1RPOA

Restored heptad pattern continuity does not alter the folding of a 4-alpha-helical bundle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
61
structure length
61
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP PROTEIN
publication title Restored heptad pattern continuity does not alter the folding of a four-alpha-helix bundle.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 29
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rpoA00
1PD3A 2IJKA 1ROPA 2IJHA 1NKDA 3K79A 2GHYA 1RPOA 1RPRA 2IJIA 4DO2A 1B6QA 1GMGA 1F4NA 2IJJA 1GTOA 1F4MA
chains in the Genus database with same CATH superfamily
3ZJZA 4X89A 5LHHA 2ITCC 5KUKA 4YHHB 5CMUA 3SYCA 1YDXA 5FNVA 1JMKC 5LP6B 1O9HA 4G2KA 4H33A 4HZ3A 1HR0B 4ZI7B 4F4LA 1R1BA 3B09A 3ETEA 3ZMTA 3DXRA 4CS4A 1PD3A 3LUTB 2OCCC 3T1YO 1L0LH 3G6BA 4O4JB 3ZCCA 4LF8B 4NTYA 3ETDA 2HJFC 4X1KB 4R7CA 4CS3A 1RSOB 4I9QA 2VRZA 4X1IB 1FJGO 4DRXB 4GUNA 3D8CA 5JH7A 2JIZG 3ABKB 4ZOLA 3ICXA 2YDEA 4FLWA 4IGGA 4LFAB 4R8CA 3OT7A 4AI8A 1B3QA 2QJ1A 1AJPA 2LO1A 2IH1C 1NQTA 4I9WA 2PUSA 5JCOA 4JI7B 4K8ZA 3ASOB 4DV2O 1K33A 1BHAA 2DYRB 4H13B 1BS3A 3GB7C 3O9OA 4FM0A 3BA8A 4TWKA 1HWYA 3U11A 1M57C 4BIUA 3E35A 2WSSG 4JYAO 1SQVH 4NXMB 2F93B 1XNRO 3HR0A 3QO8A 1Z5WA 4OX9B 3CCQV 2YEVA 2ZDIA 4ZKIA 1H2MA 2ZKOA 1FXHA 3D3QA 4Q20A 2LQTA 1KECA 3CP1A 3RYHA 2P67A 3BVOA 3JARA 2VS0A 1Q5OA 5L3EA 4G27B 2QWRB 1K73W 3OEEG 4DR6O 4LH6A 3Q4HA 1Q6IA 4QNHB 1TGOA 4Q6GA 2L35A 3BA9A 3JD4A 4B7KA 4WF9V 4LF9O 1EFRG 3TXQA 1PM9A 1H38A 1R3LC 5LMUO 4WFBV 3QO5A 2UXXA 4FLVA 4X1YA 4DR3O 1Y66A 2E74B 1GN4A 3RYIB 2YUAA 2F23A 1WP7A 4DV4B 2EINC 1SQPH 2FMLA 5EBMC 1E1RG 2UXBB 2UUCO 4FFKA 4HYOA 3ASOC 5HFLA 1M4UA 3JAKB 4P30A 3TETA 1PL4A 4MTXA 2N74A 3CS5A 2QGNA 2F43G 2V7QG 3BRCA 4O2AA 5IYDO 1MNGA 1GMGA 2LW1A 3O65A 3OR6C 2ITDC 1DF4A 2Q0AA 3ZMUA 2F95B 1HP8A 2YXYA 1VF5B 3GWOA 3VBBA 4NKGB 3ZHUA 4JV5B 3FFQA 2Z0AA 3JATB 2WLLA 5B1AB 5GTIZ 1JJOA 4J7JA 1DGSA 3PN1A 4NYKA 4O4LA 3K58A 4DV5O 4NR1A 4X65B 1QLNA 4I50B 5CA1B 3E89A 3T4DA 4UVCA 4LFBB 3ZN0A 1PL0A 4XDLA 2UXDB 1J5EO 1TUEB 4FIPC 4YJ2A 2N04A 4J7KA 4PJ0Z 4GYCB 4WFEA 4DV6O 3TGUH 2PZSA 4DR5O 1WB7A 2FTKA 2NLJC 3ML0A 2V4DA 3OAAG 5IDJA 2BE3A 3E83A 4RAIA 2Q68A 5LBQA 4LF4B 2QTSA 4QIWF 1VQ4V 1ZTEA 1J95A 2ZE8A 3H1KH 2CAZC 2ZXWB 1XMOB 1YEWA 4X88A 1VP7A 2HKOA 4BIOA 5J9PC 1QU7A 1AB3A 1NTKH 1W0JG 2GDSA 2V1DA 4QE9A 4F6RB 2M7WA 4WFAV 1IZ3A 1US6A 1B06A 3X2QC 2DOSA 4DR7B 2DE0X 1R3JC 4DXWA 5LP6A 3T1YB 1VF6A 2EZOA 5B3SC 1BE3H 5B1AC 2UUBO 3ZHTA 3BPZA 4PA9A 3E8HA 4J9ZB 1K5QA 4J9YB 1FJGB 2CGOA 2X6BA 1MSWD 4H44B 4O4JA 4TUYA 1MOFA 2NNUA 4X1KA 2B9ZA 4CH4A 4RUFA 5KLVH 1G6UA 2HVKC 4LH7A 2FKXA 2EIJC 1Y67A 4X1IA 3MDSA 1XL4A 4DRXA 2CUGA 2E5LO 3K0GA 2HLDG 4TOIA 3AG3B 1YTFD 3K0DA 3QG5A 1TA8A 2JJ2G 4JAAA 2ADQB 3TXSA 2LGQA 3K06A 1IX9A 2XNDG 1ENVA 3CJHA 2F4VO 2BSKB 4QJFB 2FYUH 5IYCO 1XQ8A 3ZHRA 4CC6A 1VQ7V 4TV8B 5LXTB 1MSDA 3SYAA 1XNRB 3RYFA 1NT2B 3IJ4A 3OUSA 3ZN1A 3A0RA 5H9CA 1SETA 1IXMA 2Y0PA 4PA4A 4PI2A 3RYCB 2IBZH 3LSQA 5D5QA 2Z3YA 4YJ3B 4DR6B 3K9AA 3JASB 4IIJB 1T5EA 2XHBA 5TISZ 3CC4V 1K7DA 3UCSC 1NR7A 5JQGB 2QKAA 4YHHO 1QNMA 4FLXA 5AG2A 4O4HB 4LF9B 4JZGA 1WA8A 4LWSB 2EZPA 4MTOA 5LMUB 4B3MO 4P9PA 5CA3A 1H2GA 1THZA 2DYSB 1RFYA 1A32A 2UUCB 3CCRV 2QA4V 2A06H 3AG3C 3STLC 1E1QG 4LF8O 3C90A 5L3GA 4CH5A 2EJRA 2KB1A 1S5LZ 4RWUA 5BZBA 2YC0A 4LR3A 3T1CA 2GV9A 3HKBB 1KP2A 5EYPA 3JAKA 3E22B 4I5SA 3H9VA 4JI7O 3ZRSA 3T1HO 2D3OW 3JD2A 4MVOA 4DV7O 2P22C 2W6JG 4DV5B 5B66Z 3BEHA 5LYJB 3P3NA 2ILMA 3N2KB 3K59A 3CCMV 3SPGA 2ADPA 3JATA 5KA6A 1SKVA 1G4YB 4KXRA 2RQ6A 1GH6A 1F7YA 4NXMO 3OD4A 2CK3G 4MVMA 3S3WA 1J5EB 3L71H 4I50A 3F5TA 5CA1A 5EIBC 4J42A 4DV6B 5ITZB 1PP9H 2DYSC 3UO2A 1YTFB 2Y0IA 4BW9A 1HNXO 1ORQC 2WLJA 4GZRB 4RO2A 4F6EA 4O4IB 2UXNA 4JYBA 3OUFA 3VQWA 4CS2A 3CMAV 1H2LA 3JSLA 3CCVV 4FMTA 4IYIA 2R9AA 2QEXV 1GM8A 1V54B 3JALA 1SQQH 2XAHA 2YICA 1KQSU 4TQDA 2W0FC 4KUMA 1PNLA 4WFGA 1XI1A 3G71V 3QTCA 4UCUA 5JWPA 4JGSA 3ZHVA 1PPJH 4O2BB 4IHJB 5K1XA 5LHGA 4X62O 5KMGB 1N33O 1VARA 2IJKA 2UUBB 3UT5B 2E3CA 4WBNB 2Q67A 4Z2WA 4GLXA 3JCUZ 3OGIB 4R50A 1V55C 4LF7O 5DEDA 2EILC 4UUJC 1KKCA 3W7SA 4NB5A 2HEPA 1PKXA 3FD9A 3AK1A 2Z5UA 2UUAO 2P5OA 1GM9A 2ZCEA 2E5LB 1MZFA 2OCCB 1M90W 4LC1A 1K8AW 4JTCB 4JV5O 2JDIG 2VQEO 2QM4A 4X65O 2F4VB 1L1FA 5EBWC 2JS3A 1P7BA 4FM2A 4ASUG 2H3OA 4LFBO 3FB5C 4P2ZA 4UB6Z 5CA0A 3CYOA 1K5SA 2BSKA 3P3PA 1S5JA 4DK1A 2CTRA 2CH7B 1OHHG 4E2LA 2RCVA 3DGEA 2YXHA 3M7MX 3BHPA 4TV8A 1EN6A 5LXTA 2YXLA 5L3BA 4AQYB 1VIBA 4LF4O 3ETQA 3M8AA 3SPJA 1M57B 1WNSA 1N4CA 2NR5A 5KHIA 2YSUB 5EK0A 1CP9A 1OCCB 1XMOO 4YJ3A 2QR4A 1VQ5V 3N2GB 3JASA 4IIJA 1FS0G 5EZYA 1OCOB 2PI4A 3QVNA 4B3MB 5B1BB 5JJJB 5GTHZ 1XNQO 4U3JB 5JQGA 2Y69C 3JD3A 4O4HA 4DR7O 3KG2A 4GX1A 4FZ0A 3UQ8A 4LWSA 1YXBA 2WLKA 1MMMA 1R6NA 1JVMA 2F1MA 1P7GA 3QO7A 4BAYA 4NXNO 4DV3O 4JI3O 4FLZA 3K5MA 1VQNV 3APOA 2ZINA 3CX5F 1Q90D 1KC8W 1TVKB 5FLXN 1XHZA 1OCZC 3K57A 5IYZB 1Z5VA 4GX0A 1K92A 1P84F 4K35A 3I56V 2EINB 4EFEA 3T1HB 5LHIA 1Y74B 4UCRA 4DV7B 1FXKB 3LSSA 4JI0O 3VQXA 2P4VA 1I94O 2Y4TA 5KAIZ 1YJ9V 4OGQB 1Y6XA 3ZEDA 5IWAO 1IURA 2HHHO 1OCCC 3SJBC 1GAXA 1O9GA 1SZTA 2RNBA 3LNNA 3ZMZA 1OCOC 1XREA 3N2KA 2WAMA 5B1BC 2DMXA 1WB8A 3SPHA 1IDSA 4MVZA 3AG4C 2YIAA 5IJ9B 2Q69A 1HNXB 2RDCA 2X7RB 3T4ZA 4UXNA 4J7ZA 4TSFG 5IY5B 1UPGA 3H1LH 2DJVA 2W0XA 1N0NA 4GCZA 2IU0A 2IH3C 2OYQA 5CBHA 4JI6O 3IGAC 3H1HH 3AG1C 4MS2A 4DW1A 1Y4MA 1ZAUA 3WU2Z 5KUMA 4D7TA 4OPHA 3BFRA 2BOBC 3SGIA 4O4IA 1VQOV 5A9GA 1BQZA 5F2VO 4JI2O 1WPBA 4UVBA 5H2FZ 1NZ6A 5J2UB 4X62B 1N33B 1SERA 3ZBHA 1FXKC 4CH3A 1R73A 4A5UB 4RUEA 3GVMA 4O2BA 4IHJA 2E75B 4LF7B 2IJHA 5KMGA 1I0HA 5DM6V 2AZ0A 4D6TH 3ABUA 2YI8A 5IJ0B 2P4KA 2HG5C 3OFNG 3B8MA 3CCLV 5KHJA 3AG2B 3X2QB 2UUAB 1AI4A 3FKSG 2WLIB 2QWPB 1XUQA 4X20B 5BR8O 4I55A 4HNAB 5B3SB 1RPOA 3CWBH 4R6ZA 1W59A 1F23A 3ZIAG 5K1PA 3LDEA 1NVPB 2VQEB 2WA3A 4HAMA 4NTWA 4WFHA 5JVDB 1N0JA 2ZT9B 1WLEA 5IY5C 1QVFU 2JVDA 3DC6A 3IC7A 1AJQA 3ETGA 5EIBD 2Q7GA 1NS1A 4L87A 2EIJB 4JI8O 2Q9LA 3W7TA 1EZJA 1AILA 4CZZA 1AP6A 1HNZO 3HKCB 2EULA 2O57A 2JRIA 4PDMA 1BCCH 3IFXA 1D5NA 4TV9B 1GKFA 2CH7A 4GX2A 1VQ8V 3FAVB 5KAFZ 4MTGA 2OTLV 5B1OA 2BOCC 4JTAB 3CD6V 1LR1A 3E8FA 2Y48A 3A0HZ 3OMAB 3ZRVA 1I5XA 3CEIA 2DWEC 1XNQB 2OWOA 3M99B 4AILC 3SPCA 3ZRWB 3A8TA 3C3SA 1CEZA 3AG2C 1N36B 3E8BA 3N2GA 2ZIOA 4DYLA 5KHGA 4JI4O 3CXCU 3HKDB 3RN4A 4EB6B 4U3JA 4ZIBA 4ZI7A 2Q0OC 2R9RB 1KYOF 5LA6B 4E4EA 4NXNB 4DV3B 4K0KO 3OEHG 4JI3B 1BZKA 2YS8A 1JQ0A 2HVJC 3SPIA 2QTOA 4KL1A 3JD0A 2EIKB 3ABTA 4XDJA 1MA1A 4GT1A 5EC1C 3K9SA 3FYEB 3TCUA 1RSOA 3FB7C 1U96A 3CMEV 3A0BZ 1M1KW 3CHXA 1Q43A 1I08A 4TQFA 2HJDA 3KCXA 1TVKA 1JCHA 4J80A 4YIPA 1KMIZ 2MK3A 4JF3A 2YIBD 4JI0B 5KHKA 1I94B 1S76D 2CDYA 1JA8A 5IWAB 1FXVA 2HHHB 1Y74A 4Z1VA 4JI1O 2Y4UA 1BT8A 2JK5C 1FXKA 4IL6Z 1GO3F 1NI8A 2XT9A 3BCCH 3D36C 4FLUA 1IBKB 1AI6A 4NTXA 1Y76B 4DR1B 3NXSA 4MVQA 1K4CC 4AQYO 4U7OA 1DTOA 4JI5O 3K08A 1HNWO 1ZL8B 3HPLC 3F5WC 3THOA 5BMVB 2K9PA 1D5AA 3WB2A 4JI6B 4DUYO 2FB5A 3K79A 3JAWB 4G28B 5IJ9A 2JGDB 3K5NA 1QLEC 4ICGA 3B4SA 4FPPA 3DTUB 4FLYA 4U3FH 2EIKC 3TK1A 3RBZA 2ZIMA 1EN4A 4JI2B 1COWG 1QHTA 3KZIZ 5BY1A 1VQKV 3AG7A 1AR4A 4JTDB 4UCTA 2VWKA 2A79B 4UCVA 2XOKG 1RP3B 2QKSA 2UU9O 5EBLC 3RYIA 5J2TB 1SRYA 3EHBB 4LBEC 2DN9A 2JJ1G 4WFFA 5J2UA 5L3DA 1EN5A 1P49A 2L6LA 1AVMA 1GRJA 1X4TA 1SQBH 2IW5A 1IBMO 4QGPA 4I7ZB 1NH2D 5IT9N 1JOYA 2ODMA 3AK3A 1H8HG 1PNKA 1TUBB 1NKDA 1URFA 5H6RA 5H5NA 3ZMVA 5BR8B 4H37A 1M5IA 4WCEV 1YITV 3CRRA 2DQ0A 5IJ0A 1YF2A 4J11A 3L70H 1K3EA 2XTAA 1K97A 2JEXA 1Q7YW 3T2MA 1Q81W 2WLIA 1V55B 4X20A 1HDJA 4YIOA 4HNAA 2EILB 1W2BU 4CH6A 2XAFA 1QR8A 2WA4A 5JVDA 4JI8B 2EIMB 1VQPV 2HR3A 5KX5B 4DO2A 1AP5A 4FFBB 1HNZB 3RYHB 4JYYA 4B3RO 2ZR3A 3JARB 4CBCA 3CB2A 3L9DA 3W7UA 1JPXA 3SJQC 3CRCA 4OPAA 3TJTA 4JAVA 2OCHA 2B1GA 1OCRB 2D2CB 3OE7G 5LOVB 3R65A 1ZLZA 3JYCA 4LFCB 3KCYA 1QVGU 3OMIB 3B77A 4JPRA 4TV9A 2LP7A 1H2NA 1L8DA 2GSMB 3FAVA 1WJZA 2A0LA 3B8NA 2G38A 3OTOO 3RWRD 3RFRA 1BHBA 4UFZA 5DN6G 4KHPO 3BABA 1FKAO 3P32A 2X0LA 2QWQB 4JI4B 5JCOC 1SS3A 4HBNA 3VQYA 4F6RA 3ZRWA 3ABLB 3RVYA 1DK1A 4K0KB 4RQFA 4DV1O 2ZNIA 3CCJV 3L72H 3OR7C 1SQFA 4W4LA 3HKDA 2YI9A 1L0NH 5GONB 3WG7B 2Y69B 2IJJA 3ZRXA 1LNQA 3CE2A 2EIMC 2LW7A 2LFSA 2ZD9A 4K3AA 3N27A 2ZDIC 3CSXA 4J10A 5LL6Y 1M93A 1P4RA 1MZEA 4DR4O 4B3SB 5C93A 4O4LB 4PELA 1K4DC 4ZHQB 4JI1B 1OCRC 4W4KA 1OCZB 4B3TB 3I55V 1K34A 3MD0A 3NR7A 2QE7G 3P30A 2GTAA 5EC2C 1MG1A 3ZS8C 1ZWIC 4FJCC 1NH2B 4DUZB 1VQ6V 1YIJV 3G67A 5FPOA 4JI5B 1HNWB 3K5LA 2A7WA 5LGTA 5JJEB 3H01A 1SC5B 3ABLC 1G1XB 2PYLA 1XEQA 3WB0A 3RYCA 4DUYB 2CE4A 1NJIW 2AZ2A 1NBMG 1SESA 4PA3A 3SR2C 1ZL8A 1FFXB 4GKKO 4X8AA 5KHHA 2KKWA 3WG7C 1GN2A 2JEUA 1KUQA 4JZ2A 1N36O 3JAWA 4H0LB 3AG4B 2JGDA 2XAJA 1NVPD 3W7XA 3CCUV 2GHYA 3G6EV 2UU9B 3CRQA 2BTQB 3AG1B 3E8GA 2Q4PA 4QPJA 1S0VA 5LGNA 2OIGA 4XDKA 4BR6A 2QDOA 2IJIA 5C8YB 4PA7A 5J2TA 1ZSPA 3DSQA 4C7UA 1IBMB 3DC5A 4TUYB 1WAZA 4J41A 1UJWB 2PY5A 3HKBA 2XUMA 4D7SA 1WN7A 2EBOA 3L74H 3MHSC 3E22A 1CXZB 4EEQA 1TUBA 3CC7V 1V9PA 2ATKC 3RGBA 3W7WA 3K3WA 2R70A 3CJHB 1KB9F 3AK2A 1U97A 3CRMA 3JCZA 2P7TC 4X64O 3ASNB 5LYJA 1OJHA 1IBKO 3KKYA 2P6JA 2HP8A 3RYFB 4UCSA 4DR1O 1RM1B 4DV0O 4PHZA 1VF7A 3FYIB 1QQCA 3BAAA 4B3RB 1S3JA 3FX7A 1KD1W 4NVPA 2DQ3A 5KX5A 5LP6C 1KP3A 5ITZA 1ZUQA 1VF6C 2A9HA 4QE7A 4LF5O 4FFBA 1AI7A 4EKWA 4X66O 5H6QA 3BY6A 1WP8A 4XBFA 2YIBA 1WA8B 4LF6O 3OTOB 5LOVA 1N8RW 2OT5A 3IAYA 4KHPB 3FB6C 2NN4A 4FLTA 2W6IG 1OZ0A 1YZBA 2YIDA 4B08A 3E2EA 3ABKC 1BSMA 1GK9A 1IXBA 2ZNJA 5KA5A 4DV1B 3APQA 4PA6A 1X59A 4I0XB 3UT5A 2IU3A 1QCEA 2RN9A 5EYPB 2BCCH 4WBNA 3CCEV 4DR2B 3ABMB 4JASA 3ASNC 1OV9A 2DYRC 3LDDA 4U7NA 5DECA 2GBOA 4P9OA 1RM1C 1W0KG 1YCIA 5GONA 2P90A 3SYQA 2M6YA 2E76B 2BTOA 1EM1A 2DWDC 4DR4B 5LMNO 4PDLA 2UXCB 3SDLA 1Q86W 1XMQB 1FFTB 3K04A 3IC9A 2QWOB 2AXTZ 3SYOA 4I4TB 2XAQA 4OXSA 1N34O 1G8MA 4ZHQA 3OM3B 3OMNB 2KG7B 4LNUB 3J80N 1R3IC 3CPWU 4QPKA 3F7VC 2CTPA 1E79G 5CB4B 1IVSA 2EX3A 1SA0B 4GKJB 1XILA 3GWKC 3ZHSA 4CC5A 3R66A 1IBLO 2MW2B 2PTMA 4RQEA 4LFCO 4PV1B 4DW0A 3STZC 3LDCA 2Q73A 5JJNB 1VQLV 1VMGA 4GKKB 3JALB 1B04A 1KKDA 2WLMA 2PYJA 3K5OA 1I7FA 1NR1A 1DF5A 2AW9A 2PGGA 4PDRA 1JX9A 1AJNA 3ABMC 1VQMV 5IE9A 1BGYH 3JSNA 1JFFB 2GUZB 1YI2V 4MSWC 5LGUA 1PNMA 2ZM6O 1N32O 1FFXA 1ZX3A 5CBGA 1YJWV 1S77D 3J81N 4PI0A 1ROPA 3H1IH 3U0ZA 4PDVA 1VEWA 2RJZA 2HFEC 1BQ0A 1QLEB 2ZR2A 1S5HC 1TAEA 4IYHA 2KSDA 2BTQA 1M56B 2VWJA 2Q7HA 2H94A 2P06A 3RW0A 1B6QA 3I5DA 5C8YA 1Q8IA 3CCSV 2CTQA 2RMKB 1AI5A 3FB8C 5IYZA 4B3SO 1BL8A 4MTFA 4YY3O 1SQGA 1Q3EA 5GW7A 2XAGA 1YVWA 4B3TO 2XASA 4DV2B 3EFFK 4X64B 1MABG 1XL6A 3JD1A 3RT3C 5CA0B 2CGNA 1H8EG 2EJ7A 1LUVA 4DUZO 4UCOA 4DV0B 5BXZA 1F51A 1LUWA 4X9QA 1QBZA 2DW4A 1NU1H 2X6CA 3CRAA 2QKCA 4JYAB 3HKEB 2ZXWC 4MVSA 3JAMN 2PI5A 1YSCA 2WPDG 3OTFA 1CPYA 3E86A 2X6AA 3VQVA 1FD9A 4LF5B 3QNEA 4FVMA 2OIEA 4X66B 1XBLA 4JYCA 1F4NA 2VQFO 5FNVB 1RPRA 5EZYB 4LF6B 3L73H 2ARHA 3G4SV 3CXHF 3WFVA 1M56C 2LGWA 4LCUC 3LNMB 3PJSK 3DXRB 1GN3A 2WLHA 2ZE5A 4ZBMA 4DR3B 3OW2U 3EVKA 5L3FA 2AHYA 2CTWA 5FL7G 3UO3A 1HR0O 1XDCA 1FPOA 1QR9A 2R9IA 2PF4E 2JS5A 2ETNA 3RVZA 2B1IA 2KQXA 5JH7B 4ZOLB 1KBHA 3MAQA 4FM1A 2FL4A 3S3XA 1PV0A 5FPRA 4I0XA 5CN0A 1F4MA 2Q8VA 4UV9A 4K8XA 2QWNB 3QF7A 1K9MW 1NTMH 5LMNB 2LJ2A 4LFAO 3ZMSA 2R72A 3U10A 3SYPA 3AEIA 1H2KA 1SF9A 1YJNV 5E79Z 2GTSA 4BWAA 2H8PC 4EFBA 1D2DA 4FK5C 3WB1A 1YHQV 2B5UA 1N34B 5E1AC 3EXAA 2ZE7A 1AR1B 2YEVB 1EZVH 4ABMA 4I4TA 5HFMA 4YXWG 1DLBA 1Q6UA 1H2SB 4OX9O 3Q4HB 1IBLB 2KG7A 4Z1MG 1R6TA 4LNUA 1UFIA 4KFMA 4DR5B 3HKCA 1XHXA 4BIZA 2IM9A 2QM7A 5CB4A 4UB8Z 1SA0A 3B2EE 3HB3B 4LP8A 2QM8A 3SJAC 4MT8A 3G80A 5L3CA 4X1YB 1SZXA 4N23A 4L8JA 2ZE6A 3UKMA 3D36A 2ZM6B 1JJ2U 1N32B 2N05A 3CC2V 4UVAA 2ZQMA 2OTJV 1KU9A 3LSUA 3OGCC 4KP4A 4UV8A 3B40A 4B7EA 4IT5A 4TT3G 3VOUA 1JFFA 2GUZA 1VQ9V 4DV4O 3L75H 3MHHC 3ZX6A 4O2AB 3H1JH 4EB6A 4JAUA 2UXBO 1S72V 5D5PA 3A2FA 5LA6A 4DR2O 2WWWA 4N21A 4MVUA 3ZHQA 2F66C 4GX5A 1R3KC 2K1EA 1NTZH 4I55B 5B1NA 4FZ1A 2WLLB 2AHZA 3D3IA 1XOUA 2LFRA 2UXCO 3SJCC 4YY3B 4AHCA 2JGUA 1XMQO 1JR9A 2C2AA 3F7YC 1M9NA 1GM7A 1SQXH 2WLNA 3C3TA 4MVRA 1BMFG 2QSAA 4PD4F 5A2QN 1AR5A 5B5EZ 4YJ2B 1FYJA 2Q7EA 1Z2GA 1AROP 1GN6A 1I5YA 1V54C 1FAFA 4GKJO 1HW7A 2UXDO 2Q5ZA 1Y76A 4MW3A 5CBFA 3J7AU 2AGAA 3K03A 3HKEA 2VQFB 4BW5A 1Q82W 5BMVA 1GTOA 2A3QA 3UM7A 1WPXA 1Q6HA 1R6KA 1EBOA 4DK0A 4MW8A 2Q6AA 5IYBO
chains in the Genus database with same CATH topology
1JCHA 2CK3G 3ZJZA 4PA6A 4MVMA 4X89A 5LHHA 2ITCC 2MK3A 4JF3A 5KUKA 5CMUA 3SYCA 1S76D 2IU3A 1QCEA 3CCEV 3ABMB 1FXVA 2DYSC 4JASA 3ASNC 2DYRC 4G2KA 3LDDA 1YTFB 4U7NA 2JK5C 1ORQC 1FXKA 4H33A 4HZ3A 4P9OA 2WLJA 4RO2A 4F4LA 1RM1C 1W0KG 1GO3F 2UXNA 4JYBA 3OUFA 2P90A 3ETEA 3ZMTA 3CMAV 1PD3A 3SYQA 3CCVV 4FMTA 3LUTB 2DWDC 2OCCC 2QEXV 1GM8A 1AI6A 1V54B 4PDLA 3NXSA 4MVQA 2XAHA 3ZCCA 1K4CC 1KQSU 3ETDA 2HJFC 1Q86W 4U7OA 2W0FC 4KUMA 4R7CA 1DTOA 1PNLA 4WFGA 1FFTB 3K08A 3G71V 3K04A 3HPLC 3F5WC 4JGSA 3SYOA 2XAQA 2JIZG 3ABKB 4OXSA 5LHGA 1G8MA 3OM3B 3OMNB 2IJKA 4R8CA 3K79A 4G28B 1AJPA 2IH1C 1NQTA 1QLEC 4I9WA 1R3IC 4FPPA 3DTUB 3CPWU 4QPKA 3F7VC 2EIKC 3TK1A 3RBZA 1E79G 2Q67A 3ASOB 4R50A 1V55C 1COWG 1VQKV 4JTDB 1K33A 1BHAA 2DYRB 2EILC 4UUJC 3W7SA 4RQEA 3GB7C 2A79B 4TWKA 1PKXA 1HWYA 3LDCA 3STZC 1M57C 2XOKG 2Z5UA 3E35A 2QKSA 4BIUA 5EBLC 1VQLV 1GM9A 2WSSG 2OCCB 1M90W 1SRYA 2WLMA 3EHBB 1KKDA 4LBEC 4LC1A 1NR1A 2JJ1G 1K8AW 1DF5A 4WFFA 4JTCB 3QO8A 5L3DA 4PDRA 1JX9A 1AJNA 2JDIG 3ABMC 3CCQV 1VQMV 2YEVA 2ZDIA 4ZKIA 1FXHA 4Q20A 1YI2V 4MSWC 5LGUA 1KECA 1PNMA 2IW5A 3CP1A 2P67A 1JOYA 1L1FA 1NH2D 5EBWC 5CBGA 5L3EA 1YJWV 1H8HG 1S77D 1P7BA 1PNKA 4G27B 1K73W 1ROPA 3OEEG 1NKDA 4ASUG 4PDVA 3FB5C 4P2ZA 5H6RA 3ZMVA 4QNHB 4H37A 2HFEC 4WCEV 1YITV 3CYOA 1QLEB 2DQ0A 2ZR2A 1K5SA 1K3EA 1S5HC 1K97A 2JEXA 1Q7YW 3T2MA 1OHHG 3JD4A 4E2LA 4WF9V 3DGEA 1EFRG 1Q81W 2WLIA 1V55B 1H38A 1R3LC 5L3BA 4WFBV 1M56B 3QO5A 2UXXA 2H94A 2EILB 1Y66A 3RW0A 1B6QA 1W2BU 3SPJA 2XAFA 1QR8A 1M57B 3CCSV 2EINC 2YSUB 1AI5A 3FB8C 2EIMB 5EK0A 1VQPV 2HR3A 5EBMC 1CP9A 1OCCB 1E1RG 4DO2A 4HYOA 1VQ5V 3ASOC 5HFLA 1BL8A 1FS0G 4MTFA 4P30A 1OCOB 3TETA 4MTXA 2PI4A 2ZR3A 5GW7A 4CBCA 5B1BB 3W7UA 1JPXA 2F43G 2V7QG 2XAGA 2Y69C 3SJQC 2XASA 5IYDO 1GMGA 3EFFK 3JD3A 1MABG 3OR6C 1XL6A 3JD1A 4JAVA 2ITDC 2B1GA 1OCRB 3KG2A 1DF4A 4GX1A 3OE7G 3R65A 1H8EG 3ZMUA 3JYCA 2WLKA 1R6NA 1QVGU 3OMIB 3B77A 1F51A 4JPRA 1JVMA 1QBZA 2DW4A 2X6CA 3QO7A 2LP7A 2ZXWC 3GWOA 4BAYA 2GSMB 3VBBA 4MVSA 2PI5A 1YSCA 2A0LA 2WPDG 3B8NA 2WLLA 5B1AB 1VQNV 1CPYA 3E86A 2X6AA 1BHBA 5DN6G 1KC8W 3P32A 2X0LA 3QNEA 1OCZC 1QLNA 4GX0A 1F4NA 4JYCA 1K92A 3I56V 3ZRWA 2EINB 3ABLB 1RPRA 3E89A 3T4DA 4UVCA 3RVYA 5LHIA 3ZN0A 4RQFA 1PL0A 4XDLA 3G4SV 3CCJV 1TUEB 3WFVA 3OR7C 1FXKB 1M56C 4FIPC 3LSSA 4LCUC 3LNMB 4WFEA 3WG7B 3PJSK 1YJ9V 2Y69B 2NLJC 2FTKA 3ML0A 3OAAG 5IDJA 2IJJA 2WLHA 3ZRXA 1LNQA 4ZBMA 3E83A 4RAIA 2EIMC 3OW2U 5L3FA 2Q68A 1OCCC 2AHYA 5LBQA 1SZTA 2LFSA 2ZD9A 5FL7G 2ZDIC 4QIWF 3ZMZA 1VQ4V 1OCOC 1J95A 1QR9A 2R9IA 1P4RA 3RVZA 2WAMA 2ZXWB 5B1BC 2B1IA 4X88A 3SPHA 2HKOA 4MVZA 5C93A 4PELA 1K4DC 5J9PC 1W0JG 1OCRC 3AG4C 2Q69A 1OCZB 2V1DA 4QE9A 2M7WA 2X7RB 3T4ZA 4UXNA 5CN0A 4WFAV 1F4MA 4UV9A 4TSFG 5IY5B 3I55V 1K34A 3X2QC 3MD0A 2QE7G 3P30A 4GCZA 5EC2C 2IU0A 1MG1A 1R3JC 2IH3C 1K9MW 5CBHA 1ZWIC 4FJCC 4DXWA 3IGAC 1NH2B 3AG1C 4MS2A 3ZMSA 1Y4MA 2EZOA 1VQ6V 5KUMA 5B3SC 1YIJV 3SYPA 5B1AC 3AEIA 2BOBC 1VQOV 1YJNV 4PA9A 3E8HA 5LGTA 2H8PC 4J9ZB 1K5QA 4J9YB 2X6BA 4UVBA 4FK5C 3H01A 1YHQV 2B5UA 1MSWD 3ABLC 1MOFA 5E1AC 2NNUA 1AR1B 1NJIW 2YEVB 1SERA 1NBMG 1SESA 4RUFA 2HVKC 4PA3A 2EIJC 1FXKC 1XL4A 4X8AA 1R73A 4RUEA 3K0GA 5HFMA 3WG7C 4YXWG 2JEUA 2HLDG 1DLBA 3AG3B 1YTFD 3K0DA 2IJHA 2JJ2G 5DM6V 4Z1MG 3AG4B 2XAJA 3K06A 2XNDG 3ABUA 1NVPD 1ENVA 4KFMA 2HG5C 3W7XA 3CCUV 2GHYA 3B8MA 3OFNG 4QJFB 3CCLV 4BIZA 2QM7A 5IYCO 3G6EV 3AG2B 3X2QB 1AI4A 3HB3B 1VQ7V 4LP8A 2QM8A 3FKSG 2WLIB 4MT8A 3SYAA 3AG1B 3E8GA 5L3CA 4QPJA 5B3SB 1S0VA 5LGNA 1RPOA 4N23A 4R6ZA 3ZIAG 1F23A 4XDKA 3OUSA 3LDEA 1NVPB 2IJIA 3ZN1A 3A0RA 5H9CA 1SETA 4PA7A 3UKMA 1IXMA 4HAMA 3D36A 4WFHA 1JJ2U 1WLEA 4PA4A 4UVAA 3CC2V 5IY5C 1QVFU 2ZQMA 3LSQA 2OTJV 2Z3YA 1UJWB 3OGCC 4KP4A 4UV8A 3IC7A 3K9AA 4TT3G 1AJQA 3CC4V 3ETGA 2EBOA 3VOUA 1K7DA 1NR7A 1VQ9V 4L87A 2EIJB 3MHHC 3MHSC 3W7TA 4JAUA 3CC7V 1EZJA 2ATKC 1S72V 3W7WA 2WWWA 2EZPA 4MTOA 4CZZA 3K3WA 4N21A 4MVUA 4P9PA 4PDMA 5CA3A 3IFXA 1H2GA 2P7TC 3JCZA 4GX5A 1THZA 1GKFA 4GX2A 2DYSB 3ASNB 1R3KC 1VQ8V 2K1EA 5B1NA 4MTGA 2OTLV 2P6JA 2WLLB 5B1OA 2AHZA 3CCRV 2BOCC 3D3IA 4JTAB 2LFRA 2QA4V 3CD6V 1RM1B 3AG3C 3STLC 1E1QG 3E8FA 2Y48A 5L3GA 3FYIB 3OMAB 2EJRA 3ZRVA 2KB1A 1I5XA 1S3JA 1KD1W 2DWEC 3M99B 2C2AA 3F7YC 1M9NA 5BZBA 2DQ3A 3SPCA 3ZRWB 1GM7A 3T1CA 2WLNA 1CEZA 4MVRA 3AG2C 1BMFG 1KP3A 3E8BA 1KP2A 2A9HA 4QE7A 1AI7A 4EKWA 3CXCU 5H6QA 4I5SA 3BY6A 1AROP 3ZRSA 4XBFA 2R9RB 2D3OW 1I5YA 3JD2A 1V54C 3OEHG 4MVOA 1N8RW 1JQ0A 2OT5A 2HVJC 3SPIA 2QTOA 2W6JG 3JD0A 3FB6C 2EIKB 3ABTA 4XDJA 4GT1A 4MW3A 5EC1C 5CBFA 3BEHA 2W6IG 1OZ0A 3FYEB 3TCUA 3K03A 3E2EA 3FB7C 4BW5A 1Q82W 3CMEV 1GTOA 3CCMV 3UM7A 3SPGA 1M1KW 3ABKC 1WPXA 1R6KA 1EBOA 1G4YB 1GK9A 5KA6A 4MW8A 2Q6AA 5IYBO 5KA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  2IJK A;  1ROP A;  2IJH A;  1NKD A;  3K79 A;  2GHY A;  1RPO A;  1RPR A;  2IJI A;  4DO2 A;  1B6Q A;  1GMG A;  1F4N A;  2IJJ A;  1GTO A;  1F4M A; 
#chains in the Genus database with same CATH topology
 3ZJZ A;  4X89 A;  5LHH A;  2ITC C;  5KUK A;  4YHH B;  5CMU A;  3SYC A;  1YDX A;  5FNV A;  1JMK C;  5LP6 B;  1O9H A;  4G2K A;  4H33 A;  4HZ3 A;  1HR0 B;  4ZI7 B;  4F4L A;  1R1B A;  3B09 A;  3ETE A;  3ZMT A;  3DXR A;  4CS4 A;  1PD3 A;  3LUT B;  2OCC C;  3T1Y O;  1L0L H;  3G6B A;  4O4J B;  3ZCC A;  4LF8 B;  4NTY A;  3ETD A;  2HJF C;  4X1K B;  4R7C A;  4CS3 A;  1RSO B;  4I9Q A;  2VRZ A;  4X1I B;  1FJG O;  4DRX B;  4GUN A;  3D8C A;  5JH7 A;  2JIZ G;  3ABK B;  4ZOL A;  3ICX A;  2YDE A;  4FLW A;  4IGG A;  4LFA B;  4R8C A;  3OT7 A;  4AI8 A;  1B3Q A;  2QJ1 A;  1AJP A;  2LO1 A;  2IH1 C;  1NQT A;  4I9W A;  2PUS A;  5JCO A;  4JI7 B;  4K8Z A;  3ASO B;  4DV2 O;  1K33 A;  1BHA A;  2DYR B;  4H13 B;  1BS3 A;  3GB7 C;  3O9O A;  4FM0 A;  3BA8 A;  4TWK A;  1HWY A;  3U11 A;  1M57 C;  4BIU A;  3E35 A;  2WSS G;  4JYA O;  1SQV H;  4NXM B;  2F93 B;  1XNR O;  3HR0 A;  3QO8 A;  1Z5W A;  4OX9 B;  3CCQ V;  2YEV A;  2ZDI A;  4ZKI A;  1H2M A;  2ZKO A;  1FXH A;  3D3Q A;  4Q20 A;  2LQT A;  1KEC A;  3CP1 A;  3RYH A;  2P67 A;  3BVO A;  3JAR A;  2VS0 A;  1Q5O A;  5L3E A;  4G27 B;  2QWR B;  1K73 W;  3OEE G;  4DR6 O;  4LH6 A;  3Q4H A;  1Q6I A;  4QNH B;  1TGO A;  4Q6G A;  2L35 A;  3BA9 A;  3JD4 A;  4B7K A;  4WF9 V;  4LF9 O;  1EFR G;  3TXQ A;  1PM9 A;  1H38 A;  1R3L C;  5LMU O;  4WFB V;  3QO5 A;  2UXX A;  4FLV A;  4X1Y A;  4DR3 O;  1Y66 A;  2E74 B;  1GN4 A;  3RYI B;  2YUA A;  2F23 A;  1WP7 A;  4DV4 B;  2EIN C;  1SQP H;  2FML A;  5EBM C;  1E1R G;  2UXB B;  2UUC O;  4FFK A;  4HYO A;  3ASO C;  5HFL A;  1M4U A;  3JAK B;  4P30 A;  3TET A;  1PL4 A;  4MTX A;  2N74 A;  3CS5 A;  2QGN A;  2F43 G;  2V7Q G;  3BRC A;  4O2A A;  5IYD O;  1MNG A;  1GMG A;  2LW1 A;  3O65 A;  3OR6 C;  2ITD C;  1DF4 A;  2Q0A A;  3ZMU A;  2F95 B;  1HP8 A;  2YXY A;  1VF5 B;  3GWO A;  3VBB A;  4NKG B;  3ZHU A;  4JV5 B;  3FFQ A;  2Z0A A;  3JAT B;  2WLL A;  5B1A B;  5GTI Z;  1JJO A;  4J7J A;  1DGS A;  3PN1 A;  4NYK A;  4O4L A;  3K58 A;  4DV5 O;  4NR1 A;  4X65 B;  1QLN A;  4I50 B;  5CA1 B;  3E89 A;  3T4D A;  4UVC A;  4LFB B;  3ZN0 A;  1PL0 A;  4XDL A;  2UXD B;  1J5E O;  1TUE B;  4FIP C;  4YJ2 A;  2N04 A;  4J7K A;  4PJ0 Z;  4GYC B;  4WFE A;  4DV6 O;  3TGU H;  2PZS A;  4DR5 O;  1WB7 A;  2FTK A;  2NLJ C;  3ML0 A;  2V4D A;  3OAA G;  5IDJ A;  2BE3 A;  3E83 A;  4RAI A;  2Q68 A;  5LBQ A;  4LF4 B;  2QTS A;  4QIW F;  1VQ4 V;  1ZTE A;  1J95 A;  2ZE8 A;  3H1K H;  2CAZ C;  2ZXW B;  1XMO B;  1YEW A;  4X88 A;  1VP7 A;  2HKO A;  4BIO A;  5J9P C;  1QU7 A;  1AB3 A;  1NTK H;  1W0J G;  2GDS A;  2V1D A;  4QE9 A;  4F6R B;  2M7W A;  4WFA V;  1IZ3 A;  1US6 A;  1B06 A;  3X2Q C;  2DOS A;  4DR7 B;  2DE0 X;  1R3J C;  4DXW A;  5LP6 A;  3T1Y B;  1VF6 A;  2EZO A;  5B3S C;  1BE3 H;  5B1A C;  2UUB O;  3ZHT A;  3BPZ A;  4PA9 A;  3E8H A;  4J9Z B;  1K5Q A;  4J9Y B;  1FJG B;  2CGO A;  2X6B A;  1MSW D;  4H44 B;  4O4J A;  4TUY A;  1MOF A;  2NNU A;  4X1K A;  2B9Z A;  4CH4 A;  4RUF A;  5KLV H;  1G6U A;  2HVK C;  4LH7 A;  2FKX A;  2EIJ C;  1Y67 A;  4X1I A;  3MDS A;  1XL4 A;  4DRX A;  2CUG A;  2E5L O;  3K0G A;  2HLD G;  4TOI A;  3AG3 B;  1YTF D;  3K0D A;  3QG5 A;  1TA8 A;  2JJ2 G;  4JAA A;  2ADQ B;  3TXS A;  2LGQ A;  3K06 A;  1IX9 A;  2XND G;  1ENV A;  3CJH A;  2F4V O;  2BSK B;  4QJF B;  2FYU H;  5IYC O;  1XQ8 A;  3ZHR A;  4CC6 A;  1VQ7 V;  4TV8 B;  5LXT B;  1MSD A;  3SYA A;  1XNR B;  3RYF A;  1NT2 B;  3IJ4 A;  3OUS A;  3ZN1 A;  3A0R A;  5H9C A;  1SET A;  1IXM A;  2Y0P A;  4PA4 A;  4PI2 A;  3RYC B;  2IBZ H;  3LSQ A;  5D5Q A;  2Z3Y A;  4YJ3 B;  4DR6 B;  3K9A A;  3JAS B;  4IIJ B;  1T5E A;  2XHB A;  5TIS Z;  3CC4 V;  1K7D A;  3UCS C;  1NR7 A;  5JQG B;  2QKA A;  4YHH O;  1QNM A;  4FLX A;  5AG2 A;  4O4H B;  4LF9 B;  4JZG A;  1WA8 A;  4LWS B;  2EZP A;  4MTO A;  5LMU B;  4B3M O;  4P9P A;  5CA3 A;  1H2G A;  1THZ A;  2DYS B;  1RFY A;  1A32 A;  2UUC B;  3CCR V;  2QA4 V;  2A06 H;  3AG3 C;  3STL C;  1E1Q G;  4LF8 O;  3C90 A;  5L3G A;  4CH5 A;  2EJR A;  2KB1 A;  1S5L Z;  4RWU A;  5BZB A;  2YC0 A;  4LR3 A;  3T1C A;  2GV9 A;  3HKB B;  1KP2 A;  5EYP A;  3JAK A;  3E22 B;  4I5S A;  3H9V A;  4JI7 O;  3ZRS A;  3T1H O;  2D3O W;  3JD2 A;  4MVO A;  4DV7 O;  2P22 C;  2W6J G;  4DV5 B;  5B66 Z;  3BEH A;  5LYJ B;  3P3N A;  2ILM A;  3N2K B;  3K59 A;  3CCM V;  3SPG A;  2ADP A;  3JAT A;  5KA6 A;  1SKV A;  1G4Y B;  4KXR A;  2RQ6 A;  1GH6 A;  1F7Y A;  4NXM O;  3OD4 A;  2CK3 G;  4MVM A;  3S3W A;  1J5E B;  3L71 H;  4I50 A;  3F5T A;  5CA1 A;  5EIB C;  4J42 A;  4DV6 B;  5ITZ B;  1PP9 H;  2DYS C;  3UO2 A;  1YTF B;  2Y0I A;  4BW9 A;  1HNX O;  1ORQ C;  2WLJ A;  4GZR B;  4RO2 A;  4F6E A;  4O4I B;  2UXN A;  4JYB A;  3OUF A;  3VQW A;  4CS2 A;  3CMA V;  1H2L A;  3JSL A;  3CCV V;  4FMT A;  4IYI A;  2R9A A;  2QEX V;  1GM8 A;  1V54 B;  3JAL A;  1SQQ H;  2XAH A;  2YIC A;  1KQS U;  4TQD A;  2W0F C;  4KUM A;  1PNL A;  4WFG A;  1XI1 A;  3G71 V;  3QTC A;  4UCU A;  5JWP A;  4JGS A;  3ZHV A;  1PPJ H;  4O2B B;  4IHJ B;  5K1X A;  5LHG A;  4X62 O;  5KMG B;  1N33 O;  1VAR A;  2IJK A;  2UUB B;  3UT5 B;  2E3C A;  4WBN B;  2Q67 A;  4Z2W A;  4GLX A;  3JCU Z;  3OGI B;  4R50 A;  1V55 C;  4LF7 O;  5DED A;  2EIL C;  4UUJ C;  1KKC A;  3W7S A;  4NB5 A;  2HEP A;  1PKX A;  3FD9 A;  3AK1 A;  2Z5U A;  2UUA O;  2P5O A;  1GM9 A;  2ZCE A;  2E5L B;  1MZF A;  2OCC B;  1M90 W;  4LC1 A;  1K8A W;  4JTC B;  4JV5 O;  2JDI G;  2VQE O;  2QM4 A;  4X65 O;  2F4V B;  1L1F A;  5EBW C;  2JS3 A;  1P7B A;  4FM2 A;  4ASU G;  2H3O A;  4LFB O;  3FB5 C;  4P2Z A;  4UB6 Z;  5CA0 A;  3CYO A;  1K5S A;  2BSK A;  3P3P A;  1S5J A;  4DK1 A;  2CTR A;  2CH7 B;  1OHH G;  4E2L A;  2RCV A;  3DGE A;  2YXH A;  3M7M X;  3BHP A;  4TV8 A;  1EN6 A;  5LXT A;  2YXL A;  5L3B A;  4AQY B;  1VIB A;  4LF4 O;  3ETQ A;  3M8A A;  3SPJ A;  1M57 B;  1WNS A;  1N4C A;  2NR5 A;  5KHI A;  2YSU B;  5EK0 A;  1CP9 A;  1OCC B;  1XMO O;  4YJ3 A;  2QR4 A;  1VQ5 V;  3N2G B;  3JAS A;  4IIJ A;  1FS0 G;  5EZY A;  1OCO B;  2PI4 A;  3QVN A;  4B3M B;  5B1B B;  5JJJ B;  5GTH Z;  1XNQ O;  4U3J B;  5JQG A;  2Y69 C;  3JD3 A;  4O4H A;  4DR7 O;  3KG2 A;  4GX1 A;  4FZ0 A;  3UQ8 A;  4LWS A;  1YXB A;  2WLK A;  1MMM A;  1R6N A;  1JVM A;  2F1M A;  1P7G A;  3QO7 A;  4BAY A;  4NXN O;  4DV3 O;  4JI3 O;  4FLZ A;  3K5M A;  1VQN V;  3APO A;  2ZIN A;  3CX5 F;  1Q90 D;  1KC8 W;  1TVK B;  5FLX N;  1XHZ A;  1OCZ C;  3K57 A;  5IYZ B;  1Z5V A;  4GX0 A;  1K92 A;  1P84 F;  4K35 A;  3I56 V;  2EIN B;  4EFE A;  3T1H B;  5LHI A;  1Y74 B;  4UCR A;  4DV7 B;  1FXK B;  3LSS A;  4JI0 O;  3VQX A;  2P4V A;  1I94 O;  2Y4T A;  5KAI Z;  1YJ9 V;  4OGQ B;  1Y6X A;  3ZED A;  5IWA O;  1IUR A;  2HHH O;  1OCC C;  3SJB C;  1GAX A;  1O9G A;  1SZT A;  2RNB A;  3LNN A;  3ZMZ A;  1OCO C;  1XRE A;  3N2K A;  2WAM A;  5B1B C;  2DMX A;  1WB8 A;  3SPH A;  1IDS A;  4MVZ A;  3AG4 C;  2YIA A;  5IJ9 B;  2Q69 A;  1HNX B;  2RDC A;  2X7R B;  3T4Z A;  4UXN A;  4J7Z A;  4TSF G;  5IY5 B;  1UPG A;  3H1L H;  2DJV A;  2W0X A;  1N0N A;  4GCZ A;  2IU0 A;  2IH3 C;  2OYQ A;  5CBH A;  4JI6 O;  3IGA C;  3H1H H;  3AG1 C;  4MS2 A;  4DW1 A;  1Y4M A;  1ZAU A;  3WU2 Z;  5KUM A;  4D7T A;  4OPH A;  3BFR A;  2BOB C;  3SGI A;  4O4I A;  1VQO V;  5A9G A;  1BQZ A;  5F2V O;  4JI2 O;  1WPB A;  4UVB A;  5H2F Z;  1NZ6 A;  5J2U B;  4X62 B;  1N33 B;  1SER A;  3ZBH A;  1FXK C;  4CH3 A;  1R73 A;  4A5U B;  4RUE A;  3GVM A;  4O2B A;  4IHJ A;  2E75 B;  4LF7 B;  2IJH A;  5KMG A;  1I0H A;  5DM6 V;  2AZ0 A;  4D6T H;  3ABU A;  2YI8 A;  5IJ0 B;  2P4K A;  2HG5 C;  3OFN G;  3B8M A;  3CCL V;  5KHJ A;  3AG2 B;  3X2Q B;  2UUA B;  1AI4 A;  3FKS G;  2WLI B;  2QWP B;  1XUQ A;  4X20 B;  5BR8 O;  4I55 A;  4HNA B;  5B3S B;  1RPO A;  3CWB H;  4R6Z A;  1W59 A;  1F23 A;  3ZIA G;  5K1P A;  3LDE A;  1NVP B;  2VQE B;  2WA3 A;  4HAM A;  4NTW A;  4WFH A;  5JVD B;  1N0J A;  2ZT9 B;  1WLE A;  5IY5 C;  1QVF U;  2JVD A;  3DC6 A;  3IC7 A;  1AJQ A;  3ETG A;  5EIB D;  2Q7G A;  1NS1 A;  4L87 A;  2EIJ B;  4JI8 O;  2Q9L A;  3W7T A;  1EZJ A;  1AIL A;  4CZZ A;  1AP6 A;  1HNZ O;  3HKC B;  2EUL A;  2O57 A;  2JRI A;  4PDM A;  1BCC H;  3IFX A;  1D5N A;  4TV9 B;  1GKF A;  2CH7 A;  4GX2 A;  1VQ8 V;  3FAV B;  5KAF Z;  4MTG A;  2OTL V;  5B1O A;  2BOC C;  4JTA B;  3CD6 V;  1LR1 A;  3E8F A;  2Y48 A;  3A0H Z;  3OMA B;  3ZRV A;  1I5X A;  3CEI A;  2DWE C;  1XNQ B;  2OWO A;  3M99 B;  4AIL C;  3SPC A;  3ZRW B;  3A8T A;  3C3S A;  1CEZ A;  3AG2 C;  1N36 B;  3E8B A;  3N2G A;  2ZIO A;  4DYL A;  5KHG A;  4JI4 O;  3CXC U;  3HKD B;  3RN4 A;  4EB6 B;  4U3J A;  4ZIB A;  4ZI7 A;  2Q0O C;  2R9R B;  1KYO F;  5LA6 B;  4E4E A;  4NXN B;  4DV3 B;  4K0K O;  3OEH G;  4JI3 B;  1BZK A;  2YS8 A;  1JQ0 A;  2HVJ C;  3SPI A;  2QTO A;  4KL1 A;  3JD0 A;  2EIK B;  3ABT A;  4XDJ A;  1MA1 A;  4GT1 A;  5EC1 C;  3K9S A;  3FYE B;  3TCU A;  1RSO A;  3FB7 C;  1U96 A;  3CME V;  3A0B Z;  1M1K W;  3CHX A;  1Q43 A;  1I08 A;  4TQF A;  2HJD A;  3KCX A;  1TVK A;  1JCH A;  4J80 A;  4YIP A;  1KMI Z;  2MK3 A;  4JF3 A;  2YIB D;  4JI0 B;  5KHK A;  1I94 B;  1S76 D;  2CDY A;  1JA8 A;  5IWA B;  1FXV A;  2HHH B;  1Y74 A;  4Z1V A;  4JI1 O;  2Y4U A;  1BT8 A;  2JK5 C;  1FXK A;  4IL6 Z;  1GO3 F;  1NI8 A;  2XT9 A;  3BCC H;  3D36 C;  4FLU A;  1IBK B;  1AI6 A;  4NTX A;  1Y76 B;  4DR1 B;  3NXS A;  4MVQ A;  1K4C C;  4AQY O;  4U7O A;  1DTO A;  4JI5 O;  3K08 A;  1HNW O;  1ZL8 B;  3HPL C;  3F5W C;  3THO A;  5BMV B;  2K9P A;  1D5A A;  3WB2 A;  4JI6 B;  4DUY O;  2FB5 A;  3K79 A;  3JAW B;  4G28 B;  5IJ9 A;  2JGD B;  3K5N A;  1QLE C;  4ICG A;  3B4S A;  4FPP A;  3DTU B;  4FLY A;  4U3F H;  2EIK C;  3TK1 A;  3RBZ A;  2ZIM A;  1EN4 A;  4JI2 B;  1COW G;  1QHT A;  3KZI Z;  5BY1 A;  1VQK V;  3AG7 A;  1AR4 A;  4JTD B;  4UCT A;  2VWK A;  2A79 B;  4UCV A;  2XOK G;  1RP3 B;  2QKS A;  2UU9 O;  5EBL C;  3RYI A;  5J2T B;  1SRY A;  3EHB B;  4LBE C;  2DN9 A;  2JJ1 G;  4WFF A;  5J2U A;  5L3D A;  1EN5 A;  1P49 A;  2L6L A;  1AVM A;  1GRJ A;  1X4T A;  1SQB H;  2IW5 A;  1IBM O;  4QGP A;  4I7Z B;  1NH2 D;  5IT9 N;  1JOY A;  2ODM A;  3AK3 A;  1H8H G;  1PNK A;  1TUB B;  1NKD A;  1URF A;  5H6R A;  5H5N A;  3ZMV A;  5BR8 B;  4H37 A;  1M5I A;  4WCE V;  1YIT V;  3CRR A;  2DQ0 A;  5IJ0 A;  1YF2 A;  4J11 A;  3L70 H;  1K3E A;  2XTA A;  1K97 A;  2JEX A;  1Q7Y W;  3T2M A;  1Q81 W;  2WLI A;  1V55 B;  4X20 A;  1HDJ A;  4YIO A;  4HNA A;  2EIL B;  1W2B U;  4CH6 A;  2XAF A;  1QR8 A;  2WA4 A;  5JVD A;  4JI8 B;  2EIM B;  1VQP V;  2HR3 A;  5KX5 B;  4DO2 A;  1AP5 A;  4FFB B;  1HNZ B;  3RYH B;  4JYY A;  4B3R O;  2ZR3 A;  3JAR B;  4CBC A;  3CB2 A;  3L9D A;  3W7U A;  1JPX A;  3SJQ C;  3CRC A;  4OPA A;  3TJT A;  4JAV A;  2OCH A;  2B1G A;  1OCR B;  2D2C B;  3OE7 G;  5LOV B;  3R65 A;  1ZLZ A;  3JYC A;  4LFC B;  3KCY A;  1QVG U;  3OMI B;  3B77 A;  4JPR A;  4TV9 A;  2LP7 A;  1H2N A;  1L8D A;  2GSM B;  3FAV A;  1WJZ A;  2A0L A;  3B8N A;  2G38 A;  3OTO O;  3RWR D;  3RFR A;  1BHB A;  4UFZ A;  5DN6 G;  4KHP O;  3BAB A;  1FKA O;  3P32 A;  2X0L A;  2QWQ B;  4JI4 B;  5JCO C;  1SS3 A;  4HBN A;  3VQY A;  4F6R A;  3ZRW A;  3ABL B;  3RVY A;  1DK1 A;  4K0K B;  4RQF A;  4DV1 O;  2ZNI A;  3CCJ V;  3L72 H;  3OR7 C;  1SQF A;  4W4L A;  3HKD A;  2YI9 A;  1L0N H;  5GON B;  3WG7 B;  2Y69 B;  2IJJ A;  3ZRX A;  1LNQ A;  3CE2 A;  2EIM C;  2LW7 A;  2LFS A;  2ZD9 A;  4K3A A;  3N27 A;  2ZDI C;  3CSX A;  4J10 A;  5LL6 Y;  1M93 A;  1P4R A;  1MZE A;  4DR4 O;  4B3S B;  5C93 A;  4O4L B;  4PEL A;  1K4D C;  4ZHQ B;  4JI1 B;  1OCR C;  4W4K A;  1OCZ B;  4B3T B;  3I55 V;  1K34 A;  3MD0 A;  3NR7 A;  2QE7 G;  3P30 A;  2GTA A;  5EC2 C;  1MG1 A;  3ZS8 C;  1ZWI C;  4FJC C;  1NH2 B;  4DUZ B;  1VQ6 V;  1YIJ V;  3G67 A;  5FPO A;  4JI5 B;  1HNW B;  3K5L A;  2A7W A;  5LGT A;  5JJE B;  3H01 A;  1SC5 B;  3ABL C;  1G1X B;  2PYL A;  1XEQ A;  3WB0 A;  3RYC A;  4DUY B;  2CE4 A;  1NJI W;  2AZ2 A;  1NBM G;  1SES A;  4PA3 A;  3SR2 C;  1ZL8 A;  1FFX B;  4GKK O;  4X8A A;  5KHH A;  2KKW A;  3WG7 C;  1GN2 A;  2JEU A;  1KUQ A;  4JZ2 A;  1N36 O;  3JAW A;  4H0L B;  3AG4 B;  2JGD A;  2XAJ A;  1NVP D;  3W7X A;  3CCU V;  2GHY A;  3G6E V;  2UU9 B;  3CRQ A;  2BTQ B;  3AG1 B;  3E8G A;  2Q4P A;  4QPJ A;  1S0V A;  5LGN A;  2OIG A;  4XDK A;  4BR6 A;  2QDO A;  2IJI A;  5C8Y B;  4PA7 A;  5J2T A;  1ZSP A;  3DSQ A;  4C7U A;  1IBM B;  3DC5 A;  4TUY B;  1WAZ A;  4J41 A;  1UJW B;  2PY5 A;  3HKB A;  2XUM A;  4D7S A;  1WN7 A;  2EBO A;  3L74 H;  3MHS C;  3E22 A;  1CXZ B;  4EEQ A;  1TUB A;  3CC7 V;  1V9P A;  2ATK C;  3RGB A;  3W7W A;  3K3W A;  2R70 A;  3CJH B;  1KB9 F;  3AK2 A;  1U97 A;  3CRM A;  3JCZ A;  2P7T C;  4X64 O;  3ASN B;  5LYJ A;  1OJH A;  1IBK O;  3KKY A;  2P6J A;  2HP8 A;  3RYF B;  4UCS A;  4DR1 O;  1RM1 B;  4DV0 O;  4PHZ A;  1VF7 A;  3FYI B;  1QQC A;  3BAA A;  4B3R B;  1S3J A;  3FX7 A;  1KD1 W;  4NVP A;  2DQ3 A;  5KX5 A;  5LP6 C;  1KP3 A;  5ITZ A;  1ZUQ A;  1VF6 C;  2A9H A;  4QE7 A;  4LF5 O;  4FFB A;  1AI7 A;  4EKW A;  4X66 O;  5H6Q A;  3BY6 A;  1WP8 A;  4XBF A;  2YIB A;  1WA8 B;  4LF6 O;  3OTO B;  5LOV A;  1N8R W;  2OT5 A;  3IAY A;  4KHP B;  3FB6 C;  2NN4 A;  4FLT A;  2W6I G;  1OZ0 A;  1YZB A;  2YID A;  4B08 A;  3E2E A;  3ABK C;  1BSM A;  1GK9 A;  1IXB A;  2ZNJ A;  5KA5 A;  4DV1 B;  3APQ A;  4PA6 A;  1X59 A;  4I0X B;  3UT5 A;  2IU3 A;  1QCE A;  2RN9 A;  5EYP B;  2BCC H;  4WBN A;  3CCE V;  4DR2 B;  3ABM B;  4JAS A;  3ASN C;  1OV9 A;  2DYR C;  3LDD A;  4U7N A;  5DEC A;  2GBO A;  4P9O A;  1RM1 C;  1W0K G;  1YCI A;  5GON A;  2P90 A;  3SYQ A;  2M6Y A;  2E76 B;  2BTO A;  1EM1 A;  2DWD C;  4DR4 B;  5LMN O;  4PDL A;  2UXC B;  3SDL A;  1Q86 W;  1XMQ B;  1FFT B;  3K04 A;  3IC9 A;  2QWO B;  2AXT Z;  3SYO A;  4I4T B;  2XAQ A;  4OXS A;  1N34 O;  1G8M A;  4ZHQ A;  3OM3 B;  3OMN B;  2KG7 B;  4LNU B;  3J80 N;  1R3I C;  3CPW U;  4QPK A;  3F7V C;  2CTP A;  1E79 G;  5CB4 B;  1IVS A;  2EX3 A;  1SA0 B;  4GKJ B;  1XIL A;  3GWK C;  3ZHS A;  4CC5 A;  3R66 A;  1IBL O;  2MW2 B;  2PTM A;  4RQE A;  4LFC O;  4PV1 B;  4DW0 A;  3STZ C;  3LDC A;  2Q73 A;  5JJN B;  1VQL V;  1VMG A;  4GKK B;  3JAL B;  1B04 A;  1KKD A;  2WLM A;  2PYJ A;  3K5O A;  1I7F A;  1NR1 A;  1DF5 A;  2AW9 A;  2PGG A;  4PDR A;  1JX9 A;  1AJN A;  3ABM C;  1VQM V;  5IE9 A;  1BGY H;  3JSN A;  1JFF B;  2GUZ B;  1YI2 V;  4MSW C;  5LGU A;  1PNM A;  2ZM6 O;  1N32 O;  1FFX A;  1ZX3 A;  5CBG A;  1YJW V;  1S77 D;  3J81 N;  4PI0 A;  1ROP A;  3H1I H;  3U0Z A;  4PDV A;  1VEW A;  2RJZ A;  2HFE C;  1BQ0 A;  1QLE B;  2ZR2 A;  1S5H C;  1TAE A;  4IYH A;  2KSD A;  2BTQ A;  1M56 B;  2VWJ A;  2Q7H A;  2H94 A;  2P06 A;  3RW0 A;  1B6Q A;  3I5D A;  5C8Y A;  1Q8I A;  3CCS V;  2CTQ A;  2RMK B;  1AI5 A;  3FB8 C;  5IYZ A;  4B3S O;  1BL8 A;  4MTF A;  4YY3 O;  1SQG A;  1Q3E A;  5GW7 A;  2XAG A;  1YVW A;  4B3T O;  2XAS A;  4DV2 B;  3EFF K;  4X64 B;  1MAB G;  1XL6 A;  3JD1 A;  3RT3 C;  5CA0 B;  2CGN A;  1H8E G;  2EJ7 A;  1LUV A;  4DUZ O;  4UCO A;  4DV0 B;  5BXZ A;  1F51 A;  1LUW A;  4X9Q A;  1QBZ A;  2DW4 A;  1NU1 H;  2X6C A;  3CRA A;  2QKC A;  4JYA B;  3HKE B;  2ZXW C;  4MVS A;  3JAM N;  2PI5 A;  1YSC A;  2WPD G;  3OTF A;  1CPY A;  3E86 A;  2X6A A;  3VQV A;  1FD9 A;  4LF5 B;  3QNE A;  4FVM A;  2OIE A;  4X66 B;  1XBL A;  4JYC A;  1F4N A;  2VQF O;  5FNV B;  1RPR A;  5EZY B;  4LF6 B;  3L73 H;  2ARH A;  3G4S V;  3CXH F;  3WFV A;  1M56 C;  2LGW A;  4LCU C;  3LNM B;  3PJS K;  3DXR B;  1GN3 A;  2WLH A;  2ZE5 A;  4ZBM A;  4DR3 B;  3OW2 U;  3EVK A;  5L3F A;  2AHY A;  2CTW A;  5FL7 G;  3UO3 A;  1HR0 O;  1XDC A;  1FPO A;  1QR9 A;  2R9I A;  2PF4 E;  2JS5 A;  2ETN A;  3RVZ A;  2B1I A;  2KQX A;  5JH7 B;  4ZOL B;  1KBH A;  3MAQ A;  4FM1 A;  2FL4 A;  3S3X A;  1PV0 A;  5FPR A;  4I0X A;  5CN0 A;  1F4M A;  2Q8V A;  4UV9 A;  4K8X A;  2QWN B;  3QF7 A;  1K9M W;  1NTM H;  5LMN B;  2LJ2 A;  4LFA O;  3ZMS A;  2R72 A;  3U10 A;  3SYP A;  3AEI A;  1H2K A;  1SF9 A;  1YJN V;  5E79 Z;  2GTS A;  4BWA A;  2H8P C;  4EFB A;  1D2D A;  4FK5 C;  3WB1 A;  1YHQ V;  2B5U A;  1N34 B;  5E1A C;  3EXA A;  2ZE7 A;  1AR1 B;  2YEV B;  1EZV H;  4ABM A;  4I4T A;  5HFM A;  4YXW G;  1DLB A;  1Q6U A;  1H2S B;  4OX9 O;  3Q4H B;  1IBL B;  2KG7 A;  4Z1M G;  1R6T A;  4LNU A;  1UFI A;  4KFM A;  4DR5 B;  3HKC A;  1XHX A;  4BIZ A;  2IM9 A;  2QM7 A;  5CB4 A;  4UB8 Z;  1SA0 A;  3B2E E;  3HB3 B;  4LP8 A;  2QM8 A;  3SJA C;  4MT8 A;  3G80 A;  5L3C A;  4X1Y B;  1SZX A;  4N23 A;  4L8J A;  2ZE6 A;  3UKM A;  3D36 A;  2ZM6 B;  1JJ2 U;  1N32 B;  2N05 A;  3CC2 V;  4UVA A;  2ZQM A;  2OTJ V;  1KU9 A;  3LSU A;  3OGC C;  4KP4 A;  4UV8 A;  3B40 A;  4B7E A;  4IT5 A;  4TT3 G;  3VOU A;  1JFF A;  2GUZ A;  1VQ9 V;  4DV4 O;  3L75 H;  3MHH C;  3ZX6 A;  4O2A B;  3H1J H;  4EB6 A;  4JAU A;  2UXB O;  1S72 V;  5D5P A;  3A2F A;  5LA6 A;  4DR2 O;  2WWW A;  4N21 A;  4MVU A;  3ZHQ A;  2F66 C;  4GX5 A;  1R3K C;  2K1E A;  1NTZ H;  4I55 B;  5B1N A;  4FZ1 A;  2WLL B;  2AHZ A;  3D3I A;  1XOU A;  2LFR A;  2UXC O;  3SJC C;  4YY3 B;  4AHC A;  2JGU A;  1XMQ O;  1JR9 A;  2C2A A;  3F7Y C;  1M9N A;  1GM7 A;  1SQX H;  2WLN A;  3C3T A;  4MVR A;  1BMF G;  2QSA A;  4PD4 F;  5A2Q N;  1AR5 A;  5B5E Z;  4YJ2 B;  1FYJ A;  2Q7E A;  1Z2G A;  1ARO P;  1GN6 A;  1I5Y A;  1V54 C;  1FAF A;  4GKJ O;  1HW7 A;  2UXD O;  2Q5Z A;  1Y76 A;  4MW3 A;  5CBF A;  3J7A U;  2AGA A;  3K03 A;  3HKE A;  2VQF B;  4BW5 A;  1Q82 W;  5BMV A;  1GTO A;  2A3Q A;  3UM7 A;  1WPX A;  1Q6H A;  1R6K A;  1EBO A;  4DK0 A;  4MW8 A;  2Q6A A;  5IYB O; 
#chains in the Genus database with same CATH homology
 1JCH A;  2CK3 G;  3ZJZ A;  4PA6 A;  4MVM A;  4X89 A;  5LHH A;  2ITC C;  2MK3 A;  4JF3 A;  5KUK A;  5CMU A;  3SYC A;  1S76 D;  2IU3 A;  1QCE A;  3CCE V;  3ABM B;  1FXV A;  2DYS C;  4JAS A;  3ASN C;  2DYR C;  4G2K A;  3LDD A;  1YTF B;  4U7N A;  2JK5 C;  1ORQ C;  1FXK A;  4H33 A;  4HZ3 A;  4P9O A;  2WLJ A;  4RO2 A;  4F4L A;  1RM1 C;  1W0K G;  1GO3 F;  2UXN A;  4JYB A;  3OUF A;  2P90 A;  3ETE A;  3ZMT A;  3CMA V;  1PD3 A;  3SYQ A;  3CCV V;  4FMT A;  3LUT B;  2DWD C;  2OCC C;  2QEX V;  1GM8 A;  1AI6 A;  1V54 B;  4PDL A;  3NXS A;  4MVQ A;  2XAH A;  3ZCC A;  1K4C C;  1KQS U;  3ETD A;  2HJF C;  1Q86 W;  4U7O A;  2W0F C;  4KUM A;  4R7C A;  1DTO A;  1PNL A;  4WFG A;  1FFT B;  3K08 A;  3G71 V;  3K04 A;  3HPL C;  3F5W C;  4JGS A;  3SYO A;  2XAQ A;  2JIZ G;  3ABK B;  4OXS A;  5LHG A;  1G8M A;  3OM3 B;  3OMN B;  2IJK A;  4R8C A;  3K79 A;  4G28 B;  1AJP A;  2IH1 C;  1NQT A;  1QLE C;  4I9W A;  1R3I C;  4FPP A;  3DTU B;  3CPW U;  4QPK A;  3F7V C;  2EIK C;  3TK1 A;  3RBZ A;  1E79 G;  2Q67 A;  3ASO B;  4R50 A;  1V55 C;  1COW G;  1VQK V;  4JTD B;  1K33 A;  1BHA A;  2DYR B;  2EIL C;  4UUJ C;  3W7S A;  4RQE A;  3GB7 C;  2A79 B;  4TWK A;  1PKX A;  1HWY A;  3LDC A;  3STZ C;  1M57 C;  2XOK G;  2Z5U A;  3E35 A;  2QKS A;  4BIU A;  5EBL C;  1VQL V;  1GM9 A;  2WSS G;  2OCC B;  1M90 W;  1SRY A;  2WLM A;  3EHB B;  1KKD A;  4LBE C;  4LC1 A;  1NR1 A;  2JJ1 G;  1K8A W;  1DF5 A;  4WFF A;  4JTC B;  3QO8 A;  5L3D A;  4PDR A;  1JX9 A;  1AJN A;  2JDI G;  3ABM C;  3CCQ V;  1VQM V;  2YEV A;  2ZDI A;  4ZKI A;  1FXH A;  4Q20 A;  1YI2 V;  4MSW C;  5LGU A;  1KEC A;  1PNM A;  2IW5 A;  3CP1 A;  2P67 A;  1JOY A;  1L1F A;  1NH2 D;  5EBW C;  5CBG A;  5L3E A;  1YJW V;  1H8H G;  1S77 D;  1P7B A;  1PNK A;  4G27 B;  1K73 W;  1ROP A;  3OEE G;  1NKD A;  4ASU G;  4PDV A;  3FB5 C;  4P2Z A;  5H6R A;  3ZMV A;  4QNH B;  4H37 A;  2HFE C;  4WCE V;  1YIT V;  3CYO A;  1QLE B;  2DQ0 A;  2ZR2 A;  1K5S A;  1K3E A;  1S5H C;  1K97 A;  2JEX A;  1Q7Y W;  3T2M A;  1OHH G;  3JD4 A;  4E2L A;  4WF9 V;  3DGE A;  1EFR G;  1Q81 W;  2WLI A;  1V55 B;  1H38 A;  1R3L C;  5L3B A;  4WFB V;  1M56 B;  3QO5 A;  2UXX A;  2H94 A;  2EIL B;  1Y66 A;  3RW0 A;  1B6Q A;  1W2B U;  3SPJ A;  2XAF A;  1QR8 A;  1M57 B;  3CCS V;  2EIN C;  2YSU B;  1AI5 A;  3FB8 C;  2EIM B;  5EK0 A;  1VQP V;  2HR3 A;  5EBM C;  1CP9 A;  1OCC B;  1E1R G;  4DO2 A;  4HYO A;  1VQ5 V;  3ASO C;  5HFL A;  1BL8 A;  1FS0 G;  4MTF A;  4P30 A;  1OCO B;  3TET A;  4MTX A;  2PI4 A;  2ZR3 A;  5GW7 A;  4CBC A;  5B1B B;  3W7U A;  1JPX A;  2F43 G;  2V7Q G;  2XAG A;  2Y69 C;  3SJQ C;  2XAS A;  5IYD O;  1GMG A;  3EFF K;  3JD3 A;  1MAB G;  3OR6 C;  1XL6 A;  3JD1 A;  4JAV A;  2ITD C;  2B1G A;  1OCR B;  3KG2 A;  1DF4 A;  4GX1 A;  3OE7 G;  3R65 A;  1H8E G;  3ZMU A;  3JYC A;  2WLK A;  1R6N A;  1QVG U;  3OMI B;  3B77 A;  1F51 A;  4JPR A;  1JVM A;  1QBZ A;  2DW4 A;  2X6C A;  3QO7 A;  2LP7 A;  2ZXW C;  3GWO A;  4BAY A;  2GSM B;  3VBB A;  4MVS A;  2PI5 A;  1YSC A;  2A0L A;  2WPD G;  3B8N A;  2WLL A;  5B1A B;  1VQN V;  1CPY A;  3E86 A;  2X6A A;  1BHB A;  5DN6 G;  1KC8 W;  3P32 A;  2X0L A;  3QNE A;  1OCZ C;  1QLN A;  4GX0 A;  1F4N A;  4JYC A;  1K92 A;  3I56 V;  3ZRW A;  2EIN B;  3ABL B;  1RPR A;  3E89 A;  3T4D A;  4UVC A;  3RVY A;  5LHI A;  3ZN0 A;  4RQF A;  1PL0 A;  4XDL A;  3G4S V;  3CCJ V;  1TUE B;  3WFV A;  3OR7 C;  1FXK B;  1M56 C;  4FIP C;  3LSS A;  4LCU C;  3LNM B;  4WFE A;  3WG7 B;  3PJS K;  1YJ9 V;  2Y69 B;  2NLJ C;  2FTK A;  3ML0 A;  3OAA G;  5IDJ A;  2IJJ A;  2WLH A;  3ZRX A;  1LNQ A;  4ZBM A;  3E83 A;  4RAI A;  2EIM C;  3OW2 U;  5L3F A;  2Q68 A;  1OCC C;  2AHY A;  5LBQ A;  1SZT A;  2LFS A;  2ZD9 A;  5FL7 G;  2ZDI C;  4QIW F;  3ZMZ A;  1VQ4 V;  1OCO C;  1J95 A;  1QR9 A;  2R9I A;  1P4R A;  3RVZ A;  2WAM A;  2ZXW B;  5B1B C;  2B1I A;  4X88 A;  3SPH A;  2HKO A;  4MVZ A;  5C93 A;  4PEL A;  1K4D C;  5J9P C;  1W0J G;  1OCR C;  3AG4 C;  2Q69 A;  1OCZ B;  2V1D A;  4QE9 A;  2M7W A;  2X7R B;  3T4Z A;  4UXN A;  5CN0 A;  4WFA V;  1F4M A;  4UV9 A;  4TSF G;  5IY5 B;  3I55 V;  1K34 A;  3X2Q C;  3MD0 A;  2QE7 G;  3P30 A;  4GCZ A;  5EC2 C;  2IU0 A;  1MG1 A;  1R3J C;  2IH3 C;  1K9M W;  5CBH A;  1ZWI C;  4FJC C;  4DXW A;  3IGA C;  1NH2 B;  3AG1 C;  4MS2 A;  3ZMS A;  1Y4M A;  2EZO A;  1VQ6 V;  5KUM A;  5B3S C;  1YIJ V;  3SYP A;  5B1A C;  3AEI A;  2BOB C;  1VQO V;  1YJN V;  4PA9 A;  3E8H A;  5LGT A;  2H8P C;  4J9Z B;  1K5Q A;  4J9Y B;  2X6B A;  4UVB A;  4FK5 C;  3H01 A;  1YHQ V;  2B5U A;  1MSW D;  3ABL C;  1MOF A;  5E1A C;  2NNU A;  1AR1 B;  1NJI W;  2YEV B;  1SER A;  1NBM G;  1SES A;  4RUF A;  2HVK C;  4PA3 A;  2EIJ C;  1FXK C;  1XL4 A;  4X8A A;  1R73 A;  4RUE A;  3K0G A;  5HFM A;  3WG7 C;  4YXW G;  2JEU A;  2HLD G;  1DLB A;  3AG3 B;  1YTF D;  3K0D A;  2IJH A;  2JJ2 G;  5DM6 V;  4Z1M G;  3AG4 B;  2XAJ A;  3K06 A;  2XND G;  3ABU A;  1NVP D;  1ENV A;  4KFM A;  2HG5 C;  3W7X A;  3CCU V;  2GHY A;  3B8M A;  3OFN G;  4QJF B;  3CCL V;  4BIZ A;  2QM7 A;  5IYC O;  3G6E V;  3AG2 B;  3X2Q B;  1AI4 A;  3HB3 B;  1VQ7 V;  4LP8 A;  2QM8 A;  3FKS G;  2WLI B;  4MT8 A;  3SYA A;  3AG1 B;  3E8G A;  5L3C A;  4QPJ A;  5B3S B;  1S0V A;  5LGN A;  1RPO A;  4N23 A;  4R6Z A;  3ZIA G;  1F23 A;  4XDK A;  3OUS A;  3LDE A;  1NVP B;  2IJI A;  3ZN1 A;  3A0R A;  5H9C A;  1SET A;  4PA7 A;  3UKM A;  1IXM A;  4HAM A;  3D36 A;  4WFH A;  1JJ2 U;  1WLE A;  4PA4 A;  4UVA A;  3CC2 V;  5IY5 C;  1QVF U;  2ZQM A;  3LSQ A;  2OTJ V;  2Z3Y A;  1UJW B;  3OGC C;  4KP4 A;  4UV8 A;  3IC7 A;  3K9A A;  4TT3 G;  1AJQ A;  3CC4 V;  3ETG A;  2EBO A;  3VOU A;  1K7D A;  1NR7 A;  1VQ9 V;  4L87 A;  2EIJ B;  3MHH C;  3MHS C;  3W7T A;  4JAU A;  3CC7 V;  1EZJ A;  2ATK C;  1S72 V;  3W7W A;  2WWW A;  2EZP A;  4MTO A;  4CZZ A;  3K3W A;  4N21 A;  4MVU A;  4P9P A;  4PDM A;  5CA3 A;  3IFX A;  1H2G A;  2P7T C;  3JCZ A;  4GX5 A;  1THZ A;  1GKF A;  4GX2 A;  2DYS B;  3ASN B;  1R3K C;  1VQ8 V;  2K1E A;  5B1N A;  4MTG A;  2OTL V;  2P6J A;  2WLL B;  5B1O A;  2AHZ A;  3CCR V;  2BOC C;  3D3I A;  4JTA B;  2LFR A;  2QA4 V;  3CD6 V;  1RM1 B;  3AG3 C;  3STL C;  1E1Q G;  3E8F A;  2Y48 A;  5L3G A;  3FYI B;  3OMA B;  2EJR A;  3ZRV A;  2KB1 A;  1I5X A;  1S3J A;  1KD1 W;  2DWE C;  3M99 B;  2C2A A;  3F7Y C;  1M9N A;  5BZB A;  2DQ3 A;  3SPC A;  3ZRW B;  1GM7 A;  3T1C A;  2WLN A;  1CEZ A;  4MVR A;  3AG2 C;  1BMF G;  1KP3 A;  3E8B A;  1KP2 A;  2A9H A;  4QE7 A;  1AI7 A;  4EKW A;  3CXC U;  5H6Q A;  4I5S A;  3BY6 A;  1ARO P;  3ZRS A;  4XBF A;  2R9R B;  2D3O W;  1I5Y A;  3JD2 A;  1V54 C;  3OEH G;  4MVO A;  1N8R W;  1JQ0 A;  2OT5 A;  2HVJ C;  3SPI A;  2QTO A;  2W6J G;  3JD0 A;  3FB6 C;  2EIK B;  3ABT A;  4XDJ A;  4GT1 A;  4MW3 A;  5EC1 C;  5CBF A;  3BEH A;  2W6I G;  1OZ0 A;  3FYE B;  3TCU A;  3K03 A;  3E2E A;  3FB7 C;  4BW5 A;  1Q82 W;  3CME V;  1GTO A;  3CCM V;  3UM7 A;  3SPG A;  1M1K W;  3ABK C;  1WPX A;  1R6K A;  1EBO A;  1G4Y B;  1GK9 A;  5KA6 A;  4MW8 A;  2Q6A A;  5IYB O;  5KA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...