUA 2WWCA 2DDXA 3W24A 1VENA 3F5LA 1QI4A 4H8UA 2V3EA 1BVZA 3PZQA 2XIBA 1OINA 4A3HA 2J47A 1PAMA 2E9BA 2IUZA 1BGGA 1YHTA 1QWUA 3WY2A 1AVAA 1ZBCA 1B3YA 4CN4A 3K4AA 3RMEA 4D6GA 3II1A 1K9DA 1TFVA 1EOKA 2J79A 1UWIA 3PTKA 3BVUA 3WN6A 3GNPA 3SCNA 1BYBA 2RGLA 3D5HA 4PMDA 2OYMA 3S2CA 3AYSA 4HZ6A 3SCSA 4JL2A 4JIEA 4Z2HA 5ABHA 3LMYA 4UQCA 8CGTA 1KGWA 1HJSA 1E71M 4TUFA 1DWIM 2JFEX 1E6QM 1HL8A 3AS3A 2WMGA 1QHZA 1V6YA 3T0AA 2BXZA 5GNYA 1E5JA 3ZM8A 3VGHA 2A3EA 4B15A 1CXIA 2WC4A 3WEZA 4EANA 4CCDA 1GOIA 4U3CA 3KLKA 5LA2A 4DUWA 5I24A 1J9YA 2Y5EA 5A2CA 2F7QA 4QCFA 4GZEA 4UR9A 3SCWA 4AIOA 4X9YA 2BY2A 2XJ7A 1D7FA 1EHNA 5CGTA 3BSHA 3BSGA 1QBBA 1ISWA 4AISA 3G6LA 2WVVB 2J74A 2VRKA 5I3DA 3HG2A 3W38A 2E9MA 1UKOA 2UY4A 5CPQA 4DWSC 1GVIA 3W37A 1QI3A 2WCSA 1GOQA 1V03A 2GUYA 1ITXA 4W7VA 3W81A 1V3KA 1UWUA 1UASA 3APGA 5A1AA 4AYGA 4OUEA 3DHPA 5CSYA 1UWTA 1PPIA 2CEQA 4AZ7A 2FDMA 3WNKA 4ZXLA 3HJEA 1MWOA 2X8RA 1W9VA 1QBAA 3ECQA 5FOOA 4M29A 5C71A 4D6CA 1H11A 5CQ1A 2XGIA 3GXMA 4QDMA 2YBTA 3RPMA 1E4MM 4MADA 4NXKA 2VX5A 2XUCA 4PCTA 4MB5A 4AC1X 2DSUA 2XM1A 3NDYA 4F66A 4Z2GA 1UR4A 3PZGA 4HA1A 3ZJ8A 3D52A 4D1IA 1XC6A 2VT0A 4JCMA 1KFWA 1UD8A 3N13A 4D6EA 2EQDA 2WW5A 5D8WA 3U57A 3JUGA 2J62A 5GNZA 3T0DA 2QMKA 4Z2LA 1CLVA 3WNLA 3WD2A 3RCNA 3SUVA 1KXVA 2OSYA 5DT5A 3VDAA 1CXEA 1UKPA 1UG6A 3OLIA 2ZIDA 1OGGA 4W8LA 3AHZA 2XFYA 2GVYA 1W2VA 1QWNA 2GDUA 2XWEA 1J11A 2ZOXA 3OIHA 3F5JA 2DT3A 3EJQA 1E43A 2BVYA 1MXGA 4NX0A 4AW7A 4BF7A 4PN2A 3CUHA 3VINA 4IISA 3WY1A 2BHZA 2G8ZA 4HMDA 4QFUA 3SEPA 1R75A 1SYTA 1XH0A 5TD4A 1J0YA 2NT0A 2V38A 2YL8A 4D6HA 1TCMA 3QHOA 2WAGA 1W9DM 3NIYA 2W62A 3TP4A 1KR0A 4B3KA 2XVKA 4XV0A 1JDCA 2Y4SA 2XHYA 2F8QA 2VX4A 2Y8VA 4PMVA 3OGRA 2DSVA 1KXTA 5IHSA 4GIAA 2WKGA 1X6NA 2VRQA 3RO8A 2VCCA 1LL7A 1E73M 4AMWA 4TOQA 2CBJA 2FGZA 5A94A 4XZWA 1BYAA 3EMCA 1JF6A 5GNXA 3BMWA 1AQHA 1QNOA 3AXXA 4A3YA 1FFQA 1V3MA 1FHDA 3EJTA 5BRQA 1MQQA 4AZCB 4UQAA 3ZR5A 5DEZA 3UCQA 2PWDA 2OWWA 1UR2A 4H7VA 3LXCA 4OOUA 4EAMA 1JXKA 4HMEA 4M81A 3ARWA 3PBGA 1B90A 4AD4A 2ZX7A 3CGTA 2YOCA 1CEOA 1UWRA 4HA4A 5ECUA 1LQ0A 3PZUA 1PX3A 5FKYA 3T09A 3OA5A 1V0MA 1CTNA 4FMVA 5E6ZA 3CV5A 2VNCA 5E0FA 3WH7A 3CZSA 5A8PA 3VGBA 1XD1A 1FHLA 5IDIA 2J7BA 4WKHA 1JZ6A 1C91A 2WHLA 1GOMA 5AYIA 2VVSA 4OOZA 3U7BA 2VL4A 5GPRA 3OB8A 3UG5A 2WMKA 5M03A 5I5RA 4BQ3A 4AZHA 1W1TA 1DEDA 3WD4A 2V3DA 2VZVA 3HU7A 3D51A 1GONA 4GPNA 5M3WA 2PWFA 2D20A 1CWYA 5E70A 1OIFA 4TXEA 2VR4A 1UH4A 3CO4A 2OWXA 3L4UA 1CGTA 3MMDA 4N42A 1R34A 1Q6GA 2YDRA 3WNOA 3BMVA 1GVYA 1KWKA 4HOXA 2J7DA 1WZAA 2XG9A 2DSZA 3OGSA 5BCAA 4S3KA 2VQUA 1O7AA 1GZJA 1ISYA 3VOCA 2VCBA 1XCWA 4HU0A 3CUFA 2CETA 1H2JA 1CGUA 1ZL1A 4BCEA 3D3AA 4CN6A 4D1JA 3K8LA 3DYPA 1WDRA 1UD4A 4JKKA 1NH6A 5DMYA 4MNLA 1TR1A 2X1IA 4MDPA 2WSKA 4D6DA 1G94A 2D0HA 3CLWA 4BZYA 1WNOA 1TVPA 1DTUA 5BXPA 1KQZA 3GYCA 4PMQA 1ECEA 3VU2A 4W88A 1GOKA 2BFGA 2RGMA 2HVMA 4WF7A 4UFLA 3RJYA 2ZWZA 1NP2A 2V3FA 2GFTA 5D8ZA 3A24A 2E40A 4YN5A 2ZUSA 1E6SM 3L4TA 2W66A 4NZJA 2J77A 3GM8A 3ZIZA 4PMRA 5BROA 3EJSA 2ESCA 1OCQA 1JYXA 1UA7A 3CZLA 3NCOA 4S3JA 1UD2A 3ZR6A 3KL5A 3VX1A 1W1YA 1J0ZA 1DWJM 4WIWA 1UKSA 1HJXA 4W7UA 3LPPA 2NSXA 4W5ZA 3BAWA 4UOQA 5I23A 5CJ5A 4DO5A 3QOMA 4LYQA 5HXMA 1SZNA 3BVTA 2E3ZA 1ESWA 4OKDA 2PB1A 1LJYA 5A6AA 4R5EA 3AYRA 3W25A 4DWSD 1UR1A 3FNDA 4HPGA 1AMYA 2ZUWA 5D9PA 2GK1B 3EDDA 4UFMA 4ML4A 1A3HA 1EGZA 4J3TA 1HJWA 4PMZA 1EDTA 1Q4NX 1ZBVA 3LPOA 2V3GA 2CHOA 1HXKA 4TVUA 1ISZA 2D0FA 4PTWA 3RM9A 1E55A 1B1YA 1XHGA 4RL3A 4AXNA 3VPLA 3IAQA 2Z1KA 5A6BA 1F4AA 1UOKA 3A3HA 5A8NA 2YJQA 3ZMRA 3N11A 1W3KA 1QNSA 1HJUA 3VD9A 3KLLA 2EPNA 1GUVA 5BYWA 4H41A 3WDIA 4U2ZA 4ACZB 2CXGA 2VZTA 3NYDA 2EAEA 3VDHA 3D4ZA 3WF4A 5DO8A 2W91A 2D2OA 3UG3A 2X2HA 2ZUUA 2WMIA 1G0CA 3U7VA 4BQ4A 3MV01 3PZ9A 4LPCA 3CIVA 4M24A 2Z1SA 3WL1A 3WH6A 2OYLA 2ZXQA 3CZEA 1G01A 4WK9A 3RM8A 2XN0A 3SUUA 1PS3A 1UQZA 3NJ3A 2QLYA 3O6AA 4DWSA 4F79A 7TAAA 1B3XA 1PJ9A 3BCFA 5BWFA 3H55A 1JZ3A 1OSEA 3UR7A 3KEHA 3WDRA 3K8MA 4P7NA 1K9TA 2IGTA 4KRUA 1EDGA 1HP4A 3A5VA 2GJXB 1TQUA 1XRVA 5A8QA 2BY0A 4PTVA 1VBRA 4JFWA 4UZSA 2ZX5A 4UFIA 1MYRA 2HISA 1WO2A 2FYVA 1VJZA 2J8FA 3WF1A 5FL1A 4CU8A 3T2QA 1J12A 1H0IA 1TQWA 4CCCA 1E0VA 4J3VA 4FNTA 3SUTA 4UFHA 4UOJA 3PZVA 4C7GA 4CD7A 1V3IA 4WKAA 1KCKA 3ARTA 1OWQA 4L4OA 4XX6A 3VIMA 1GJUA 1B31A 2EABA 3VGFA 1FFRA 1MVYA 4HTYA 4CD8A 4WSJA 4CKQA 2G4FA 3WDQA 3WFLA 4J28A 4NSBA 5M17A 3RM4A 3BXWA 1V3LA 4KWUA 3WBEA 6A3HA 3N15A 1O6IA 1QI0A 3W53A 1W1VA 1EDQA 4WKFA 1ZB5A 3HG3A 2GJXA 2X0YA 2WNWA 4E8CA 3LPFA 4JHOA 3AIVA 1HTYA 5EBAA 3DX0A 1C92A 5ABGA 3CUIA 2WZIA 2YDSA 4OBSA 3ARUA 1J0HA 3N1AA 8A3HA 1E4LA 1B3VA 4CU7A 4LGXA 3M6DA 1E15A 1R47A 1UQYA 1HX0A 1K9FA 2CIPA 4HZ7A 1OBAA 3L4ZA 1SMDA 3PZIA 1VBUA 1W9BM 3MMUA 2O92A 3KZSA 2ZWYA 2ZX9A 2XVPA 5IFPA 2MANA 1GW1A 1E56A 2DEPA 4M1RA 3WH8A 3VDBA 3K8KA 4DO6A 2A3BA 4QLKA 1KWGA 5D9MA 2WSPA 4GKLA 2DT2A 3T0BA 3L2LA 1C3FA 1TZ7A 1U30A 1WZLA 5A95A 2CBUA 2J4GA 1JAKA 2VTFA 1B30A 5CGMA 1JF5A 3I3EA 1QNPA 4LX4A 3AS0A 3EMQA 3IANA 3UR8A 4D6IA 1K6AA 5BXTA 1NOUA 4JFUA 2DSWA 1UKQA 2J7GA 4PUEA 6CGTA 1ODUA 1UD5A 1D3CA 3AMDA 3WF2A 5BRPA 4P8XA 2A3AA 3S5ZA 1UUQA 3A21A 3CUGA 4CVWA 2FGLA 2AAAA 1Q6DA 5CZKA 2B31A 2EACA 1GPFA 3DX2A 3EJPA 4AY1A 1TUXA 4AZ5A 2YFOA 1E72M 1IZKA 1BHGA 2C0HA 9CGTA 2ZICA 2J25A 3B9DA 4PTXA 2CKSA 3WQ8A 2X09A 4JZ5A 2QMJA 2DSKA 3AMLA 1J18A 4HMCA 4P7RA 3GBEA 1RP8A 2GSJA 5EFDA 2G41A 4P7LA 1V6WA 4JFVA 3EDFA 4GI9A 1UZ4A 4CCEA 1JYWA 3UEQA 2VJXA 1J0KA 1DWFM 4NF7A 3AS1A 1UYQA 1SFSA 2V5CA 3DYMA 2O9PA 1WPCA 3FW6A 1EO7A 5LA1A 3WY3A 1TQVA 1VFFA 2XGBA 3ZJ6A 4HU8A 3CC1A 3MUIA 5I0DA 1JFXA 1V6XA 1PZ3A 2X2YA 2JEPA 4HP5A 2TAAA 4UQEA 2XFFA 5D9OA 4D72A 3WH5A 4MNKA 4NRSA 4ZFMA 3TTOA 3DX3A 4JKLA 4AZBA 1WZKA 5DFAA 3GH4A 1VFUA 2VX6A 2PBGA 3LX9A 4LXFA 1HKMA 4DM1A 1QHPA 1NM9A 2W4XA 4V2XA 7CGTA 2JEQA 3MKKA 4DWSB 5CG0A 1KXHA 1W3HA 2CITA 4U31A 3AI0A 4CUCA 1SMAA 1W1PA 1FA2A 3SCUA 3VIIA 1E5NA 1E6PA 3AROA 2UY5A 2XWDA 3M46A 3DX1A 3CHFA 1BSIA 3VMPA 3WEMA 3HG5A 2CERA 1TVNA 1CXLA 1PZ2A 1EQCA 1PX8A 5ABFB 4PRWA 3ALFA 2J78A 3F5KA 3AIQA 5CLWA 3WD1A 3FAXA 2EXOA 2DPEA 3SUWA 3VMNA 3DECA 1KTBA 1L8NA 2DH2A 7A3HA 1JL8A 3A4AA 3WQWA 1C93A 3SCQA 3AMGA 3VNYA 3OLDA 3AICA 3TV8A 2J7FA 3FHQA 2OW6A 4AD3A 3UESA 3AIUA 2F7RA 1HF6A 3AFBA 1T0OA 4DM2A 1W9XA 1BAGA 5FD0A 2VC9A 3BH4A 3AHTA 5A6JA 1TA3A 1EHAA 3CZGA 1IT0A 2WANA 1J10A 2BNJA 5I79A 3GH5A 3H54A 1WB0A 2ZUMA 1US2A 3CZNA 3LRMA 2GDVA 5I77A 4UCFA 2WPGA 2EADA 1JG9A 1R87A 4ZE5A 4LYPA 4UQDA 1OGBA 2AMGA 3SCPA 1TA3B 5CXPA 4JL1A 4F9DA 1KB3A 4W8AA 4MAZA 1GCYA 3WQ6A 3J7HA 3ARZA 1MQRA 3FAWA 1TG7A 3PZTA 4V27A 1NQ6A 1EXPA 3WY4A 2BY1A 3EYPA 3TTSA 1GHSA 4J3WA 3WKZA 3CMJA 5I6SA 5IHRA 1QW8A 1G9HA 3ZOAA 2DH3A 1HJVA 3PZOA 4CD4A 5JBFA 3E1F1 4U3AA 3RDKA 1XCXA 3BLPX 1Q6EA 5KZ6A 3BAXA 1W32A 3EMZA 5DF0A 5EFFA 2F1AA 2E8YA 2D3LA 2VR5A 3S6TA 3BLKA 3EDJA 3AXIA 3MUY1 2Y2WA 2WMJA 3IAPA 1GHRA 2FHFA 1L0PA 1TQSA 1E40A 1M04A 4FK9A 2Y24A 3BAKA 1C7SA 1ISVA 4HA3A 1LG1A 2WCAA 3VUPA 1OM0A 4OGZA 2CESA 2YA1A 1UR0A 4NRRA 4NXSA 1UR8A 4HZ8A 4PMYA 1OB0A 2ZXDA 5M5DA 3BUBA 3GXIA 2JALA 1JYNA 3A4XA 1FH8A 2QF8A 2WK2A 3AHYA 4RE2A 3M7SA 1PIFA 2WHKA 1OIMA 4PYSA 2XVNA 3QHNA 1TQTA 2VOTA 1XYZA 3IJ8A 1E6XM 2FE0A 1SR0A 2F61A 3ARPA 4LQ1A 1LF1A 4PSRA 1H4PA 3VD4A 4UFKA 2WM0A 1MW1A 1C8QA 2J75A 3WMSA 1XSKA 2ZX6A 1JZ2A 4KGJA 3HZ3A 1OGSA 3L4XA 4GINA 4CD6A 1JDAA 3AIRA 4JCLA 4NI3A 1ZJBA 1WDSA 3MU7A 1AQMA 1JIBA 2VURA 3O2LA 2ZX8A 4MNJA 4YHEA 3VSTA 1UWSA 2PWEA 2VX7A 4EK7A 4URIA 2OSXA 3UERA 2D1ZA 2QV4A 4OBRA 1HL9A 3WQVA 2E0PA 1VAHA 3ZSSA 1CECA 4YPJA 2C8NA 3VO0A 1B3ZA 2G3IA 1WDQA 3ARVA 4PBGA 2JE8A 1KBBA 2D23A 1MQPA 2J7EA 3VNZA 4IPLA 2WBGA 2EBNA 3W0KA 1HIZA 3CHEA 3VGGA 2F7PA 1LWHA 1BYDA 1VB9A 4B9YA 4UZUA 3WF0A 5DT7A 1VEPA 3CZJA 2X2IA 1E4NA 3SUSA 3LRLA 3OLGA 1H5VA 1W9UA 2PWHA 5ABFA 4N0RA 4OZOA 2D0GA 1M01A 2A3HA 1BQCA 4W7WA 5E1QA 3VX0A 1WP6A 3PN8A 3CZ8A 2F7OA 4J7RA 4OIFA 1E6NA 2XN1A 5E6YA 3VIPA 1G1YA 1XSIA 4DUVA 1EH9A 1UH3A 2O9TA 1S46A 4MJ2A 3WL0A 4BA0A 2NT1A 5C70A 1B3WA 3W82A 1DHKA 1CPUA 4FLSA 1JYVA 2XM2A 2EEXA 3OGVA 3TTQA 1E3XA 4CVUA 4AZCA 3AOFA 4AD0A 5HBFA 4IM4A 4NZFA 3CPUA 1PEZA 3B9AA 1FH7A 4AZGA 4TTUA 1DWGM 3SCVA 1WZMA 1KBKA 1Q6FA 5D9NA 5LA0A 1GJWA 2WVSA 3ZO9A 1JGIA 2JIEA 1F4HA 2JIWA 2VMFA 1H3GA 2EPLX 1OD0A 1UHVA 2E9LA 3SCRA 4PUDA 3TA9A 1VEOA 1EO5A 1C8XA 1CXFA 3A23A 1PIGA 4ATWA 3AZTA 5E0CA 1CYGA 2WBKA 2W63A 1TE1A 4RE4A 2XN2A 2DIEA 3VIHA 4PMOA 3RILA 1BLIA 3WBAA 1V3JA 1JI2A 3THDA 3GH7A 4C7FA 3AMCA 2CCRA 4J3XA 4AWEA 3W27A 2YDQA 2VZSA 1V0LA 2QPUA 1HKJA 2F18A 1UD3A 3VD7A 1ZJAA 1HT6A 1JZ7A 1QVBA 3VIOA 2VZOA 3A4WA 3ARQA 2VZUA 1CGXA 5I78A 1JD9A 3CZKA 4JHZA 2XYLA 4TTGA 4MDOA 3TONA 4TVDA 3DYOA 3ARXA 1HJQA 5EB8A 3MMWA 1ZS2A 2ZUNA 3WH9A 2W92A 1QOXA 1GOWA 4DUXA 1KR1A 4MJ4A 2XTKA 1HKIA 1BTCA 1FP9A 1NWTA 1I1XA 2UY3A 3QR3A 1MFUA 1D2KA 2XPKA 5E09A 2DIJA 1J0IA 4D71A 2O9RA 1DWHM 1MW3A 1WCGA 3G6MA 4FF5A 1R86A 3BAYA 1FP8A 1E1FA 1KCLA 1VFMA 3VMOA 1QHOA 1BFNA 2OYKA 1NARA 2BXYA 4DO4A 4UQ9A 2EPKX 3N9KA 4EKJA 2YIHA 3WELA 4W87A
chains in the Genus database with same CATH superfamily
3VRJA 3HMCA 3US1A 2Y7QA 3TC7A 5IVNA 2LGNA 3JU2A 1AP2A 5EFIA 3PBMA 1E4KA 3NP4A 3W26A 3GLCA 2GJRA 1XCTA 4FNQA 4LSVL 5E8OB 3LQAL 5JA8B 2QEZA 2OMUA 2VEMA 4CEXC 4S3BA 3F84A 4PCSA 5IJVA 2FWUA 5K9JH 3O7UA 4KW2A 1Q13A 3U9UA 1HK6A 2RJMA 3CD4A 4XBJA 3H4XA 3H42H 4DN4L 2RHGA 3GHEH 3IETB 1ZLPA 2VXSH 2EIKB 2PCXA 2O0TA 2WKOF 3NJHA 1UA3A 2YBRB 4RFOH 3QRHA 2OQHA 1DE4A 1IAIM 1FDZA 1YMMB 5CZJA 4H3DA 2BY3A 2XI9A 3L4VA 5B3JF 3VD3A 1NSJA 3MRHB 4JBRA 2GJ6A 4ZL1A 3WEXB 1P48A 5M7QA 3GFZA 3GKAA 4KKLD 1UCBH 1PUDA 4JTKA 4Z1AA 4JAWA 2DJ4A 2BVTA 1T1WB 2Z2BA 3M0IA 1OCZB 3AT9A 5D7IB 4P5UA 1B2YA 1FA4A 5HMEA 3WD5H 1YQVH 1MIMH 4H20H 5I1EL 1ADOA 3EJYC 3IT8D 3CSTA 1AQ0A 1QABA 8TIMA 1EQPA 4WDTA 3LN4B 5BRZD 3UZWA 5BXSA 3VIFA 1RUMH 1SJHB 1BM3H 4YNYA 3SN1A 4FA3A 4XP1H 2V2TA 4LRNH 3DGCR 4K55A 2Y72A 3USZA 3T6VA 5EN2B 2B4GA 5DZOA 3J27A 5E4EC 1I1AC 5SX5H 5SWQB 4K8RH 3DHUA 1VHNA 2G50A 1OHQA 1YUHB 1JNJA 4QOKE 1JPGB 1HJCA 3NIDB 3VXRA 3O6MH 2Z35A 1OTSC 4Y4FA 3GSXB 2I60H 1A80A 5LXXA 3BJFA 3BO9A 5JA9A 1BD2A 4DEFA 3VFSB 4O57A 3SCTA 2FLRT 2C1IA 3MLYL 3T1GA 1BWVA 3VFMB 2YAFA 5L88L 3MJ9L 3PRZA 4PY8J 3BLFA 4P3DB 2CK0H 3PF3A 1PLAA 3FRPA 3GSNH 3VXUB 3MCNA 5I07A 5JIPA 5KSAA 2NQ5A 4JFYB 3RF9A 2ZOTA 4GYJA 1CBVH 4DJFD 5C5YA 1BD2E 1U8HA 1TZGL 4H8PA 4LCWA 4AV5A 1HL4A 3HN8A 1VS1A 5FYLE 2X2JA 3QRGH 3RG1C 2EKGA 5EUOB 4IQDA 1AHWA 3LEVL 1BQLH 4P2RE 3TO4D 3A6OA 2WTOA 3ZK0A 1H8LA 1O7DE 1JTPA 2NY6B 4CRPA 3H7LA 5FYJH 3LMJL 1FXPA 4N0FB 5FUZH 1Y1DA 1XLAA 2MOVA 2YPVA 1JDDA 1G9MH 1L9TA 3QQXA 4FL4B 4MVBC 4L1TA 1BBDL 3S3BB 5KVEH 4IOFD 1JFHA 1HH6A 1XLKA 3OQEA 4CGTA 5DK3A 5ABEA 4L3AA 4UT6H 3S7GA 1IAOB 4AIUA 5DS1A 1H15A 2DQUH 4FNLL 1H19A 4JO3H 4PI0A 3F03K 2BVOA 3B5GA 1IAMA 4R7NA 1I0DA 2RD0A 1OZMA 2HA1A 5C0CD 3OA3A 1E3ZA 5JHMA 3DI0A 4NENA 1N67A 3FQ1A 3WFZA 2UY2A 3GZ3A 4XPHH 2ADAA 1NFDE 1VFSA 1YMHA 2J44A 4W9TA 5FHAH 5IK3B 2WB1A 5IESL 4LLQB 3FFCB 5KOVC 3L4CA 5EEVA 4UIKH 4IQLA 3INPA 4DVOA 1RHCA 2WZPA 4Y7OC 3RPBA 3B0XA 3B1TA 4UNUA 1LL6A 5AYUL 2EDDA 4RRPA 4Q8TA 4L4VE 1CD1A 1SPDA 2GUOB 3H4FA 4FNUA 1G7LB 1CBJA 3GXDA 4IU2A 4NRXA 2X2UA 4O5LL 1IEBA 2AQQA 3W0WA 5C08D 1ENUA 5BVJB 4RA3A 1JGDA 2HZHA 3HC2A 3L5WB 4KC3B 3K5RA 1R8LA 1Y8BA 4GABA 2AXJA 3UTOA 4D9RE 3WHXB 1KCVH 5MEOB 2A6KA 3EOYG 4LCWD 3HJ0A 5SWSD 3T9WA 3QFJA 3IMBA 4U28A 4DELA 2X1OA 4UAOC 4IGHA 2XTJB 2Q87A 4WSGA 4WI9A 1QVOB 3BH8B 3PZNA 2VXQA 3BD5A 4ZO7A 2KQNA 3ONBA 3AIEA 5K9KA 3UP6A 4DP9X 4KEVA 4DXKA 1RH8A 3DHFA 3OMNB 1EEZA 1OW0A 4AF0A 5LGJA 1D5BA 3AC0A 3QC6X 4XWOD 3ZDWA 1R9FA 4LUTA 5HMSA 2Y8KA 3FY1A 4Y4FD 4JIPA 3UC0H 1SO4A 3PUCA 4RISL 1XLCA 2A83A 2UBPC 3L5HA 4S23A 2WMFA 2ARJB 4QGYA 3E8UL 1G6RL 4IKJA 4WNQA 4E5XA 5E8EA 3BZ4B 4LKXA 1L8PA 5CPLA 5DS8B 3TH6A 1Y6NR 1Q63A 1FHGA 4UUIA 3SW6A 1EFQA 4FNRA 4MB4A 3FU6A 3TJ4A 3VKKA 3EUUA 4WI0B 1IILE 4L37A 3WD0A 1IL1A 1S4IA 4QKTA 4PCKA 1VFOA 2PU0A 1OVDA 3V1PA 3VZYA 3LGEA 3C0LA 5M95B 2IFFH 5HHPB 1EVTC 2EDLA 5DUJA 4NPJA 4CQ9A 2LU4A 4TNFA 2WKLA 4DZ8A 5IUSA 5AD0B 4Q9QL 9XIMA 3T6ZA 1WAWA 3LKRB 3NL5A 4QXIA 1G7JB 5GISH 4M6PA 1Y6KR 1TMQA 3FT1A 4JFSA 4N28A 1DVJA 2GSIA 1H1NA 5IOPA 3BVXA 2NY1D 1X39A 1VACA 3H6OA 5LGYA 3BVNA 1EA9C 3UT0A 2WBJC 4QHNB 3IJIA 3DBXA 3DOSB 4H13C 4K3DH 4KO7A 4MNGA 1OPGH 4PD4J 1BLNB 1YA5A 4N5EC 3UAJA 3GNOA 4C5ZA 3BT0A 2XQBH 3TN0D 4WDWA 3HI6L 2BV9A 3IVUA 2D7QA 1IQDB 1GPOL 2WQVA 2H32H 4N0YH 2CIKB 3DX4A 4JFXB 4Q56A 1R5IB 4XSLA 3E1ZA 5EA0L 1HWWA 1PIIA 3FTXA 3PPCA 5A8GA 5PTDA 4FIQA 4AKPA 3DUUB 1J5OL 3DJ9A 3QEHA 4UMGA 3OVQA 2PLCA 2X16A 3N6QA 2HVKA 3QYNA 5BV7B 1S3TC 2IQTA 1QA9A 3L21A 2OWCA 4CD5A 4OLEA 3GSUB 3TW7A 1L9SA 5G55A 5I0XA 3ENEA 2PXYC 4HS3A 3DIFB 4PB9L 1AHMA 1FUNA 3OJGA 3RFZC 1GQIA 1J1PL 1WC7A 1M7XA 5JO5A 3TMLA 2QDDA 4AD1A 2Z93B 4TNVK 4QG9A 4QO1B 1FBIL 5C9XA 3M64A 1AC6A 2HLAB 2CMRH 3V3WA 3W28A 3WUBA 3VFOA 3ES7A 4MAUL 3C8HA 5L6UA 3U0TB 1OFPA 1KV3A 2OZ3A 1MCLA 2AXFB 3AZUA 3UIYA 4NAFA 5CBEB 2ICEC 5LZLA 1XUUA 2KPNA 1QRND 2AJYL 3G6JF 4MDJA 5HYFA 3AHVA 4L4LA 1NMBL 4MGXA 2P3YA 1SFJA 4UANA 3H8AA 1FCBA 1G4MA 3EHBD 4QR7A 4D8PB 4ZXOA 2YO3A 4NKOA 2ZTBA 4UF7C 4WCYH 1QNRA 3U8GA 4WEBH 2ZUTA 2P3EA 3ANYA 4REQA 3ZVHB 4I3SH 5I18L 3QPYA 4I9AA 1SVBA 3UGRA 1J01A 5IR1A 2XICA 2ATPB 3SPJA 3BUQA 1ICQA 2QJHA 3C0QA 1OXYA 3IIOA 3ESPA 2UZPA 1Q3NA 3NCYS 1ICSA 3O2DL 4LLVB 4F7EB 3F83A 4TTDD 1TE6A 2B2XH 2I5YL 3TEUA 1SY6L 2BJMH 2TRYA 5HGHB 3VNKA 4S1DD 1BEYH 1I1YA 2DZWA 1ET8A 4RJEA 4XPTL 1U33A 3FRUA 5D2YA 3WENA 3P81A 1OTUD 2ALAA 2FD6H 4FHKA 4X6FB 3BL3A 1RI8A 5ESAB 4H6RA 2ZONA 3NABH 1V5JA 2BVWA 2C1PA 1AANA 2AKZA 2CKRA 2WLYA 4M19A 4QMEA 4P23D 2DKSA 3LQAH 2GJPA 5C86A 1HKWA 1NM4A 1R85A 1RJPA 4Y9CA 4X0KB 3GAKA 2LAAA 1P7TA 2XWJB 3EDEA 5F72S 3HPLB 1K2DA 1NGXA 2W38A 1JPEA 4ZSOE 3GSWA 4HN4A 1IJ9A 1MRCH 3GHEL 3P2DA 1I2OA 3NFPA 4IFKB 5LBSL 3W7IA 5CD3A 2PGRA 3VFNB 1ZGLP 1PZBA 1IEQA 1AFVH 1D8WA 2BWDA 3QDHA 5GHWH 1TVLA 1WOBA 4ROPA 3FU7B 5A2JH 4F8XA 5LUMA 3TWCH 3MV9E 3NQKA 4KTGA 3NDZA 3I9PA 4GSDH 3WUGA 2G60H 2WBJD 5EEYA 1TPEA 1AA1B 2XN9D 4HCDA 3EH4B 4WW2B 2Q86A 5LWYH 1X5XA 2VXUL 3SE9H 5DCCA 3PQYE 1EX5A 3ZKND 2FO8A 3W83A 1YQVL 4R97B 3NAAL 3PV6B 5E94B 3U1SL 1DQQA 3F7KA 5L9DH 5HJGA 4UUJB 1JNEA 3GW3A 3WMCA 4LVNB 2XBDA 4MMZA 1L9OA 1IEHA 4GQ0A 4XP1L 2IDCA 2P8CA 5I1LB 2A73A 5K9OA 4NJ9L 4TL5A 4X80H 1OK4A 2EGZA 4BQCA 1YPZB 2VISA 3FO9B 3UG4A 3WAKA 5H37H 2F5AH 5JR1H 1QOQA 2I14A 2IMMA 2Z3FA 2AK1H 2F8IA 2P26A 1IUZA 1NGPL 1UR9A 5EZJA 3T0EB 2Z65C 1DANT 1QWGA 3TT3L 4J5NA 5HVGB 1KYFA 4Y4KC 1OT1A 4G70B 5DCDA 1AKJD 4PP2A 4Q0XL 2IV8A 4XTRC 4KKAD 1QI5A 1L2QA 2COQA 3JZUA 3WQ4A 1PVNA 4R26H 4ZDHA 2G95A 4IRJD 5HA7A 4EWND 3KJ6L 4XCFH 1FI8C 4GNJA 2CXKA 5MEPA 2ZTJA 4NKQB 2EDOA 2WIIA 3GHTA 2CK0L 3GRWA 3NYKA 4ZFOL 1XYAA 4W8BA 3ZL1A 1L6SA 1I4FB 3PK7A 3CSGA 3GC3A 4XN7A 4P2QE 1ZHNA 3NQIA 3P4MA 4R7LA 3QUZD 4IOFC 3IMVA 4UOW1 1YXYA 3RX8A 1A1MB 4JTIA 4OQVA 5AY7A 3WK3A 4ADUA 1MCCA 2RAGA 2QVKA 4HS8L 5HDWA 1RK1A 4TUJA 3RMJA 4YXLL 3ULUL 4GO8A 3HB3D 4W93A 2RCSH 3LZFL 4JRYB 3W2DL 1MJJB 2HFEB 3KXFB 1JWSA 3D18B 4Z3EA 4O2FA 2NQLA 2YARA 3CDFA 3NPUA 4XZBA 4FAMA 5F7KC 2E7CA 2QQKL 2JF7A 2V5BA 5JVLA 5JLZB 2QHAA 4Y6GA 5DLLA 3W22A 4IRSD 1NFIB 4GNKB 4L48A 1FOBA 3WQ5A 3B2UC 1YEIH 2QHLA 4I1PA 1CENA 4GI8A 5F2FA 1KOAA 4HBCH 5D9PA 5AZ2L 4ADIA 3O0RL 1S7RA 4HEME 1QT1A 4GMTL 4JN6A 4C56A 2MEJB 4ONHA 4QO1A 4XHQA 1FQ0A 3HVDA 3QZNA 1J9RA 1WCBB 2WLLB 1UZ1A 1YDVA 4LAZA 4YTRA 4AQOA 3G08A 2XHNA 5JO5B 3OVUB 5AZEL 5F9JB 5E6RB 1KCXA 3GTFA 2J6EH 3R11A 3DNKA 3ZJKA 4U05A 5GZNC 4QHKI 1B4KA 2R56H 3RUGA 4HYVA 2WY3B 4FLRA 3PYCA 5T5FL 1TV3A 4L4PA 1LJMA 3MXWH 4QX4A 2VDRB 3ZKMC 1OP3K 1EO8H 5GRUL 3JV5A 2E6PA 2ZZ7A 1KNWA 3H8NA 5INDA 3GO2A 3VJ6B 3ZJ7A 4R9HA 5CINH 2MUCA 3DUUA 4PJFE 1P2CA 3AJ7A 4E9VA 5I75B 5DURB 1M7OA 2HCVA 3K0YA 5EUKA 2PPFA 3WN5C 5FM8A 4ELMA 8FABB 2YCIX 1AR1C 3G1RA 3LXAA 1ZS8A 5TK4A 1GEHA 4R4ND 4FLQA 4J27A 2ARWA 1FH9A 3AB0C 2YD1A 3DKLA 4JRYE 4NIKB 4NHUB 3RVXC 1ZXQA 3NDZE 3WI9A 3FPYA 2ZZ1A 4TQIA 1R46A 2ZC1A 2Z26A 2CZVA 3U5YA 1WCBA 2GBVA 4Y8DC 4LH8A 3CPLA 3W4RA 4EACA 1KGJA 2O56A 3HHRB 1ZTVA 3DVNA 1MWAA 2PNDA 4IRZL 1JZJA 1HHJB 5KN5B 3C6EA 5A2BA 4W89A 3K1GA 3WSUA 2GEQA 2X42A 4PRPE 4F3HA 3LS5H 2IFGA 2GGHA 4LHUD 1V0KA 1FG2A 2YCEA 4JTJA 2GY5A 4LLUB 5HHOE 5CCKH 5AD0A 3EJZD 3C6SA 2BS9A 3WFHB 1VCVA 1RVFL 4JW3A 1PTAA 1RJYA 1LO3L 3RHWF 1T6WA 5DWUH 1A4LA 2VDQB 1RK1B 3GXTA 4TUJB 2X05A 4YXGA 2PGFA 1QSFA 3PBUA 2R2HB 3GTXA 1XL6A 1EOMA 3SCMB 2BSDA 5MENE 2PTVA 3SN0A 3LM7A 3SQBA 4N6EA 4PJFB 1EJSC 2WXPA 4C4KT 4XBSA 3REQA 3QBTB 1NTDA 5C2CA 1GQLA 1BYCA 3TWAA 3P0XA 3GU9A 4JDZB 4S0HA 3KBHE 2VLJD 4BFIB 3EA2A 1IAIH 1N4XH 3VG0L 1Q9OB 5GS2D 1UIPA 1S9YB 3VI4B 3MO4A 4ZENA 2OCJA 3S2JA 1CK0L 3CLFH 4LUTB 1Z9MA 1WCQA 2G0KA 4FNSA 2CBMA 3N2TA 4XKYA 2CHDA 5FM5O 1U8CB 3KPMA 3K2UH 4BUHA 1TO5A 4U1JA 1ZP4A 2V5YA 3PAOA 3RX5A 2WWDA 2W94A 3P3SA 4F9JA 5SWZE 2HRHA 2XDHA 1I85C 1X38A 2Y1HA 1YPZA 1M3JA 3FO9A 4HPHA 2AJXH 2AV1B 2FH6A 2WLJA 2JXMA 3K6SA 3SCOA 4BQ2A 3THML 1ZRUA 4AYBA 3CN3A 5BNXD 1L7TH 3BE1H 3LNFA 3II2A 2WCGA 5U4NA 2X9ZA 3BAJA 5EEUA 4KROC 5CLXA 5EU6A 4H9ZA 4W81A 4DW2L 5AW6B 3PSWA 4MQ7A 4U5IA 1TG8A 1P43A 2QSTA 5EIVA 1NTHA 3QDJB 5EKYA 5LGXA 3OZOA 3FBKA 3RU8H 3E8UH 2XH2A 2ISDA 1WUZA 4KMQA 2VDML 3UR2A 5HNNA 1O7DC 5E2UL 5A3IC 1Z42A 1BOGA 1UJQA 4L0ZA 4LV9A 1F90H 1T5XA 5DQ9A 1JZ4A 4H7ZA 2I7GA 4O53A 4GO6B 3MYJB 4BZ1H 4Z0BH 1MAKA 4U1LB 1J1PH 2WLNA 5FUZL 3ZDYB 3ULVF 2QCDA 3AISA 1S5HB 3V0GA 1F1GA 4J3UA 1MW0A 3HFYA 3F6JA 1GYNA 3GMOA 4OLXH 1CGWA 5KYUB 2HVOA 4LNRB 1L3WA 2OMTA 4FNLH 4MS6A 4LC6A 4Y89A 3GSRB 3ZL2A 1J8HE 3VFGH 3QMRA 1N8OE 3G5VA 4X2UA 1PY4A 1OT4A 3CZFB 2HKHH 3BP7A 3LSOB 3GLZA 4YVUA 5E9DD 3Q2DA 2OMWB 3W7GA 4MMYA 3O06A 2H3KA 1JGVL 4PRAB 1W5OA 5AKQA 3AZRA 4EIGB 3N55A 5HJYA 4AXWB 1TKWB 1O5RA 2JKNA 2G5UA 3UCRA 3B9VA 3PGDB 3FSVA 4LP8A 3S5YA 2CYGA 1E50A 4GISA 4EBQH 2AK4A 4GRLC 1KFKA 1F58H 5FW6A 5IGXH 1MDLA 1QWKA 2KBGA 3LKOA 1KFLA 3SZKC 4TUKH 3STFA 4HIHA 1WBYB 4HIJA 2IPKA 3W73A 1QFWM 3BP7B 1FWRA 2VXTH 5J56B 4D8LA 3GRWL 2X44D 3RL1B 2FTWA 3FXYA 1MXDA 4ONFL 3VU1A 4N90E 1V7YA 4U3HA 3OM3B 1VF8A 3CMOL 2A5HA 3IN2A 4K0OA 2B4CL 5KVGE 3VG9C 5C9JA 1A6UH 1YY9C 3NZHH 3I6LE 1W91A 5A6LA 4OQTA 4YWGH 1W6TA 5BXRA 4C6JA 4EI5B 4BKLB 1X5IA 2BIMA 1A4AA 4G8GA 4U33A 1BQSA 5D7IE 5L0QB 1E0WA 3N04A 3SIMA 3WJYA 1VFBA 3PS6A 3HPXA 5FWRA 1GGUA 1AQ8A 1EZSA 4WENB 2UVFA 1FWWA 4LVOB 2BSLA 3NFNB 2NUPB 1FKWA 1Q8AA 3LN4A 4HHAA 1TV5A 2C0AA 2IBGA 2CNZA 4TSAL 3CTTA 4OD1L 1XB6A 2JJVA 1KGUA 1QOKA 1HN1A 1OAJA 2XIDA 4PLOB 4KDVA 1DCEA 4TX8A 2OPJA 3TZFA 2YD8A 3SOBL 3KCLA 1OP9A 4PRHD 4QRRB 5LAPA 2E77A 2K0RA 1AXTH 4HK3J 4R96A 1C8PA 1I1FB 1CGYA 2A3LA 1MIEL 2NR6A 3L1GA 4QRPB 3UXFA 2MNUA 4NAJA 1AW2A 3BSMA 1TPXC 4WGKA 1BWWA 3P3TA 4YNGA 1HXYB 4WDIA 1GS7A 1P6FA 2VDKL 2G3JA 5C6WH 1E6RA 2PXYA 4Q22A 3T8MA 1SY6H 2FQGA 3CFIC 3KL0A 4G2DA 3L1EA 1M3UA 5CSBA 3IFLH 1UC4A 3ULVC 4AVKA 4CN1A 4ZFFB 3NCWA 4IPJA 4OV4A 2EIJB 2VDQH 5D1XA 2DLFL 4NC2B 1AD0B 2EXWD 3NABL 1U3NA 5LQBL 2ZF8A 3QHFH 2O93L 3CB8A 1XV8A 4IJ3C 4YDJA 3MNZA 3BQVA 3OBAA 2RGSA 4MRBA 4MD5A 1E8XA 1MFDH 4KH2A 1HAWA 4NDMB 2WXGA 4QAWA 4PHXA 4A63A 1U8QA 3QZBA 1E1EA 1SPQA 4MB3A 1V02A 4JIRA 1QAPA 5I8OL 2XZAL 5DVLA 3MSYA 3FTGB 4LRIC 2CU9A 2VLRD 3IDYC 4ENLA 1U8KA 4A2EA 2Q10A 3PNUA 3Q3GA 4PRRA 1NKGA 4JGMA 4LSPH 1MQKH 4L6OA 2AQVA 1KIUB 3O11B 3TGXA 2BRQA 4PUJA 2WZEA 1Q6CA 2PMZA 3QH3B 4XNUH 2TRHA 1E9LA 4RMTA 2GG1A 1QPKA 3AS2A 2B7NA 4PULA 5KSWA 1QFWI 1UWEL 3IEAA 5DA4A 4EOWH 3VM5A 1A8ZA 1F4YL 1A6VH 4RESB 2GOKA 3ANVA 3QTGA 2E9WA 3TXVA 4YXLH 3S9IA 3LKPA 4NN7B 3NUKA 1IXQA 1FWAC 1DVXA 2F08A 1Z9PA 2EO7A 2NY3B 3QDMD 4Y16B 3E96A 3P8JA 3P73B 1KLUB 5AYBA 1H5YA 5IM51 4W1TA 1WHPA 3RWCA 4FS9A 1ZHLA 4L8SA 3C5ZB 4WUUA 4PSPA 3LGDA 2G0LA 3QDAA 1A64A 3AREC 2IGFL 4L4VB 4N2BA 4F58L 1NFKA 2P8MA 5FM4A 1Z5HA 3IGUA 2VC7A 2R51A 2YPVL 3C5SA 2WWCA 1E6JH 1RJLA 4F2FA 1I60A 3W24A 8RUCA 2BNQE 3F5LA 1QI4A 3QCVH 1N6QL 4WTZG 2NLYA 4UMCA 1BVZA 1IC1A 3DX5A 2ZP0T 3WJJC 2HRGA 3FCTA 4WUUE 3HE7A 3D30A 3IDXL 4ZRGA 1QBML 4OTXH 1S1PA 2RQ8A 4EPDC 2XIBA 4PRNA 5EWIL 3VXRE 3IRCA 3P74A 1MCPH 4OW6A 1JGDB 4Z7VA 2JCCA 3JSSA 4QWWC 4U7MA 1S2AA 5I73C 1JGLH 4RFEA 3O2DH 1XGPA 1QNVA 4EZKA 2YR3A 4BK4A 2H32A 1B6DA 2DU2A 1BGGA 4PMJA 4AY7A 5DDHB 3NCYP 3WY2A 4TN9A 3ITTA 3HZVA 4MXWH 3QZPA 4W9HC 4HA0A 5AFAA 1J79A 1A21A 1EVUA 3RHGA 1WIOA 4G42A 5D1XE 4L61A 5AYYA 3NSYA 3DFSA 4NUGL 1ONQB 5JLZA 3II1A 1EZVY 3CIWA 4WHBA 2WTPA 1HI6B 3TYFA 3PQYA 3D18A 1EJRC 2GVLA 3R2GA 3N4FA 1UWIA 2ZOWA 5BW7C 3GNPA 3PTKA 4AX6A 4TQTA 1AO7B 4GRWB 1EZVX 4LIQE 5E2TL 2RGLA 3RR4A 2OYMA 3MWAA 4Q9RH 2QQKH 3MBWA 4F8OA 1HH6B 1S2UA 3AYSA 1YNTB 5DD0H 5J11C 1W2KT 3TE9A 1DYSA 3G1VA 1UM6H 5T1KB 1D5IL 3LMYA 4UQCA 3QQ1A 3Q9QA 3HCVB 4GSQA 2A99A 5GHWL 3TBTA 1EXUB 1Y5VA 3S8HA 2NQDA 1S1RA 5MP6L 3KPNA 3GDMA 4N2GA 4NCC2 1T5AA 1UGKA 3G2GA 3O0KA 3MA9H 3ASWA 3MUGB 4US5D 1ADSA 2WO4A 2FJSA 2HG0A 3E6FA 3WLJA 2CSPA 1TKWA 1VFAA 2DS4A 1QHZA 1V6YA 2E09A 5TNVA 2BXZA 1RY0A 2F74A 5BOZG 4AUJA 1E5JA 3G8RA 4OCRH 2OMWA 4DKFL 1A7RH 1B0RB 4MA1B 2F53B 5FO8A 1EJXC 1MVUA 4M3PA 4IMKA 4NUJA 1LP9B 2NPLX 3M1OA 1NIUA 1QLEB 1BMWA 4X5XB 2DDQL 1CI5A 5TQLA 5K1NA 3DPDA 3TYEA 1JHLL 2BP5M 3EH5B 3PE9A 4Q9CA 1BJ1H 4N20A 1ZY9A 5IROD 1XF2A 4M1CC 3NEHA 4FXJA 1JPSL 4KKPA 5J7CC 4XAYA 4AEOA 3KPSB 1DYZA 1JVLA 3NSJA 4BQ8A 4DAIA 1T5XB 2ZWSA 1IM9D 5HHMD 2ZKHH 1YEDA 4RAHA 2Y0FA 1KJVB 3E7JA 1K4DA 3DI1A 3UJEA 5DJ2B 1KJMA 4KHXL 3G5XA 1RULH 5A2CA 1TQXA 2F7QA 4UR9A 2YLHA 1HEZA 4LFHG 4E41D 3SCWA 1IGJB 1NPJA 1FDJA 4V1DA 4JO3L 3PAVA 4AIOA 2XJ7A 3V4PH 4Z3IA 1P0KA 1GS6X 1QKZH 4Z0SA 4DHGA 4KMTL 4IMLA 4UQ3B 3U1PA 4L65A 4P04A 3MNZB 3LKSA 2JCCF 3LXUX 3HF3A 1SN5A 2ITFA 5KYXB 1HYSC 3D12B 5HD8C 4OF5A 5KANG 4NO3A 5KW9H 4WY0B 4IGBD 2AI0H 4AJYV 3GI9L 3ZZ1A 1YEEH 4RZBA 2VRKA 2WZTA 4GYFA 4JD4A 1H5BA 3W38A 4QHRA 3W9ZA 4EVZA 1CF8L 3Q67A 1QI3A 4ELMF 2I9TB 2WCSA 5FA4B 5DQJA 1VD6A 3M0YA 1ML0A 2YPLE 1BBJB 4AMKL 5F4SA 4PS7A 1MLCB 4UTAA 2GUYA 5I1GH 3CH1B 5ICYB 3UBXG 3EWCA 1OYBA 1UWUA 1UXWA 3VFGL 1RA0A 3DRTB 3QAZB 1KRMA 4J3ZA 4AYGA 1CK0H 3CLFL 3ZKNC 1OAUL 4NNBA 1EAQA 5KVDE 2NUWA 4APQD 2J6EL 2DJMA 3NJFA 2CEQA 3TJPA 4UQ3A 3TF4A 4LS2A 5BWAA 4J4KA 2Z8VC 4AZ7A 5LLIC 2OS7A 4G8FA 4JZJC 4R7XA 2BB0A 1ZGLB 4Z7AA 2H9GB 1L6XA 2JK5A 4A1RA 3HJEA 2O5YH 4HWBA 4YHKL 3S36L 2FMNA 2X8RA 5EYWA 1UEMA 2QQLH 1OB1B 3NOEA 4K8EA 4Q7IA 4EUPH 3WIIH 2X6AA 4OJFH 3RWFB 3LRSA 1XM3A 3T8QA 1FWNA 4MY9A 3UYPA 2MCPL 4M29A 1RJYB 3IXTB 2Z24A 2NW3A 1FCQA 5C71A 3AVEA 5FEBA 1JEZA 4GOAA 3VXGA 4KKCD 4D6CA 3L67A 2Q76A 1IWPA 2VXTL 3F6LA 2XGIA 5EBMB 3GXMA 1I7ZB 5AVYB 4AV4A 4GUQA 1D3HA 1LUCB 5DRNB 2YBTA 4GIRA 1TUFA 5TF1H 3CU2A 4MADA 2QIIA 4H8QA 4KJYB 5C8JB 1A3LL 3VWKA 3AADB 4PCTA 3IU3B 3WNJA 4IBQA 2OELA 4H9VA 2YC1A 5JXED 4IRJA 1LILA 2NY3C 3NDYA 4Z2GA 4APXB 3QQ3A 4GAAA 1UR4A 1NSNL 4MCYA 1FNFA 1TPFA 1D2OA 4D1IA 2VM9A 1CLOL 3IJQA 3GB7A 3V0AC 4K3JH 1KFWA 5FCUL 4QGCA 4JPVL 4P2YA 4M43H 3COTA 1INQB 3N13A 2EQDA 2QQNL 3T0DA 2WW5A 1EEUA 1GZGA 1HO1A 4YHYC 3JUGA 5GNZA 3U57A 5L4IA 2Y9RT 1JZDC 5DQDL 3I85A 4IGBA 3WNLA 2Z29A 3RCNA 3WD2A 3SUVA 1AAJA 1KXVA 1ZV2A 2HKHL 3QJFA 1ZLUH 4OH2A 1N55A 4Z18A 4LEXL 3LMZA 4GXUM 3C5JA 2H9AA 3HV8A 3R8GA 2FZMA 4K3DL 4MNHB 1IQDA 1MLBA 2VC2B 2GVGA 3PG2A 1PKYA 5FESA 1B2WL 1JPFA 4FYSA 1P53A 5CJOL 4ICMA 4TU1A 4B4FA 2CD0A 4UT9A 2VM4A 4PWFA 1YNTA 4ZXBD 4W8LA 2R24A 3G08B 4MNGB 1AS6A 1XAUA 5F9JA 4DT2A 4F7CA 5C0BB 3SPIA 4FTVB 3GJFH 1QW7A 1LM1A 4IQJA 4L64A 3HLKA 5FM5M 1WD8A 2QADB 1CL7I 2ZOXA 3U6XS 4NZDA 3E3QE 1O95A 1MXGA 4NX0A 5BQDA 4NHVA 5D09A 3AGWA 4WO4D 1AE6L 4UTAL 4WRHA 7ENLA 4X7DC 4WO4A 1S5HA 2HJFB 1DJSA 2VDKB 3Q2VA 3QYCA 4N9GA 3CUHA 3Q01A 2OB3A 3LV5A 4PTNA 1OSYA 3RJDA 4IISA 2UY7B 1CR9H 3AU1B 3PXHA 3T8LA 4BQ6A 1GHFH 3HC0A 3QCUH 3SBPA 3KAAA 3MV8E 1T41A 1EP2A 1DJHA 4FKKA 3UW6A 4Z1PA 2PEVA 1NDMB 1WEJL 4QEHA 2F9BT 1RZIA 3C60B 3FC8A 1XH0A 4ANXA 5CC5A 1Z0MA 1NAL1 3THMH 2NT0A 4KMLB 4KY2A 3UTPD 2V38A 3QNZB 3CXOA 3BW9B 3TEVA 1GXEA 3ECBB 4K5LA 2IQAA 4LVFA 1TCMA 5I8OH 1HZYA 3CWNA 3QHOA 4IG2B 4D6HA 4F15B 2PPGA 1J2BA 1KY7A 2HS8A 3KRZA 3B9KA 4GYBA 2E6QA 4F37F 4AYID 2W60B 2AS5M 2DLGA 3QJSB 1B4EA 1OGAD 1ETZB 1UURA 1W9DM 3FT4B 2FZNA 4LLYB 3TBYA 5CBAB 1IIIA 1SHXA 1KR0A 2O6CA 4EPBC 2OMBA 5F97E 2PUZA 1O5DT 3TJXA 4C6OA 3QO1A 5ENWB 2JWYA 3RGBA 2OZTA 2IVFC 3NCJL 4N86A 1LQSR 2PGEA 1C8VA 2V37A 3L3JA 2XPGA 4AIBA 3RVTC 2QSCH 2HVJB 4BZ1L 3ZE0E 2EXWC 5ACLA 4OZIB 4HEMA 1YPXA 2F6UA 3BP6A 4JDYA 2DQWA 3FQRA 4XVUC 2WKGA 4TMCA 2LVEA 1ND0B 1P7QD 3Q8EA 3DH7A 1R5WB 2A73B 4MQSB 1PLGH 4GG9A 5KSAD 5IVXF 4DVRH 2K9UA 3PJUA 4AMWA 5HJLA 2FGZA 2H3NB 2IDUA 5FYJE 5CGYD 4HWEH 1W0VB 4J2PA 4H1LH 3T77A 2DBLH 2B7PA 2J21A 2A4EA 1RZPA 2QJIA 1FHDA 1JCMP 3EJTA 3O11A 4KEMA 2X4UB 5HY9B 1MQQA 2ETWA 3G0UA 4LIQH 5I02A 1U8KB 5G4EA 1QO5A 5F7NC 2WJZA 5D2NB 1E5ZA 2PWDA 3EGXB 3GBMH 4GE8A 3IARA 2EEAA 3EJYD 3DU0A 4OOUA 5AHLA 3OAWA 4PCPA 4DGIH 2BVPB 1JXKA 4H1LG 4HMEA 4AQ1B 4Y2NA 4WEEA 4N9GB 2WQDA 3VCCA 1TZIA 5KSBE 2Z7GA 4DB7A 5CD3B 1B90A 3DOIA 2D9CA 1TVHB 4PTTB 2HG5B 1MWAB 2ZX7A 2BVQA 2YOCA 4MXWL 3TWBA 3ZTJH 4ZUSB 1FZKA 3QF0A 2A85A 1GMIA 2CGYA 5F6HJ 2QJDA 5T1LD 2NSOA 3FK4A 2DN7A 1KLFB 2L7JA 4RAUB 3PZUA 5G5DB 2V7NA 5FKYA 1HHGA 4JM2D 2VW4A 3X3GL 2FKPA 2YAQA 3GK0A 5KVEE 4NQVB 4L4JA 3CV5A 3OTTA 5L2KA 3FUKA 5E0FA 1A5UA 3WH7A 3APTA 4QI3A 4F0KA 2OK0H 2HCZX 4KPHL 1IVLA 1WV7T 2HSIA 3HNSL 1LQ2A 1NINA 3VJ6A 5AAWC 1WITA 4EIUA 1MFBL 2J43A 2GC4C 3LQGA 3PJXA 1INQA 2JB5H 4DP8X 5A8PA 5IW3A 1YADA 5IDIA 3NZ1A 3KYKH 2OX1A 4FR6A 3V75A 1N0XL 2B0SH 2HMID 2FLMA 1R19A 1EA0A 4JG5A 5LIYX 4OV6F 5E9DE 4O19A 4GLRI 5KS9E 2VM3A 5D1ZI 4MRCA 1CDBA 3LD5A 3U7BA 1DVFD 3UXIA 4DZBA 1RZJC 2FQFA 4PRBB 4LCQA 1SJDA 5LXEA 4F57H 1E30A 1ZAIA 4TUFA 1QAWA 3OB8A 1W6LA 4J3OG 1FNGB 5EMUA 3STZA 4IHOA 2GI0A 5F7EH 4W9LC 1UZDA 5CBEA 3T6XA 5KUKA 5L2JA 3SECA 3FFOA 4YFDB 1XBYA 1DEDA 4C60A 2FVLA 3U0TA 2H26B 3WD4A 3HU7A 1NC4D 5E7FA 3VFOB 1GONA 2NXGA 3UIZA 3NJJA 1FYHB 5GGQL 3UYPB 1MWAH 3S1GA 4OCXL 3VI4E 4X42A 4XCYA 2AZUA 2J8UF 4C4KO 3MZNA 4N4PA 4J1OA 3MLPA 3GG0A 2OWXA 4QNPF 3S3JA 4UNTA 4FX8A 3SB3A 5C0GB 1K4HA 3BANA 5EMKA 2ESVA 3MMDA 3NSDA 4O2EA 1ED3A 1GC1C 3RRQA 2F7IA 3D09A 3QJHA 4L29A 1Q6GA 4OLUH 2RUSA 2VOMA 4RUBA 4UMAA 3ROLA 2A6IA 5GJSH 1KWKA 4LMQI 5AZ2H 4ZVJA 2J7DA 5AVVB 1SEQH 3QIBB 2BO0A 4KZEL 3DFOA 3BQUB 2QL1A 2UZXB 3QFJD 3NQMA 4PV1C 4F2BA 1WZAA 3VOJA 2IAMA 4LK4A 1BTMA 5E8NB 1I0BA 2DSZA 4XSMA 3CVHH 1PTGA 4HUXA 1SJMA 5MP6H 3BTNA 1XIWB 3IGKA 4F93B 3QWOB 2FUTA 1Z7AA 2ODIA 4IGNA 1SSDA 3MA9L 5CP3H 4YSTA 3TH2T 1KCZA 4PUNA 4ROQA 3GI9H 3VOCA 2OMTB 4AH7A 3GKWL 1XCWA 3BRDA 1BXVA 3CUFA 4Q4IA 4Y5YA 1E7VA 3EOBB 4YE4H 1ZLWK 5CINL 1CGUA 5CZVH 3MCKA 3O05A 1N2RB 3I84A 1IM3D 4UM8B 4O15A 2D2CC 1W1A1 2YCJA 4JQ1A 5J5RA 1G7PB 1ZLEA 1AP2B 5EFIB 4NZRH 1BWLA 3P4NA 2V2WA 3BLDA 5J8LA 4GXWA 2ZPKH 1GZQB 3AACA 2ABAA 4Z0XA 1XAKA 4PJ7F 4H9YA 1NQBA 1QXLA 1UPPA 4YVXA 4Q8VA 4X98B 3SFKA 3CXDH 3FGCB 2VC2L 1CDYA 2BPBA 2ZSVA 3P40A 4WW2A 1NH6A 5D2LF 5T5FA 5T33H 3R4DA 4KK9C 1NZRA 1KTNA 4BQ9A 3NQVA 4JFEA 3UWWA 2WSKA 3WLBB 1X5FA 4PRIE 1O5XA 1LD9B 3VRIB 3G6DH 4PA8A 1SRDA 3D25A 2ICEB 1U36A 1XBVA 2VKXA 2ICSA 3GS6A 4QHUB 4AX3A 1H3TA 5I76A 4KVNL 3VXSA 1T80A 1SZEA 4PS4H 2HAZA 2C34A 5EOCH 3V52H 4US6A 2FFCA 1LP9F 2V9DA 2HRPH 2WGNB 4ONOA 4U0RB 4A6YL 3ZUCA 1NEUA 2BFGA 4WF7A 1AW5A 6PAZA 1G9MC 5TK2A 4A66A 1OG6A 4GC3A 4GWEA 3WQPA 4BE6A 1NP2A 1UP3A 3HB9A 3FQYA 1XKYA 5DRZA 5D8ZA 3EX4A 5F9AC 4Y4KA 1CFMA 3U9PL 2UX6A 3WZ0E 1PVHA 1E6SM 4HK0B 5IQLA 2IG2L 1AKJA 5FO9B 4JFED 4BY3A 4IIHA 4UOW0 4CVXB 5IUCA 1U93B 5JMUA 4XR8C 2P1YA 1VZIA 2UWEE 4RETB 3QJOA 2A4ZA 2VENA 4XIAA 1WKEA 1OCQA 3UROR 1JQXA 3CZLA 3G04A 3M1BB 3MP4A 3L95A 4DAGH 2P7TB 3GUTB 1GZPB 4F9LA 5EL1A 3QC3A 1RZ7H 2HWZL 2E7LA 1ZV5A 1J0ZA 1H0DB 1N19A 2IDTA 5E08L 1DWJM 4W7UA 5EBLA 4HJFA 3MRRB 4HDIA 1IM3A 2JLLA 1GTNA 4MDJB 3TA3B 1J9CT 4DGYL 5FJRA 2O5YL 1MCWM 4RMQA 2CLEA 2QQLL 3PHSA 5CJ5A 1F7BA 2C4FT 1D5XB 4ZQOA 4NNAA 3CL7A 4Z7WF 3FSZA 5GGVH 3EH3B 2CFFA 2R1KA 4DH2A 3GNXA 2IJ0C 5DK0B 2PYEB 5BOJA 4NT0A 4HVXA 1NCWH 5CEZD 3BVTA 2E3ZA 4CDHA 4D9QE 1TPC1 3PFRA 1GVSA 3CTLA 2IAMD 1MJ7L 2V6HA 2Z8RA 3QIUB 1QD0A 3GEFA 1MEHA 4R5EA 3AYRA 4ELMB 8FABA 4Z78B 3W25A 4M6QA 5HI4C 3QJFB 2MIZA 4PRHA 1GYMA 3T65A 4M4PA 4UTUA 2CGRH 4Z7UF 5I6OA 1H1ZA 1NSNH 1CZ8H 4G83A 1MPAL 3NFSH 2ODOA 4BCXA 4UFMA 1IYXA 2JKSA 2NV9A 3UTQB 5FCUH 1WFTA 3FRPB 2YKLL 3D39D 1YPZE 3O6FB 3VXUA 2QKIC 4L8BA 1XR8A 1XISA 5D5MB 2QT6A 2YAOA 4J3TA 4PMZA 3S5NA 1XINA 3KD4A 1EDTA 3KVPA 1RUQL 1JGVH 3I50H 4L8SB 4KX8A 4WUUB 1ZBVA 3AALA 3RWCB 1IXPA 4XOAA 3GWQA 1E4KC 1MCRA 1U21A 2AEPH 1AGBA 2BP0A 2XWTB 3IU3A 3JUYA 2VN5A 3MREA 2IWFA 4NWTL 4Y16A 5L4JA 1T0NB 3DFTA 4PWEA 4LPTA 3O16A 4YSQA 2D0FA 3B8WA 2XFWA 2Z2AA 4LSSH 1RCXB 3NZPA 5LNSA 1I7ZA 3PP3K 4N87A 4Z6AT 3OYZA 2I27N 3IAQA 1TTJA 1SY6A 3E2RA 2Z1KA 4LANA 3VPLA 4JQAA 5A6BA 5EN2A 3A3HA 4XBPB 3MV8D 1ZJHA 3NCBB 4RDQG 3WLNA 1FFPB 4G2AA 1W3KA 1A5SA 3WTWA 3UP1A 4C56E 4B9GA 1DKWA 3DERA 4URTB 4NQCD 1R3JA 1S9VA 4P5TD 3W9EA 1DDTA 4AL8L 2H6RA 1EEYA 2JK5B 4BWWA 3VD9A 3KLLA 3MQTA 4XZMX 1CR9L 5IKCA 3DXIA 1NAMB 3AWEA 3HE6C 3W2NA 4UTTC 2VYRE 2FBOJ 5DMIL 4H8NA 2DM4A 4GVFA 4IH3A 4TSBL 2XQBL 5I8CA 4MWAB 5J13C 3TROA 1HS6A 2BP1A 4PTUB 2ED8A 3BEVA 5E9DA 4ZA0A 1RZQA 2BFVH 4P9MH 1I8IB 3C3UA 3WF4A 3P60A 2HV5A 4U1HB 3U7VA 5INCB 4DIXA 1ORSA 3MV01 1KB9K 3O8XC 4ODXA 3KH4A 3AAZA 4LPCA 4HPNA 4R33A 3WL1A 3IDNA 5HQMA 2Q6WB 4IP7A 4O17A 3CFCL 5KYYA 4X2RA 4QRPA 4WK9A 1N7KA 4CQAA 1NGZA 4M7KL 1I1CA 2GK0A 4LS0A 3RI5K 3QW4B 3WOVA 2AJZB 4AHOA 5J13B 2WWMD 2QLYA 3RLSA 1REIA 1OC6A 1JPTL 3JTTA 4PJEE 1YNLL 1WS8A 3TT1H 2NXIA 3NVQA 2I5QA 3VI2A 4Y5VB 3UAJD 3F2CA 1OVZA 4KDTA 4V1DB 5AVUB 2MCG1 4PFMA 1WFNA 1G0XA 3IMSA 3HS8A 5CCHE 4HWNA 1Z2KA 3WDRA 2BP8A 4R2GB 2R69L 1CI1A 3IFLL 2VHLA 4PJEA 5EU6D 3FFCA 4ZFQA 3A5VA 1X5KA 2ZBTA 2CLIA 2Q8LA 3F7YA 1FO0H 4AJWA 1WXJA 4PTVA 1W3TA 3FN3A 2J8TA 1VBRA 2Z1BA 4E0RB 3CVBA 1NBCA 2ZX5A 5AL0A 3SODB 1MYRA 1TVBB 4TNWF 4RGMB 4TVPH 2Y3AA 5JHDE 4FF7A 4YXHH 1X7FA 4EO5A 2CNYA 2NNFA 4M93B 1B4RA 3WF1A 3PJSA 3TXAA 4ZUVB 3ZGIA 2I9LA 4IOIA 1NDYA 4K3EH 4RFOL 5ICXB 1H0IA 2F53A 5I0VA 4Q4MA 2FL5B 2XZCL 2ZOUA 1PZ1A 3DVGA 2AJVL 2XT1B 4RGND 4UFHA 2JH2A 4P46A 3SYOA 3ZMEA 5C0JB 4LHJB 4PV9A 4PGCA 5BZDA 5KSUB 3GDLA 4HWZA 2Z91B 1ZT7B 3MLXH 1ACZA 4I5UA 4X5WB 3FU8A 3BJSA 1XQLA 5CIPH 5F2MA 4QSFA 4L4OA 2DW7A 2BW5A 4WO4C 4NAQA 3SCNA 3W3OA 4P2QD 1ROCA 3UXDA 1J2WA 1B31A 3HNVH 4Y4KD 3R7MA 3CL8A 3W1NA 1XRTA 4CCZA 1EJUC 4J6RL 4AVHA 1VRSA 1WVZA 2ZG1A 5IMMB 5GJSL 4ZUVA 3WDQA 2WUCH 3D3VB 3VXQA 3WFLA 2ARJQ 2DLHA 4J28A 1XWVA 3C12A 2XWXA 1DQDL 1WOAA 1MUJA 1N8ZA 3BFWA 2H6PB 5DRXA 1F2XK 1BF5A 2CKBH 3MBEA 2CHRA 5AVTB 3OO2A 4GKZB 5J57B 4X22A 3FRPG 2PCFB 1EDQA 2X4TB 1T2JA 1PKLA 2PTTA 1QG3A 4WKFA 3UAEA 3LOWA 1ZT4A 1JXGA 3ILPB 5E5MB 4P06A 4J2QA 3KPPA 2WNWA 3CYVA 1JGLL 4DUOA 3AIVA 5ABTA 3U1SH 1AGDB 3W56A 4G8IA 3LEXB 2EEDA 1WBHA 1WC7B 5T3XL 3RGTA 1IB5A 4QTHA 1TCRB 1FF5A 3U6WA 3WK0A 2YDSA 4UTKA 5CJNA 5FSDC 1AH1A 3VXTB 3MI3A 4N2LA 3U6RB 5DJDA 3BPOB 5JXEC 2BC4B 4CQDA 3M45A 4IBLT 2A74A 4EEEA 1GSKA 5FECA 1CFVH 3CL6A 3TJIA 3LY6A 4AH2B 5I1IL 1XF1A 3QIUC 3VQ2C 4IK7A 3NPSC 1E15A 3TEXA 1HEJC 3AU6A 3V0VB 3ZO0A 1UQYA 1RZ8B 3LRGA 1YEYA 4TUOA 1G7UA 5LKYA 2YXVA 3PWPB 5DMGD 3MV9D 3WQOA 4JFXA 3M17B 4LS1A 4N8UA 2Q71A 3EO0B 1U8CA 4DNMA 1W6WA 2C9PA 1PZDA 3C5SB 3A4EA 1I3RB 1PSKH 1OZTG 3MMUA 3W1XA 3FOLA 3AQDA 1LK2B 3KZSA 4S2SA 3IFPA 4LCRA 3DBXB 3DOSA 4AV0A 5I8CB 4MWAA 4FJ6A 4PJ5B 2PETA 4NWUL 1WAPA 1W5QA 1R3IL 1KY6A 3KPRE 4JHWL 3C08H 3C2VA 5FHAL 4NASA 3TZVB 4GKSB 5AHIA 2MANA 2YZRA 4L8DA 4XZHA 3HZKA 3S35X 1K6QH 1BYPA 4GVHA 3SCMA 4M1RA 4ZD3L 1MN4A 2HJPA 3KPOB 3ZIMA 4G71B 1P4CA 1H8NA 1KYUA 3QG6A 4O5LH 2KZ1B 3WFAA 2P80A 3KPTA 1TNMA 2RFGA 5D9MA 4B92A 3ISRA 2GABA 4APQA 3SB0A 1YYCA 3PULA 2F58L 4HNOA 3L2LA 3TX4A 1KGYE 1LYQA 1C3FA 5EMLA 5EY5A 1H6FA 2QHRH 2YUWA 1AQFA 4MCZB 2XWZA 4I48A 3EWBX 5A95A 1U8IB 1K77A 2Y6SC 1WYIA 4XZUA 3WKYA 2J4GA 1MCOH 2GPZA 3NA9H 2HTLD 3FSWA 1TQCC 3FZUC 5HJ3A 3TF7C 4PBEA 2BCMA 1T5WB 3OB0H 2CJUL 2ZG3A 3QQ9D 4LLDA 4L9ZA 2OSLA 5FYKU 4O1EA 4FALA 1KCUH 1QFHA 3QUMA 4WVRA 3US9A 1ZHBB 1A9EB 3WTSA 3GC4A 1XR8B 5E99H 2MCAA 2IKIA 1QNPA 4XP4L 4B4HA 4KRPC 3H12A 3IANA 1ZLSL 5T3ZH 1H7WA 4D6IA 1K6AA 5ABAA 1NDWA 1G67A 2J6XA 2NQHA 1MNUL 5DJ6A 2EYTA 4RA0C 3GJFA 4C6LA 2DSWA 1UKQA 2Z7WA 4PUEA 3D6NA 1ODUA 4GW5A 3I6EA 5IRPA 3AMDA 4WAFA 3D3FA 3WF2A 4MXQD 5BRPA 3K2GA 1FWTA 1O5KA 4P8XA 2AVGA 3L66A 2R1PA 4KIRA 4M7ZB 1YDPB 3Q8AA 5TDPA 5JPNA 2D3JA 3EJPA 4PJ8A 5CEYB 2I5GA 2C4FU 3SDDA 3NT0A 3FB8B 5F6IC 4AZ5A 4HT1L 3QPXH 4N8VG 5AG8A 2YFOA 3LS5L 4JRXA 4XNAA 3UBHA 1TU2B 1ZDSA 3FUNA 4DK6A 3OIXA 1M7IA 4RDBA 4QCIA 4X5QA 4KDTC 2VEPA 2X1RA 1TKKA 2G96A 1T8XA 1KF9B 1Y18B 4GQBA 3DUHA 1W72H 3OAUH 3SBFA 2FCBA 5IQMA 3B56A 3DV4B 1ZVYA 4NJHA 2XZQL 3B9DA 3G6JE 1FZMB 1COBA 2HPIA 5L8JB 1SUJA 4OT7A 7PTDA 4HK6A 1NMAL 2LTQC 5ESVB 3X11A 1KDIA 3GKWH 1SLXA 2KX9A 1G4SA 2BSTA 2X6UA 5MERA 1L9WA 3SKUD 3VDGA 4LSSL 5IMMA 4PVNA 2Q20A 3FDGA 2GWGA 3U4AA 1OD9A 2FJFB 4MJIE 3SO3C 3O6CA 1UOLA 3T0VA 5DEGA 4JTQA 1ZHNB 5CSRA 3NQ7A 4F40A 1KW1A 2G41A 1NLBL 1OIOA 3BGFB 3MOBL 5FFGA 3IJYA 4F7PB 1DLFL 1P9MA 1UZ4A 4PJ9C 1QP1A 3P0VH 4HK0A 5EV7A 1DUZB 3AS1A 1G9NH 3ZTNL 2EIMB 2PGWA 3DYMA 4YHYB 2VLMD 4S3DA 3TCTA 3JWNE 3QQDA 4K9EH 1ZLVH 3H2PA 2Y6ZA 1R2TA 1HU8A 3QC5X 3AQYA 3P5ZA 2XV3A 3UJ2A 4HKZA 3ZJ6A 3S1XA 3KOWA 3L3DB 3D85A 3MUIA 1JNLH 3UY8A 3UXLA 2HYMA 2P5ED 2H3BA 2EDXA 4CNTA 4XVOA 5D4QA 4AGNA 4G80B 4PWKA 2XFFA 3G3DA 5ID1A 3PAZA 5FA3B 3O0LA 3MP3A 3DX3A 1NBVH 3EO1A 2HLFD 3TCLB 4AZBA 4RSVA 5JPMB 1NMBH 5DFAA 1NCOA 1OC7A 5FJUA 3RR1A 2LLLA 4O2CA 3QIWC 1VH7A 4G7VH 2YXGA 2J4WL 2VX6A 4WCYL 4KJQD 5C0CA 4UIKL 2PBGA 2NDGA 3LX9A 2DVXA 4LXFA 4IIBA 4C47A 1XXFC 4XN2A 3STBA 3EKLA 3HUJE 1QHPA 3U7AA 5KJ7E 4HC1L 5JQIB 4S3EA 1NM9A 4WU5A 3CAKA 5LIWX 3V9CA 3QSTA 2FEJA 1OFQA 5BJTA 4XAKE 1XHHA 3OKMB 1HXMB 4KY1H 4A7TA 5BMFH 4IDJH 5K59F 2IPGA 3WS3A 4NFDA 4OCLC 5F7HA 4JRWA 4S3AA 4DWSB 5JPMA 3STLA 1H1YA 3NDOA 5E6IC 2R69H 1JGMA 1PGRB 3UOAB 4JRXD 5DR5L 3WEXA 3AI0A 2HPOA 1SMAA 3QFDA 1FA2A 2MPAH 1M2VB 4ERIA 1U95B 5EUOE 4YFEA 4DGVH 1W17A 2Y62A 4MQTB 1IFHH 3PG9A 3M46A 5DYOA 3FU3A 5C0DA 1C5DB 4I89A 1EUNA 4N4QA 2K6WA 43C9A 3RX7A 1ZA6B 2B39A 2QDGA 3E0IA 5TQ0L 1SR9A 3NEXA 3UZXA 4K37A 4RISH 4C4BA 3F5KA 3KBJA 3MTRA 4I0PA 4JZOB 2DPEA 4ZMYA 5K33A 4PJGA 2DMBA 4F7EA 3VXRD 2D9QB 2J88A 1CLZH 2DH2A 5IBTH 3NL6A 2WQSA 5IKCB 3A4AA 3F4NA 3WQWA 2G60L 1V54B 3KYNB 3R18A 1IR1A 1VPYA 1WA2X 2IAAC 1T40A 3SCQA 2QPEB 3KVDD 2VXUH 3VNYA 5IW1A 3OLDA 3AICA 1FFPA 3KXQA 1KPUB 2WLHA 3W9DA 2YMXL 1U8JA 1QCWA 3C6SB 4XAGA 2OW6A 4QKXB 1QU4A 4HUVA 3UESA 1AGEA 4WQ6A 4AD3A 4ADJA 1IE7C 3CFEA 3GFUA 4JJHA 2FATL 3EO9L 3S34H 3GMMB 2PO6D 1ROWA 4PJHF 3JV4A 3GVGA 3TFKD 2VDOH 4R7WA 4G11A 4FI7A 4TLUA 1GOFA 5D72H 3VFTB 4PFHA 2P8PA 3D2UB 1J8HD 3ZTEA 5HYQB 4IFRA 1EERB 1F5ZA 4Q4PA 1UA6L 2DLIA 3SDDB 1A7OH 4HSOA 4RZKA 5GZOD 1NC2D 2J88H 1IT0A 2PP3A 3EIFA 1RZGB 4UV7H 1J10A 3NMEA 2BNJA 4RNRB 3HI6H 2OR2A 4FQPA 2W5PA 1DN0B 4JUSA 4OZHB 5HHVL 5FUCE 4BSVB 2QCGA 4K8GA 1OQXA 1YYMH 3EG9A 5IQ7L 3BSZH 5D1ZB 1VFHA 4UWMA 2C9VA 3R19A 1S7UA 2ZUMA 4F80A 4PWJA 1TWIA 3LRMA 4U1MB 3NPXA 1EZUA 2DQTH 1WGOA 1F4XH 5INDB 4UCFA 1KYAA 1YNPA 3VE7A 2IGLA 5KVDL 3GS7A 4HIIA 3RVUD 2REQB 2YPKA 2EADA 2DQHH 4MKMA 3UEZA 4ELDA 1PCWA 5LSMA 1H60A 1YJDL 2QFPA 4ODVH 3RUGB 5I1IH 1GVOA 1IWBA 1FNLA 3X12A 1PE1A 1R3YA 1OCCB 3LKNA 3EOUA 4MYAA 4P5MA 5F7LB 3GR4A 4QYOB 4MIMA 3KTXA 4XPGL 2FQEA 3IJ6A 4R3SA 1R4XA 4CSSA 3LZNA 4PJAA 3V1HA 3QHMA 1J1OL 5F93C 5F4WA 1FYTA 1RERA 1KB3A 2G5RA 1FGNH 3O4OC 4XCNA 4QIRA 3DK2A 5CSGA 3DUSA 4RFNB 4BR1A 1BVLB 1FVDA 2WWOA 1MQKL 1NQ6A 3EADA 2DZBA 2VD8A 3CVIH 3U4EA 4AQZA 4DJEA 1GHSA 1FWIC 3WKZA 3F5WB 1YLBB 4WFGE 1RZJH 5EULV 4XCCH 1R3IH 5I3HA 1QW8A 2VL5A 1LE5A 2CO1A 8PAZA 3BZGA 5IHRA 1X5LA 2CKBL 3CT2A 2Z27A 5DD6B 3TYGL 3KJ4C 1HQTA 2XG5A 3PUUA 4OLYH 5DLML