1RPRA

The structure of cole1 rop in solution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGDDGENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP
publication title The structure of ColE1 rop in solution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 26
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rprA00
1ROPA 2IJKA 2IJHA 1RPRA 1F4MA 1GTOA 3K79A 1RPOA 1GMGA 1B6QA 1PD3A 2IJIA 4DO2A 1NKDA 2IJJA 1F4NA 2GHYA
chains in the Genus database with same CATH superfamily
2UUBO 1KP2A 3HKDB 3CS5A 1AI4A 3CRQA 3ICXA 2YUAA 4JZGA 1IXBA 1KECA 4JF3A 2F93B 1N36O 4JZ2A 5GONB 2YXLA 5CBGA 4TUYB 1H2SB 1V9PA 4QJFB 5B66Z 4J7JA 2F1MA 2EJRA 4DR1B 1EN6A 1X59A 4X88A 4DUYB 4IIJA 2Q69A 4YY3B 1GMGA 3OW2U 3ZHVA 1F4NA 2CTPA 4E2LA 2LW7A 3T1HB 2XASA 1QU7A 4PDMA 3RFRA 1JQ0A 2ITDC 4YHHO 2A79B 3RYHA 3CC7V 4YXWG 4ASUG 2B1GA 2DQ0A 1SQQH 2ITCC 2GBOA 4DR3B 2ZD9A 4P30A 3HKBB 5EIBD 3TXSA 1QNMA 5EK0A 5IYDO 4JI8B 3CRAA 4WBNB 1HP8A 2EJ7A 3W7SA 2OT5A 1YF2A 2AHYA 4GKKB 3RW0A 4U7NA 1TUBB 3TK1A 3OEEG 4DYLA 2EIKC 5LMUB 4UUJC 4DR1O 2HEPA 4YJ2B 1OCRB 3B2EE 3UQ8A 3G6EV 1VQ4V 4DUYO 1F7YA 1YJ9V 4YY3O 4QNHB 5JQGA 1D5NA 4JI1O 4DRXA 3W7TA 4I7ZB 3CP1A 1R6NA 1IX9A 4LFAO 2E75B 3ABLC 3T1HO 3JALA 2XT9A 1SRYA 2BOBC 2Y69C 1QCEA 1URFA 2FL4A 2P06A 1V55C 2WLJA 3LSQA 1W0KG 1BHBA 3QO5A 1AI5A 4DR3O 2HKOA 4BR6A 3B4SA 4IYIA 3CPWU 4Z1VA 4N21A 5IY5C 2Q4PA 2UXBB 2Q7GA 3NR7A 3BA8A 4LWSA 1M57C 4JI8O 3GB7C 4WFEA 4MVUA 3ETGA 1SC5B 4F6RB 4GKKO 1Q5OA 2EILC 4DV3B 4AI8A 5LMUO 2MW2B 2NN4A 1RM1C 1WPBA 1CPYA 1DGSA 1BGYH 2QJ1A 1HR0B 2XAGA 2XTAA 1J95A 1HW7A 1ZSPA 2LO1A 5J2TB 1W59A 1Q6IA 3K5NA 4B3SB 2RN9A 4C7UA 4MVMA 2PZSA 4WF9V 2EBOA 1M9NA 1H8EG 4Z2WA 5CBHA 1P4RA 2WLNA 2D3OW 1US6A 3CCQV 3DTUB 3G4SV 3L75H 2HFEC 4LFBB 5KA6A 2WLMA 4UV9A 4G28B 2FMLA 1FFXB 2PI4A 2AGAA 1GM9A 2L6LA 1BQZA 3HKCA 2UXBO 4FLYA 4XDLA 3SPGA 4NYKA 1WB7A 1XQ8A 1R3KC 2F23A 2FTKA 4UCTA 3JAWB 3M7MX 2N74A 1MZFA 4DV3O 3ETQA 1VEWA 3VOUA 3MHHC 4P9PA 1E79G 3BCCH 4AILC 5BY1A 2JGUA 5LHGA 1NTMH 3B40A 1HR0O 1GM8A 4UCOA 3K9SA 4RQFA 4IGGA 3RYIA 5LHHA 2CGNA 4DR6B 3ZCCA 4B3SO 1BMFG 4FK5C 5FPRA 2WLIA 2RNBA 1WJZA 4O2BA 3LDDA 2ZDIC 4O4IB 1I7FA 4JI5O 4KP4A 2Y69B 4QE9A 3N2KB 2YXYA 5IJ0B 1VF7A 2P22C 1V55B 3E83A 5LYJB 2LFSA 4TV8A 2DQ3A 4TWKA 1N34B 4B3RB 1VQ8V 3R65A 2OYQA 4X1YA 4K8XA 3L73H 1AP6A 2XOKG 1M57B 4WFFA 1GK9A 2L35A 1LR1A 3N2GB 3GWOA 3C3SA 3CCRV 1AB3A 4JPRA 1TVKB 1EBOA 2EILB 4CS3A 1N32B 1Y74B 3CXCU 4ABMA 1QQCA 5LHIA 2JRIA 4CH5A 1GAXA 1KB9F 1YHQV 2QTSA 1N8RW 3RVZA 1DLBA 2V4DA 5JH7B 1JFFB 4DR6O 4DUZB 2Z3YA 5IYZB 1PNKA 3CXHF 4PA9A 1JJ2U 2DE0X 2ZQMA 4GX0A 2A0LA 2H3OA 1SA0B 3O65A 3SYPA 3JD2A 2WLKA 2UUAB 1S77D 4DR7B 2WPDG 3QG5A 1DK1A 1K3EA 2Y0IA 4LCUC 1GO3F 4DK0A 2PI5A 2IBZH 5DEDA 5CN0A 1R73A 2RCVA 1L8DA 1N34O 4GKJB 4B3RO 3ABTA 3LDCA 2AZ0A 1JMKC 1S3JA 2LGQA 2A9HA 4OXSA 4I0XB 1AJNA 2K1EA 5B1BB 5CA1A 4F4LA 3OD4A 1DF5A 3FKSG 2N05A 4FM1A 4E4EA 2BE3A 1V54B 4I55A 4I4TA 3JSNA 4R8CA 2E76B 3L74H 1I0HA 2Y4TA 3WB1A 3HPLC 4FLXA 2DYSC 5E79Z 2LJ2A 4RAIA 4DUZO 4MVOA 1XMOB 5L3GA 4U3FH 5BR8B 4CH3A 4X66B 3OMAB 4LF7B 1R3LC 2UUAO 5D5QA 4DR7O 4W4LA 2BTQA 2P7TC 1W0JG 3WB0A 4X1KA 1ROPA 4X1IB 2P4KA 2YI9A 4NTWA 4I9WA 3TGUH 4GKJO 3S3XA 4MW3A 3RYHB 3A8TA 1K73W 2H8PC 4FPPA 2CDYA 3APQA 4LR3A 3JYCA 3IJ4A 2YIBA 5EZYA 3CE2A 3IFXA 2GHYA 4OPAA 4NTYA 1WA8A 4MTOA 1PNMA 1RSOA 2HG5C 2GUZB 1S5HC 1XHZA 5CA0A 4DR5O 2RJZA 2QWNB 3FB5C 1XMOO 3HKEA 1BS3A 3UCSC 1OCZB 5BR8O 1Q82W 4X66O 3P3PA 5JQGB 4ZIBA 2Y4UA 1ZLZA 1VQ5V 2KB1A 1P49A 1BCCH 4Z1MG 2YXHA 4WFAV 1I94B 3JD3A 5KUKA 4EEQA 4JI4B 2Z5UA 3P3NA 4O4LB 1DF4A 5KHHA 1AVMA 1B06A 3E8HA 3ZRXA 1N0JA 4DW1A 4FVMA 3W7WA 2FB5A 1MSDA 1B04A 1D2DA 1YCIA 1UFIA 1EN4A 1NZ6A 2JJ1G 3K59A 5JWPA 1PNLA 4EKWA 3CWBH 5BXZA 4FLUA 3BRCA 4X89A 3UM7A 2PUSA 1N0NA 4FM2A 1IBMB 4LWSB 5KA5A 2IJIA 4U3JA 1KP3A 3ZS8C 4UCSA 2DOSA 4EB6A 4LF5B 2DYSB 3K03A 3RVYA 1SQFA 2EZPA 4GX1A 4FJCC 3ZMVA 3K79A 1KMIZ 2K9PA 1HDJA 5GTHZ 1VF6A 3L70H 1TAEA 1Y67A 3ZX6A 1K97A 3ZHUA 2YSUB 2LP7A 3JCUZ 4HNAA 3BA9A 2VQFO 2XHBA 1SESA 5C8YA 3RWRD 1I94O 1NI8A 3CCJV 4JI4O 4DV4B 2OIGA 3JARA 1NVPB 1H2LA 3ZHSA 1MA1A 2X0LA 2IW5A 2ATKC 4DV5O 1JX9A 5LP6A 3J7AU 5LOVA 3VQWA 5EBWC 2ZNIA 3HKCB 2A3QA 2IH3C 5JVDB 3F5WC 4QGPA 2X6CA 1NH2D 1Z5VA 1FD9A 1Q8IA 3SYCA 4QPJA 4LF5O 4JTDB 3OE7G 3VBBA 3OR7C 2E74B 1JCHA 1QLNA 3DC6A 4PDLA 4TQFA 1NR7A 1SF9A 1MOFA 1OJHA 3KKYA 5KX5B 4LF6O 4ICGA 1NTKH 2QKCA 3RYIB 1Q86W 2R9IA 5J2UA 5CBFA 2QM8A 1BHAA 3IC7A 3ZRWA 4PDVA 2YEVA 4LF4O 2WLIB 4OX9B 2QTOA 1ORQC 2IJKA 5GW7A 4FFBA 3K58A 1BE3H 3D3QA 1XNQB 4DV7B 5D5PA 2JS3A 4B7KA 3W7XA 4X20A 2PYJA 3ABUA 5FNVB 4GX2A 5KHKA 4B08A 2NR5A 4UFZA 3OUSA 1XILA 2ARHA 4G27B 4TV8B 5TISZ 3QNEA 1VQOV 2F4VB 1AI7A 5ITZA 1FKAO 5FL7G 3F7YC 4X1YB 4PJ0Z 1VQ6V 2VQEB 1VQNV 5EBMC 4DV0B 4KL1A 4MTXA 3Q4HB 1I08A 4G2KA 4O4JB 4J42A 1O9HA 3K0GA 4GLXA 3OAAG 1MZEA 2ZIOA 4ZHQA 1M93A 3BVOA 1YEWA 2ZINA 1BL8A 4LNUA 1NTZH 3RYFA 1Q6UA 1M90W 1SETA 4HZ3A 2R72A 1AR5A 4B3MB 2VRZA 1T5EA 5CB4A 5B1OA 4DV7O 5BMVA 3VQXA 3BEHA 3CX5F 2BOCC 4MTFA 5LA6B 3ZMZA 2P4VA 2WLHA 4FM0A 4J41A 1HNXB 2AXTZ 3SPJA 1Z5WA 3A0HZ 2VWJA 3ZIAG 1VP7A 1NBMG 4UB6Z 3CMEV 2AZ2A 4JI7B 4O4HB 4D7TA 1GN2A 4L87A 3RYCA 2VS0A 2VQEO 4O2AA 1YJNV 1SKVA 3JAKA 5E1AC 4FLVA 4YJ3A 1YXBA 1U97A 4CS2A 4I55B 4JYYA 1Y66A 3QVNA 4TV9B 2KG7B 1RP3B 3EHBB 1SZXA 2QR4A 3PJSK 3CHXA 1CXZB 4JAAA 2Y0PA 4IHJA 4J80A 1VQ9V 4KUMA 3ZN1A 1ZL8A 3L72H 1UJWB 3E8BA 4B3MO 5K1PA 1VF6C 3G80A 4BIUA 5B1NA 3KZIZ 1EZVH 4TSFG 1SQPH 1YSCA 3STLC 4OGQB 2FYUH 2BTQB 2LFRA 1FPOA 3C90A 4X1KB 5BZBA 2CH7A 1HNXO 4TQDA 1RFYA 1QVGU 3AG2C 4H37A 4JASA 5LL6Y 2R9AA 5H6RA 4LBEC 3AK3A 5LP6C 3ZN0A 5IE9A 1GRJA 3M8AA 2DN9A 4J7ZA 4DR2B 3ZRSA 3F7VC 2W0XA 3X2QC 2JEUA 3JD0A 1YIJV 2HP8A 2WA3A 2EIKB 5IJ9B 4D6TH 1PPJH 2KQXA 2Q7EA 5CA0B 3HKDA 5FPOA 1TGOA 2N04A 4FMTA 2ADPA 1R6TA 1K9MW 2CAZC 5KHGA 3LDEA 3HKEB 3ZRVA 4K3AA 5KAIZ 5KHJA 3FX7A 1GM7A 1XL6A 1LNQA 1H2GA 4K0KB 1OCOC 2AHZA 5GONA 3TETA 1F51A 3KCYA 3MD0A 4TUYA 3SJBC 3ABLB 4XBFA 2PYLA 1COWG 3FFQA 2WLLA 3OTOB 4ZOLA 4R50A 3CJHB 4LFBO 3IC9A 2QSAA 3DXRA 3ML0A 4EFEA 4ZBMA 1XREA 3CSXA 4QE7A 3LSSA 4P9OA 2EIMC 1G8MA 1GN4A 5IY5B 3AG1C 1KYOF 2UXDB 3BAAA 1K92A 2IU3A 1RPOA 4MVQA 2PTMA 1UPGA 1QLEC 3JATA 4U3JB 4GZRB 1PL4A 2IM9A 3ASOC 3CB2A 1K33A 4EB6B 3HKBA 4I50A 1RM1B 4LF9B 1WAZA 3CRRA 4RUFA 3CCLV 1B6QA 1NQTA 5KMGA 2WAMA 5JJEB 4WBNA 2BSKB 3CMAV 2QE7G 3M99B 2PY5A 1S5LZ 3LUTB 4FZ1A 3O9OA 5A2QN 5JCOA 4K0KO 5JJNB 1XHXA 1WPXA 4PI0A 3IAYA 3ZMTA 2PF4E 1VF5B 5LXTB 2HR3A 4AQYB 2ZCEA 4YJ2A 1KD1W 5C8YB 2Q5ZA 3OTOO 1K7DA 2F95B 3AG2B 2RMKB 3RGBA 4A5UB 4PELA 1EZJA 3JARB 1R3JC 1YTFB 4UVCA 3K04A 4EFBA 2EINC 4J9YB 4JYCA 4BAYA 5LP6B 5LOVB 2QGNA 4GT1A 3T2MA 2GV9A 3UO3A 4PHZA 2Q7HA 1MSWD 1GTOA 4PD4F 3FB6C 3ZHQA 3OUFA 1N32O 3CCMV 2FKXA 3X2QB 1YDXA 3GWKC 1NT2B 1P7BA 1JOYA 5GTIZ 4LF9O 3AG4C 3E35A 1QR8A 1S0VA 3K5LA 3H1JH 4MVRA 5DN6G 4F6RA 2QWOB 2OIEA 1HWYA 2E3CA 1NJIW 5EIBC 3N27A 3TJTA 1OCOB 2HVKC 1BT8A 4IIJB 4DV2B 2YEVB 3FAVA 4AQYO 1R3IC 2IJHA 2P5OA 3SJCC 2CTRA 2UXNA 3G67A 2W6IG 3OMNB 4MT8A 4X20B 4LF8B 5J2TA 3TXQA 1FYJA 4NR1A 4IT5A 2PGGA 4FLTA 1L0LH 2QWQB 5L3CA 2X7RB 2JGDA 3K5MA 2P6JA 3AG1B 4HYOA 1JPXA 1BZKA 2XAFA 2CUGA 1QLEB 3RT3C 1FFXA 2JEXA 5IYBO 3E89A 3ASOB 2X6BA 3EVKA 4IL6Z 3T1CA 4X64B 5K1XA 3E22A 4PDRA 5H6QA 3JAWA 3ABMC 3ZBHA 1M56C 3B8MA 1Q3EA 1L0NH 4J11A 3GVMA 1XNRB 3RYFB 1WN7A 2OCHA 4DV2O 4LF7O 2EULA 1P84F 1H2MA 3SJAC 4DRXB 4WCEV 2QWPB 4CBCA 5BMVB 4LF8O 3E8FA 3JALB 5H2FZ 4RO2A 3H9VA 3WFVA 2DW4A 1SZTA 4ZI7A 3CYOA 3ETDA 4JI6B 1DTOA 4JYBA 5LGUA 5F2VO 1AP5A 3L9DA 5EBLC 3CCVV 3A0RA 1S76D 2JK5C 1N4CA 3MDSA 3OEHG 2F43G 4BIOA 4PI2A 3SDLA 3ZMUA 3H1LH 3RBZA 4NXMB 3RYCB 2G38A 3K5OA 3QO8A 5LYJA 2Q68A 4O2AB 4R7CA 5LGTA 1ZAUA 2R9RB 1GN3A 4DW0A 1Q6HA 1Q7YW 2XAQA 2UU9B 4LC1A 5CMUA 2JS5A 3OM3B 4LFCB 4XDJA 2ZR3A 2JIZG 1KC8W 3CRCA 4UB8Z 3VQYA 3H1IH 2ODMA 1ZL8B 1Y74A 2QDOA 1QHTA 3LSUA 3OGCC 5JCOC 5JH7A 1JFFA 4FIPC 2XUMA 3K06A 5IYZA 3D3IA 2QM7A 2CH7B 1O9GA 4QPKA 3JD4A 4JI6O 2LGWA 3UKMA 2QM4A 3EXAA 2KKWA 3LNMB 3SGIA 2P67A 2ZE6A 1LUVA 4DK1A 1SERA 1NU1H 4NXMO 2W6JG 2ETNA 1IBMO 3FB8C 4WFHA 1SS3A 5IDJA 4YHHB 3DSQA 2UU9O 2QKSA 4LFCO 4ZKIA 1VQPV 2CGOA 1FFTB 1CEZA 5L3FA 1QVFU 5IYCO 3JSLA 3ABMB 1M56B 3OT7A 5EYPA 3K08A 2Q0AA 3QF7A 2Q67A 5IWAB 2Q0OC 2ZKOA 3PN1A 2HJDA 5LBQA 4MTGA 3SYAA 1OZ0A 4O2BB 1K5SA 2UUCB 3OTFA 4DV4O 2IH1C 2WLLB 1IDSA 2JVDA 5B1AC 4ZOLB 3I5DA 3WU2Z 4NXNB 4JI1B 2ZDIA 3DXRB 4X1IA 5FLXN 4JI0B 1KQSU 4LFAB 1K4DC 3SJQC 4PA4A 4CS4A 2CTWA 4U7OA 4WFBV 3THOA 1R1BA 2HJFC 4FLWA 1JR9A 1IURA 3SPIA 1THZA 1AJPA 2ZM6B 1L1FA 1HNZB 3FB7C 4JI2B 2QKAA 5H5NA 3JATB 2ZE8A 4F6EA 3AG3C 2ZT9B 3UT5A 3EFFK 4CC6A 3E86A 4I50B 3JD1A 1K8AW 3DGEA 3S3WA 4FZ0A 1AR4A 5KMGB 3MAQA 4MVSA 2OTJV 5B5EZ 3K9AA 5IWAO 1MG1A 1Y76A 2GUZA 3H1HH 2Z0AA 2YC0A 4OX9O 1NVPD 3BPZA 3KG2A 1XNQO 2UUCO 1ZWIC 1VQMV 4RUEA 4JYAB 4FFKA 1Y6XA 2MK3A 2WA4A 1RPRA 4GYCB 1KBHA 4YIPA 2Q9LA 3D8CA 1F4MA 1ZX3A 4NXNO 3AEIA 4JI0O 1XI1A 2YS8A 4BIZA 3IGAC 2F4VO 1AR1B 1PKXA 2ZE5A 3SYOA 4O4LA 1AROP 1EM1A 4QIWF 5CA1B 2JDIG 4DV0O 2ZM6O 1VQKV 1HNZO 3T4DA 1SQBH 1OCCC 4HAMA 4JI2O 3JASA 5AG2A 3C3TA 4I4TB 1G6UA 2H94A 4JGSA 4RWUA 4X9QA 1Q81W 1WLEA 2DJVA 1FXVA 2HVJC 1MABG 3QO7A 1SQGA 1SQVH 2EIJC 3K57A 3APOA 1E1QG 2Q6AA 3CC2V 1FS0G 1FXHA 1XUQA 2Q8VA 4JYAO 1NS1A 5EC1C 1AILA 4B7EA 4OPHA 2NNUA 3FAVB 5A9GA 2GTSA 1FXKA 5JJJB 4I9QA 3CRMA 5B1AB 3HB3B 4Q20A 4X65B 3CC4V 4NTXA 1Q43A 1OHHG 1G1XB 5LMNB 4CZZA 1NKDA 1IBLB 4JI7O 1F23A 2JGDB 3JCZA 4JI5B 4P2ZA 4LH7A 2OCCC 5EZYB 3G71V 3L71H 3R66A 4JTCB 4MSWC 3F5TA 4KXRA 1WA8B 1TUEB 2YIAA 3AG3B 1RSOB 3VQVA 3SPHA 5JVDA 3DC5A 1IVSA 1XEQA 1WB8A 3E22B 4TOIA 4DR4B 5B1BC 2YDEA 4GX5A 4DV6B 1V54C 2E5LB 1VARA 3OMIB 5L3BA 1XOUA 1LUWA 2ZXWC 2WSSG 4KFMA 3TCUA 4HBNA 4JAVA 1S72V 3P30A 1Y4MA 1XDCA 5KX5A 3FYEB 1IXMA 4X65O 3ABKC 2B5UA 2HHHB 2CTQA 2JJ2G 2RDCA 4ZI7B 1MMMA 5LMNO 3SPCA 5IT9N 1IBLO 1XMQB 1B3QA 4UCUA 2RQ6A 1X4TA 1GH6A 2CE4A 4CH6A 1SQXH 2IJJA 5HFLA 3ZHTA 1N33B 5FNVA 4BW5A 4DR2O 2Y48A 4PA6A 4UXNA 1ZTEA 5KAFZ 1AI6A 1VMGA 3U11A 1FJGB 1K4CC 1OCCB 3UO2A 2UXXA 4J9ZB 3CD6V 3I55V 2DWEC 5J9PC 4H0LB 2OWOA 4NKGB 4IYHA 1PM9A 1I5XA 1YJWV 1J5EB 4DR4O 4RQEA 4CH4A 4H44B 4B3TB 4NB5A 3AG7A 2M6YA 2EIJB 1WP8A 4DV6O 2EZOA 4DXWA 4UVBA 2E5LO 5DM6V 3Q4HA 1IBKB 4N23A 4O4JA 1TUBA 1KKDA 3NXSA 3WG7C 4BW9A 5HFMA 1M5IA 4HNAB 2ZNJA 3P32A 5C93A 2GTAA 1K5QA 4GUNA 1MNGA 3A2FA 3CCUV 1YZBA 2GDSA 2HHHO 3FYIB 3T4ZA 1OCZC 4LH6A 3BFRA 1JVMA 4GCZA 5B3SC 2ILMA 4UCRA 1VQLV 4KHPB 2LW1A 2YICA 2QA4V 1KKCA 2HLDG 1XMQO 5KHIA 2YI8A 2YIBD 3FD9A 1E1RG 3ASNC 1YI2V 3ZJZA 1N33O 5LA6A 2UXDO 1KUQA 2DYRC 4UCVA 3D36A 1R6KA 1HNWB 1P7GA 2OCCB 1FJGO 1KU9A 1H8HG 3SYQA 4PA7A 1H38A 1ENVA 3SR2C 1EN5A 1J5EO 4O4HA 3J80N 3CCSV 4B3TO 2IU0A 4H13B 5L3DA 1U96A 1GKFA 1BSMA 1IBKO 5EYPB 2AW9A 1M1KW 5H9CA 1VQ7V 5J2UB 3BHPA 2ZIMA 2ZE7A 4TV9A 2KG7A 2ZXWB 2YIDA 2CK3G 3ZRWB 1S5JA 3B09A 4UV8A 4FFBB 4DR5B 3OFNG 2DWDC 4L8JA 5DECA 4J10A 1CP9A 3ABKB 4KHPO 3RN4A 1JJOA 1FXKC 2WWWA 4R6ZA 4FLZA 2LQTA 2QWRB 2GSMB 3ZEDA 1FAFA 3AK2A 1NR1A 2EIMB 2D2CB 2Q73A 2R70A 2V7QG 1HNWO 4MW8A 3E2EA 5ITZB 1G4YB 3CCEV 3E8GA 4PV1B 3I56V 2XAHA 2QEXV 2X6AA 3BABA 3ETEA 2B1IA 5LGNA 3UT5B 4JV5B 2O57A 1H2KA 3KCXA 4Q6GA 4NVPA 3G6BA 1QR9A 4DV1B 4ZHQB 3MHSC 1EFRG 3B8NA 4CC5A 5KLVH 3STZC 2NLJC 4LNUB 4JI3B 1Y76B 5IJ9A 3WG7B 4D7SA 1WNSA 3K3WA 2DMXA 1YTFD 5CB4B 3QTCA 4YIOA 1NH2B 2UXCB 4PA3A 4UVAA 4WFGA 1ZUQA 1XL4A 5B3SB 2OTLV 3WB2A 4X62B 1VIBA 4TT3G 4X8AA 3OGIB 1PV0A 3K0DA 2EINB 4LP8A 4O4IA 4DO2A 1Z2GA 2KSDA 3ASNB 2VWKA 5EC2C 2VQFB 1YVWA 4H33A 3ZMSA 1I5YA 2DYRB 3N2KA 3CJHA 1A32A 1M4UA 5IJ0A 3T1YB 1QBZA 4MVZA 3B77A 1JA8A 3AK1A 3JAKB 1Q90D 4YJ3B 3AG4B 3JASB 4DV5B 1XBLA 4X64O 4JV5O 2ZR2A 3JAMN 1AJQA 4AHCA 3N2GA 4J7KA 4DV1O 2UUBB 4I5SA 1TVKA 4W4KA 2F66C 2BTOA 4IHJB 2V1DA 1XNRO 2ADQB 2P90A 1GN6A 4JI3O 2C2AA 3H01A 3H1KH 3LNNA 2XNDG 1YITV 2A06H 2UXCO 1N36B 1IZ3A 1PL0A 4JAUA 3W7UA 2BSKA 4MS2A 3ZHRA 1PP9H 3U10A 5CA3A 1OCRC 3BY6A 4X62O 1FXKB 3OR6C 4LF6B 2M7WA 1SA0A 1PD3A 2B9ZA 3HR0A 5KUMA 1TA8A 5LXTA 4LF4B 4K8ZA 4JTAB 1WP7A 3CEIA 2A7WA 3T1YO 1D5AA 2W0FC 3U0ZA 2EX3A 1OV9A 3D36C 1K34A 2XAJA 4K35A 5L3EA 1W2BU 1BQ0A 2BCCH 4BWAA 4XDKA 3A0BZ 4I0XA 3J81N 1H2NA
chains in the Genus database with same CATH topology
1KP2A 1WLEA 3ASOC 1K33A 1AI4A 1FXVA 1RM1B 4MTOA 2HVJC 1PNMA 1MABG 3QO7A 2HG5C 4RUFA 1S5HC 3CCLV 2EIJC 1B6QA 1NQTA 2WAMA 1KECA 1E1QG 4JF3A 3CMAV 2Q6AA 2QE7G 3FB5C 3M99B 3CC2V 1FS0G 1FXHA 5CBGA 1OCZB 3LUTB 1Q82W 4QJFB 5EC1C 2EJRA 2NNUA 1WPXA 1FXKA 3ZMTA 2HR3A 4X88A 1KD1W 2Q69A 5B1AB 3HB3B 4Q20A 3CC4V 1VQ5V 2KB1A 1K7DA 1GMGA 3AG2B 3OW2U 1F4NA 4Z1MG 1OHHG 4WFAV 4PELA 3JD3A 1EZJA 5KUKA 1R3JC 1YTFB 4CZZA 2Z5UA 1NKDA 4E2LA 2XASA 4UVCA 3K04A 1DF4A 4PDMA 1F23A 3JCZA 2EINC 4J9YB 4JYCA 4BAYA 3E8HA 1JQ0A 2ITDC 3ZRXA 4P2ZA 4GT1A 3T2MA 3W7WA 2A79B 2OCCC 3CC7V 4YXWG 2JJ1G 1MSWD 4ASUG 3G71V 2B1GA 2DQ0A 1PNLA 4EKWA 1GTOA 2ITCC 4JTCB 4MSWC 3FB6C 2ZD9A 4P30A 4X89A 3UM7A 3OUFA 1TUEB 3AG3B 3CCMV 5EK0A 3X2QB 5KA5A 3SPHA 2IJIA 1P7BA 1JOYA 5IYDO 3AG4C 3E35A 1KP3A 3W7SA 5B1BC 1QR8A 1S0VA 2DYSB 2OT5A 4GX5A 2AHYA 3K03A 3RW0A 3RVYA 2EZPA 4MVRA 4GX1A 1V54C 4U7NA 3TK1A 5DN6G 3OEEG 3OMIB 2EIKC 4FJCC 3ZMVA 1HWYA 3K79A 4UUJC 5L3BA 2ZXWC 2WSSG 4KFMA 3TCUA 4JAVA 1NJIW 1S72V 1OCOB 2HVKC 1OCRB 1Y4MA 3P30A 1K97A 2YEVB 2YSUB 2LP7A 1R3IC 3G6EV 3FYEB 1VQ4V 2IJHA 1IXMA 1YJ9V 4QNHB 3ABKC 2B5UA 2UXNA 2JJ2G 2W6IG 3OMNB 1SESA 4MT8A 3W7TA 3CP1A 3CCJV 3SPCA 1R6NA 3ABLC 1NVPB 1SRYA 5L3CA 2IJJA 2X7RB 2BOBC 2Y69C 2X0LA 2IW5A 5HFLA 4BW5A 1QCEA 2ATKC 1JX9A 2Y48A 2P6JA 3AG1B 4PA6A 5EBWC 4UXNA 4HYOA 1V55C 1AI6A 2WLJA 3LSQA 1W0KG 1BHBA 3QO5A 1K4CC 1AI5A 1OCCB 2HKOA 2UXXA 1JPXA 2IH3C 4J9ZB 3I55V 3CPWU 2XAFA 3CD6V 2DWEC 4N21A 5J9PC 1QLEB 3F5WC 5IY5C 2X6CA 2JEXA 1NH2D 5IYBO 1I5XA 3E89A 3ASOB 2X6BA 1M57C 1YJWV 3GB7C 4WFEA 3SYCA 4QPJA 4MVUA 4RQEA 4JTDB 3OE7G 3ETGA 3T1CA 4PDRA 2EIJB 5H6QA 3VBBA 2EILC 2EZOA 4DXWA 4UVBA 3ABMC 1M56C 3B8MA 3OR7C 5DM6V 1QLNA 1JCHA 4PDLA 4N23A 1RM1C 1KKDA 3NXSA 1NR7A 1CPYA 3WG7C 1MOFA 5HFMA 2XAGA 1Q86W 2R9IA 3P32A 1J95A 5C93A 1K5QA 5CBFA 2QM8A 3CCUV 1BHAA 3IC7A 3ZRWA 4WCEV 4PDVA 2YEVA 3FYIB 2WLIB 3T4ZA 2QTOA 1OCZC 1ORQC 4CBCA 1JVMA 4GCZA 2IJKA 5B3SC 3E8FA 5GW7A 4MVMA 1VQLV 3WFVA 4RO2A 2DW4A 3W7XA 4WF9V 2EBOA 1SZTA 2QA4V 2HLDG 1M9NA 3CYOA 1H8EG 3ABUA 3ETDA 1E1RG 1DTOA 5CBHA 4GX2A 3ASNC 1YI2V 1P4RA 4JYBA 5LGUA 2WLNA 3ZJZA 3OUSA 2D3OW 2DYRC 5EBLC 3CCVV 3A0RA 3CCQV 3DTUB 4G27B 2JK5C 3G4SV 3D36A 2HFEC 1S76D 1R6KA 3OEHG 5KA6A 2F43G 2OCCB 2WLMA 4UV9A 3QNEA 4G28B 3ZMUA 1H8HG 1VQOV 2PI4A 3RBZA 3SYQA 1GM9A 4PA7A 1AI7A 3QO8A 5FL7G 1H38A 2Q68A 4R7CA 5LGTA 1ENVA 3F7YC 4XDLA 1VQ6V 3SPGA 2R9RB 1R3KC 2FTKA 3CCSV 1Q7YW 2XAQA 1VQNV 4LC1A 5EBMC 5CMUA 2IU0A 5L3DA 3OM3B 4MTXA 4XDJA 2ZR3A 4G2KA 1GKFA 2JIZG 3VOUA 3K0GA 1KC8W 3MHHC 4P9PA 1E79G 3OAAG 1M1KW 5LHGA 5H9CA 1VQ7V 2ZXWB 1GM8A 2CK3G 3ZRWB 4RQFA 1BL8A 4UV8A 1M90W 3OGCC 1SETA 4HZ3A 5LHHA 3OFNG 2DWDC 3ZCCA 1BMFG 1CP9A 3ABKB 4FK5C 5B1OA 2WLIA 4FIPC 1FXKC 2WWWA 3K06A 4R6ZA 3D3IA 3BEHA 3LDDA 2QM7A 2BOCC 4QPKA 4MTFA 3JD4A 2GSMB 2ZDIC 3ZMZA 2WLHA 3SPJA 4KP4A 3UKMA 1NR1A 2EIMB 2Y69B 4QE9A 3LNMB 2V7QG 2P67A 3ZIAG 4MW8A 3E2EA 1G4YB 1NBMG 3CCEV 1V55B 3E83A 2LFSA 1SERA 2DQ3A 4TWKA 2W6JG 3CMEV 3E8GA 3FB8C 3I56V 1VQ8V 4L87A 3R65A 2XAHA 4WFHA 2QEXV 5IDJA 2X6AA 1YJNV 2XOKG 2QKSA 3ETEA 1M57B 2B1IA 4WFFA 5LGNA 1GK9A 5E1AC 3GWOA 3CCRV 4ZKIA 4JPRA 1VQPV 1Y66A 1FFTB 1QR9A 1CEZA 1EBOA 5L3FA 1QVFU 2EILB 5IYCO 3ABMB 1M56B 3MHSC 1EFRG 3B8NA 3CXCU 3EHBB 3STZC 5LHIA 2NLJC 3K08A 3PJSK 3WG7B 2Q67A 1YHQV 1N8RW 3K3WA 1VQ9V 4KUMA 3ZN1A 3RVZA 1DLBA 5LBQA 1YTFD 1UJWB 3E8BA 1NH2B 4MTGA 2Z3YA 3SYAA 1OZ0A 1PNKA 4PA3A 4UVAA 4PA9A 1K5SA 4WFGA 5B1NA 4BIUA 1JJ2U 2ZQMA 4GX0A 4TSFG 1XL4A 2A0LA 3STLC 1YSCA 5B3SB 2OTLV 2IH1C 3SYPA 3JD2A 4TT3G 4X8AA 2WLKA 2LFRA 5BZBA 2WLLB 1S77D 5B1AC 1QVGU 3K0DA 2WPDG 2EINB 3AG2C 4LP8A 4DO2A 1K3EA 4H37A 3ASNB 4JASA 4LCUC 1GO3F 5EC2C 2ZDIA 2PI5A 4H33A 3ZMSA 1I5YA 2DYRB 1KQSU 5CN0A 5H6RA 1QBZA 1R73A 1K4DC 3SJQC 4LBEC 4PA4A 4MVZA 3ABTA 3LDCA 3ZN0A 3B77A 4U7OA 4WFBV 1S3JA 2HJFC 2A9HA 4OXSA 3SPIA 3AG4B 1THZA 1AJPA 1L1FA 1AJNA 2ZR2A 3FB7C 2K1EA 5B1BB 1AJQA 3ZRSA 4F4LA 3F7VC 1DF5A 3AG3C 3EFFK 3FKSG 3E86A 3X2QC 1V54B 2JEUA 3JD0A 1YIJV 4I5SA 3JD1A 4R8CA 1K8AW 2EIKB 3DGEA 2V1DA 2P90A 3HPLC 2C2AA 4MVSA 2OTJV 2DYSC 3H01A 3K9AA 2XNDG 1YITV 4FMTA 1MG1A 1K9MW 3LDEA 3ZRVA 4RAIA 4MVOA 1NVPD 1PL0A 3KG2A 4JAUA 5L3GA 3W7UA 1GM7A 1XL6A 1ZWIC 4RUEA 1VQMV 4MS2A 1LNQA 1H2GA 1OCOC 2AHZA 5CA3A 1OCRC 3BY6A 3TETA 1F51A 3MD0A 1FXKB 3OMAB 3OR6C 2MK3A 2M7WA 3ABLB 1RPRA 1R3LC 4XBFA 1PD3A 2P7TC 1W0JG 1COWG 5KUMA 1ROPA 2WLLA 1F4MA 4R50A 4JTAB 3AEIA 4BIZA 3IGAC 3ML0A 4I9WA 2W0FC 4ZBMA 1AR1B 1PKXA 4QE7A 3LSSA 3SYOA 4P9OA 1K34A 2EIMC 1G8MA 4MW3A 5IY5B 1AROP 2XAJA 3AG1C 4QIWF 5L3EA 2JDIG 1K73W 1W2BU 2H8PC 4FPPA 1K92A 1VQKV 2IU3A 3T4DA 4XDKA 1OCCC 1RPOA 4HAMA 4MVQA 3JYCA 2H94A 4JGSA 1QLEC 1Q81W 3IFXA 2GHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROP A;  2IJK A;  2IJH A;  1RPR A;  1F4M A;  1GTO A;  3K79 A;  1RPO A;  1GMG A;  1B6Q A;  1PD3 A;  2IJI A;  4DO2 A;  1NKD A;  2IJJ A;  1F4N A;  2GHY A; 
#chains in the Genus database with same CATH topology
 2UUB O;  1KP2 A;  3HKD B;  3CS5 A;  1AI4 A;  3CRQ A;  3ICX A;  2YUA A;  4JZG A;  1IXB A;  1KEC A;  4JF3 A;  2F93 B;  1N36 O;  4JZ2 A;  5GON B;  2YXL A;  5CBG A;  4TUY B;  1H2S B;  1V9P A;  4QJF B;  5B66 Z;  4J7J A;  2F1M A;  2EJR A;  4DR1 B;  1EN6 A;  1X59 A;  4X88 A;  4DUY B;  4IIJ A;  2Q69 A;  4YY3 B;  1GMG A;  3OW2 U;  3ZHV A;  1F4N A;  2CTP A;  4E2L A;  2LW7 A;  3T1H B;  2XAS A;  1QU7 A;  4PDM A;  3RFR A;  1JQ0 A;  2ITD C;  4YHH O;  2A79 B;  3RYH A;  3CC7 V;  4YXW G;  4ASU G;  2B1G A;  2DQ0 A;  1SQQ H;  2ITC C;  2GBO A;  4DR3 B;  2ZD9 A;  4P30 A;  3HKB B;  5EIB D;  3TXS A;  1QNM A;  5EK0 A;  5IYD O;  4JI8 B;  3CRA A;  4WBN B;  1HP8 A;  2EJ7 A;  3W7S A;  2OT5 A;  1YF2 A;  2AHY A;  4GKK B;  3RW0 A;  4U7N A;  1TUB B;  3TK1 A;  3OEE G;  4DYL A;  2EIK C;  5LMU B;  4UUJ C;  4DR1 O;  2HEP A;  4YJ2 B;  1OCR B;  3B2E E;  3UQ8 A;  3G6E V;  1VQ4 V;  4DUY O;  1F7Y A;  1YJ9 V;  4YY3 O;  4QNH B;  5JQG A;  1D5N A;  4JI1 O;  4DRX A;  3W7T A;  4I7Z B;  3CP1 A;  1R6N A;  1IX9 A;  4LFA O;  2E75 B;  3ABL C;  3T1H O;  3JAL A;  2XT9 A;  1SRY A;  2BOB C;  2Y69 C;  1QCE A;  1URF A;  2FL4 A;  2P06 A;  1V55 C;  2WLJ A;  3LSQ A;  1W0K G;  1BHB A;  3QO5 A;  1AI5 A;  4DR3 O;  2HKO A;  4BR6 A;  3B4S A;  4IYI A;  3CPW U;  4Z1V A;  4N21 A;  5IY5 C;  2Q4P A;  2UXB B;  2Q7G A;  3NR7 A;  3BA8 A;  4LWS A;  1M57 C;  4JI8 O;  3GB7 C;  4WFE A;  4MVU A;  3ETG A;  1SC5 B;  4F6R B;  4GKK O;  1Q5O A;  2EIL C;  4DV3 B;  4AI8 A;  5LMU O;  2MW2 B;  2NN4 A;  1RM1 C;  1WPB A;  1CPY A;  1DGS A;  1BGY H;  2QJ1 A;  1HR0 B;  2XAG A;  2XTA A;  1J95 A;  1HW7 A;  1ZSP A;  2LO1 A;  5J2T B;  1W59 A;  1Q6I A;  3K5N A;  4B3S B;  2RN9 A;  4C7U A;  4MVM A;  2PZS A;  4WF9 V;  2EBO A;  1M9N A;  1H8E G;  4Z2W A;  5CBH A;  1P4R A;  2WLN A;  2D3O W;  1US6 A;  3CCQ V;  3DTU B;  3G4S V;  3L75 H;  2HFE C;  4LFB B;  5KA6 A;  2WLM A;  4UV9 A;  4G28 B;  2FML A;  1FFX B;  2PI4 A;  2AGA A;  1GM9 A;  2L6L A;  1BQZ A;  3HKC A;  2UXB O;  4FLY A;  4XDL A;  3SPG A;  4NYK A;  1WB7 A;  1XQ8 A;  1R3K C;  2F23 A;  2FTK A;  4UCT A;  3JAW B;  3M7M X;  2N74 A;  1MZF A;  4DV3 O;  3ETQ A;  1VEW A;  3VOU A;  3MHH C;  4P9P A;  1E79 G;  3BCC H;  4AIL C;  5BY1 A;  2JGU A;  5LHG A;  1NTM H;  3B40 A;  1HR0 O;  1GM8 A;  4UCO A;  3K9S A;  4RQF A;  4IGG A;  3RYI A;  5LHH A;  2CGN A;  4DR6 B;  3ZCC A;  4B3S O;  1BMF G;  4FK5 C;  5FPR A;  2WLI A;  2RNB A;  1WJZ A;  4O2B A;  3LDD A;  2ZDI C;  4O4I B;  1I7F A;  4JI5 O;  4KP4 A;  2Y69 B;  4QE9 A;  3N2K B;  2YXY A;  5IJ0 B;  1VF7 A;  2P22 C;  1V55 B;  3E83 A;  5LYJ B;  2LFS A;  4TV8 A;  2DQ3 A;  4TWK A;  1N34 B;  4B3R B;  1VQ8 V;  3R65 A;  2OYQ A;  4X1Y A;  4K8X A;  3L73 H;  1AP6 A;  2XOK G;  1M57 B;  4WFF A;  1GK9 A;  2L35 A;  1LR1 A;  3N2G B;  3GWO A;  3C3S A;  3CCR V;  1AB3 A;  4JPR A;  1TVK B;  1EBO A;  2EIL B;  4CS3 A;  1N32 B;  1Y74 B;  3CXC U;  4ABM A;  1QQC A;  5LHI A;  2JRI A;  4CH5 A;  1GAX A;  1KB9 F;  1YHQ V;  2QTS A;  1N8R W;  3RVZ A;  1DLB A;  2V4D A;  5JH7 B;  1JFF B;  4DR6 O;  4DUZ B;  2Z3Y A;  5IYZ B;  1PNK A;  3CXH F;  4PA9 A;  1JJ2 U;  2DE0 X;  2ZQM A;  4GX0 A;  2A0L A;  2H3O A;  1SA0 B;  3O65 A;  3SYP A;  3JD2 A;  2WLK A;  2UUA B;  1S77 D;  4DR7 B;  2WPD G;  3QG5 A;  1DK1 A;  1K3E A;  2Y0I A;  4LCU C;  1GO3 F;  4DK0 A;  2PI5 A;  2IBZ H;  5DED A;  5CN0 A;  1R73 A;  2RCV A;  1L8D A;  1N34 O;  4GKJ B;  4B3R O;  3ABT A;  3LDC A;  2AZ0 A;  1JMK C;  1S3J A;  2LGQ A;  2A9H A;  4OXS A;  4I0X B;  1AJN A;  2K1E A;  5B1B B;  5CA1 A;  4F4L A;  3OD4 A;  1DF5 A;  3FKS G;  2N05 A;  4FM1 A;  4E4E A;  2BE3 A;  1V54 B;  4I55 A;  4I4T A;  3JSN A;  4R8C A;  2E76 B;  3L74 H;  1I0H A;  2Y4T A;  3WB1 A;  3HPL C;  4FLX A;  2DYS C;  5E79 Z;  2LJ2 A;  4RAI A;  4DUZ O;  4MVO A;  1XMO B;  5L3G A;  4U3F H;  5BR8 B;  4CH3 A;  4X66 B;  3OMA B;  4LF7 B;  1R3L C;  2UUA O;  5D5Q A;  4DR7 O;  4W4L A;  2BTQ A;  2P7T C;  1W0J G;  3WB0 A;  4X1K A;  1ROP A;  4X1I B;  2P4K A;  2YI9 A;  4NTW A;  4I9W A;  3TGU H;  4GKJ O;  3S3X A;  4MW3 A;  3RYH B;  3A8T A;  1K73 W;  2H8P C;  4FPP A;  2CDY A;  3APQ A;  4LR3 A;  3JYC A;  3IJ4 A;  2YIB A;  5EZY A;  3CE2 A;  3IFX A;  2GHY A;  4OPA A;  4NTY A;  1WA8 A;  4MTO A;  1PNM A;  1RSO A;  2HG5 C;  2GUZ B;  1S5H C;  1XHZ A;  5CA0 A;  4DR5 O;  2RJZ A;  2QWN B;  3FB5 C;  1XMO O;  3HKE A;  1BS3 A;  3UCS C;  1OCZ B;  5BR8 O;  1Q82 W;  4X66 O;  3P3P A;  5JQG B;  4ZIB A;  2Y4U A;  1ZLZ A;  1VQ5 V;  2KB1 A;  1P49 A;  1BCC H;  4Z1M G;  2YXH A;  4WFA V;  1I94 B;  3JD3 A;  5KUK A;  4EEQ A;  4JI4 B;  2Z5U A;  3P3N A;  4O4L B;  1DF4 A;  5KHH A;  1AVM A;  1B06 A;  3E8H A;  3ZRX A;  1N0J A;  4DW1 A;  4FVM A;  3W7W A;  2FB5 A;  1MSD A;  1B04 A;  1D2D A;  1YCI A;  1UFI A;  1EN4 A;  1NZ6 A;  2JJ1 G;  3K59 A;  5JWP A;  1PNL A;  4EKW A;  3CWB H;  5BXZ A;  4FLU A;  3BRC A;  4X89 A;  3UM7 A;  2PUS A;  1N0N A;  4FM2 A;  1IBM B;  4LWS B;  5KA5 A;  2IJI A;  4U3J A;  1KP3 A;  3ZS8 C;  4UCS A;  2DOS A;  4EB6 A;  4LF5 B;  2DYS B;  3K03 A;  3RVY A;  1SQF A;  2EZP A;  4GX1 A;  4FJC C;  3ZMV A;  3K79 A;  1KMI Z;  2K9P A;  1HDJ A;  5GTH Z;  1VF6 A;  3L70 H;  1TAE A;  1Y67 A;  3ZX6 A;  1K97 A;  3ZHU A;  2YSU B;  2LP7 A;  3JCU Z;  4HNA A;  3BA9 A;  2VQF O;  2XHB A;  1SES A;  5C8Y A;  3RWR D;  1I94 O;  1NI8 A;  3CCJ V;  4JI4 O;  4DV4 B;  2OIG A;  3JAR A;  1NVP B;  1H2L A;  3ZHS A;  1MA1 A;  2X0L A;  2IW5 A;  2ATK C;  4DV5 O;  1JX9 A;  5LP6 A;  3J7A U;  5LOV A;  3VQW A;  5EBW C;  2ZNI A;  3HKC B;  2A3Q A;  2IH3 C;  5JVD B;  3F5W C;  4QGP A;  2X6C A;  1NH2 D;  1Z5V A;  1FD9 A;  1Q8I A;  3SYC A;  4QPJ A;  4LF5 O;  4JTD B;  3OE7 G;  3VBB A;  3OR7 C;  2E74 B;  1JCH A;  1QLN A;  3DC6 A;  4PDL A;  4TQF A;  1NR7 A;  1SF9 A;  1MOF A;  1OJH A;  3KKY A;  5KX5 B;  4LF6 O;  4ICG A;  1NTK H;  2QKC A;  3RYI B;  1Q86 W;  2R9I A;  5J2U A;  5CBF A;  2QM8 A;  1BHA A;  3IC7 A;  3ZRW A;  4PDV A;  2YEV A;  4LF4 O;  2WLI B;  4OX9 B;  2QTO A;  1ORQ C;  2IJK A;  5GW7 A;  4FFB A;  3K58 A;  1BE3 H;  3D3Q A;  1XNQ B;  4DV7 B;  5D5P A;  2JS3 A;  4B7K A;  3W7X A;  4X20 A;  2PYJ A;  3ABU A;  5FNV B;  4GX2 A;  5KHK A;  4B08 A;  2NR5 A;  4UFZ A;  3OUS A;  1XIL A;  2ARH A;  4G27 B;  4TV8 B;  5TIS Z;  3QNE A;  1VQO V;  2F4V B;  1AI7 A;  5ITZ A;  1FKA O;  5FL7 G;  3F7Y C;  4X1Y B;  4PJ0 Z;  1VQ6 V;  2VQE B;  1VQN V;  5EBM C;  4DV0 B;  4KL1 A;  4MTX A;  3Q4H B;  1I08 A;  4G2K A;  4O4J B;  4J42 A;  1O9H A;  3K0G A;  4GLX A;  3OAA G;  1MZE A;  2ZIO A;  4ZHQ A;  1M93 A;  3BVO A;  1YEW A;  2ZIN A;  1BL8 A;  4LNU A;  1NTZ H;  3RYF A;  1Q6U A;  1M90 W;  1SET A;  4HZ3 A;  2R72 A;  1AR5 A;  4B3M B;  2VRZ A;  1T5E A;  5CB4 A;  5B1O A;  4DV7 O;  5BMV A;  3VQX A;  3BEH A;  3CX5 F;  2BOC C;  4MTF A;  5LA6 B;  3ZMZ A;  2P4V A;  2WLH A;  4FM0 A;  4J41 A;  1HNX B;  2AXT Z;  3SPJ A;  1Z5W A;  3A0H Z;  2VWJ A;  3ZIA G;  1VP7 A;  1NBM G;  4UB6 Z;  3CME V;  2AZ2 A;  4JI7 B;  4O4H B;  4D7T A;  1GN2 A;  4L87 A;  3RYC A;  2VS0 A;  2VQE O;  4O2A A;  1YJN V;  1SKV A;  3JAK A;  5E1A C;  4FLV A;  4YJ3 A;  1YXB A;  1U97 A;  4CS2 A;  4I55 B;  4JYY A;  1Y66 A;  3QVN A;  4TV9 B;  2KG7 B;  1RP3 B;  3EHB B;  1SZX A;  2QR4 A;  3PJS K;  3CHX A;  1CXZ B;  4JAA A;  2Y0P A;  4IHJ A;  4J80 A;  1VQ9 V;  4KUM A;  3ZN1 A;  1ZL8 A;  3L72 H;  1UJW B;  3E8B A;  4B3M O;  5K1P A;  1VF6 C;  3G80 A;  4BIU A;  5B1N A;  3KZI Z;  1EZV H;  4TSF G;  1SQP H;  1YSC A;  3STL C;  4OGQ B;  2FYU H;  2BTQ B;  2LFR A;  1FPO A;  3C90 A;  4X1K B;  5BZB A;  2CH7 A;  1HNX O;  4TQD A;  1RFY A;  1QVG U;  3AG2 C;  4H37 A;  4JAS A;  5LL6 Y;  2R9A A;  5H6R A;  4LBE C;  3AK3 A;  5LP6 C;  3ZN0 A;  5IE9 A;  1GRJ A;  3M8A A;  2DN9 A;  4J7Z A;  4DR2 B;  3ZRS A;  3F7V C;  2W0X A;  3X2Q C;  2JEU A;  3JD0 A;  1YIJ V;  2HP8 A;  2WA3 A;  2EIK B;  5IJ9 B;  4D6T H;  1PPJ H;  2KQX A;  2Q7E A;  5CA0 B;  3HKD A;  5FPO A;  1TGO A;  2N04 A;  4FMT A;  2ADP A;  1R6T A;  1K9M W;  2CAZ C;  5KHG A;  3LDE A;  3HKE B;  3ZRV A;  4K3A A;  5KAI Z;  5KHJ A;  3FX7 A;  1GM7 A;  1XL6 A;  1LNQ A;  1H2G A;  4K0K B;  1OCO C;  2AHZ A;  5GON A;  3TET A;  1F51 A;  3KCY A;  3MD0 A;  4TUY A;  3SJB C;  3ABL B;  4XBF A;  2PYL A;  1COW G;  3FFQ A;  2WLL A;  3OTO B;  4ZOL A;  4R50 A;  3CJH B;  4LFB O;  3IC9 A;  2QSA A;  3DXR A;  3ML0 A;  4EFE A;  4ZBM A;  1XRE A;  3CSX A;  4QE7 A;  3LSS A;  4P9O A;  2EIM C;  1G8M A;  1GN4 A;  5IY5 B;  3AG1 C;  1KYO F;  2UXD B;  3BAA A;  1K92 A;  2IU3 A;  1RPO A;  4MVQ A;  2PTM A;  1UPG A;  1QLE C;  3JAT A;  4U3J B;  4GZR B;  1PL4 A;  2IM9 A;  3ASO C;  3CB2 A;  1K33 A;  4EB6 B;  3HKB A;  4I50 A;  1RM1 B;  4LF9 B;  1WAZ A;  3CRR A;  4RUF A;  3CCL V;  1B6Q A;  1NQT A;  5KMG A;  2WAM A;  5JJE B;  4WBN A;  2BSK B;  3CMA V;  2QE7 G;  3M99 B;  2PY5 A;  1S5L Z;  3LUT B;  4FZ1 A;  3O9O A;  5A2Q N;  5JCO A;  4K0K O;  5JJN B;  1XHX A;  1WPX A;  4PI0 A;  3IAY A;  3ZMT A;  2PF4 E;  1VF5 B;  5LXT B;  2HR3 A;  4AQY B;  2ZCE A;  4YJ2 A;  1KD1 W;  5C8Y B;  2Q5Z A;  3OTO O;  1K7D A;  2F95 B;  3AG2 B;  2RMK B;  3RGB A;  4A5U B;  4PEL A;  1EZJ A;  3JAR B;  1R3J C;  1YTF B;  4UVC A;  3K04 A;  4EFB A;  2EIN C;  4J9Y B;  4JYC A;  4BAY A;  5LP6 B;  5LOV B;  2QGN A;  4GT1 A;  3T2M A;  2GV9 A;  3UO3 A;  4PHZ A;  2Q7H A;  1MSW D;  1GTO A;  4PD4 F;  3FB6 C;  3ZHQ A;  3OUF A;  1N32 O;  3CCM V;  2FKX A;  3X2Q B;  1YDX A;  3GWK C;  1NT2 B;  1P7B A;  1JOY A;  5GTI Z;  4LF9 O;  3AG4 C;  3E35 A;  1QR8 A;  1S0V A;  3K5L A;  3H1J H;  4MVR A;  5DN6 G;  4F6R A;  2QWO B;  2OIE A;  1HWY A;  2E3C A;  1NJI W;  5EIB C;  3N27 A;  3TJT A;  1OCO B;  2HVK C;  1BT8 A;  4IIJ B;  4DV2 B;  2YEV B;  3FAV A;  4AQY O;  1R3I C;  2IJH A;  2P5O A;  3SJC C;  2CTR A;  2UXN A;  3G67 A;  2W6I G;  3OMN B;  4MT8 A;  4X20 B;  4LF8 B;  5J2T A;  3TXQ A;  1FYJ A;  4NR1 A;  4IT5 A;  2PGG A;  4FLT A;  1L0L H;  2QWQ B;  5L3C A;  2X7R B;  2JGD A;  3K5M A;  2P6J A;  3AG1 B;  4HYO A;  1JPX A;  1BZK A;  2XAF A;  2CUG A;  1QLE B;  3RT3 C;  1FFX A;  2JEX A;  5IYB O;  3E89 A;  3ASO B;  2X6B A;  3EVK A;  4IL6 Z;  3T1C A;  4X64 B;  5K1X A;  3E22 A;  4PDR A;  5H6Q A;  3JAW A;  3ABM C;  3ZBH A;  1M56 C;  3B8M A;  1Q3E A;  1L0N H;  4J11 A;  3GVM A;  1XNR B;  3RYF B;  1WN7 A;  2OCH A;  4DV2 O;  4LF7 O;  2EUL A;  1P84 F;  1H2M A;  3SJA C;  4DRX B;  4WCE V;  2QWP B;  4CBC A;  5BMV B;  4LF8 O;  3E8F A;  3JAL B;  5H2F Z;  4RO2 A;  3H9V A;  3WFV A;  2DW4 A;  1SZT A;  4ZI7 A;  3CYO A;  3ETD A;  4JI6 B;  1DTO A;  4JYB A;  5LGU A;  5F2V O;  1AP5 A;  3L9D A;  5EBL C;  3CCV V;  3A0R A;  1S76 D;  2JK5 C;  1N4C A;  3MDS A;  3OEH G;  2F43 G;  4BIO A;  4PI2 A;  3SDL A;  3ZMU A;  3H1L H;  3RBZ A;  4NXM B;  3RYC B;  2G38 A;  3K5O A;  3QO8 A;  5LYJ A;  2Q68 A;  4O2A B;  4R7C A;  5LGT A;  1ZAU A;  2R9R B;  1GN3 A;  4DW0 A;  1Q6H A;  1Q7Y W;  2XAQ A;  2UU9 B;  4LC1 A;  5CMU A;  2JS5 A;  3OM3 B;  4LFC B;  4XDJ A;  2ZR3 A;  2JIZ G;  1KC8 W;  3CRC A;  4UB8 Z;  3VQY A;  3H1I H;  2ODM A;  1ZL8 B;  1Y74 A;  2QDO A;  1QHT A;  3LSU A;  3OGC C;  5JCO C;  5JH7 A;  1JFF A;  4FIP C;  2XUM A;  3K06 A;  5IYZ A;  3D3I A;  2QM7 A;  2CH7 B;  1O9G A;  4QPK A;  3JD4 A;  4JI6 O;  2LGW A;  3UKM A;  2QM4 A;  3EXA A;  2KKW A;  3LNM B;  3SGI A;  2P67 A;  2ZE6 A;  1LUV A;  4DK1 A;  1SER A;  1NU1 H;  4NXM O;  2W6J G;  2ETN A;  1IBM O;  3FB8 C;  4WFH A;  1SS3 A;  5IDJ A;  4YHH B;  3DSQ A;  2UU9 O;  2QKS A;  4LFC O;  4ZKI A;  1VQP V;  2CGO A;  1FFT B;  1CEZ A;  5L3F A;  1QVF U;  5IYC O;  3JSL A;  3ABM B;  1M56 B;  3OT7 A;  5EYP A;  3K08 A;  2Q0A A;  3QF7 A;  2Q67 A;  5IWA B;  2Q0O C;  2ZKO A;  3PN1 A;  2HJD A;  5LBQ A;  4MTG A;  3SYA A;  1OZ0 A;  4O2B B;  1K5S A;  2UUC B;  3OTF A;  4DV4 O;  2IH1 C;  2WLL B;  1IDS A;  2JVD A;  5B1A C;  4ZOL B;  3I5D A;  3WU2 Z;  4NXN B;  4JI1 B;  2ZDI A;  3DXR B;  4X1I A;  5FLX N;  4JI0 B;  1KQS U;  4LFA B;  1K4D C;  3SJQ C;  4PA4 A;  4CS4 A;  2CTW A;  4U7O A;  4WFB V;  3THO A;  1R1B A;  2HJF C;  4FLW A;  1JR9 A;  1IUR A;  3SPI A;  1THZ A;  1AJP A;  2ZM6 B;  1L1F A;  1HNZ B;  3FB7 C;  4JI2 B;  2QKA A;  5H5N A;  3JAT B;  2ZE8 A;  4F6E A;  3AG3 C;  2ZT9 B;  3UT5 A;  3EFF K;  4CC6 A;  3E86 A;  4I50 B;  3JD1 A;  1K8A W;  3DGE A;  3S3W A;  4FZ0 A;  1AR4 A;  5KMG B;  3MAQ A;  4MVS A;  2OTJ V;  5B5E Z;  3K9A A;  5IWA O;  1MG1 A;  1Y76 A;  2GUZ A;  3H1H H;  2Z0A A;  2YC0 A;  4OX9 O;  1NVP D;  3BPZ A;  3KG2 A;  1XNQ O;  2UUC O;  1ZWI C;  1VQM V;  4RUE A;  4JYA B;  4FFK A;  1Y6X A;  2MK3 A;  2WA4 A;  1RPR A;  4GYC B;  1KBH A;  4YIP A;  2Q9L A;  3D8C A;  1F4M A;  1ZX3 A;  4NXN O;  3AEI A;  4JI0 O;  1XI1 A;  2YS8 A;  4BIZ A;  3IGA C;  2F4V O;  1AR1 B;  1PKX A;  2ZE5 A;  3SYO A;  4O4L A;  1ARO P;  1EM1 A;  4QIW F;  5CA1 B;  2JDI G;  4DV0 O;  2ZM6 O;  1VQK V;  1HNZ O;  3T4D A;  1SQB H;  1OCC C;  4HAM A;  4JI2 O;  3JAS A;  5AG2 A;  3C3T A;  4I4T B;  1G6U A;  2H94 A;  4JGS A;  4RWU A;  4X9Q A;  1Q81 W;  1WLE A;  2DJV A;  1FXV A;  2HVJ C;  1MAB G;  3QO7 A;  1SQG A;  1SQV H;  2EIJ C;  3K57 A;  3APO A;  1E1Q G;  2Q6A A;  3CC2 V;  1FS0 G;  1FXH A;  1XUQ A;  2Q8V A;  4JYA O;  1NS1 A;  5EC1 C;  1AIL A;  4B7E A;  4OPH A;  2NNU A;  3FAV B;  5A9G A;  2GTS A;  1FXK A;  5JJJ B;  4I9Q A;  3CRM A;  5B1A B;  3HB3 B;  4Q20 A;  4X65 B;  3CC4 V;  4NTX A;  1Q43 A;  1OHH G;  1G1X B;  5LMN B;  4CZZ A;  1NKD A;  1IBL B;  4JI7 O;  1F23 A;  2JGD B;  3JCZ A;  4JI5 B;  4P2Z A;  4LH7 A;  2OCC C;  5EZY B;  3G71 V;  3L71 H;  3R66 A;  4JTC B;  4MSW C;  3F5T A;  4KXR A;  1WA8 B;  1TUE B;  2YIA A;  3AG3 B;  1RSO B;  3VQV A;  3SPH A;  5JVD A;  3DC5 A;  1IVS A;  1XEQ A;  1WB8 A;  3E22 B;  4TOI A;  4DR4 B;  5B1B C;  2YDE A;  4GX5 A;  4DV6 B;  1V54 C;  2E5L B;  1VAR A;  3OMI B;  5L3B A;  1XOU A;  1LUW A;  2ZXW C;  2WSS G;  4KFM A;  3TCU A;  4HBN A;  4JAV A;  1S72 V;  3P30 A;  1Y4M A;  1XDC A;  5KX5 A;  3FYE B;  1IXM A;  4X65 O;  3ABK C;  2B5U A;  2HHH B;  2CTQ A;  2JJ2 G;  2RDC A;  4ZI7 B;  1MMM A;  5LMN O;  3SPC A;  5IT9 N;  1IBL O;  1XMQ B;  1B3Q A;  4UCU A;  2RQ6 A;  1X4T A;  1GH6 A;  2CE4 A;  4CH6 A;  1SQX H;  2IJJ A;  5HFL A;  3ZHT A;  1N33 B;  5FNV A;  4BW5 A;  4DR2 O;  2Y48 A;  4PA6 A;  4UXN A;  1ZTE A;  5KAF Z;  1AI6 A;  1VMG A;  3U11 A;  1FJG B;  1K4C C;  1OCC B;  3UO2 A;  2UXX A;  4J9Z B;  3CD6 V;  3I55 V;  2DWE C;  5J9P C;  4H0L B;  2OWO A;  4NKG B;  4IYH A;  1PM9 A;  1I5X A;  1YJW V;  1J5E B;  4DR4 O;  4RQE A;  4CH4 A;  4H44 B;  4B3T B;  4NB5 A;  3AG7 A;  2M6Y A;  2EIJ B;  1WP8 A;  4DV6 O;  2EZO A;  4DXW A;  4UVB A;  2E5L O;  5DM6 V;  3Q4H A;  1IBK B;  4N23 A;  4O4J A;  1TUB A;  1KKD A;  3NXS A;  3WG7 C;  4BW9 A;  5HFM A;  1M5I A;  4HNA B;  2ZNJ A;  3P32 A;  5C93 A;  2GTA A;  1K5Q A;  4GUN A;  1MNG A;  3A2F A;  3CCU V;  1YZB A;  2GDS A;  2HHH O;  3FYI B;  3T4Z A;  1OCZ C;  4LH6 A;  3BFR A;  1JVM A;  4GCZ A;  5B3S C;  2ILM A;  4UCR A;  1VQL V;  4KHP B;  2LW1 A;  2YIC A;  2QA4 V;  1KKC A;  2HLD G;  1XMQ O;  5KHI A;  2YI8 A;  2YIB D;  3FD9 A;  1E1R G;  3ASN C;  1YI2 V;  3ZJZ A;  1N33 O;  5LA6 A;  2UXD O;  1KUQ A;  2DYR C;  4UCV A;  3D36 A;  1R6K A;  1HNW B;  1P7G A;  2OCC B;  1FJG O;  1KU9 A;  1H8H G;  3SYQ A;  4PA7 A;  1H38 A;  1ENV A;  3SR2 C;  1EN5 A;  1J5E O;  4O4H A;  3J80 N;  3CCS V;  4B3T O;  2IU0 A;  4H13 B;  5L3D A;  1U96 A;  1GKF A;  1BSM A;  1IBK O;  5EYP B;  2AW9 A;  1M1K W;  5H9C A;  1VQ7 V;  5J2U B;  3BHP A;  2ZIM A;  2ZE7 A;  4TV9 A;  2KG7 A;  2ZXW B;  2YID A;  2CK3 G;  3ZRW B;  1S5J A;  3B09 A;  4UV8 A;  4FFB B;  4DR5 B;  3OFN G;  2DWD C;  4L8J A;  5DEC A;  4J10 A;  1CP9 A;  3ABK B;  4KHP O;  3RN4 A;  1JJO A;  1FXK C;  2WWW A;  4R6Z A;  4FLZ A;  2LQT A;  2QWR B;  2GSM B;  3ZED A;  1FAF A;  3AK2 A;  1NR1 A;  2EIM B;  2D2C B;  2Q73 A;  2R70 A;  2V7Q G;  1HNW O;  4MW8 A;  3E2E A;  5ITZ B;  1G4Y B;  3CCE V;  3E8G A;  4PV1 B;  3I56 V;  2XAH A;  2QEX V;  2X6A A;  3BAB A;  3ETE A;  2B1I A;  5LGN A;  3UT5 B;  4JV5 B;  2O57 A;  1H2K A;  3KCX A;  4Q6G A;  4NVP A;  3G6B A;  1QR9 A;  4DV1 B;  4ZHQ B;  3MHS C;  1EFR G;  3B8N A;  4CC5 A;  5KLV H;  3STZ C;  2NLJ C;  4LNU B;  4JI3 B;  1Y76 B;  5IJ9 A;  3WG7 B;  4D7S A;  1WNS A;  3K3W A;  2DMX A;  1YTF D;  5CB4 B;  3QTC A;  4YIO A;  1NH2 B;  2UXC B;  4PA3 A;  4UVA A;  4WFG A;  1ZUQ A;  1XL4 A;  5B3S B;  2OTL V;  3WB2 A;  4X62 B;  1VIB A;  4TT3 G;  4X8A A;  3OGI B;  1PV0 A;  3K0D A;  2EIN B;  4LP8 A;  4O4I A;  4DO2 A;  1Z2G A;  2KSD A;  3ASN B;  2VWK A;  5EC2 C;  2VQF B;  1YVW A;  4H33 A;  3ZMS A;  1I5Y A;  2DYR B;  3N2K A;  3CJH A;  1A32 A;  1M4U A;  5IJ0 A;  3T1Y B;  1QBZ A;  4MVZ A;  3B77 A;  1JA8 A;  3AK1 A;  3JAK B;  1Q90 D;  4YJ3 B;  3AG4 B;  3JAS B;  4DV5 B;  1XBL A;  4X64 O;  4JV5 O;  2ZR2 A;  3JAM N;  1AJQ A;  4AHC A;  3N2G A;  4J7K A;  4DV1 O;  2UUB B;  4I5S A;  1TVK A;  4W4K A;  2F66 C;  2BTO A;  4IHJ B;  2V1D A;  1XNR O;  2ADQ B;  2P90 A;  1GN6 A;  4JI3 O;  2C2A A;  3H01 A;  3H1K H;  3LNN A;  2XND G;  1YIT V;  2A06 H;  2UXC O;  1N36 B;  1IZ3 A;  1PL0 A;  4JAU A;  3W7U A;  2BSK A;  4MS2 A;  3ZHR A;  1PP9 H;  3U10 A;  5CA3 A;  1OCR C;  3BY6 A;  4X62 O;  1FXK B;  3OR6 C;  4LF6 B;  2M7W A;  1SA0 A;  1PD3 A;  2B9Z A;  3HR0 A;  5KUM A;  1TA8 A;  5LXT A;  4LF4 B;  4K8Z A;  4JTA B;  1WP7 A;  3CEI A;  2A7W A;  3T1Y O;  1D5A A;  2W0F C;  3U0Z A;  2EX3 A;  1OV9 A;  3D36 C;  1K34 A;  2XAJ A;  4K35 A;  5L3E A;  1W2B U;  1BQ0 A;  2BCC H;  4BWA A;  4XDK A;  3A0B Z;  4I0X A;  3J81 N;  1H2N A; 
#chains in the Genus database with same CATH homology
 1KP2 A;  1WLE A;  3ASO C;  1K33 A;  1AI4 A;  1FXV A;  1RM1 B;  4MTO A;  2HVJ C;  1PNM A;  1MAB G;  3QO7 A;  2HG5 C;  4RUF A;  1S5H C;  3CCL V;  2EIJ C;  1B6Q A;  1NQT A;  2WAM A;  1KEC A;  1E1Q G;  4JF3 A;  3CMA V;  2Q6A A;  2QE7 G;  3FB5 C;  3M99 B;  3CC2 V;  1FS0 G;  1FXH A;  5CBG A;  1OCZ B;  3LUT B;  1Q82 W;  4QJF B;  5EC1 C;  2EJR A;  2NNU A;  1WPX A;  1FXK A;  3ZMT A;  2HR3 A;  4X88 A;  1KD1 W;  2Q69 A;  5B1A B;  3HB3 B;  4Q20 A;  3CC4 V;  1VQ5 V;  2KB1 A;  1K7D A;  1GMG A;  3AG2 B;  3OW2 U;  1F4N A;  4Z1M G;  1OHH G;  4WFA V;  4PEL A;  3JD3 A;  1EZJ A;  5KUK A;  1R3J C;  1YTF B;  4CZZ A;  2Z5U A;  1NKD A;  4E2L A;  2XAS A;  4UVC A;  3K04 A;  1DF4 A;  4PDM A;  1F23 A;  3JCZ A;  2EIN C;  4J9Y B;  4JYC A;  4BAY A;  3E8H A;  1JQ0 A;  2ITD C;  3ZRX A;  4P2Z A;  4GT1 A;  3T2M A;  3W7W A;  2A79 B;  2OCC C;  3CC7 V;  4YXW G;  2JJ1 G;  1MSW D;  4ASU G;  3G71 V;  2B1G A;  2DQ0 A;  1PNL A;  4EKW A;  1GTO A;  2ITC C;  4JTC B;  4MSW C;  3FB6 C;  2ZD9 A;  4P30 A;  4X89 A;  3UM7 A;  3OUF A;  1TUE B;  3AG3 B;  3CCM V;  5EK0 A;  3X2Q B;  5KA5 A;  3SPH A;  2IJI A;  1P7B A;  1JOY A;  5IYD O;  3AG4 C;  3E35 A;  1KP3 A;  3W7S A;  5B1B C;  1QR8 A;  1S0V A;  2DYS B;  2OT5 A;  4GX5 A;  2AHY A;  3K03 A;  3RW0 A;  3RVY A;  2EZP A;  4MVR A;  4GX1 A;  1V54 C;  4U7N A;  3TK1 A;  5DN6 G;  3OEE G;  3OMI B;  2EIK C;  4FJC C;  3ZMV A;  1HWY A;  3K79 A;  4UUJ C;  5L3B A;  2ZXW C;  2WSS G;  4KFM A;  3TCU A;  4JAV A;  1NJI W;  1S72 V;  1OCO B;  2HVK C;  1OCR B;  1Y4M A;  3P30 A;  1K97 A;  2YEV B;  2YSU B;  2LP7 A;  1R3I C;  3G6E V;  3FYE B;  1VQ4 V;  2IJH A;  1IXM A;  1YJ9 V;  4QNH B;  3ABK C;  2B5U A;  2UXN A;  2JJ2 G;  2W6I G;  3OMN B;  1SES A;  4MT8 A;  3W7T A;  3CP1 A;  3CCJ V;  3SPC A;  1R6N A;  3ABL C;  1NVP B;  1SRY A;  5L3C A;  2IJJ A;  2X7R B;  2BOB C;  2Y69 C;  2X0L A;  2IW5 A;  5HFL A;  4BW5 A;  1QCE A;  2ATK C;  1JX9 A;  2Y48 A;  2P6J A;  3AG1 B;  4PA6 A;  5EBW C;  4UXN A;  4HYO A;  1V55 C;  1AI6 A;  2WLJ A;  3LSQ A;  1W0K G;  1BHB A;  3QO5 A;  1K4C C;  1AI5 A;  1OCC B;  2HKO A;  2UXX A;  1JPX A;  2IH3 C;  4J9Z B;  3I55 V;  3CPW U;  2XAF A;  3CD6 V;  2DWE C;  4N21 A;  5J9P C;  1QLE B;  3F5W C;  5IY5 C;  2X6C A;  2JEX A;  1NH2 D;  5IYB O;  1I5X A;  3E89 A;  3ASO B;  2X6B A;  1M57 C;  1YJW V;  3GB7 C;  4WFE A;  3SYC A;  4QPJ A;  4MVU A;  4RQE A;  4JTD B;  3OE7 G;  3ETG A;  3T1C A;  4PDR A;  2EIJ B;  5H6Q A;  3VBB A;  2EIL C;  2EZO A;  4DXW A;  4UVB A;  3ABM C;  1M56 C;  3B8M A;  3OR7 C;  5DM6 V;  1QLN A;  1JCH A;  4PDL A;  4N23 A;  1RM1 C;  1KKD A;  3NXS A;  1NR7 A;  1CPY A;  3WG7 C;  1MOF A;  5HFM A;  2XAG A;  1Q86 W;  2R9I A;  3P32 A;  1J95 A;  5C93 A;  1K5Q A;  5CBF A;  2QM8 A;  3CCU V;  1BHA A;  3IC7 A;  3ZRW A;  4WCE V;  4PDV A;  2YEV A;  3FYI B;  2WLI B;  3T4Z A;  2QTO A;  1OCZ C;  1ORQ C;  4CBC A;  1JVM A;  4GCZ A;  2IJK A;  5B3S C;  3E8F A;  5GW7 A;  4MVM A;  1VQL V;  3WFV A;  4RO2 A;  2DW4 A;  3W7X A;  4WF9 V;  2EBO A;  1SZT A;  2QA4 V;  2HLD G;  1M9N A;  3CYO A;  1H8E G;  3ABU A;  3ETD A;  1E1R G;  1DTO A;  5CBH A;  4GX2 A;  3ASN C;  1YI2 V;  1P4R A;  4JYB A;  5LGU A;  2WLN A;  3ZJZ A;  3OUS A;  2D3O W;  2DYR C;  5EBL C;  3CCV V;  3A0R A;  3CCQ V;  3DTU B;  4G27 B;  2JK5 C;  3G4S V;  3D36 A;  2HFE C;  1S76 D;  1R6K A;  3OEH G;  5KA6 A;  2F43 G;  2OCC B;  2WLM A;  4UV9 A;  3QNE A;  4G28 B;  3ZMU A;  1H8H G;  1VQO V;  2PI4 A;  3RBZ A;  3SYQ A;  1GM9 A;  4PA7 A;  1AI7 A;  3QO8 A;  5FL7 G;  1H38 A;  2Q68 A;  4R7C A;  5LGT A;  1ENV A;  3F7Y C;  4XDL A;  1VQ6 V;  3SPG A;  2R9R B;  1R3K C;  2FTK A;  3CCS V;  1Q7Y W;  2XAQ A;  1VQN V;  4LC1 A;  5EBM C;  5CMU A;  2IU0 A;  5L3D A;  3OM3 B;  4MTX A;  4XDJ A;  2ZR3 A;  4G2K A;  1GKF A;  2JIZ G;  3VOU A;  3K0G A;  1KC8 W;  3MHH C;  4P9P A;  1E79 G;  3OAA G;  1M1K W;  5LHG A;  5H9C A;  1VQ7 V;  2ZXW B;  1GM8 A;  2CK3 G;  3ZRW B;  4RQF A;  1BL8 A;  4UV8 A;  1M90 W;  3OGC C;  1SET A;  4HZ3 A;  5LHH A;  3OFN G;  2DWD C;  3ZCC A;  1BMF G;  1CP9 A;  3ABK B;  4FK5 C;  5B1O A;  2WLI A;  4FIP C;  1FXK C;  2WWW A;  3K06 A;  4R6Z A;  3D3I A;  3BEH A;  3LDD A;  2QM7 A;  2BOC C;  4QPK A;  4MTF A;  3JD4 A;  2GSM B;  2ZDI C;  3ZMZ A;  2WLH A;  3SPJ A;  4KP4 A;  3UKM A;  1NR1 A;  2EIM B;  2Y69 B;  4QE9 A;  3LNM B;  2V7Q G;  2P67 A;  3ZIA G;  4MW8 A;  3E2E A;  1G4Y B;  1NBM G;  3CCE V;  1V55 B;  3E83 A;  2LFS A;  1SER A;  2DQ3 A;  4TWK A;  2W6J G;  3CME V;  3E8G A;  3FB8 C;  3I56 V;  1VQ8 V;  4L87 A;  3R65 A;  2XAH A;  4WFH A;  2QEX V;  5IDJ A;  2X6A A;  1YJN V;  2XOK G;  2QKS A;  3ETE A;  1M57 B;  2B1I A;  4WFF A;  5LGN A;  1GK9 A;  5E1A C;  3GWO A;  3CCR V;  4ZKI A;  4JPR A;  1VQP V;  1Y66 A;  1FFT B;  1QR9 A;  1CEZ A;  1EBO A;  5L3F A;  1QVF U;  2EIL B;  5IYC O;  3ABM B;  1M56 B;  3MHS C;  1EFR G;  3B8N A;  3CXC U;  3EHB B;  3STZ C;  5LHI A;  2NLJ C;  3K08 A;  3PJS K;  3WG7 B;  2Q67 A;  1YHQ V;  1N8R W;  3K3W A;  1VQ9 V;  4KUM A;  3ZN1 A;  3RVZ A;  1DLB A;  5LBQ A;  1YTF D;  1UJW B;  3E8B A;  1NH2 B;  4MTG A;  2Z3Y A;  3SYA A;  1OZ0 A;  1PNK A;  4PA3 A;  4UVA A;  4PA9 A;  1K5S A;  4WFG A;  5B1N A;  4BIU A;  1JJ2 U;  2ZQM A;  4GX0 A;  4TSF G;  1XL4 A;  2A0L A;  3STL C;  1YSC A;  5B3S B;  2OTL V;  2IH1 C;  3SYP A;  3JD2 A;  4TT3 G;  4X8A A;  2WLK A;  2LFR A;  5BZB A;  2WLL B;  1S77 D;  5B1A C;  1QVG U;  3K0D A;  2WPD G;  2EIN B;  3AG2 C;  4LP8 A;  4DO2 A;  1K3E A;  4H37 A;  3ASN B;  4JAS A;  4LCU C;  1GO3 F;  5EC2 C;  2ZDI A;  2PI5 A;  4H33 A;  3ZMS A;  1I5Y A;  2DYR B;  1KQS U;  5CN0 A;  5H6R A;  1QBZ A;  1R73 A;  1K4D C;  3SJQ C;  4LBE C;  4PA4 A;  4MVZ A;  3ABT A;  3LDC A;  3ZN0 A;  3B77 A;  4U7O A;  4WFB V;  1S3J A;  2HJF C;  2A9H A;  4OXS A;  3SPI A;  3AG4 B;  1THZ A;  1AJP A;  1L1F A;  1AJN A;  2ZR2 A;  3FB7 C;  2K1E A;  5B1B B;  1AJQ A;  3ZRS A;  4F4L A;  3F7V C;  1DF5 A;  3AG3 C;  3EFF K;  3FKS G;  3E86 A;  3X2Q C;  1V54 B;  2JEU A;  3JD0 A;  1YIJ V;  4I5S A;  3JD1 A;  4R8C A;  1K8A W;  2EIK B;  3DGE A;  2V1D A;  2P90 A;  3HPL C;  2C2A A;  4MVS A;  2OTJ V;  2DYS C;  3H01 A;  3K9A A;  2XND G;  1YIT V;  4FMT A;  1MG1 A;  1K9M W;  3LDE A;  3ZRV A;  4RAI A;  4MVO A;  1NVP D;  1PL0 A;  3KG2 A;  4JAU A;  5L3G A;  3W7U A;  1GM7 A;  1XL6 A;  1ZWI C;  4RUE A;  1VQM V;  4MS2 A;  1LNQ A;  1H2G A;  1OCO C;  2AHZ A;  5CA3 A;  1OCR C;  3BY6 A;  3TET A;  1F51 A;  3MD0 A;  1FXK B;  3OMA B;  3OR6 C;  2MK3 A;  2M7W A;  3ABL B;  1RPR A;  1R3L C;  4XBF A;  1PD3 A;  2P7T C;  1W0J G;  1COW G;  5KUM A;  1ROP A;  2WLL A;  1F4M A;  4R50 A;  4JTA B;  3AEI A;  4BIZ A;  3IGA C;  3ML0 A;  4I9W A;  2W0F C;  4ZBM A;  1AR1 B;  1PKX A;  4QE7 A;  3LSS A;  3SYO A;  4P9O A;  1K34 A;  2EIM C;  1G8M A;  4MW3 A;  5IY5 B;  1ARO P;  2XAJ A;  3AG1 C;  4QIW F;  5L3E A;  2JDI G;  1K73 W;  1W2B U;  2H8P C;  4FPP A;  1K92 A;  1VQK V;  2IU3 A;  3T4D A;  4XDK A;  1OCC C;  1RPO A;  4HAM A;  4MVQ A;  3JYC A;  2H94 A;  4JGS A;  1QLE C;  1Q81 W;  3IFX A;  2GHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...