1RPOA

Restored heptad pattern continuity does not alter the folding of a 4-alpha-helical bundle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
61
structure length
61
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP PROTEIN
publication title Restored heptad pattern continuity does not alter the folding of a four-alpha-helix bundle.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 29
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rpoA00
1RPRA 2IJHA 1F4MA 2GHYA 4DO2A 1GTOA 1B6QA 1F4NA 1RPOA 2IJJA 3K79A 1PD3A 1ROPA 2IJKA 2IJIA 1GMGA 1NKDA
chains in the Genus database with same CATH superfamily
1KQSU 2DW4A 2CH7A 2ITDC 3OTFA 3OTOB 1NTKH 3A0BZ 3ETQA 5HFMA 1X4TA 3O9OA 3OUSA 1OCRB 3CCLV 1WP7A 5KA6A 4FFBB 4QPKA 4B7KA 3AG4B 3QO8A 5EK0A 3JASA 3CC7V 3L71H 2JJ1G 2OIEA 1Q81W 1NVPB 4DV7B 1SQFA 4FLUA 1KKDA 4YJ3B 1QCEA 3ABLB 2LW1A 3X2QC 3LNNA 1XEQA 2QGNA 4PV1B 4NVPA 1Y74B 3RT3C 4LF8B 1MG1A 4GX0A 1KC8W 4C7UA 2IU3A 3WB2A 1I94O 1H8EG 3CCRV 4U3FH 3T2MA 3A0HZ 4LFBO 4NXNB 3DXRB 4QIWF 1Y76B 4MVMA 2QR4A 2UXCO 2CUGA 4PA7A 5JJNB 5LBQA 3QTCA 2XT9A 2DQ0A 4LF4B 2A0LA 1R73A 4NB5A 2B5UA 3FB5C 3OGCC 4JI0O 2XHBA 3HKEB 1OCZC 1XNQB 4DV3O 2UXDB 2GSMB 1NS1A 1YCIA 4E4EA 1Q6IA 4GLXA 2YUAA 1BT8A 2RCVA 1JOYA 1AB3A 2CE4A 1R6NA 3HKDB 4DV0O 4WCEV 3K5OA 1S72V 3Q4HA 2D3OW 3FB6C 2ADPA 4LNUB 1BE3H 1AP6A 4DV5B 3SYQA 1N32B 1G8MA 2IH1C 1JFFB 5IJ9A 1HR0O 4J7JA 4CH6A 1V54B 2VQFO 3F7VC 4NTYA 2W0FC 1YTFB 3AK1A 1MZEA 1PNMA 2Y69C 3ABTA 2HG5C 4PA4A 3N2GB 4FLYA 1OCRC 2QWPB 4EB6B 3DGEA 1YZBA 1IXBA 3AG4C 3MD0A 1VQ9V 4L87A 5CA1A 3RYCB 3ABLC 2Q67A 4LFCO 1PPJH 4KFMA 4HYOA 1F4MA 3BCCH 1SC5B 4G28B 4ZOLA 1E1QG 1WPXA 4PA9A 4X1IB 2MK3A 3BA8A 3E22A 1O9HA 3IC7A 3OFNG 3UKMA 2E5LO 1IVSA 1M90W 3MDSA 3CCUV 2BSKA 1PP9H 1IBMB 2P5OA 1IBKO 4JI2B 1V55B 3M7MX 1YXBA 1AI7A 5C8YB 3ABKB 1EBOA 1JX9A 1K5SA 3JYCA 1FAFA 5LOVB 4DR5O 2UUBB 2WLLB 2OCHA 1K9MW 4X20A 1F7YA 1NI8A 3L72H 3RVZA 3FX7A 2ZE5A 4IGGA 2UXXA 4D6TH 3CCMV 2P22C 3ZIAG 4OX9B 1RFYA 4B3TB 4DV1B 2EIJC 3F5TA 1LNQA 1VQ7V 1BSMA 4LF6B 1ZX3A 4QE9A 2CTWA 2F23A 3IGAC 5E79Z 2UUAO 5JCOC 4JI1B 3CMEV 4JASA 2DE0X 1HNXO 1HDJA 4DW0A 2EZPA 2CDYA 2RJZA 1OCOB 4JZGA 4ZHQB 2XTAA 3WU2Z 5KUKA 3G71V 2OIGA 3B40A 1QVFU 3OMAB 2RDCA 4JI3O 3ZMSA 3G6EV 5CN0A 5KLVH 4CH5A 5JWPA 4UXNA 4QPJA 1VQLV 4A5UB 2CGOA 1XHZA 2LFRA 1US6A 4ASUG 1PNKA 1MZFA 4F4LA 3RBZA 4YIOA 2R9AA 2JRIA 4X8AA 3R65A 3A8TA 5LGNA 2ATKC 4PI0A 2YDEA 2W6IG 3T1HO 1I08A 1HWYA 1AI5A 4JGSA 4CS3A 4PI2A 4P9OA 1KD1W 1V55C 4DV3B 3ABKC 4B08A 2D2CB 2VRZA 4J80A 1QNMA 2DQ3A 3J80N 3CRCA 1M5IA 1KMIZ 1IXMA 1VF6C 1TVKA 4X1YA 4MVOA 3ICXA 1VQ6V 1VMGA 3B09A 1IBLO 4TQFA 1HNWO 4J7ZA 4YJ2A 1A32A 3LDDA 2P4VA 4U3JB 4O4LB 1SZXA 3WFVA 5LMUO 5D5PA 1XQ8A 3H1HH 1Q3EA 5FPOA 2X6AA 4ZI7B 2GTSA 2AZ0A 2ZE8A 4MVSA 3FB7C 2OTJV 5IWAO 4X65O 4IIJA 1NJIW 2JGDB 3ABUA 3T4DA 1OCOC 1K33A 1VQNV 2EIKB 4TOIA 2X7RB 3P32A 1Q5OA 4WFBV 4LFCB 1KKCA 4DV6O 4TT3G 4LWSB 5JVDA 3N2KA 2HHHO 4DR1O 3UT5B 4Q20A 3K06A 4JV5O 1NT2B 5AG2A 3OTOO 3B8MA 2E5LB 4TSFG 1WA8B 1I5XA 2E3CA 2Q4PA 3LSSA 2F4VB 4GX5A 3JAWB 3N27A 1GM7A 3CHXA 1XHXA 1S76D 3HPLC 2JJ2G 2Y48A 4FM1A 2QM8A 4BR6A 1GRJA 1RSOB 4PDLA 1P7GA 4GZRB 4QNHB 2ODMA 3W7TA 1VP7A 2A9HA 3QG5A 4LH7A 3EXAA 4LF8O 2NNUA 4K0KO 5H6QA 1FJGO 1ROPA 3RYFA 1PL4A 4R6ZA 1Q7YW 3K0GA 3SJBC 5KMGB 5LMNB 2EZOA 4OXSA 4NXNO 2EULA 1E79G 2BCCH 2XAQA 2VWJA 1KP3A 4H37A 4YXWG 1QBZA 1XMQB 4LF4O 3ZCCA 1U96A 1H2MA 1AJNA 4FLTA 4U7OA 2ZKOA 1XNQO 3JSLA 2UXDO 3LDEA 1EZVH 5EC2C 1WNSA 3FYIB 4DO2A 2LO1A 3BEHA 3VQXA 5KX5B 3CPWU 2FMLA 4JYYA 2KKWA 5IYCO 3GWKC 3OAAG 1F4NA 2EIKC 1I0HA 4DV5O 5H6RA 2Q0OC 3LSUA 1R3JC 3ZRXA 3UM7A 5LHIA 1BCCH 4PELA 2WLNA 2ZQMA 1J5EO 3HKBB 3ZN1A 2ZD9A 4JF3A 4TV8B 1H2GA 2LW7A 1BZKA 4MW8A 1S5LZ 2GTAA 2GHYA 3QO5A 1NTMH 1ENVA 4MT8A 3SYAA 3ZHUA 4GT1A 4CS4A 3EHBB 3RGBA 1M57B 3KCYA 2W6JG 1SESA 3FAVA 1H2KA 2BTQA 4WF9V 3JARA 1NKDA 1F23A 1I7FA 4DR3B 4HNAA 4JTCB 3SR2C 4O4JB 3RYHA 2WWWA 2GBOA 3CMAV 3ZRWB 5EBMC 1VQOV 1SQVH 1B3QA 3RYIA 3CJHA 1IBMO 2ZE7A 4FK5C 4JI2O 4DV4B 2JDIG 5DN6G 5FL7G 3CRAA 3GB7C 1QLEB 3ZRVA 1FS0G 5LHHA 2UUBO 1AP5A 1WPBA 1JQ0A 3H1IH 3S3WA 1FYJA 1UJWB 1VIBA 4O2AB 1PV0A 1N0NA 2YIBA 1JCHA 3OM3B 4FZ0A 4GCZA 2YI9A 3AG2B 5KUMA 4JI7B 1WAZA 4W4KA 1GM9A 3ZX6A 5L3CA 2AZ2A 4OX9O 3T1YB 5EYPA 5JH7B 1K4DC 4B3TO 1NZ6A 3OR6C 5CMUA 5CB4A 5GTIZ 2IBZH 4LF6O 4TUYB 3D3IA 4UVAA 5CBGA 1HNZO 4RWUA 4JI1O 1KP2A 5CA0A 1W2BU 4UCVA 3H9VA 3SJQC 4I0XB 3BVOA 3JD2A 1W59A 3B77A 1PNLA 1AR4A 3K5NA 3SYPA 5J2UA 4K8ZA 1PL0A 3K79A 4I50B 5IJ0B 2GV9A 1ZL8A 4WFAV 1URFA 3HKCA 4I55A 5IDJA 5B5EZ 5IYZB 1DF4A 1M57C 4IL6Z 1MA1A 1OZ0A 1WLEA 3C3SA 4CS2A 4K0KB 1FJGB 1K97A 5LP6B 2H8PC 1SS3A 1Q82W 2ZDIC 4H0LB 1TUBB 1OV9A 5IT9N 1PM9A 3W7UA 1Y67A 2XAJA 3ETGA 2WA3A 4LC1A 2ARHA 3IC9A 4DR2B 4RQEA 3ABMB 2H94A 4DV2B 3BA9A 3CS5A 4MVQA 4UUJC 2JS3A 1JR9A 1IX9A 4FZ1A 4NTWA 5JQGA 5J2TB 5L3BA 3TXSA 5CA3A 3L73H 1QLEC 2Y0PA 3C3TA 4W4LA 2B1IA 4R7CA 3JATA 1TUEB 3JAKB 4NR1A 2DWEC 2LGWA 5EIBD 3AG2C 3U11A 1M93A 3AEIA 1N8RW 5GTHZ 3RFRA 2WAMA 3GWOA 3MHSC 4FLWA 3OD4A 5J9PC 5LXTB 2HKOA 3DTUB 1J5EB 4YHHB 1GO3F 4UV9A 2UU9B 4K35A 2KG7A 2QWQB 2B1GA 1XOUA 4O4HA 4HBNA 2XAFA 4PD4F 5LGUA 2HLDG 2MW2B 4TV9B 1XI1A 1FFXA 2E76B 2OCCB 1FXKA 4JZ2A 4OPHA 3H01A 4B3SB 1VQMV 2A3QA 4KUMA 3TK1A 4KP4A 1K5QA 2F1MA 2LGQA 4P30A 5KAFZ 4R8CA 3E83A 3P3PA 2Q6AA 4X1KB 4PA6A 1Y4MA 2V4DA 5K1PA 2F4VO 5D5QA 3K04A 1EN6A 2GUZA 1F51A 3C90A 3AG1B 2DOSA 1WP8A 2ZE6A 1K8AW 2QE7G 4LCUC 3PN1A 3AG7A 1RP3B 4KXRA 1AJQA 4I9WA 4WFFA 1G4YB 1U97A 3LDCA 5FNVA 3ABMC 2GDSA 4NYKA 5EBWC 2QEXV 5KHKA 2XOKG 2FKXA 1VF7A 4CBCA 2DWDC 3CRQA 2AHYA 5BMVB 1NQTA 5A9GA 3K59A 2Q73A 1H8HG 4BWAA 3DC6A 5LMNO 2E74B 2XUMA 4FIPC 4IYIA 1DK1A 1QHTA 3L9DA 3E86A 1BMFG 5KHJA 1AI6A 1S3JA 1RM1B 5ITZB 1XMQO 4F6RA 1Q90D 4GKJO 1HNZB 3CCSV 4U7NA 3TGUH 5DECA 2QTSA 1E1RG 2CH7B 1PKXA 1GN2A 2EX3A 2F43G 1V54C 1QVGU 1XL4A 3STLC 1THZA 4J9ZB 1HP8A 1YJWV 4JAVA 2JK5C 4LFAB 1N34O 1KECA 3JASB 1ZWIC 4MSWC 5CBHA 3E8FA 1GTOA 1P4RA 2YC0A 3SPIA 4EKWA 3E89A 3CCEV 1CEZA 3W7SA 1RPOA 1JVMA 3ZEDA 2OCCC 3L75H 4IT5A 4BW5A 4WFEA 4FLZA 4X66O 2VQEB 3M8AA 1N33B 2YXYA 5IE9A 1ORQC 2A06H 4O2BA 3SPJA 2NN4A 3TJTA 4ICGA 4GKKB 2YEVA 1TAEA 2E75B 3JALA 2R9RB 1OHHG 4FM0A 3H1KH 1IURA 2R72A 4ZKIA 5C93A 3AG1C 1EM1A 2IU0A 1UPGA 3ZHQA 3DSQA 3CCJV 2XAGA 2EILB 2RQ6A 4MS2A 2ZT9B 4I4TA 1SA0A 1L0LH 1SF9A 3ZMUA 4E2LA 4DR3O 2OWOA 5LA6A 3ZMVA 3TXQA 3AK3A 3B4SA 2WPDG 2NLJC 3M99B 3H1LH 1SERA 3ZHVA 3FFQA 4XDJA 1QLNA 3Q4HB 4UCSA 2WLIA 1AR1B 4IHJA 4DXWA 4DV4O 1AVMA 3AK2A 5GONA 1XL6A 1ZLZA 4WBNA 4O4IA 5IJ9B 1RM1C 1S77D 1Z5WA 2YICA 4L8JA 1K92A 3D36C 3UO3A 1NTZH 2HR3A 1V9PA 5TISZ 1ZSPA 4TQDA 2QTOA 5EZYA 1SKVA 1N0JA 2FTKA 1VQ5V 1FFTB 4DR7B 3TETA 1MSDA 4JI7O 1AR5A 4DK1A 3VQYA 4DRXA 1LR1A 1T5EA 1EN4A 4EEQA 3T1YO 2HJDA 5B1AB 2ETNA 1XILA 5CA1B 1N36B 1SQXH 2NR5A 4AHCA 1L1FA 5B3SB 4EFEA 5LYJA 1M9NA 4P2ZA 2X6CA 2JGUA 3QO7A 1MNGA 2CTPA 4CH4A 4ZOLB 3J7AU 3CRMA 4UV8A 3T4ZA 3PJSK 4P9PA 4RUFA 2LQTA 3E22B 2HVKC 1YI2V 2C2AA 4KL1A 4AI8A 1BQZA 4AILC 2BSKB 3P30A 2QM7A 3RWRD 3L70H 4FFBA 1NR1A 2R9IA 1BHAA 5EIBC 1VARA 3WB0A 4YY3O 4LF7O 2XNDG 1JPXA 1MABG 4YJ3A 1OCCB 2A7WA 4N21A 3OGIB 4GUNA 2EILC 2QKSA 3ETEA 4X20B 5JJEB 1S5JA 3DC5A 4KHPB 1I5YA 4NKGB 1XMOB 2YIAA 4UCRA 4CH3A 1Y74A 3VBBA 4B3MB 3CRRA 1D5AA 4DR2O 4LF5B 2WLHA 4DV2O 3D8CA 2BOBC 2L35A 1SQQH 3DXRA 4GKJB 4FJCC 4QE7A 1YHQV 2M6YA 1Y76A 1MMMA 5FLXN 1AI4A 5BR8B 3E8HA 2ZNJA 1AJPA 5L3DA 3ZN0A 2RN9A 1GN4A 4DUZB 3FYEB 1N34B 1NU1H 2AXTZ 4FLXA 4QJFB 4BIOA 5L3EA 3HKEA 2AGAA 3F5WC 5GW7A 3CYOA 2UUCB 3LNMB 1FPOA 1L8DA 2KSDA 4BAYA 4X66B 3HKDA 2IJKA 3CSXA 4LF9B 3QF7A 5B1AC 1AILA 2FYUH 4LNUA 2Y4UA 2W0XA 5B3SC 2HEPA 1D5NA 4DYLA 4YHHO 2F93B 3LUTB 2UU9O 5JCOA 1Y66A 1JFFA 5KAIZ 4JPRA 4JTDB 3CEIA 5H2FZ 3ASOB 3ZHTA 3JD0A 3STZC 1R3KC 4JI4B 3N2GA 3MHHC 4B3SO 1QR9A 4EB6A 4GX2A 4X64B 2M7WA 2RMKB 2JEUA 2YXHA 2IM9A 2JS5A 4N23A 3SYOA 3HB3B 1K34A 5LGTA 3RYCA 2CK3G 2Q5ZA 1NR7A 4R50A 1TVKB 4X1YB 5KA5A 2P6JA 5LL6Y 4UCTA 1VF5B 4X1IA 1GKFA 4K3AA 4YJ2B 1VQKV 3K0DA 1SETA 3IAYA 2QSAA 1GMGA 3SYCA 5IYBO 4H44B 4MVRA 4I7ZB 3CC2V 1JMKC 3A2FA 1Z5VA 1DGSA 5C8YA 1JJOA 4IIJB 3SDLA 3CX5F 5LOVA 3THOA 2WLLA 3WG7B 1GN6A 5EBLC 4DUYB 1D2DA 1VF6A 1K3EA 2HJFC 2XAHA 1BS3A 1R1BA 4WFHA 4JI5B 2QA4V 2AHZA 3ZMTA 1S0VA 5JVDB 1DTOA 3N2KB 3E8GA 2EINB 3BY6A 1M56B 1KYOF 1FD9A 1W0JG 2Z3YA 3CXHF 2YIBD 3SGIA 5L3FA 3K5LA 2A79B 4LFAO 2ADQB 4MTFA 2Y69B 4I5SA 1YSCA 2Z0AA 4JI6B 3TCUA 3U10A 4ZHQA 3CC4V 4JI8O 3ASOC 4RUEA 1SQGA 3OT7A 4YY3B 5BY1A 4LF7B 2QJ1A 1P49A 2O57A 2UXNA 2VQEO 1N33O 2JEXA 4GX1A 3P3NA 3E2EA 1WB7A 3RYFB 3RVYA 4JV5B 3T1CA 1SZTA 3E8BA 3ML0A 2PI4A 4XDKA 2IH3C 4GKKO 2P67A 4DR4B 3K5MA 4RQFA 4PDMA 1XBLA 1VQ8V 2QDOA 3JAMN 2N74A 1KB9F 3U0ZA 1CXZB 1ZAUA 4JYCA 2WLMA 2PYLA 4RO2A 1NH2D 1K73W 2Q0AA 2WSSG 3BABA 2AW9A 4IYHA 1FXVA 4UB6Z 1TA8A 2JVDA 5FPRA 1BGYH 3CP1A 2Z5UA 2CAZC 2DN9A 2UXBB 2Q69A 1XNRB 2XASA 3WG7C 2ZM6B 3K03A 1YJNV 1Q6HA 2P7TC 4D7SA 2WLJA 3ZHRA 4ZIBA 3LSQA 3J81N 1EZJA 3G80A 4MTXA 3ZHSA 2EIJB 3OUFA 1QU7A 4U3JA 4JYAO 4O4LA 2EINC 5EC1C 1GN3A 2P06A 2ZINA 1M56C 3K57A 3AG3B 1MOFA 1YITV 3BFRA 3CXCU 3CCVV 4ZI7A 1S5HC 4X89A 4DR7O 1L0NH 4FLVA 1XDCA 4X62O 2JGDA 3KZIZ 3ZS8C 3FAVB 1ZTEA 1N36O 2BTQB 4Z1VA 3JARB 3RW0A 2WLKA 2QWNB 2CGNA 2DJVA 5LP6C 4HNAB 4CC6A 5IY5B 5HFLA 3O65A 4LWSA 3RYHB 1FXHA 1EN5A 2PZSA 3G67A 4B3RB 3H1JH 3UT5A 4OPAA 4ZBMA 4RAIA 4F6EA 1YJ9V 2BOCC 3RYIB 3CJHB 3JCUZ 1MSWD 5KHIA 4JYBA 5LHGA 1WA8A 4LBEC 5KHHA 3ZMZA 2EJRA 3JAWA 2FL4A 1O9GA 1GH6A 4MVZA 2JIZG 1VQ4V 3HR0A 1K7DA 1RSOA 1VQPV 3OEHG 4Z2WA 4KHPO 2HVJC 1XMOO 1GAXA 3W7XA 1KUQA 2R70A 3VQVA 4B3MO 1ZUQA 1H2SB 2F66C 3CD6V 1KU9A 2K1EA 2ZIOA 2BE3A 5H5NA 4PA3A 3OR7C 4H33A 4LF5O 5EYPB 2PUSA 5KMGA 4DR6B 1VEWA 2OTLV 2BTOA 5CB4B 4JAUA 1K4CC 2N05A 4FFKA 2KQXA 3JSNA 5BR8O 2DMXA 5CA0B 3JD3A 1KBHA 1YEWA 1SQPH 4DUZO 1Q8IA 3F7YC 3UO2A 4NXMO 3ASNB 3RN4A 2WA4A 3AG3C 4EFBA 1YVWA 1XUQA 5J2UB 2L6LA 4JI8B 3NXSA 2UUCO 1ZL8B 1Q6UA 3HKCB 2V7QG 4I55B 5KX5A 1YDXA 1HW7A 4MW3A 3CCQV 4HAMA 3K3WA 5H9CA 2QWRB 2ZR3A 1UFIA 3BRCA 1DF5A 3B2EE 4LF9O 1NH2B 3JD4A 2ZCEA 2PF4E 1PD3A 4MTGA 2QWOB 3APQA 5IY5C 3I56V 4UVBA 2OT5A 3KKYA 4BIZA 1I94B 1R6TA 3HKBA 4DK0A 5B1BB 2VS0A 3UQ8A 2IJIA 4JI4O 4TV8A 4LFBB 4J9YB 1Y6XA 4X64O 1JJ2U 2PTMA 2UXCB 3A0RA 5JQGB 3EFFK 2G38A 1X59A 1J95A 3S3XA 2YXLA 2Y0IA 1FKAO 1LUVA 1SRYA 3D3QA 2ZDIA 1QR8A 3VQWA 4JI0B 3JATB 1R6KA 4UCUA 3FD9A 2QM4A 3G4SV 4O4JA 2K9PA 2EIMB 1M1KW 4FM2A 2YSUB 3EVKA 3ZRWA 5E1AC 1CPYA 4HZ3A 1R3IC 1G6UA 4DV0B 5DM6V 2ZNIA 1W0KG 2YS8A 5K1XA 2Q9LA 1H2NA 2DYRB 4JYAB 4TWKA 2B9ZA 3ETDA 4AQYO 2KG7B 1HR0B 4DW1A 1GM8A 4FMTA 4O4HB 4BIUA 2VQFB 3ZRSA 1AROP 4DUYO 2P90A 2QKCA 4LR3A 4X62B 3APOA 3ASNC 3OE7G 1FFXB 4O2AA 1FXKB 1Q43A 5KHGA 5A2QN 4JI5O 4WFGA 3KG2A 1BQ0A 4Z1MG 1EFRG 2EJ7A 1P84F 2CTQA 5JH7A 2QKAA 2LJ2A 2Q7GA 4JTAB 1COWG 5L3GA 4GYCB 3IFXA 4TUYA 4UVCA 3SJAC 2GUZB 4I9QA 3E35A 1QQCA 1OJHA 2ZXWB 4JI6O 2FB5A 4I0XA 3SPHA 5B1BC 2YIDA 3CE2A 5FNVB 4J11A 3FB8C 2ZIMA 4I50A 4DV7O 3VOUA 5IJ0A 2H3OA 1IBKB 4PJ0Z 5IYZA 3UCSC 1WN7A 3K9AA 4DR5B 5LP6A 2EBOA 4DR4O 5IYDO 4PDVA 1RPRA 4G27B 4PHZA 4LH6A 1TUBA 4B7EA 1IDSA 3ZJZA 3I5DA 1NVPD 4UCOA 2EIMC 3SPGA 2DYSB 1Q86W 4F6RB 5B1OA 1YIJV 4JAAA 2YI8A 2PY5A 2PI5A 3BHPA 1H2LA 4XBFA 2DYRC 3K58A 2RNBA 4NXMB 2V1DA 2PGGA 1SQBH 1B6QA 1BHBA 5J2TA 2UUAB 2UXBO 4J7KA 3CB2A 5B1NA 3I55V 1XNRO 1HNXB 3FKSG 1NBMG 2ZM6O 4X88A 3W7WA 2IW5A 3JAKA 4Q6GA 4ABMA 3ZBHA 4FPPA 1FXKC 2F95B 2Q7EA 3JD1A 5JJJB 3QNEA 4JI3B 1JA8A 1M4UA 2ITCC 4UFZA 2N04A 4UB8Z 1XREA 1B06A 4O2BB 1DLBA 1WJZA 1R3LC 3SPCA 5LXTA 3MAQA 1N32O 2YEVB 3B8NA 4MVUA 1WB8A 4PDRA 3JALB 1TGOA 5BXZA 3CWBH 2Q68A 2HP8A 4J42A 2ZXWC 4D7TA 3OEEG 3OMIB 4TV9A 2ILMA 2OYQA 3SJCC 2VWKA 5CBFA 3X2QB 2X0LA 5B66Z 4I4TB 3JCZA 1B04A 1SA0B 2KB1A 2P4KA 3T1HB 1H38A 4LP8A 1OCCC 4CZZA 5LA6B 5F2VO 4CC5A 4X1KA 4B3RO 2Q8VA 3GVMA 2ZR2A 1YTFD 3NR7A 2CTRA 4NTXA 1N4CA 2IJHA 1GK9A 5DEDA 4J41A 2WLIB 2Y4TA 4IHJB 5BZBA 1YF2A 5GONB 3L74H 1P7BA 1Z2GA 4WBNB 4O4IB 1IBLB 4FVMA 2PYJA 1G1XB 1HNWB 4H13B 2DYSC 4AQYB 1CP9A 4YIPA 3KCXA 1OCZB 4J10A 4G2KA 5LMUB 5EZYB 3G6BA 4QGPA 3OMNB 5BMVA 4DRXB 2X6BA 5IWAB 4X65B 3K9SA 3BPZA 3R66A 3BAAA 4DR6O 4BW9A 4MTOA 4X9QA 3K08A 3OW2U 5LYJB 1BL8A 3IJ4A 3WB1A 2LFSA 1LUWA 2HFEC 2LP7A 4DV6B 3QVNA 4DV1O 5ITZA 4K8XA 2HHHB 4OGQB 4DR1B 2IJJA 1IZ3A 3D36A 4XDLA 2Q7HA
chains in the Genus database with same CATH topology
1KQSU 2DW4A 3ZMVA 2ITDC 4ZBMA 4RAIA 5EC2C 2WPDG 2NLJC 5HFMA 3M99B 1SERA 3FYIB 1YJ9V 3OUSA 1OCRB 2BOCC 3CCLV 4XDJA 4DO2A 3BEHA 5KA6A 1QLNA 4QPKA 1MSWD 3AG4B 3CPWU 3QO8A 5EK0A 4JYBA 5LHGA 4LBEC 3CC7V 2JJ1G 3ZMZA 1Q81W 2EJRA 1NVPB 2WLIA 1AR1B 1KKDA 4DXWA 5IYCO 1XL6A 1QCEA 1F4NA 3ABLB 3OAAG 2EIKC 4MVZA 2JIZG 5H6RA 3X2QC 1VQ4V 1K7DA 1VQPV 3OEHG 1R3JC 1RM1C 1S77D 3ZRXA 3UM7A 5LHIA 4PELA 2HVJC 2WLNA 2ZQMA 1K92A 1MG1A 4GX0A 3W7XA 1KC8W 2HR3A 3ZN1A 2IU3A 2QTOA 2ZD9A 3CD6V 2FTKA 1VQ5V 1H8EG 3CCRV 4JF3A 2K1EA 1H2GA 3T2MA 1FFTB 4MW8A 4PA3A 3TETA 3OR7C 4H33A 2GHYA 3QO5A 4QIWF 1ENVA 2OTLV 4MT8A 3SYAA 4MVMA 4GT1A 3EHBB 5B1AB 1M57B 1K4CC 4JAUA 4PA7A 1L1FA 5LBQA 2W6JG 1SESA 5B3SB 2DQ0A 1M9NA 4P2ZA 2X6CA 4WF9V 3QO7A 2A0LA 3JD3A 1R73A 1NKDA 2B5UA 3FB5C 1F23A 4UV8A 3OGCC 3T4ZA 3PJSK 4P9PA 3F7YC 1OCZC 4RUFA 2HVKC 4JTCB 2C2AA 1YI2V 3ASNB 2WWWA 3AG3C 2GSMB 3CMAV 3ZRWB 5EBMC 1VQOV 3NXSA 1JOYA 3P30A 2V7QG 1R6NA 2QM7A 4WCEV 1NR1A 1S72V 4MW3A 3CCQV 2R9IA 4HAMA 4FK5C 3K3WA 5H9CA 1BHAA 2ZR3A 1DF5A 2D3OW 3FB6C 2XNDG 1JPXA 2JDIG 1NH2B 5DN6G 3JD4A 1MABG 5FL7G 3GB7C 1OCCB 1QLEB 4N21A 3SYQA 3ZRVA 1G8MA 1FS0G 2IH1C 5LHHA 1JQ0A 2EILC 2QKSA 3ETEA 1PD3A 4MTGA 1I5YA 1V54B 1UJWB 5IY5C 3I56V 4UVBA 3F7VC 2OT5A 3VBBA 2W0FC 1YTFB 4BIZA 2Y69C 1PNMA 1JCHA 3ABTA 5B1BB 3OM3B 2HG5C 4GCZA 4PA4A 5KUMA 3AG2B 2IJIA 1GM9A 1OCRC 3DGEA 4J9YB 2WLHA 2BOBC 5L3CA 3AG4C 3MD0A 1K4DC 4L87A 1JJ2U 1VQ9V 4FJCC 4QE7A 1YHQV 3A0RA 3OR6C 3EFFK 5CMUA 1AI4A 3E8HA 1AJPA 1J95A 5L3DA 3D3IA 4UVAA 3ABLC 2Q67A 5CBGA 3ZN0A 1SRYA 4KFMA 2ZDIA 1KP2A 1W2BU 1QR8A 4HYOA 1F4MA 1R6KA 3SJQC 3FYEB 4G28B 1E1QG 1WPXA 4QJFB 4PA9A 5L3EA 3G4SV 2MK3A 3JD2A 3IC7A 3OFNG 3UKMA 2EIMB 3B77A 1M1KW 1PNLA 3F5WC 5GW7A 2YSUB 3ZRWA 3CYOA 3SYPA 5E1AC 1CPYA 3LNMB 4HZ3A 1PL0A 3K79A 1M90W 1R3IC 3CCUV 4WFAV 4BAYA 5DM6V 1W0KG 5IDJA 2IJKA 2DYRB 1V55B 1DF4A 1M57C 4TWKA 5B1AC 1AI7A 3ABKB 1EBOA 1OZ0A 1WLEA 3ETDA 1JX9A 1K5SA 1K97A 3JYCA 5B3SC 2H8PC 3LUTB 2WLLB 1Q82W 2ZDIC 1GM8A 4FMTA 1Y66A 4BIUA 1K9MW 4JPRA 1AROP 4JTDB 3ZRSA 3W7UA 2P90A 2XAJA 3ASNC 3ETGA 3RVZA 3ASOB 3OE7G 3JD0A 3STZC 1FXKB 4LC1A 1R3KC 2UXXA 4RQEA 4WFGA 3ABMB 3CCMV 2H94A 3MHHC 3KG2A 1QR9A 4Z1MG 1EFRG 3ZIAG 4MVQA 4GX2A 4UUJC 2M7WA 2JEUA 2EIJC 4N23A 3SYOA 1LNQA 1VQ7V 4JTAB 1COWG 5L3GA 5L3BA 3HB3B 4QE9A 1K34A 5LGTA 5CA3A 3IGAC 1QLEC 3IFXA 4UVCA 3CMEV 2CK3G 4JASA 1NR7A 3E35A 2B1IA 4R50A 2ZXWB 5KA5A 2EZPA 4R7CA 1OCOB 1TUEB 2P6JA 5KUKA 3G71V 3SPHA 2DWEC 1GKFA 5B1BC 1QVFU 1VQKV 3K0DA 3OMAB 1SETA 3AG2C 3AEIA 1N8RW 1GMGA 3FB8C 3SYCA 3ZMSA 3G6EV 5IYBO 2WAMA 3GWOA 3MHSC 5CN0A 4MVRA 3VOUA 3CC2V 5J9PC 2HKOA 4UXNA 3DTUB 4QPJA 1VQLV 3K9AA 1GO3F 4UV9A 2EBOA 2LFRA 2WLLA 5IYDO 2B1GA 4PDVA 1RPRA 3WG7B 4G27B 5EBLC 4ASUG 2XAFA 1PNKA 4F4LA 5LGUA 2HLDG 1K3EA 2HJFC 2XAHA 3RBZA 4X8AA 4WFHA 3ZJZA 1NVPD 2OCCB 2EIMC 3R65A 1FXKA 3SPGA 2DYSB 1Q86W 2QA4V 5LGNA 2ATKC 3H01A 5B1OA 2AHZA 1YIJV 1VQMV 4KUMA 3ZMTA 3TK1A 2W6IG 4KP4A 1S0VA 1DTOA 1K5QA 4P30A 3E8GA 1HWYA 2EINB 3BY6A 4R8CA 3E83A 2PI5A 1M56B 1AI5A 2Q6AA 4JGSA 4XBFA 3LDEA 4P9OA 1KD1W 2DYRC 1V55C 1W0JG 4PA6A 2Z3YA 2V1DA 3ABKC 1Y4MA 1B6QA 1BHBA 5L3FA 2A79B 5B1NA 3I55V 2DQ3A 3FKSG 3K04A 4MTFA 2Y69B 1F51A 1NBMG 1IXMA 1YSCA 4I5SA 3AG1B 4X88A 3W7WA 2IW5A 1K8AW 4MVOA 3TCUA 1VQ6V 2QE7G 4LCUC 3CC4V 1AJQA 3ASOC 4I9WA 4RUEA 4FPPA 1FXKC 4WFFA 3JD1A 1G4YB 3LDDA 3QNEA 3LDCA 3ABMC 2UXNA 2ITCC 5EBWC 3WFVA 2QEXV 2JEXA 2XOKG 4GX1A 3E2EA 1DLBA 1R3LC 3SPCA 2X6AA 4CBCA 2DWDC 3RVYA 2AHYA 2YEVB 3B8NA 3T1CA 4MVUA 1SZTA 1NQTA 3E8BA 1H8HG 3ML0A 4MVSA 4PDRA 3FB7C 2IH3C 4XDKA 2PI4A 2OTJV 2P67A 1NJIW 4RQFA 3ABUA 4PDMA 1VQ8V 3T4DA 2Q68A 4FIPC 2ZXWC 1OCOC 3OEEG 1K33A 1VQNV 3OMIB 3E86A 2EIKB 2X7RB 3P32A 5CBFA 3X2QB 2X0LA 1BMFG 4JYCA 2WLMA 1AI6A 3JCZA 4WFBV 1S3JA 4RO2A 2KB1A 1RM1B 1NH2D 1K73W 1H38A 4LP8A 1OCCC 4TT3G 3CCSV 4U7NA 4CZZA 2WSSG 1FXVA 1E1RG 3CP1A 1PKXA 2F43G 4Q20A 3K06A 2Z5UA 1V54C 1QVGU 1XL4A 3STLC 2ZR2A 1THZA 4J9ZB 1YTFD 1YJWV 4JAVA 2JK5C 3B8MA 2Q69A 2IJHA 2XASA 1GK9A 4TSFG 1KECA 1I5XA 3LSSA 4GX5A 1ZWIC 4MSWC 3WG7C 1GM7A 2WLIB 3K03A 5CBHA 3E8FA 1YJNV 1GTOA 1P4RA 3HPLC 5BZBA 1S76D 3SPIA 4EKWA 2P7TC 2Y48A 1P7BA 3E89A 3CCEV 2WLJA 2QM8A 1CEZA 3W7SA 1RPOA 1JVMA 2OCCC 4PDLA 2DYSC 4QNHB 3LSQA 4BW5A 1CP9A 1EZJA 4MTXA 4WFEA 3W7TA 2EIJB 2A9HA 3OUFA 1OCZB 4G2KA 2EINC 5EC1C 1M56C 2NNUA 1ORQC 5H6QA 3AG3B 1MOFA 1ROPA 1YITV 3OMNB 3CXCU 3SPJA 3CCVV 1S5HC 4R6ZA 1Q7YW 2YEVA 3K0GA 2X6BA 4X89A 2EZOA 4OXSA 2R9RB 1OHHG 1E79G 4MTOA 4ZKIA 3K08A 3AG1C 5C93A 2IU0A 3OW2U 1BL8A 2XAQA 1KP3A 4H37A 2WLKA 4YXWG 2LFSA 3RW0A 1QBZA 3CCJV 2XAGA 2EILB 4MS2A 3ZCCA 2HFEC 2LP7A 3ZMUA 5IY5B 5HFLA 1AJNA 2IJJA 4E2LA 4U7OA 1FXHA 3D36A 4XDLA 2JJ2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPR A;  2IJH A;  1F4M A;  2GHY A;  4DO2 A;  1GTO A;  1B6Q A;  1F4N A;  1RPO A;  2IJJ A;  3K79 A;  1PD3 A;  1ROP A;  2IJK A;  2IJI A;  1GMG A;  1NKD A; 
#chains in the Genus database with same CATH topology
 1KQS U;  2DW4 A;  2CH7 A;  2ITD C;  3OTF A;  3OTO B;  1NTK H;  3A0B Z;  3ETQ A;  5HFM A;  1X4T A;  3O9O A;  3OUS A;  1OCR B;  3CCL V;  1WP7 A;  5KA6 A;  4FFB B;  4QPK A;  4B7K A;  3AG4 B;  3QO8 A;  5EK0 A;  3JAS A;  3CC7 V;  3L71 H;  2JJ1 G;  2OIE A;  1Q81 W;  1NVP B;  4DV7 B;  1SQF A;  4FLU A;  1KKD A;  4YJ3 B;  1QCE A;  3ABL B;  2LW1 A;  3X2Q C;  3LNN A;  1XEQ A;  2QGN A;  4PV1 B;  4NVP A;  1Y74 B;  3RT3 C;  4LF8 B;  1MG1 A;  4GX0 A;  1KC8 W;  4C7U A;  2IU3 A;  3WB2 A;  1I94 O;  1H8E G;  3CCR V;  4U3F H;  3T2M A;  3A0H Z;  4LFB O;  4NXN B;  3DXR B;  4QIW F;  1Y76 B;  4MVM A;  2QR4 A;  2UXC O;  2CUG A;  4PA7 A;  5JJN B;  5LBQ A;  3QTC A;  2XT9 A;  2DQ0 A;  4LF4 B;  2A0L A;  1R73 A;  4NB5 A;  2B5U A;  3FB5 C;  3OGC C;  4JI0 O;  2XHB A;  3HKE B;  1OCZ C;  1XNQ B;  4DV3 O;  2UXD B;  2GSM B;  1NS1 A;  1YCI A;  4E4E A;  1Q6I A;  4GLX A;  2YUA A;  1BT8 A;  2RCV A;  1JOY A;  1AB3 A;  2CE4 A;  1R6N A;  3HKD B;  4DV0 O;  4WCE V;  3K5O A;  1S72 V;  3Q4H A;  2D3O W;  3FB6 C;  2ADP A;  4LNU B;  1BE3 H;  1AP6 A;  4DV5 B;  3SYQ A;  1N32 B;  1G8M A;  2IH1 C;  1JFF B;  5IJ9 A;  1HR0 O;  4J7J A;  4CH6 A;  1V54 B;  2VQF O;  3F7V C;  4NTY A;  2W0F C;  1YTF B;  3AK1 A;  1MZE A;  1PNM A;  2Y69 C;  3ABT A;  2HG5 C;  4PA4 A;  3N2G B;  4FLY A;  1OCR C;  2QWP B;  4EB6 B;  3DGE A;  1YZB A;  1IXB A;  3AG4 C;  3MD0 A;  1VQ9 V;  4L87 A;  5CA1 A;  3RYC B;  3ABL C;  2Q67 A;  4LFC O;  1PPJ H;  4KFM A;  4HYO A;  1F4M A;  3BCC H;  1SC5 B;  4G28 B;  4ZOL A;  1E1Q G;  1WPX A;  4PA9 A;  4X1I B;  2MK3 A;  3BA8 A;  3E22 A;  1O9H A;  3IC7 A;  3OFN G;  3UKM A;  2E5L O;  1IVS A;  1M90 W;  3MDS A;  3CCU V;  2BSK A;  1PP9 H;  1IBM B;  2P5O A;  1IBK O;  4JI2 B;  1V55 B;  3M7M X;  1YXB A;  1AI7 A;  5C8Y B;  3ABK B;  1EBO A;  1JX9 A;  1K5S A;  3JYC A;  1FAF A;  5LOV B;  4DR5 O;  2UUB B;  2WLL B;  2OCH A;  1K9M W;  4X20 A;  1F7Y A;  1NI8 A;  3L72 H;  3RVZ A;  3FX7 A;  2ZE5 A;  4IGG A;  2UXX A;  4D6T H;  3CCM V;  2P22 C;  3ZIA G;  4OX9 B;  1RFY A;  4B3T B;  4DV1 B;  2EIJ C;  3F5T A;  1LNQ A;  1VQ7 V;  1BSM A;  4LF6 B;  1ZX3 A;  4QE9 A;  2CTW A;  2F23 A;  3IGA C;  5E79 Z;  2UUA O;  5JCO C;  4JI1 B;  3CME V;  4JAS A;  2DE0 X;  1HNX O;  1HDJ A;  4DW0 A;  2EZP A;  2CDY A;  2RJZ A;  1OCO B;  4JZG A;  4ZHQ B;  2XTA A;  3WU2 Z;  5KUK A;  3G71 V;  2OIG A;  3B40 A;  1QVF U;  3OMA B;  2RDC A;  4JI3 O;  3ZMS A;  3G6E V;  5CN0 A;  5KLV H;  4CH5 A;  5JWP A;  4UXN A;  4QPJ A;  1VQL V;  4A5U B;  2CGO A;  1XHZ A;  2LFR A;  1US6 A;  4ASU G;  1PNK A;  1MZF A;  4F4L A;  3RBZ A;  4YIO A;  2R9A A;  2JRI A;  4X8A A;  3R65 A;  3A8T A;  5LGN A;  2ATK C;  4PI0 A;  2YDE A;  2W6I G;  3T1H O;  1I08 A;  1HWY A;  1AI5 A;  4JGS A;  4CS3 A;  4PI2 A;  4P9O A;  1KD1 W;  1V55 C;  4DV3 B;  3ABK C;  4B08 A;  2D2C B;  2VRZ A;  4J80 A;  1QNM A;  2DQ3 A;  3J80 N;  3CRC A;  1M5I A;  1KMI Z;  1IXM A;  1VF6 C;  1TVK A;  4X1Y A;  4MVO A;  3ICX A;  1VQ6 V;  1VMG A;  3B09 A;  1IBL O;  4TQF A;  1HNW O;  4J7Z A;  4YJ2 A;  1A32 A;  3LDD A;  2P4V A;  4U3J B;  4O4L B;  1SZX A;  3WFV A;  5LMU O;  5D5P A;  1XQ8 A;  3H1H H;  1Q3E A;  5FPO A;  2X6A A;  4ZI7 B;  2GTS A;  2AZ0 A;  2ZE8 A;  4MVS A;  3FB7 C;  2OTJ V;  5IWA O;  4X65 O;  4IIJ A;  1NJI W;  2JGD B;  3ABU A;  3T4D A;  1OCO C;  1K33 A;  1VQN V;  2EIK B;  4TOI A;  2X7R B;  3P32 A;  1Q5O A;  4WFB V;  4LFC B;  1KKC A;  4DV6 O;  4TT3 G;  4LWS B;  5JVD A;  3N2K A;  2HHH O;  4DR1 O;  3UT5 B;  4Q20 A;  3K06 A;  4JV5 O;  1NT2 B;  5AG2 A;  3OTO O;  3B8M A;  2E5L B;  4TSF G;  1WA8 B;  1I5X A;  2E3C A;  2Q4P A;  3LSS A;  2F4V B;  4GX5 A;  3JAW B;  3N27 A;  1GM7 A;  3CHX A;  1XHX A;  1S76 D;  3HPL C;  2JJ2 G;  2Y48 A;  4FM1 A;  2QM8 A;  4BR6 A;  1GRJ A;  1RSO B;  4PDL A;  1P7G A;  4GZR B;  4QNH B;  2ODM A;  3W7T A;  1VP7 A;  2A9H A;  3QG5 A;  4LH7 A;  3EXA A;  4LF8 O;  2NNU A;  4K0K O;  5H6Q A;  1FJG O;  1ROP A;  3RYF A;  1PL4 A;  4R6Z A;  1Q7Y W;  3K0G A;  3SJB C;  5KMG B;  5LMN B;  2EZO A;  4OXS A;  4NXN O;  2EUL A;  1E79 G;  2BCC H;  2XAQ A;  2VWJ A;  1KP3 A;  4H37 A;  4YXW G;  1QBZ A;  1XMQ B;  4LF4 O;  3ZCC A;  1U96 A;  1H2M A;  1AJN A;  4FLT A;  4U7O A;  2ZKO A;  1XNQ O;  3JSL A;  2UXD O;  3LDE A;  1EZV H;  5EC2 C;  1WNS A;  3FYI B;  4DO2 A;  2LO1 A;  3BEH A;  3VQX A;  5KX5 B;  3CPW U;  2FML A;  4JYY A;  2KKW A;  5IYC O;  3GWK C;  3OAA G;  1F4N A;  2EIK C;  1I0H A;  4DV5 O;  5H6R A;  2Q0O C;  3LSU A;  1R3J C;  3ZRX A;  3UM7 A;  5LHI A;  1BCC H;  4PEL A;  2WLN A;  2ZQM A;  1J5E O;  3HKB B;  3ZN1 A;  2ZD9 A;  4JF3 A;  4TV8 B;  1H2G A;  2LW7 A;  1BZK A;  4MW8 A;  1S5L Z;  2GTA A;  2GHY A;  3QO5 A;  1NTM H;  1ENV A;  4MT8 A;  3SYA A;  3ZHU A;  4GT1 A;  4CS4 A;  3EHB B;  3RGB A;  1M57 B;  3KCY A;  2W6J G;  1SES A;  3FAV A;  1H2K A;  2BTQ A;  4WF9 V;  3JAR A;  1NKD A;  1F23 A;  1I7F A;  4DR3 B;  4HNA A;  4JTC B;  3SR2 C;  4O4J B;  3RYH A;  2WWW A;  2GBO A;  3CMA V;  3ZRW B;  5EBM C;  1VQO V;  1SQV H;  1B3Q A;  3RYI A;  3CJH A;  1IBM O;  2ZE7 A;  4FK5 C;  4JI2 O;  4DV4 B;  2JDI G;  5DN6 G;  5FL7 G;  3CRA A;  3GB7 C;  1QLE B;  3ZRV A;  1FS0 G;  5LHH A;  2UUB O;  1AP5 A;  1WPB A;  1JQ0 A;  3H1I H;  3S3W A;  1FYJ A;  1UJW B;  1VIB A;  4O2A B;  1PV0 A;  1N0N A;  2YIB A;  1JCH A;  3OM3 B;  4FZ0 A;  4GCZ A;  2YI9 A;  3AG2 B;  5KUM A;  4JI7 B;  1WAZ A;  4W4K A;  1GM9 A;  3ZX6 A;  5L3C A;  2AZ2 A;  4OX9 O;  3T1Y B;  5EYP A;  5JH7 B;  1K4D C;  4B3T O;  1NZ6 A;  3OR6 C;  5CMU A;  5CB4 A;  5GTI Z;  2IBZ H;  4LF6 O;  4TUY B;  3D3I A;  4UVA A;  5CBG A;  1HNZ O;  4RWU A;  4JI1 O;  1KP2 A;  5CA0 A;  1W2B U;  4UCV A;  3H9V A;  3SJQ C;  4I0X B;  3BVO A;  3JD2 A;  1W59 A;  3B77 A;  1PNL A;  1AR4 A;  3K5N A;  3SYP A;  5J2U A;  4K8Z A;  1PL0 A;  3K79 A;  4I50 B;  5IJ0 B;  2GV9 A;  1ZL8 A;  4WFA V;  1URF A;  3HKC A;  4I55 A;  5IDJ A;  5B5E Z;  5IYZ B;  1DF4 A;  1M57 C;  4IL6 Z;  1MA1 A;  1OZ0 A;  1WLE A;  3C3S A;  4CS2 A;  4K0K B;  1FJG B;  1K97 A;  5LP6 B;  2H8P C;  1SS3 A;  1Q82 W;  2ZDI C;  4H0L B;  1TUB B;  1OV9 A;  5IT9 N;  1PM9 A;  3W7U A;  1Y67 A;  2XAJ A;  3ETG A;  2WA3 A;  4LC1 A;  2ARH A;  3IC9 A;  4DR2 B;  4RQE A;  3ABM B;  2H94 A;  4DV2 B;  3BA9 A;  3CS5 A;  4MVQ A;  4UUJ C;  2JS3 A;  1JR9 A;  1IX9 A;  4FZ1 A;  4NTW A;  5JQG A;  5J2T B;  5L3B A;  3TXS A;  5CA3 A;  3L73 H;  1QLE C;  2Y0P A;  3C3T A;  4W4L A;  2B1I A;  4R7C A;  3JAT A;  1TUE B;  3JAK B;  4NR1 A;  2DWE C;  2LGW A;  5EIB D;  3AG2 C;  3U11 A;  1M93 A;  3AEI A;  1N8R W;  5GTH Z;  3RFR A;  2WAM A;  3GWO A;  3MHS C;  4FLW A;  3OD4 A;  5J9P C;  5LXT B;  2HKO A;  3DTU B;  1J5E B;  4YHH B;  1GO3 F;  4UV9 A;  2UU9 B;  4K35 A;  2KG7 A;  2QWQ B;  2B1G A;  1XOU A;  4O4H A;  4HBN A;  2XAF A;  4PD4 F;  5LGU A;  2HLD G;  2MW2 B;  4TV9 B;  1XI1 A;  1FFX A;  2E76 B;  2OCC B;  1FXK A;  4JZ2 A;  4OPH A;  3H01 A;  4B3S B;  1VQM V;  2A3Q A;  4KUM A;  3TK1 A;  4KP4 A;  1K5Q A;  2F1M A;  2LGQ A;  4P30 A;  5KAF Z;  4R8C A;  3E83 A;  3P3P A;  2Q6A A;  4X1K B;  4PA6 A;  1Y4M A;  2V4D A;  5K1P A;  2F4V O;  5D5Q A;  3K04 A;  1EN6 A;  2GUZ A;  1F51 A;  3C90 A;  3AG1 B;  2DOS A;  1WP8 A;  2ZE6 A;  1K8A W;  2QE7 G;  4LCU C;  3PN1 A;  3AG7 A;  1RP3 B;  4KXR A;  1AJQ A;  4I9W A;  4WFF A;  1G4Y B;  1U97 A;  3LDC A;  5FNV A;  3ABM C;  2GDS A;  4NYK A;  5EBW C;  2QEX V;  5KHK A;  2XOK G;  2FKX A;  1VF7 A;  4CBC A;  2DWD C;  3CRQ A;  2AHY A;  5BMV B;  1NQT A;  5A9G A;  3K59 A;  2Q73 A;  1H8H G;  4BWA A;  3DC6 A;  5LMN O;  2E74 B;  2XUM A;  4FIP C;  4IYI A;  1DK1 A;  1QHT A;  3L9D A;  3E86 A;  1BMF G;  5KHJ A;  1AI6 A;  1S3J A;  1RM1 B;  5ITZ B;  1XMQ O;  4F6R A;  1Q90 D;  4GKJ O;  1HNZ B;  3CCS V;  4U7N A;  3TGU H;  5DEC A;  2QTS A;  1E1R G;  2CH7 B;  1PKX A;  1GN2 A;  2EX3 A;  2F43 G;  1V54 C;  1QVG U;  1XL4 A;  3STL C;  1THZ A;  4J9Z B;  1HP8 A;  1YJW V;  4JAV A;  2JK5 C;  4LFA B;  1N34 O;  1KEC A;  3JAS B;  1ZWI C;  4MSW C;  5CBH A;  3E8F A;  1GTO A;  1P4R A;  2YC0 A;  3SPI A;  4EKW A;  3E89 A;  3CCE V;  1CEZ A;  3W7S A;  1RPO A;  1JVM A;  3ZED A;  2OCC C;  3L75 H;  4IT5 A;  4BW5 A;  4WFE A;  4FLZ A;  4X66 O;  2VQE B;  3M8A A;  1N33 B;  2YXY A;  5IE9 A;  1ORQ C;  2A06 H;  4O2B A;  3SPJ A;  2NN4 A;  3TJT A;  4ICG A;  4GKK B;  2YEV A;  1TAE A;  2E75 B;  3JAL A;  2R9R B;  1OHH G;  4FM0 A;  3H1K H;  1IUR A;  2R72 A;  4ZKI A;  5C93 A;  3AG1 C;  1EM1 A;  2IU0 A;  1UPG A;  3ZHQ A;  3DSQ A;  3CCJ V;  2XAG A;  2EIL B;  2RQ6 A;  4MS2 A;  2ZT9 B;  4I4T A;  1SA0 A;  1L0L H;  1SF9 A;  3ZMU A;  4E2L A;  4DR3 O;  2OWO A;  5LA6 A;  3ZMV A;  3TXQ A;  3AK3 A;  3B4S A;  2WPD G;  2NLJ C;  3M99 B;  3H1L H;  1SER A;  3ZHV A;  3FFQ A;  4XDJ A;  1QLN A;  3Q4H B;  4UCS A;  2WLI A;  1AR1 B;  4IHJ A;  4DXW A;  4DV4 O;  1AVM A;  3AK2 A;  5GON A;  1XL6 A;  1ZLZ A;  4WBN A;  4O4I A;  5IJ9 B;  1RM1 C;  1S77 D;  1Z5W A;  2YIC A;  4L8J A;  1K92 A;  3D36 C;  3UO3 A;  1NTZ H;  2HR3 A;  1V9P A;  5TIS Z;  1ZSP A;  4TQD A;  2QTO A;  5EZY A;  1SKV A;  1N0J A;  2FTK A;  1VQ5 V;  1FFT B;  4DR7 B;  3TET A;  1MSD A;  4JI7 O;  1AR5 A;  4DK1 A;  3VQY A;  4DRX A;  1LR1 A;  1T5E A;  1EN4 A;  4EEQ A;  3T1Y O;  2HJD A;  5B1A B;  2ETN A;  1XIL A;  5CA1 B;  1N36 B;  1SQX H;  2NR5 A;  4AHC A;  1L1F A;  5B3S B;  4EFE A;  5LYJ A;  1M9N A;  4P2Z A;  2X6C A;  2JGU A;  3QO7 A;  1MNG A;  2CTP A;  4CH4 A;  4ZOL B;  3J7A U;  3CRM A;  4UV8 A;  3T4Z A;  3PJS K;  4P9P A;  4RUF A;  2LQT A;  3E22 B;  2HVK C;  1YI2 V;  2C2A A;  4KL1 A;  4AI8 A;  1BQZ A;  4AIL C;  2BSK B;  3P30 A;  2QM7 A;  3RWR D;  3L70 H;  4FFB A;  1NR1 A;  2R9I A;  1BHA A;  5EIB C;  1VAR A;  3WB0 A;  4YY3 O;  4LF7 O;  2XND G;  1JPX A;  1MAB G;  4YJ3 A;  1OCC B;  2A7W A;  4N21 A;  3OGI B;  4GUN A;  2EIL C;  2QKS A;  3ETE A;  4X20 B;  5JJE B;  1S5J A;  3DC5 A;  4KHP B;  1I5Y A;  4NKG B;  1XMO B;  2YIA A;  4UCR A;  4CH3 A;  1Y74 A;  3VBB A;  4B3M B;  3CRR A;  1D5A A;  4DR2 O;  4LF5 B;  2WLH A;  4DV2 O;  3D8C A;  2BOB C;  2L35 A;  1SQQ H;  3DXR A;  4GKJ B;  4FJC C;  4QE7 A;  1YHQ V;  2M6Y A;  1Y76 A;  1MMM A;  5FLX N;  1AI4 A;  5BR8 B;  3E8H A;  2ZNJ A;  1AJP A;  5L3D A;  3ZN0 A;  2RN9 A;  1GN4 A;  4DUZ B;  3FYE B;  1N34 B;  1NU1 H;  2AXT Z;  4FLX A;  4QJF B;  4BIO A;  5L3E A;  3HKE A;  2AGA A;  3F5W C;  5GW7 A;  3CYO A;  2UUC B;  3LNM B;  1FPO A;  1L8D A;  2KSD A;  4BAY A;  4X66 B;  3HKD A;  2IJK A;  3CSX A;  4LF9 B;  3QF7 A;  5B1A C;  1AIL A;  2FYU H;  4LNU A;  2Y4U A;  2W0X A;  5B3S C;  2HEP A;  1D5N A;  4DYL A;  4YHH O;  2F93 B;  3LUT B;  2UU9 O;  5JCO A;  1Y66 A;  1JFF A;  5KAI Z;  4JPR A;  4JTD B;  3CEI A;  5H2F Z;  3ASO B;  3ZHT A;  3JD0 A;  3STZ C;  1R3K C;  4JI4 B;  3N2G A;  3MHH C;  4B3S O;  1QR9 A;  4EB6 A;  4GX2 A;  4X64 B;  2M7W A;  2RMK B;  2JEU A;  2YXH A;  2IM9 A;  2JS5 A;  4N23 A;  3SYO A;  3HB3 B;  1K34 A;  5LGT A;  3RYC A;  2CK3 G;  2Q5Z A;  1NR7 A;  4R50 A;  1TVK B;  4X1Y B;  5KA5 A;  2P6J A;  5LL6 Y;  4UCT A;  1VF5 B;  4X1I A;  1GKF A;  4K3A A;  4YJ2 B;  1VQK V;  3K0D A;  1SET A;  3IAY A;  2QSA A;  1GMG A;  3SYC A;  5IYB O;  4H44 B;  4MVR A;  4I7Z B;  3CC2 V;  1JMK C;  3A2F A;  1Z5V A;  1DGS A;  5C8Y A;  1JJO A;  4IIJ B;  3SDL A;  3CX5 F;  5LOV A;  3THO A;  2WLL A;  3WG7 B;  1GN6 A;  5EBL C;  4DUY B;  1D2D A;  1VF6 A;  1K3E A;  2HJF C;  2XAH A;  1BS3 A;  1R1B A;  4WFH A;  4JI5 B;  2QA4 V;  2AHZ A;  3ZMT A;  1S0V A;  5JVD B;  1DTO A;  3N2K B;  3E8G A;  2EIN B;  3BY6 A;  1M56 B;  1KYO F;  1FD9 A;  1W0J G;  2Z3Y A;  3CXH F;  2YIB D;  3SGI A;  5L3F A;  3K5L A;  2A79 B;  4LFA O;  2ADQ B;  4MTF A;  2Y69 B;  4I5S A;  1YSC A;  2Z0A A;  4JI6 B;  3TCU A;  3U10 A;  4ZHQ A;  3CC4 V;  4JI8 O;  3ASO C;  4RUE A;  1SQG A;  3OT7 A;  4YY3 B;  5BY1 A;  4LF7 B;  2QJ1 A;  1P49 A;  2O57 A;  2UXN A;  2VQE O;  1N33 O;  2JEX A;  4GX1 A;  3P3N A;  3E2E A;  1WB7 A;  3RYF B;  3RVY A;  4JV5 B;  3T1C A;  1SZT A;  3E8B A;  3ML0 A;  2PI4 A;  4XDK A;  2IH3 C;  4GKK O;  2P67 A;  4DR4 B;  3K5M A;  4RQF A;  4PDM A;  1XBL A;  1VQ8 V;  2QDO A;  3JAM N;  2N74 A;  1KB9 F;  3U0Z A;  1CXZ B;  1ZAU A;  4JYC A;  2WLM A;  2PYL A;  4RO2 A;  1NH2 D;  1K73 W;  2Q0A A;  2WSS G;  3BAB A;  2AW9 A;  4IYH A;  1FXV A;  4UB6 Z;  1TA8 A;  2JVD A;  5FPR A;  1BGY H;  3CP1 A;  2Z5U A;  2CAZ C;  2DN9 A;  2UXB B;  2Q69 A;  1XNR B;  2XAS A;  3WG7 C;  2ZM6 B;  3K03 A;  1YJN V;  1Q6H A;  2P7T C;  4D7S A;  2WLJ A;  3ZHR A;  4ZIB A;  3LSQ A;  3J81 N;  1EZJ A;  3G80 A;  4MTX A;  3ZHS A;  2EIJ B;  3OUF A;  1QU7 A;  4U3J A;  4JYA O;  4O4L A;  2EIN C;  5EC1 C;  1GN3 A;  2P06 A;  2ZIN A;  1M56 C;  3K57 A;  3AG3 B;  1MOF A;  1YIT V;  3BFR A;  3CXC U;  3CCV V;  4ZI7 A;  1S5H C;  4X89 A;  4DR7 O;  1L0N H;  4FLV A;  1XDC A;  4X62 O;  2JGD A;  3KZI Z;  3ZS8 C;  3FAV B;  1ZTE A;  1N36 O;  2BTQ B;  4Z1V A;  3JAR B;  3RW0 A;  2WLK A;  2QWN B;  2CGN A;  2DJV A;  5LP6 C;  4HNA B;  4CC6 A;  5IY5 B;  5HFL A;  3O65 A;  4LWS A;  3RYH B;  1FXH A;  1EN5 A;  2PZS A;  3G67 A;  4B3R B;  3H1J H;  3UT5 A;  4OPA A;  4ZBM A;  4RAI A;  4F6E A;  1YJ9 V;  2BOC C;  3RYI B;  3CJH B;  3JCU Z;  1MSW D;  5KHI A;  4JYB A;  5LHG A;  1WA8 A;  4LBE C;  5KHH A;  3ZMZ A;  2EJR A;  3JAW A;  2FL4 A;  1O9G A;  1GH6 A;  4MVZ A;  2JIZ G;  1VQ4 V;  3HR0 A;  1K7D A;  1RSO A;  1VQP V;  3OEH G;  4Z2W A;  4KHP O;  2HVJ C;  1XMO O;  1GAX A;  3W7X A;  1KUQ A;  2R70 A;  3VQV A;  4B3M O;  1ZUQ A;  1H2S B;  2F66 C;  3CD6 V;  1KU9 A;  2K1E A;  2ZIO A;  2BE3 A;  5H5N A;  4PA3 A;  3OR7 C;  4H33 A;  4LF5 O;  5EYP B;  2PUS A;  5KMG A;  4DR6 B;  1VEW A;  2OTL V;  2BTO A;  5CB4 B;  4JAU A;  1K4C C;  2N05 A;  4FFK A;  2KQX A;  3JSN A;  5BR8 O;  2DMX A;  5CA0 B;  3JD3 A;  1KBH A;  1YEW A;  1SQP H;  4DUZ O;  1Q8I A;  3F7Y C;  3UO2 A;  4NXM O;  3ASN B;  3RN4 A;  2WA4 A;  3AG3 C;  4EFB A;  1YVW A;  1XUQ A;  5J2U B;  2L6L A;  4JI8 B;  3NXS A;  2UUC O;  1ZL8 B;  1Q6U A;  3HKC B;  2V7Q G;  4I55 B;  5KX5 A;  1YDX A;  1HW7 A;  4MW3 A;  3CCQ V;  4HAM A;  3K3W A;  5H9C A;  2QWR B;  2ZR3 A;  1UFI A;  3BRC A;  1DF5 A;  3B2E E;  4LF9 O;  1NH2 B;  3JD4 A;  2ZCE A;  2PF4 E;  1PD3 A;  4MTG A;  2QWO B;  3APQ A;  5IY5 C;  3I56 V;  4UVB A;  2OT5 A;  3KKY A;  4BIZ A;  1I94 B;  1R6T A;  3HKB A;  4DK0 A;  5B1B B;  2VS0 A;  3UQ8 A;  2IJI A;  4JI4 O;  4TV8 A;  4LFB B;  4J9Y B;  1Y6X A;  4X64 O;  1JJ2 U;  2PTM A;  2UXC B;  3A0R A;  5JQG B;  3EFF K;  2G38 A;  1X59 A;  1J95 A;  3S3X A;  2YXL A;  2Y0I A;  1FKA O;  1LUV A;  1SRY A;  3D3Q A;  2ZDI A;  1QR8 A;  3VQW A;  4JI0 B;  3JAT B;  1R6K A;  4UCU A;  3FD9 A;  2QM4 A;  3G4S V;  4O4J A;  2K9P A;  2EIM B;  1M1K W;  4FM2 A;  2YSU B;  3EVK A;  3ZRW A;  5E1A C;  1CPY A;  4HZ3 A;  1R3I C;  1G6U A;  4DV0 B;  5DM6 V;  2ZNI A;  1W0K G;  2YS8 A;  5K1X A;  2Q9L A;  1H2N A;  2DYR B;  4JYA B;  4TWK A;  2B9Z A;  3ETD A;  4AQY O;  2KG7 B;  1HR0 B;  4DW1 A;  1GM8 A;  4FMT A;  4O4H B;  4BIU A;  2VQF B;  3ZRS A;  1ARO P;  4DUY O;  2P90 A;  2QKC A;  4LR3 A;  4X62 B;  3APO A;  3ASN C;  3OE7 G;  1FFX B;  4O2A A;  1FXK B;  1Q43 A;  5KHG A;  5A2Q N;  4JI5 O;  4WFG A;  3KG2 A;  1BQ0 A;  4Z1M G;  1EFR G;  2EJ7 A;  1P84 F;  2CTQ A;  5JH7 A;  2QKA A;  2LJ2 A;  2Q7G A;  4JTA B;  1COW G;  5L3G A;  4GYC B;  3IFX A;  4TUY A;  4UVC A;  3SJA C;  2GUZ B;  4I9Q A;  3E35 A;  1QQC A;  1OJH A;  2ZXW B;  4JI6 O;  2FB5 A;  4I0X A;  3SPH A;  5B1B C;  2YID A;  3CE2 A;  5FNV B;  4J11 A;  3FB8 C;  2ZIM A;  4I50 A;  4DV7 O;  3VOU A;  5IJ0 A;  2H3O A;  1IBK B;  4PJ0 Z;  5IYZ A;  3UCS C;  1WN7 A;  3K9A A;  4DR5 B;  5LP6 A;  2EBO A;  4DR4 O;  5IYD O;  4PDV A;  1RPR A;  4G27 B;  4PHZ A;  4LH6 A;  1TUB A;  4B7E A;  1IDS A;  3ZJZ A;  3I5D A;  1NVP D;  4UCO A;  2EIM C;  3SPG A;  2DYS B;  1Q86 W;  4F6R B;  5B1O A;  1YIJ V;  4JAA A;  2YI8 A;  2PY5 A;  2PI5 A;  3BHP A;  1H2L A;  4XBF A;  2DYR C;  3K58 A;  2RNB A;  4NXM B;  2V1D A;  2PGG A;  1SQB H;  1B6Q A;  1BHB A;  5J2T A;  2UUA B;  2UXB O;  4J7K A;  3CB2 A;  5B1N A;  3I55 V;  1XNR O;  1HNX B;  3FKS G;  1NBM G;  2ZM6 O;  4X88 A;  3W7W A;  2IW5 A;  3JAK A;  4Q6G A;  4ABM A;  3ZBH A;  4FPP A;  1FXK C;  2F95 B;  2Q7E A;  3JD1 A;  5JJJ B;  3QNE A;  4JI3 B;  1JA8 A;  1M4U A;  2ITC C;  4UFZ A;  2N04 A;  4UB8 Z;  1XRE A;  1B06 A;  4O2B B;  1DLB A;  1WJZ A;  1R3L C;  3SPC A;  5LXT A;  3MAQ A;  1N32 O;  2YEV B;  3B8N A;  4MVU A;  1WB8 A;  4PDR A;  3JAL B;  1TGO A;  5BXZ A;  3CWB H;  2Q68 A;  2HP8 A;  4J42 A;  2ZXW C;  4D7T A;  3OEE G;  3OMI B;  4TV9 A;  2ILM A;  2OYQ A;  3SJC C;  2VWK A;  5CBF A;  3X2Q B;  2X0L A;  5B66 Z;  4I4T B;  3JCZ A;  1B04 A;  1SA0 B;  2KB1 A;  2P4K A;  3T1H B;  1H38 A;  4LP8 A;  1OCC C;  4CZZ A;  5LA6 B;  5F2V O;  4CC5 A;  4X1K A;  4B3R O;  2Q8V A;  3GVM A;  2ZR2 A;  1YTF D;  3NR7 A;  2CTR A;  4NTX A;  1N4C A;  2IJH A;  1GK9 A;  5DED A;  4J41 A;  2WLI B;  2Y4T A;  4IHJ B;  5BZB A;  1YF2 A;  5GON B;  3L74 H;  1P7B A;  1Z2G A;  4WBN B;  4O4I B;  1IBL B;  4FVM A;  2PYJ A;  1G1X B;  1HNW B;  4H13 B;  2DYS C;  4AQY B;  1CP9 A;  4YIP A;  3KCX A;  1OCZ B;  4J10 A;  4G2K A;  5LMU B;  5EZY B;  3G6B A;  4QGP A;  3OMN B;  5BMV A;  4DRX B;  2X6B A;  5IWA B;  4X65 B;  3K9S A;  3BPZ A;  3R66 A;  3BAA A;  4DR6 O;  4BW9 A;  4MTO A;  4X9Q A;  3K08 A;  3OW2 U;  5LYJ B;  1BL8 A;  3IJ4 A;  3WB1 A;  2LFS A;  1LUW A;  2HFE C;  2LP7 A;  4DV6 B;  3QVN A;  4DV1 O;  5ITZ A;  4K8X A;  2HHH B;  4OGQ B;  4DR1 B;  2IJJ A;  1IZ3 A;  3D36 A;  4XDL A;  2Q7H A; 
#chains in the Genus database with same CATH homology
 1KQS U;  2DW4 A;  3ZMV A;  2ITD C;  4ZBM A;  4RAI A;  5EC2 C;  2WPD G;  2NLJ C;  5HFM A;  3M99 B;  1SER A;  3FYI B;  1YJ9 V;  3OUS A;  1OCR B;  2BOC C;  3CCL V;  4XDJ A;  4DO2 A;  3BEH A;  5KA6 A;  1QLN A;  4QPK A;  1MSW D;  3AG4 B;  3CPW U;  3QO8 A;  5EK0 A;  4JYB A;  5LHG A;  4LBE C;  3CC7 V;  2JJ1 G;  3ZMZ A;  1Q81 W;  2EJR A;  1NVP B;  2WLI A;  1AR1 B;  1KKD A;  4DXW A;  5IYC O;  1XL6 A;  1QCE A;  1F4N A;  3ABL B;  3OAA G;  2EIK C;  4MVZ A;  2JIZ G;  5H6R A;  3X2Q C;  1VQ4 V;  1K7D A;  1VQP V;  3OEH G;  1R3J C;  1RM1 C;  1S77 D;  3ZRX A;  3UM7 A;  5LHI A;  4PEL A;  2HVJ C;  2WLN A;  2ZQM A;  1K92 A;  1MG1 A;  4GX0 A;  3W7X A;  1KC8 W;  2HR3 A;  3ZN1 A;  2IU3 A;  2QTO A;  2ZD9 A;  3CD6 V;  2FTK A;  1VQ5 V;  1H8E G;  3CCR V;  4JF3 A;  2K1E A;  1H2G A;  3T2M A;  1FFT B;  4MW8 A;  4PA3 A;  3TET A;  3OR7 C;  4H33 A;  2GHY A;  3QO5 A;  4QIW F;  1ENV A;  2OTL V;  4MT8 A;  3SYA A;  4MVM A;  4GT1 A;  3EHB B;  5B1A B;  1M57 B;  1K4C C;  4JAU A;  4PA7 A;  1L1F A;  5LBQ A;  2W6J G;  1SES A;  5B3S B;  2DQ0 A;  1M9N A;  4P2Z A;  2X6C A;  4WF9 V;  3QO7 A;  2A0L A;  3JD3 A;  1R73 A;  1NKD A;  2B5U A;  3FB5 C;  1F23 A;  4UV8 A;  3OGC C;  3T4Z A;  3PJS K;  4P9P A;  3F7Y C;  1OCZ C;  4RUF A;  2HVK C;  4JTC B;  2C2A A;  1YI2 V;  3ASN B;  2WWW A;  3AG3 C;  2GSM B;  3CMA V;  3ZRW B;  5EBM C;  1VQO V;  3NXS A;  1JOY A;  3P30 A;  2V7Q G;  1R6N A;  2QM7 A;  4WCE V;  1NR1 A;  1S72 V;  4MW3 A;  3CCQ V;  2R9I A;  4HAM A;  4FK5 C;  3K3W A;  5H9C A;  1BHA A;  2ZR3 A;  1DF5 A;  2D3O W;  3FB6 C;  2XND G;  1JPX A;  2JDI G;  1NH2 B;  5DN6 G;  3JD4 A;  1MAB G;  5FL7 G;  3GB7 C;  1OCC B;  1QLE B;  4N21 A;  3SYQ A;  3ZRV A;  1G8M A;  1FS0 G;  2IH1 C;  5LHH A;  1JQ0 A;  2EIL C;  2QKS A;  3ETE A;  1PD3 A;  4MTG A;  1I5Y A;  1V54 B;  1UJW B;  5IY5 C;  3I56 V;  4UVB A;  3F7V C;  2OT5 A;  3VBB A;  2W0F C;  1YTF B;  4BIZ A;  2Y69 C;  1PNM A;  1JCH A;  3ABT A;  5B1B B;  3OM3 B;  2HG5 C;  4GCZ A;  4PA4 A;  5KUM A;  3AG2 B;  2IJI A;  1GM9 A;  1OCR C;  3DGE A;  4J9Y B;  2WLH A;  2BOB C;  5L3C A;  3AG4 C;  3MD0 A;  1K4D C;  4L87 A;  1JJ2 U;  1VQ9 V;  4FJC C;  4QE7 A;  1YHQ V;  3A0R A;  3OR6 C;  3EFF K;  5CMU A;  1AI4 A;  3E8H A;  1AJP A;  1J95 A;  5L3D A;  3D3I A;  4UVA A;  3ABL C;  2Q67 A;  5CBG A;  3ZN0 A;  1SRY A;  4KFM A;  2ZDI A;  1KP2 A;  1W2B U;  1QR8 A;  4HYO A;  1F4M A;  1R6K A;  3SJQ C;  3FYE B;  4G28 B;  1E1Q G;  1WPX A;  4QJF B;  4PA9 A;  5L3E A;  3G4S V;  2MK3 A;  3JD2 A;  3IC7 A;  3OFN G;  3UKM A;  2EIM B;  3B77 A;  1M1K W;  1PNL A;  3F5W C;  5GW7 A;  2YSU B;  3ZRW A;  3CYO A;  3SYP A;  5E1A C;  1CPY A;  3LNM B;  4HZ3 A;  1PL0 A;  3K79 A;  1M90 W;  1R3I C;  3CCU V;  4WFA V;  4BAY A;  5DM6 V;  1W0K G;  5IDJ A;  2IJK A;  2DYR B;  1V55 B;  1DF4 A;  1M57 C;  4TWK A;  5B1A C;  1AI7 A;  3ABK B;  1EBO A;  1OZ0 A;  1WLE A;  3ETD A;  1JX9 A;  1K5S A;  1K97 A;  3JYC A;  5B3S C;  2H8P C;  3LUT B;  2WLL B;  1Q82 W;  2ZDI C;  1GM8 A;  4FMT A;  1Y66 A;  4BIU A;  1K9M W;  4JPR A;  1ARO P;  4JTD B;  3ZRS A;  3W7U A;  2P90 A;  2XAJ A;  3ASN C;  3ETG A;  3RVZ A;  3ASO B;  3OE7 G;  3JD0 A;  3STZ C;  1FXK B;  4LC1 A;  1R3K C;  2UXX A;  4RQE A;  4WFG A;  3ABM B;  3CCM V;  2H94 A;  3MHH C;  3KG2 A;  1QR9 A;  4Z1M G;  1EFR G;  3ZIA G;  4MVQ A;  4GX2 A;  4UUJ C;  2M7W A;  2JEU A;  2EIJ C;  4N23 A;  3SYO A;  1LNQ A;  1VQ7 V;  4JTA B;  1COW G;  5L3G A;  5L3B A;  3HB3 B;  4QE9 A;  1K34 A;  5LGT A;  5CA3 A;  3IGA C;  1QLE C;  3IFX A;  4UVC A;  3CME V;  2CK3 G;  4JAS A;  1NR7 A;  3E35 A;  2B1I A;  4R50 A;  2ZXW B;  5KA5 A;  2EZP A;  4R7C A;  1OCO B;  1TUE B;  2P6J A;  5KUK A;  3G71 V;  3SPH A;  2DWE C;  1GKF A;  5B1B C;  1QVF U;  1VQK V;  3K0D A;  3OMA B;  1SET A;  3AG2 C;  3AEI A;  1N8R W;  1GMG A;  3FB8 C;  3SYC A;  3ZMS A;  3G6E V;  5IYB O;  2WAM A;  3GWO A;  3MHS C;  5CN0 A;  4MVR A;  3VOU A;  3CC2 V;  5J9P C;  2HKO A;  4UXN A;  3DTU B;  4QPJ A;  1VQL V;  3K9A A;  1GO3 F;  4UV9 A;  2EBO A;  2LFR A;  2WLL A;  5IYD O;  2B1G A;  4PDV A;  1RPR A;  3WG7 B;  4G27 B;  5EBL C;  4ASU G;  2XAF A;  1PNK A;  4F4L A;  5LGU A;  2HLD G;  1K3E A;  2HJF C;  2XAH A;  3RBZ A;  4X8A A;  4WFH A;  3ZJZ A;  1NVP D;  2OCC B;  2EIM C;  3R65 A;  1FXK A;  3SPG A;  2DYS B;  1Q86 W;  2QA4 V;  5LGN A;  2ATK C;  3H01 A;  5B1O A;  2AHZ A;  1YIJ V;  1VQM V;  4KUM A;  3ZMT A;  3TK1 A;  2W6I G;  4KP4 A;  1S0V A;  1DTO A;  1K5Q A;  4P30 A;  3E8G A;  1HWY A;  2EIN B;  3BY6 A;  4R8C A;  3E83 A;  2PI5 A;  1M56 B;  1AI5 A;  2Q6A A;  4JGS A;  4XBF A;  3LDE A;  4P9O A;  1KD1 W;  2DYR C;  1V55 C;  1W0J G;  4PA6 A;  2Z3Y A;  2V1D A;  3ABK C;  1Y4M A;  1B6Q A;  1BHB A;  5L3F A;  2A79 B;  5B1N A;  3I55 V;  2DQ3 A;  3FKS G;  3K04 A;  4MTF A;  2Y69 B;  1F51 A;  1NBM G;  1IXM A;  1YSC A;  4I5S A;  3AG1 B;  4X88 A;  3W7W A;  2IW5 A;  1K8A W;  4MVO A;  3TCU A;  1VQ6 V;  2QE7 G;  4LCU C;  3CC4 V;  1AJQ A;  3ASO C;  4I9W A;  4RUE A;  4FPP A;  1FXK C;  4WFF A;  3JD1 A;  1G4Y B;  3LDD A;  3QNE A;  3LDC A;  3ABM C;  2UXN A;  2ITC C;  5EBW C;  3WFV A;  2QEX V;  2JEX A;  2XOK G;  4GX1 A;  3E2E A;  1DLB A;  1R3L C;  3SPC A;  2X6A A;  4CBC A;  2DWD C;  3RVY A;  2AHY A;  2YEV B;  3B8N A;  3T1C A;  4MVU A;  1SZT A;  1NQT A;  3E8B A;  1H8H G;  3ML0 A;  4MVS A;  4PDR A;  3FB7 C;  2IH3 C;  4XDK A;  2PI4 A;  2OTJ V;  2P67 A;  1NJI W;  4RQF A;  3ABU A;  4PDM A;  1VQ8 V;  3T4D A;  2Q68 A;  4FIP C;  2ZXW C;  1OCO C;  3OEE G;  1K33 A;  1VQN V;  3OMI B;  3E86 A;  2EIK B;  2X7R B;  3P32 A;  5CBF A;  3X2Q B;  2X0L A;  1BMF G;  4JYC A;  2WLM A;  1AI6 A;  3JCZ A;  4WFB V;  1S3J A;  4RO2 A;  2KB1 A;  1RM1 B;  1NH2 D;  1K73 W;  1H38 A;  4LP8 A;  1OCC C;  4TT3 G;  3CCS V;  4U7N A;  4CZZ A;  2WSS G;  1FXV A;  1E1R G;  3CP1 A;  1PKX A;  2F43 G;  4Q20 A;  3K06 A;  2Z5U A;  1V54 C;  1QVG U;  1XL4 A;  3STL C;  2ZR2 A;  1THZ A;  4J9Z B;  1YTF D;  1YJW V;  4JAV A;  2JK5 C;  3B8M A;  2Q69 A;  2IJH A;  2XAS A;  1GK9 A;  4TSF G;  1KEC A;  1I5X A;  3LSS A;  4GX5 A;  1ZWI C;  4MSW C;  3WG7 C;  1GM7 A;  2WLI B;  3K03 A;  5CBH A;  3E8F A;  1YJN V;  1GTO A;  1P4R A;  3HPL C;  5BZB A;  1S76 D;  3SPI A;  4EKW A;  2P7T C;  2Y48 A;  1P7B A;  3E89 A;  3CCE V;  2WLJ A;  2QM8 A;  1CEZ A;  3W7S A;  1RPO A;  1JVM A;  2OCC C;  4PDL A;  2DYS C;  4QNH B;  3LSQ A;  4BW5 A;  1CP9 A;  1EZJ A;  4MTX A;  4WFE A;  3W7T A;  2EIJ B;  2A9H A;  3OUF A;  1OCZ B;  4G2K A;  2EIN C;  5EC1 C;  1M56 C;  2NNU A;  1ORQ C;  5H6Q A;  3AG3 B;  1MOF A;  1ROP A;  1YIT V;  3OMN B;  3CXC U;  3SPJ A;  3CCV V;  1S5H C;  4R6Z A;  1Q7Y W;  2YEV A;  3K0G A;  2X6B A;  4X89 A;  2EZO A;  4OXS A;  2R9R B;  1OHH G;  1E79 G;  4MTO A;  4ZKI A;  3K08 A;  3AG1 C;  5C93 A;  2IU0 A;  3OW2 U;  1BL8 A;  2XAQ A;  1KP3 A;  4H37 A;  2WLK A;  4YXW G;  2LFS A;  3RW0 A;  1QBZ A;  3CCJ V;  2XAG A;  2EIL B;  4MS2 A;  3ZCC A;  2HFE C;  2LP7 A;  3ZMU A;  5IY5 B;  5HFL A;  1AJN A;  2IJJ A;  4E2L A;  4U7O A;  1FXH A;  3D36 A;  4XDL A;  2JJ2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...