1RPWA

Crystal structure of the multidrug binding protein qacr bound to the diamidine hexamidine
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator qacR
publication title Crystal structures of QacR-diamidine complexes reveal additional multidrug-binding modes and a novel mechanism of drug charge neutralization.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 63
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rpwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1rpwA02
3OIOA 3TW6A 2IAIA 2LY9A 3NNRA 3COLA 3B6AA 3M4OJ 3BQZA 2VKEA 4MO7A 4L5EA 4DYQA 1JUPA 1MBEA 2DA4A 3H0GJ 4J19A 1IG7A 3F0CA 1TWAJ 3S1NJ 2ECCA 3HOWJ 4IHXA 1S7EA 1IRZA 4MXMA 1X58A 3GTGJ 3DPJA 1MBHA 5IP9J 3S2DJ 5J1UA 3BR1A 4JL3A 2L9RA 1SFOJ 3S1MJ 4A3EJ 1ZR2A 2K9SA 2XRLA 4W97A 3LWJA 3SJMA 2YU9J 1IJWC 3CDLA 1VF9A 1H88C 2W53A 1ETXA 3LNQA 3PASA 3HGYA 2OPTA 3T6NA 5HAWA 2K9QA 2R92J 4RDUA 4A3GJ 3G7RA 4A3MJ 2E19A 2LVSA 1WGXA 3IH3A 2MW8A 5FKNA 1ZKGA 1RESA 4M3DA 4V2GA 4A3JJ 2ZCNA 4GCKA 3LOCA 1K61A 1QRYA 3UKGA 2R7ZJ 3GBGA 1GV2A 4ME9A 3PM1A 2M9HA 2AO9A 4FTHA 2UXOA 4AC0A 1VFCA 4IHVA 5FKMA 5K7FA 3QPSA 1LFUP 5D19A 1WH7A 1O4XA 1SANA 3DCFA 1QVUA 5E3NA 2E1OA 3GTKJ 4A3FJ 2B63J 1E3OC 2XPWA 1MBJA 2WV1A 3VUQA 1A6IA 4NDLA 5C4YA 5E3MA 2TCTA 2M2EA 2IBDA 1DU0A 3G1MA 2JA5J 4UUSB 1BA5A 5FKOA 2EH3A 1JGGA 3HOZJ 9ANTA 5IP6A 5HBUA 3G56A 3JSJA 3VPRA 4QTRA 3Q0WA 3LSPA 4FCYA 1K83J 3Q0VA 4CYCB 4JX4A 3KNWA 3FK7A 4XIDA 3ZOBA 4B3AA 2X6OA 4PXIA 1AHDP 3FK6A 2NP3A 1YRNB 2N8GA 1EF4A 2PBXA 3K2AA 1B8IB 4BKXA 1I50J 4S0HB 3HIMA 4MK6A 2HI3A 1MSEC 1U9OA 3JRHA 1GDTA 4M3FA 5K58A 3LSJA 4XK4A 3ZQCA 2MG4A 4X1EA 2JWTA 3O60A 4AF5A 4QSHA 1IDZA 4JX5A 4M3BA 2GENA 2ZCXA 3O8HA 5EGOA 2XDNA 3NRGA 3HTAA 4FE7A 2DA2A 5BNGA 1JJ8C 1AU7A 1G2HA 4AYBN 2K9NA 1SGMA 1RR7A 5FLMJ 3GEUA 4BY7J 5EYRA 4GCTA 1FIAA 4YZEA 2DG7A 4DYCA 1ETQA 4Y52J 5DAJA 1ETOA 3CWRA 2ZB9A 2DMQA 3BG5A 4D5CA 1P7IA 2E2HJ 4I76A 5EGOB 4B4CA 5GPCA 1JTYA 3MNLA 2ME0A 3NAUA 5M3FJ 2UXIA 3Q0UA 4B1RA 2REKA 2DN0A 3OSGA 3A01A 4JKZA 3HOYJ 3Q3SA 3BTCA 2DMUA 4C3JJ 1ETVA 3VVZA 3VP5A 3IV5A 2LKXA 4M3GA 2Y30A 2CRGA 1OCTC 1UI5A 4JX6A 5E3LA 3RD3A 3C07A 3VIBA 2OERA 3S16J 4NN1A 3FISA 5EG0B 3A01B 1MBFA 2JJ7A 1Z77A 2ZOYA 5H9TA 3LHQA 2NVYJ 5CXGA 1W0TA 5F1JA 1HDDC 1NK2P 2WGBA 2NS7A 1NK3P 3I4MJ 3JRIA 3HEFA 3ZQFA 1JTXA 4L62A 1X2MA 2JMWA 3TP0A 3MVPA 2YUSA 4DZJA 2WUIA 2G7SA 4FISA 1JT0A 1QPIA 4XRSG 5J1RA 3HTIA 2FBQA 3O8GA 3IUVA 1ITYA 2EBIA 1HDPA 2FJ1A 2EZLA 4M6VA 3S1QJ 2MSYA 3K7AJ 3RZOJ 3ANPA 3JRBA 5F04A 1FTTA 1X2NA 3AQTA 2O7TA 1GT0C 1WCMJ 3W6VA 2DA7A 3RH2A 5D1RA 2K40A 3BNIA 1HF0A 2M34A 1TC3C 1FTZA 1MBKA 1Q1VA 2ZCMA 3VOKA 3HM5A 2HQ5A 1Y1WJ 2OF7A 3PO2J 2JK3A 5IYCJ 2ID3A 4KWAA 1GV5A 3D1NI 4UUSA 3G1LA 2DMTA 2XGDA 2VKVA 3G1OA 2LK2A 4I6ZA 2FQ4A 1TWFJ 2VPRA 4MLOA 4CYCA 5IOYA 1BJZA 3KKDA 1TWGJ 2XSDC 2R5ZB 2HOSA 1JT6A 3OOUA 1MSFC 2O8KA 3GTMJ 2UXHA 1YRNA 2D6YA 5HODA 2ME6A 4BY1J 3GTOJ 1U78A 1B8IA 3HTJA 2EZIA 3ON4A 3JRDA 5K7ZA 3M3YJ 1I3QJ 4A3LJ 2HDDA 4C2MJ 2Y31A 3BJBA 5C4XJ 2P81A 2NP5A 3VOXA 2QCOA 4RBOA 1XC5A 1WH5A 1HLVA 3HB9A 3EUPA 2W48A 5J1YA 4A3KJ 3ZQLA 2V57A 1H8AC 1APLC 3RQIA 3HKZN 1UHSA 4GFLA 2CJJA 1H89C 3IH4A 2R5YB 2QTQA 3PPBA 2GFNA 2YVHA 1LE8A 2HYJA 4A69C 4Y7NJ 3RKQA 1ETWA 2YVEA 2ZOZA 1ORKA 1JJ6C 4M3EA 4JNNA 3BG3A 2O7OA 3NARA 4JYKA 4GFKA 3CJDA 3BTJA 1GVDA 2HKUA 5EZGA 2DMPA 3QQAA 5EZHA 2EZKA 1ZR4A 2UXUA 4UUTA 4XRSA 1IUFA 3VW2A 4LOCA 3ZQGA 2D5VA 3B6CA 1LE8B 1UMQA 5EDNA 2JA7J 3BCGA 2NVXJ 4AC6A 4W1UA 2CUEA 3S14J 2NVQJ 3GTQJ 1I6HJ 3KKCA 2ECBA 5IOZA 1RPWA 2YS9A 2QF7A 2QOPA 3MN2A 4BBSJ 3JRAA 3RZDJ 4ABZA 1T33A 5EG0A 1FEXA 1W0UA 2CQXA 2JN6A 5J3LA 3E7LA 4HKUA 2E2IJ 3BTLA 2DA1A 3GTLJ 2NX4A 5M5XJ 4DYRA 3QBMA 2Y2ZA 1MNMC 2M8GX 4D7NA 2EZHA 1OFCX 1RETA 2XPVA 3MKLA 5IPAA 3ZQHA 1PUFA 3HOVJ 1OCPA 2LTPA 3FKIJ 3H3VK 2Y0SN 5F0FA 3S5RA 5JLWA 3NXCA 4DW6A 1BW6A 2RHAA 2DJNA 1RKTA 3BR0A 1XS9A 5CXIA 2G7GA 1ZQ3P 3JR9A 1AKHA 3S17J 3BT9A 3BRUA 3JREA 4A3IJ 1PUFB 2HOTA 2DA3A 1IV6A 3CRJA 2L7FP 5CW8A 5IYDJ 1JKRC 2CUFA 2TRTA 2DA6A 3GTJJ 2QKOA 2L7ZA 3HGGA 5FMPA 4IHWA 1DU6A 3VVYA 1XG1A 1Y1VJ 1ZTRA 5GPAA 1AKHB 2DG8A 2LR8A 2UXPA 5M5YJ 5FGLA 2CU7A 3SFIA 1IGNA 2WB1N 3WHCA 2VUMJ 3OSFA 5M5WJ 3S1RJ 4AUXA 3S2HJ 3LSGA 3IH2A 2G3BA 1B72A 2EQRA 2R5ZA 4UDSA 2HOAA 2ELKA 3GTPJ 5HSZA 2PZ9A 3BTIA 3L1PA 3F1BA 1F36A 3BR6A 2I10A 3ZQIA 2R0QC 3E7QA 2KT0A 3V6GA 2GM4A 5JLXA 5C4JJ 1F43A 2CQQA 2XGEA 3SDGA 3FRQA 1U9NA 5F08A 5IYBJ 4BBRJ 3JRFA 4MFDA 3LSRA 1HOMA 1JKPC 3HBLA 3NI7A 4G12A 1B72B 3VVXA 4D5FA 3QKXA 3HOUJ 3BR3A 1ZK8A 2GLOA 2NVTJ 1IDYA 2XGCA 4C3IJ 4A3CJ 3HTHA 1HCRA 2JA6J 4V2FA 2VI6A 4XRMA 2GBYA 1CQTA 1TWCJ 1JKOC 3QPLA 4FE4A 2DMNA 2R5YA 2F07A 3P9TA 3FIWA 4ACIA 5FKKA 3AQSA 2X48A 1BW5A 5EFYA 5C3EJ 3S15J 2Y9YA 1U8BA 3ON2A 4A3DJ 5EEAA 5D18A 4C3HJ 2GUHA 4NELA 1ETKA 5DTDA 2OI8A 3GZIA 5FHPA 2ID6A 3WHBA 3JRGA 3HDDA 2LD5A 2XB0X 1LFBA 3EGQA 4X6AJ 4EEFG 3V78A 2AHQA 2G0EA 3KZ9A 2FD5A 1POGA 5E3OA 5DS9A 2DA5A 3BHQA 1ZGWA 3A03A 5F0CA 2HXOA 2E2JJ 2L7MP 1FJLA 5EF6A 3HE0A 1GUUA 4GCLA 3BR2A 1TWHJ 4IEJA 2QWTA 2IEKA 1UG2A 4ICHA 1BL0A 4QIWN 1WI3A 2IU5A 1NTCA 4MFEA 1WPKA 3TEDA 4D7MA 1RKWA 3PO3J 1A5JA 5FJ8J 5AQCA 2LLKA 1QVTA 5IP7J 4GFBA 2M0CA 2NOGA 5GP9A 1MH4A 3JRCA 1IC8A 3VW0A 2G7LA 2FX0A 5K7HA 3HOXJ 4HNVA 5FLVA 1MH3A 3BR5A 1JKQC 1JUSA 2WAQN 4A93J 1VNDA 5M3MJ 2H8RA 2HYTA 5FKLA 5C44J 2Q24A 2O9LA 2Y9ZA 4IHYA 3A02A 1T56A 1ENHA 1R9TJ 3B81A 4DZPA 2LFBA 3DEWA 1JUMA 1FIPA 2PMZN 3CCYA 2QIBA 5F27A 2JA8J 1D5YA 2H1KA 4JP0A 2XPUA 3C2BA 2R93J 3LJLA 2RASA 3NPIA 2HXIA 1MBGA 2LP0A 2MGQA 4XICA 4CGRA 2DTZA 1P7JA 2COBA 2L0KA 1UI6A 1ETYA 3BG9A 3CQZJ 3TW7A 3TP3A 5F0HA 4A3BJ 3VW1A 3I4NJ 1Z0XA 1VI0A 2X9DA 2KDZA 1OJLA 4BXXJ 3BQYA 2RAEA 4MIMA 3ANGA 2NS8A 2XB5A 3CMYA
chains in the Genus database with same CATH superfamily
4YFKF 5CVVA 2X1DA 4BXUA 1ZELA 2IAIA 2LY9A 3NNRA 1K79A 3B6AA 3B73A 3BQZA 4MO7A 1QPMA 1MBEA 1W7PA 5E1WA 3TL4X 3H0GJ 3F0CA 2VLAA 1MNDA 4U0VA 2R7WA 1O3TA 2IT0A 1U5TB 2DFEA 3ZR8X 4E7ZA 2F5DA 5BOXA 2L02A 3H5RA 3GFLA 2A07F 2WV0A 1MBHA 3GUDA 5IP9J 4XSXF 2OJED 3BR1A 3P5JA 1I39A 1TW3A 3EETA 1SVMA 1M1EB 3I58A 4YIIA 2VL8A 2XRLA 4W97A 3X2QH 4AIHA 4ZZDA 2FU4A 1YHQI 2YU9J 3CDLA 2L01A 4ZH4F 2B1EA 3HSFA 1VF9A 5FFZA 4XLPF 3KYLA 2W53A 3EUHC 3SFZA 3T6NA 5HAWA 4HX8A 2V9PA 2K9QA 2M7BA 3ZXSA 2EIJH 1R71A 4OD5A 2E19A 3FXQA 3IH3A 2ZNZA 5L3DA 5E79C 3CCMI 1WVRA 4A3JJ 1PP8F 2PEXA 3ZP5A 4YELA 4KMUX 3LOCA 3DWLE 4IJAA 1K61A 1MKMA 1R7JA 3GBGA 1GV2A 1MMAA 5B66C 1V5FA 2A05A 2M9HA 4MQ9F 3ASNH 1VFCA 4L9JA 2QA4I 4XNFA 3QPSA 3WU1B 4XLFA 2LH9A 3VYRB 5H6QA 1R4NB 4A5MA 5E3NA 1Z6TA 3FXLA 1Y0NA 3ABMH 1VQPI 2OBPA 3QYFA 4UV8A 5AIPA 3VB2A 3RIRA 4LG3A 4R79A 2WV1A 2VE8A 4LK0F 2ISZA 3L9FA 5TGTA 1DU0A 1RR8C 1YQAA 2Q0OA 1VQNI 5FKOA 2ZBKA 2EH3A 1PJRA 3HOZJ 2IS6A 1ON1A 2H09A 4BXFA 3J7YJ 3VPRA 2CW7A 3LSPA 4FCYA 4CYCB 1DP7P 3FK7A 4XIDA 3F6OA 4PXIA 2JA2A 3FK6A 1YRNB 3FKJA 1EF4A 3K4NA 2PBXA 5CPRB 4BKXA 1I50J 5DD8A 3TO7A 2HI3A 1FOWA 3CJRB 2DYSH 3U21A 1OYYA 2ACJA 1U9OA 2STTA 2OCCH 1QZZA 2CW8A 3PNVA 3JRHA 1T2KA 1FOKA 4XK4A 3PJRA 2CO5A 2NYXA 2KKOA 5FD6A 1J9IA 2JSPA 5LGNA 4U9LA 4EGYA 4AF5A 2BOLA 1IDZA 2KMUA 2G9WA 1RUNA 5LEKA 1OCZH 2XDNA 2FNPA 2VONA 3OYEA 2BW3A 5BNGA 3CCVI 2OZUA 1G2HA 4KISA 4BY7J 2DYRH 2KDOA 5ED4A 4GCTA 4YZEA 2H1LA 1PVEA 1ETQA 2LG4A 4UHTA 1YJWI 2DG7A 4U7BA 4PFPA 2DMQA 3BOQA 5L3GA 2F5FA 3ONQA 3RKXA 4I76A 4OU0A 5GPCA 5EGOB 3AKZA 3ZMTA 2ZCWA 3HUGB 5B5EC 4AIKA 2REKA 3FMQA 1SD7A 2IGOA 5LRRA 3I5UA 3CUQA 3Q3SA 5GAEJ 4KICA 2EFOA 1YJNI 1GLNA 4EATA 2BEOA 4M74A 5BPDA 3VP5A 2GOMA 2X1CA 3J80Z 2Y30A 4RAGA 1I3AA 1OCTC 1UI5A 1YE9A 2WB1A 5D8LB 4JX6A 2QQ8A 5DYMA 3F23A 3F8BA 3DBRB 2ZNYA 2H6BA 3OIPA 4PCQA 1R5HA 2ZMEB 4G7HF 5LFAA 3S16J 1Z77A 4KT5C 2NVYJ 2JPBA 2EFPA 1E0EA 2DBBA 4FT8A 1Y0UA 3I56I 3F6VA 4BS9A 2JMWA 3FXRA 3TP0A 3VYTB 1KQ0A 5ICGA 4B47A 1XSXA 2HS5A 4HW0A 4WXDA 4XRSG 1BR4A 1OPCA 1LDKB 1ITYA 1TNTA 2DOAA 4BNCA 4CHUA 1XN7A 1A31A 3JRBA 1TQPA 2Y0MA 1FTTA 2O7TA 1K6YA 1GT0C 2EA4A 1W5TA 3W6VA 3IP4B 4HV6A 4RM2A 2YVXA 1Y39A 3RH2A 3BNIA 1HF0A 1O3RA 4HV5A 1Q1VA 4PFOA 1R22A 2ZCMA 1B4AA 5K5RA 4CSWA 1TZLA 2O0YA 2JK3A 3I71A 5IYCJ 1DQUA 1LJ9A 3G1LA 4OIRF 2DMTA 2LSOA 1NG7A 1PYVA 2LK2A 2K27A 2FNAA 4G9YA 2F5VA 3W2AA 2K86A 3SHFA 2IGKA 5FD5A 2HOSA 3FXMA 3GTMJ 1TW2A 2DCEA 1J59A 1T08B 2ME6A 2P7VB 3HTJA 1B8IA 3WTSC 2BBYA 3OL4A 3ON4A 3KLOA 4PJNA 5K7ZA 4OIOF 3HC7A 1I3QJ 2PFVA 1ZREA 4C2MJ 3BJBA 2P81A 3K1PA 2Z16A 1BR1A 4IOAF 3VOXA 1HC8A 1QO0D 2KJCA 2QCOA 3OYFA 3CCUI 4BQNA 1WH5A 2PG4A 3HB9A 2JT1A 4IZZA 1HKQA 2DFHA 3V7CA 5J1YA 4ZYGA 2IW5A 3BCAA 3ECHA 2MFZA 3ABKH 1A35A 1I6XA 1WWXA 3E3VA 3GW2A 1UHSA 3RKWA 2R5YB 3A4CA 3CCJI 1U2WA 2V79A 1FP1D 2GZWA 4IKFA 1HKTA 1KQ9A 1SD5A 4Y7NJ 2YVEA 1SAXA 4HNTA 3CO7C 4EJWA 1PP7U 4KUMA 2UXNA 3BG3A 4JYKA 4GFKA 1VQ5I 1E3HA 1DDNA 1H9TA 3CJDA 1QBJA 2CFOA 1GVDA 5EZGA 3REOA 2EZKA 1ZR4A 1K4TA 2QYOA 3KETA 4BDZA 3ZQGA 2ZXJA 1T6SA 1UMQA 1BN5A 2IJLA 4D0PA 1XGMA 2XHKA 3S14J 1I6HJ 3KKCA 4QLCU 3C3WA 5TJJA 2XGXA 3E6DA 3ESWB 2RNGA 3JRAA 4ABZA 3DLAA 3OYNA 2LC2A 4HKUA 3BTLA 3WE3A 4NUBA 4DYRA 3OS1A 2Y2ZA 2WC2A 4AU7A 2M8GX 2KRFA 2HKXA 4Q47A 2EIKH 1PUFA 2R7OA 2DTRA 2EJRA 3DP7A 4AVZA 5K5QA 3N4MA 2LTPA 5KAIC 5FRMA 2Y0SN 2CQKA 4RGRA 2VXZA 3S5RA 1SVOA 3CMAI 2DJNA 2DW4A 4L9VA 2D1VA 4ASNA 2HEOA 3W3CA 3HJEA 1DPUA 4CCJA 2CFXA 1AKHA 3S17J 4Q5SF 3TOAA 3JREA 4II3A 4A3IJ 5CVUA 4HEA2 2ZO4A 2NVUB 1JKRC 2QKOA 4PGHA 2TDXA 3GTJJ 3HGGA 4JQFA 3DKXA 1B9MA 2AS5F 1H9GA 2VQGA 4KIGA 2MLGA 2FEZA 1OCCH 5GPAA 4NBQA 2M1BA 2VOOA 3KZYA 2HVSA 1W5SA 3WHCA 2VUMJ 3OSFA 2F6CA 4Y4RA 1HA8A 4GXOA 3LSGA 3IH2A 3VFZA 4YG2F 4P1WA 3CUQC 1SC7A 2R5ZA 1D0XA 2LMDA 2KIFA 2QSHX 5HSZA 5GADJ 4XL9A 3L1PA 2QLZA 3BZ6A 1FOYA 2CUJA 3BR6A 4ESBA 2E5NA 2ZY9A 2B7EA 4KN7X 2R7DA 3K1MA 4L5IA 4MEXF 4P9UA 1JHHA 3SDGA 2DFIA 3DFGA 1R5GA 1U9NA 3LSKA 3JW4A 1G3YA 4IF4A 5IYBJ 4BBRJ 2M4KA 3MKWB 1BI0A 2KL4A 4XBFA 3HBLA 4G12A 4U0WA 4D5FA 4BL0B 2NVTJ 2R7VA 1YX3A 2VC1A 4E7JA 1X1BA 2OTLI 1MNEA 1Z9CA 3I55I 2ZXWH 2FXAA 4LB5A 3G6EI 1TWCJ 3SDBA 2QQBA 2KIUA 3BROA 2P5KA 2OC6A 2MA3A 2F07A 3E1SA 1WRJA 3SEQA 2K02A 2V6EA 1LPQA 2X48A 2X6XA 5EFYA 4B8XA 3S15J 5D18A 2XSJC 4NELA 3M8JA 1MIJA 3GZIA 2ID6A 2LD5A 2XB0X 2LBFB 4B43A 3EGQA 4GGGA 3QYEA 4OINF 4A0ZA 1VQKI 2DT7B 1F4KA 1A6QA 3CJNA 4ENKA 4OIPF 5GAHJ 3KZ9A 5E3OA 3FHNA 1VQ8I 2CWEA 2PMZA 1ZGWA 3A03A 4ZYDA 4BUPA 1ZARA 2L7MP 1HQCA 4LK1F 4B48A 1FJLA 3T5XA 4ZDOA 3BR2A 3H5AA 1TWHJ 4IEJA 2QWTA 3MCZA 1FMWA 1IF1A 4ICHA 1TLHB 4A6DA 2IU5A 3K69A 3KZIC 1A5JA 3LSIA 4I0AA 2E1MB 2LLKA 2BY0A 3WTVC 3RYRA 5IP7J 3WTWC 1XTAA 3M7GA 2KIMA 2RGVA 1VQ9I 3VW0A 1IC8A 2G7LA 2FX0A 3MWMA 1ZLJA 2CV2A 4QPOA 1MH3A 3BR5A 1VNDA 2QWWA 3LFKA 2HYTA 4LITA 4XR6A 2O61A 2CS3A 2O9LA 4ZYHA 1SFUA 4V19K 1EJ9A 3CCRI 3A02A 2HZDA 3H3UA 4II2A 3K8PC 1ENHA 2CV1A 1X3ZB 2XRNA 3HSEA 3DEWA 4LIUA 3IC7A 5GTIC 2H6CA 4G7ZF 3HG9A 4F52A 1NH3A 5F27A 1ZRCA 2H1KA 4IL6C 3FBNB 2OA4A 2WBMA 4BHCA 2GA1A 1YTYA 4CGRA 1Z6RA 2L0KA 2OUMA 4BYYA 4HF0A 5ILUA 3BG9A 2DOEA 1D0ZA 4F92B 1K4SA 1VI0A 5AONA 2KDZA 3QOEA 3Q9VA 4CUGA 3ANGA 3ELKA 3KEOA 1SFKA 2VN2A 4RGSA 4HQMA 3E6CC 3KIOA 2P4WA 2RVCA 1P4WA 3KZZA 3L2UA 4DYQA 3OYKA 2VXDA 2K4JA 4J19A 1G4DA 3OYHA 4JBAA 2Q8KA 4IHXA 5DUIA 1IUYA 2W1OA 3PUFA 4HX7A 3MKYB 3F72A 3I59A 3S2DJ 1TL8A 2L9RA 1V4RA 4B44A 2LF8A 1ZR2A 2LOOA 1R36A 1D3YA 3G4SI 2YPRA 3F8FA 5J4VA 1G3TA 1ETXA 3LNQA 2BY2A 1L0OC 2WTEA 4C2TA 2VOPA 1EH6A 5LHIA 2ADUA 2LVSA 1ZKGA 5J40A 2A5WA 2Q2EB 2R4GA 2QQAA 3SZTA 2K3PA 3SEZA 5F1RA 4BE1A 4IX7A 3R6SA 3AL0C 2MH2A 4Y17A 2V4JC 1W5CC 2R7ZJ 3UKGA 3PM1A 2QQ9A 3ZRGA 4ITVA 2MD0A 3HYIA 3UR3C 1IXCA 5J8FA 1WH7A 5JVGF 1YITI 3HHHA 4A0YA 1Z3YA 4Q48A 1S5LC 3OR2C 3VYUB 1HSJA 2E1OA 3S2WA 1I27A 3GFJA 2B63J 1BI3A 3F8NA 3S3OA 1DGWY 2PJRB 3VTIA 2M2EA 1DPRA 3G1MA 3GZ5A 3NS4A 2OAZA 4UUSB 4H0EA 1REPC 3BZKA 2MABA 4N9IA 3VWBA 2PN6A 1QHGA 3G56A 3JTGA 5HBUA 5KK1A 2D1HA 2RDPA 1KA8A 1K83J 3KNWA 1W36C 2L9SA 3V8JA 2RQPA 1IXSB 4B3AA 4L0ZB 1AHDP 4JOMA 1VQ7I 1J5YA 2X1EA 3HOTA 3BDDA 2LKSA 1MDMB 1YFHA 1ZG1A 4DVYP 1V54H 1MSEC 3VYSB 3HXLA 3OV8A 2Z33A 2W57A 4ESJA 1GDTA 1IRFA 4HAMA 5ICCA 2K85A 1ZGAA 4RAZA 4O3MA 3ZQCA 2EPFA 3VSLA 2W24A 4X1EA 4HG2A 3R60A 2JWTA 4C2MA 4NC6A 3O60A 3OS0A 1OR7C 4QWQA 3MZ8A 2GENA 2VJ5A 2WY8Q 1BIAA 3PL8A 3O8HA 4CCMA 5EGOA 5L3CA 2B9SA 1E2XA 2GWRA 1ZRFA 2JQ7A 3NRGA 2KFDA 3HTAA 2BVMA 4FE7A 1AU7A 3CP8A 2LF7A 1ZH5A 2K9NA 4HOBA 3GEUA 3H35A 5EYRA 3ZCOA 2L5QA 4DYCA 3AG1H 5DAJA 2VJ4A 2KJBA 2KLOA 2ZB9A 3I4PA 1P9QC 1F9NA 1Z3XA 5DM7F 4HDUA 2QBYA 2EV5A 1LDDA 2E2HJ 3E5UA 2YX4A 4B4CA 2ME0A 3NAUA 5J4YA 2UXIA 4B1RA 1K6OA 3VOEA 5FLXK 2OQGA 2MYSA 3WODF 2XROA 3OSGA 4BE0A 3H92A 4RB3C 2DDBA 3GFIA 2EB7A 3IV5A 4E6KG 1FZPB 1R5ID 2KIQA 1MZBA 1TQIA 3HPGA 2ZJ2A 2OERA 1VQ4I 4NN1A 4D1QA 3FISA 5EG0B 2JJ7A 2ZJPF 5DM6F 3ZGKA 5CXGA 3DU6A 4N9HA 1HDDC 1NK2P 1FBUA 3DEEA 2O5RA 4IRVA 2A6HF 1ULYA 3HOSA 4GYIA 3U9GA 4DOZA 1D5VA 1X2MA 4DZJA 5AIQA 5A2QK 4F91B 5J1RA 4LG0A 3IUVA 3QPHA 2EBIA 2FJ1A 4UNOA 2EZLA 3LQQA 3S1QJ 3RCOA 2MSYA 3K7AJ 3RZOJ 1FYKA 4KITB 3Q5FA 1ON2A 1WCMJ 2DA7A 1YYVA 5D1RA 2K40A 5IT9Z 2O03A 3PUBA 4MEYF 4BEHB 2P5LC 1FTZA 4CCKA 3DPLC 1GXQA 3QODA 2IPQX 2FMYA 2HQRA 2E71A 3NEUA 3GLLA 2G7UA 4I01A 4EM2A 4KWAA 1G8XA 3HKZA 4E70A 2W7NA 3D1NI 3CTAA 2XGDA 3ECOA 4HYEA 3EUAA 3G1OA 1KQ8A 3BP8A 3FMRA 5FFXA 2MLKA 4KA4A 2WWYA 1TWFJ 2QSFX 1BJZA 1TWGJ 2UUZA 3M8FA 1P2FA 4XLCA 1XDUA 1JT6A 3OOUA 4RLFA 1MSFC 2HPIA 2O8KA 5FRNA 2D6YA 2F2EA 3RKYA 3T8RA 5HODA 1F5TA 3ZMZA 5LLQA 2EK5A 1EH7A 1X1AA 1LNWA 2HDDA 2QGUA 3LL7A 5BQTA 1XGNA 4KT6A 2QENA 3GVAA 4RBOA 1XC5A 1ZG3A 2PMHA 3H0DA 1CGPA 3MZHA 1C0WA 1X4PA 2WA0A 3KP6A 2V57A 2JUGA 4N4NB 1N75A 1ZYRF 3V7RA 3N97A 1WJBA 1H8AC 1MJBA 2QKLB 3PFIA 2QVOA 3TDUC 2CJJA 5D6EA 3GXOA 4IRGA 3L2RA 5JVTA 1KGSA 4F7ZA 1IO2A 2VPLA 2YVHA 3RKQA 1ETWA 2QZ8A 5CJ9A 4KYWA 3ISPA 2BZTA 4JNNA 3NARA 3O3KA 1ZG5A 1XSVA 4IVNA 1TP4A 2K9MA 1Z7LA 5DUKA 4DBQA 3WTYC 1Y8QB 1YW8A 2HQAA 2DMPA 3A0BC 3DTIA 3FBIB 3QQAA 3L2VA 1GXPA 4C30A 3IWFA 4F3QA 4LOCA 2GOXB 2YSRA 3WU0A 1LE8B 5GTHC 5EDNA 2JA7J 3K4JA 2XIGA 3DKWA 2AQEA 1D1CA 4CXFA 3L2WA 4KFCA 3OY9A 2NVQJ 3CJQB 1WJEA 4WXHA 2D45A 3F8CA 2OQRA 2DU9A 1T33A 2BY3A 1FEXA 1W0UA 2JN6A 2XAGA 2DQLA 4UB6C 5BPIA 5JI6A 2NX4A 3QBMA 2M4GA 2O6GE 3G73A 1O57A 4HA8A 2EZHA 1OFCX 1RETA 4E7IA 2XPVA 2X6WA 4PJLA 4AVPA 1OCPA 3HPHA 1MMNA 1R1UA 1P6RA 4UY8I 2DODA 2WADA 1UCRA 4AD9A 3NXCA 3FHZA 4E7KA 3HTUA 4KN4X 2XASA 2ZXIA 2Y69H 4BGDA 1WHUA 1IRGA 3E6BA 3LFUA 4CDGA 2M5WA 3TO9A 3BT9A 2F5EA 2DA3A 3I9V2 2VASA 4IHTA 2VE9A 4YFXF 1XCVA 2HDWA 2TRTA 2PI0A 2L7ZA 4XM3A 5E18F 1DU6A 3W2WA 1KU2A 3F22A 1D8KA 3IHUA 3GYHX 4DJAA 2DG8A 2LREA 4PK4A 1XMAA 4ENNA 5FGLA 3CDHA 1IGNA 2ZC2A 1OMIA 1UHWA 3AG2H 5CQEA 4CO8A 3S1RJ 1BC7C 4OAZA 2DXIA 2H94A 5EEGA 1W7PB 3GTPJ 3K10A 3QP5A 3BTIA 3CF2A 1F36A 2R0QC 4XQFA 2NNYA 3MMYB 5FROA 3E7QA 3OYDA 2A3SA 2PLYA 5C4JJ 1F43A 2ETHA 2XGEA 1U0JA 3FRQA 4PJMA 4XLEA 3JRFA 4MFDA 5D4SA 2CG4A 1QU3A 5KHDA 2ZFWA 3K1NA 4ANJA 1B72B 5F6FA 1BC8C 1MGTA 1ZK8A 3BR3A 1IDYA 4RM3A 4A3CJ 5HS7A 1BI2A 3HZJA 2NS0A 3V8KA 3CO6C 4I7HA 1FYLA 3WGHA 1CQTA 3CDIA 2R7UA 1ZHFA 3ZMUA 2VIXA 2W25A 3P9TA 2YR2A 4ACIA 4XLAA 3AQSA 5C3EJ 2IVMA 1U8BA 3ON2A 2NOJB 4C3HJ 3T8TA 5ILSA 5LBQA 5DTDA 4RGXA 2GUHA 4Y13A 1X3UA 1JI8A 1HW1A 4UVBA 4F93B 4X6AJ 4P55A 4EEFG 3FXJA 2FOKA 3LA3A 4XKVA 3V78A 2AHQA 3ZMDA 1V5EA 2FD5A 2DI3A 3OYGA 4CZZA 1SFEA 3ABLH 3LA2A 4OD4A 4UXNA 4IQJA 4HPQA 4P9FA 3CLOA 1FSHA 5FLXZ 2IEKA 1QA6A 1WI3A 2K4BA 1WPKA 2OU2A 3TEDA 2MD5A 1RKWA 4D7MA 3PO3J 2Y48A 1OISA 2R7TA 1HXDA 2EV0A 5K7HA 3HOXJ 2W84A 1ONVA 2DFFA 5M3MJ 4XKBA 5C44J 2Q24A 1R00A 3WGIA 4MHGA 2Y9ZA 2RNJA 3BY6A 5IT3A 2WAFA 1SMTA 2Z1DA 4ENJA 4ZZLA 3B81A 4DZPA 1YS6A 2LFBA 5KVRA 4L0YB 2LNBA 3M1EA 3ASOH 3OYMA 4LLLA 3IWZA 1WJDA 2PMZN 2QIBA 5A2QZ 1R23A 3OMYA 2CV0A 1FLIA 5D5XB 3GX4X 3FM3A 1D5YA 2JA8J 1K78B 2VKHA 4I0BA 2HXIA 3CD6I 2MGQA 2LP0A 3QRFF 1AOYA 3QYBA 4G7OF 4LB6B 1SFXA 4WWCA 1ETYA 2NRAC 5F0HA 2L2OA 1J2XA 3VW1A 1Z0XA 2X9DA 1RUOA 2W00A 4BHPA 2AXLA 2GXBA 2FMLA 4JL3A 2NS8A 2XB5A 3KLNA 5D4RA 3CMYA 4IRIA 1MJ9A 3TW6A 3PSIA 3COLA 3M4OJ 2VKEA 2ZFUA 1B9NA 2LY1A 4L5EA 3G71I 2DA4A 1MMSA 1ERDA 3OYAA 3CZ6A 3KP2A 3J81K 3IUOA 3CUQB 2ECCA 3T0YA 3HOWJ 1LKXA 1WKMA 3FMSA 5DCMA 3LSTA 1S7EA 5KNLA 2HTJA 3ROUA 1IRZA 2MBFA 1X58A 1AA7A 3DPJA 2FBHA 4G6QA 1ZGJA 5HVQC 3S1MJ 4A3EJ 1RNLA 3RI4A 2UXXA 1Z21A 3LWJA 5D6FA 1R1VA 1H88C 3P9CA 2BY1A 3PASA 2P0WA 3GZ6A 2M45A 2NXNB 2FBIA 1U3EM 2R92J 3RPUA 3IKTA 4A3GJ 4A3MJ 1WGXA 2YU3A 1D1BA 1W4MA 4A2UA 1YJ9I 2VODA 1Z67A 4V2GA 2ZCNA 1FBSA 2K5CA 3VSKA 3RPUD 4DNCA 3K70D 4GCKA 4EJOA 4YIRX 5D8KB 2W85A 1QRYA 4WK8F 2PJRA 1YO5C 1UELB 2AO9A 1UG0A 3CMEI 4FTHA 4AC0A 4IHVA 2Z3YA 2X85A 2J5OA 1WFXA 1O4XA 1SANA 1TBXA 3DCFA 3DU5A 1KU9A 3TKYA 5DV5A 3GTKJ 3ZQ7A 5TISC 4KIBA 2XPWA 1MBJA 1IN4A 3VUQA 4HZFA 4CICA 2IS4A 1VQOI 4XOPA 3SZPA 3M8EA 3OYLA 4IQ4A 4AYBA 2IBDA 1X1DA 2JA5J 1MDMA 1BA5A 3E6MA 1S3JA 3EYYA 9ANTA 5IP6A 2JUCA 1J75A 2KHMA 4LIVA 4RMNA 1QZYA 1S9HA 2JZYA 4ZC3A 3Q0WA 4CCOA 3Q0VA 3R0AA 1KU7A 1T0FA 4CZCA 1N25A 3ZOBA 5HNFA 3QU6A 4TV7A 1T39A 1F1ZA 2A5YB 4AM3A 4CCNA 1BI1A 4LFUA 2UZKA 3K2AA 1B8IB 3BZCA 3HIMA 1UFMA 2EV6A 3LQRA 4FETA 3A2KA 1SD6A 2OCEA 1Y6IA 1EH8A 1V5GA 2PQ8A 2FBKA 3LSJA 1EKEA 1N78A 2MC3A 4QSHA 3D0SA 2L3DA 1BOAA 3FM5A 1JJ8C 4WIBA 1OYWA 1SGMA 5FLMJ 1TQMA 1I1SA 3BJOA 2LRDA 1ETOA 2OZ6A 4D5CA 1P7IA 2XC7A 2XDVA 4PZJA 1RZ4A 4KMFA 4S05A 5DCFA 3OR1C 3NQOA 1V3FA 3Q0UA 3K6GA 2CGPA 2DN0A 4ENMA 2DAOA 3S93A 3C1DA 4JKZA 2H27A 4BQOA 3BTCA 1U5TA 1ETVA 3NRVA 1FP2A 3VVZA 2LKXA 3H5NA 2XAUA 3VEPA 5E3LA 5D5WB 3RD3A 2BE5F 3C07A 2GIVA 1KZHA 1LUJB 4XLNF 3CP2A 2FA5A 1VZ0A 3A01B 2ZOYA 5H9TA 2A61A 3LHQA 1W0TA 3DF8A 5F1JA 1R4MB 2JVHA 2Z5UA 3FX3A 2X0LA 4DIQA 4Z6YA 3I4MJ 1S7AA 1Z05A 5CLSA 3ZQFA 1STZA 3JRIA 4HDVA 1JTXA 4ON0A 2Z9OA 4EJTA 5H20A 2ELJA 4L62A 3MVPA 2YUSA 4FISA 1JT0A 4U9NA 4BEHA 4MTDA 3CMMA 3KE2A 3HTIA 4UUVA 6PAXA 3HSRA 3EYIA 2IS2A 2VT3A 1X1PA 1A36A 3HHGA 3AL0B 3ANPA 2E7XA 5HNHA 1LVKA 3R61A 4RLQA 1VQMI 2VJIA 1LEBA 2A6TA 4U0YA 2M8EA 3DPTA 3QP6A 4E7LA 2M34A 3TQNA 5LGUA 1TC3C 1MBKA 2K7LA 2M7AA 3WGGA 1TTYA 3SYTA 2GQQA 2HQ5A 4GRIA 4L9NA 1Y1WJ 2OF7A 1V55H 4M72A 2HVQA 1O7LA 1GV5A 2HZTA 1ACIA 1ZLKA 2PX9A 3M1CA 4NQWB 4OMYA 1N77A 5HLGA 3H3ZA 3H36A 2YX7A 4IO9F 4I6ZA 2XAJA 3K0LA 3ML6A 2FQ4A 1U8RA 2VPRA 2BV6A 2V1DA 4MLOA 2XKPA 2KRCA 4AIDA 5IOYA 2E60A 1WQ2A 4CYCA 3WTTC 3FF5A 3KKDA 1S7OA 1X19A 2XSDC 2R5ZB 4X0GA 4OMZA 3LAPA 3CC7I 4NB5A 1LDJA 2E1NA 1YRNA 4MQVA 4PSWA 4BY1J 1U78A 4D9JA 2IRFG 1XCBA 3C2HA 3LAJA 5D5VB 3WG9A 2NP5A 1FOXA 4RAYA 1HLVA 2RQQA 3LSMA 3QAHA 5HDNA 1DUXC 3ZQLA 5F64A 1RRJA 4OIQF 2QKMB 1MMDA 3NWSA 3B02A 2CMPA 3HKZN 1H89C 3IH4A 2V1XA 2IP2A 3BWGA 3PPBA 5JFRA 1RI7A 4B09A 1LE8A 2DK8A 4S04A 1MJAA 2ZOZA 3KPHA 1FY7A 1ORKA 2XF7A 3ZMVA 1HW5A 4M3EA 2KRHA 5E20A 3HUGA 3BTJA 2DLLA 3J7ZI 2HKUA 1BJAA 4MNUA 3SQNA 4UUTA 4E4HA 2UXUA 4LMYA 3PIOF 1IUFA 1Y56A 4F55A 3COAC 2IS1A 1ZRDA 2HYGD 3PQKA 5BMZA 1IN8A 1DGRM 3L09A 5FB2A 4RGUA 2NVXJ 4AC6A 3KP7A 2CUEA 3MEXA 2F4OB 2HWVA 3W6JB 5ICEA 1LB2A 5IOZA 1FSEA 1RPWA 2QF7A 2XF6A 3J81Z 4BBSJ 2ZMEA 5HOOA 4HLXA 3HRUA 4FASD 1YS7A 1SD4A 2CQXA 4DBRA 3KYCB 1T98A 3FZVA 1HKSA 2DA1A 3GTLJ 2A6EF 3O6BB 4HSRA 2V1NA 1GVJA 2W82A 4Y33A 3CCLI 3MKLA 5IPAA 3ZQHA 3HOVJ 3QU3A 3H3VK 1EA3A 2JRMA 5KAFC 5F0FA 5JLWA 2GIZA 1XB4A 5EEHA 1G3SA 1BW6A 2XVCA 5B1AH 1CF7B 5TRDA 2RHAA 3K4KA 3RTRA 3S32A 3BR0A 1XS9A 3V42A 1YG2A 1Z7UA 1FC3A 1P4XA 2A69F 1IN7A 2HOTA 3GZNB 4JK1X 2OV7A 4DQ2A 2L7FP 5CW8A 5IYDJ 4EMSA 2DA6A 1X3WB 3LMMA 1UB9A 5FMPA 3S3NA 1BOBA 1S6LA 3SZGA 3VVYA 2V6CA 4RB2C 2VKDA 1WJ5A 1Y1VJ 4ZTFA 4C2UA 1ZTRA 3DLLF 1Q1HA 3PQJA 4FX0A 1FBQA 1FPQA 1W7PD 4RS8A 2FUG2 4A3LJ 2WB1N 4HX4A 3QWLA 4QPQA 1T38A 1B6AA 2GA2A 2L7KA 1B72A 4L5JA 3HIFA 2EQRA 5J47A 4WX9A 1U5TC 2HOAA 3F21A 1SVLA 4EQQA 2KP6A 2VQHA 3IKVA 3F1BA 3ZQIA 2I10A 2ZSHB 1ODDA 3DV8A 4R1HA 2HKOA 2GM4A 1J7KA 1YLFA 1DP3A 2M87A 2CQQA 5LEJA 2RV8A 4XKCA 3I59B 4RB0A 3OYBA 1OCOH 2DO7A 5LD2C 3P7NA 5LRSA 1YW7A 2FSWA 1WJCA 4O5VA 3TO6A 2EFWA 3VVXA 3RPQA 1IV8A 1O7FA 3QKXA 3HOUJ 3CESA 1B1BA 4N4OB 3R0JA 1S8NA 1KONA 2XGCA 4XOTA 4C3IJ 4EM1A 1XPXA 3HTHA 4YEJA 1HCRA 4XRMA 5LHGA 2GBYA 3C7JA 4BDYA 1JKOC 3CJTB 4FE4A 3DTKA 1HBXG 3L7WA 3SXYA 2R5YA 3PFYA 1XDSA 3VDXA 2WAQA 1BW5A 1NG6A 2XV4S 5EEAA 4A3DJ 5BS6A 4BJ6C 1ETKA 4G94A 2OI8A 5FHPA 3JRGA 3ZPLA 3HDDA 1LFBA 3BJ6A 5HDKA 4EV0A 1ZAOA 2E35A 2RC4A 5HLIA 2CQ7A 4M6XA 2MH9A 2G0EA 4AIJA 2O8XA 4BQAA 1OKRA 2ICWG 2P8TA 1POGA 1WJFA 3PSFA 5DS9A 4KDPA 3BHQA 5F0CA 2HXOA 1E3PA 1Z91A 2L9NA 3HE0A 3ZQQA 4HLYA 1GUUA 4GCLA 2G7HA 4AWXB 4GO1A 1UG2A 2HNHA 2NAZA 4QIWN 3GEZA 1QGPA 4OOIA 5LGTA 2XAFA 5AQCA 1QVTA 1HW2A 4GFBA 3M9AA 3RDIA 1MH4A 3TMOA 1K7AA 1FMVA 3FWEA 5FLVA 2WAEA 1JKQC 4ZTJA 2UV1A 1UAAA 5FKLA 2QSGX 3KFWX 3JAMK 1K78A 2ESHA 2IA0A 3GFMA 3EUKL 2AXTC 3L2QA 3DTEA 1XX5A 1R9TJ 2XKOA 5LHHA 5JHUA 4A12A 1JUMA 4CYDA 1JXSA 3S8PA 4CA0A 1QZEA 4ZDPA 4DGWB 1BBYA 4JP0A 2XPUA 2ZSIB 1VQLI 3C2BA 3LJLA 3H9GA 2RASA 3W6KB 1O3SA 4WXCA 2A68F 3NPIA 2K9LA 1MBGA 5DD4A 3I64A 3HTSB 3CQZJ 2QUFA 4A6EA 1OJLA 4U88A 1RC9A 3K4LA 3BQYA 1IRXA 4MIMA 4A0XA 4BACA 2VT2A 3PNYA 1TNSA 2QBYB 1T95A 3OIOA 2VBYA 2CW0F 3J7AO 2HPMA 3KP4A 3LA7A 3EQLF 4I2OA 1JUPA 3QOPA 3F9KA 1IG7A 1TWAJ 3S1NJ 2X51A 3BCBA 4BHBA 1TT0A 2ZJRF 2P7CB 4MXMA 3GTGJ 3KP3A 4GYGA 5J1UA 3WG7H 4UVCA 2ZMEC 1SFOJ 2MC4A 2CSOA 4CH7A 2BGCA 2K9SA 3PNTA 2QEXI 3SJMA 3OWTA 1IJWC 1LVAA 3IRQA 1YI2I 2F48A 2EIMH 3DBHB 2IA2A 3Q9SA 3HGYA 2OPTA 1IXRC 4RDUA 3G7RA 1QHHD 2M30A 2F4IA 1LEAA 5HS9A 2MW8A 3BPXA 5FKNA 1RESA 2B0LA 2V9VA 4Y15A 2Z99A 1XMKA 4M3DA 2GXGA 3ULQB 2DDAA 2AQFA 3BC8A 4LG0B 3KYDB 2R7XA 1S29A 2V26A 2VBWA 4I99C 4ME9A 1WJAA 3D5LA 4J00A 2UXOA 2LBFA 1IW7F 2DT6A 2EWNA 1YIOA 5FKMA 5K7FA 3C2GA 1LFUP 2ZKZA 5D19A 4GCVA 3PIPF 2KZGA 4BAYA 4EJVA 2KPMA 1QVUA 1RIOH 1USSA 2FRHA 4XKWA 5DEQA 4A3FJ 1R49A 4P96A 1Z1DA 1SMYF 1E3OC 3JSOA 4G6TB 2KISA 4J01A 2Y75A 2PBIA 3F3XA 1A6IA 4NDLA 5C4YA 4BE2A 2LDUA 5E3MA 1LFPA 2TCTA 4XLHA 4RB1A 3MD2A 3MKZA 3ABTA 5E1XA 1JGGA 1USTA 2IGNA 1ZN2A 3JSJA 1X1CA 4QTRA 4JX4A 3ZN1A 5HLTA 2EINH 3WE2A 2L4MA 3FXOA 3GWZA 4RA2A 2X6OA 1YIJI 1IN6A 2DK5A 4R8HA 2NP3A 2N8GA 3OIQA 4I02A 1YX5A 4PGGA 4S0HB 4MK6A 2IXSA 5ILVA 2DPUA 2JVGA 3W2VA 2DOFA 2H8WA 4M3FA 5K58A 2CQNA 4P5OA 3KX2A 3EPZA 2MG4A 3MFKA 1VTNC 2EFQA 5E8IA 4HRIA 2E34A 1SAUA 2JRTA 5CVIA 1AWCA 4IXAA 4JX5A 4M3BA 2ZCXA 2I8DA 3U1DA 3BG6A 4WCGA 2DA2A 2V7FA 4AYBN 1RR7A 4M73A 2I5UA 1FIAA 4NC7A 4UVAA 3AG3H 1XMXA 4Y52J 3T1BA 4ZDLA 4Q4ZF 3CWRA 1FT9A 2R7FA 3NWTA 3BG5A 4WF2A 1KYZA 5K5OA 2NNNA 1O3QA 1JTYA 1NHAA 3L00A 4L9TA 4Y3OA 5M3FJ 4IOCF 3MNLA 2BW3B 1MMGA 3FXKA 4NNJA 3KEQA 3HRSA 4YIFA 3A01A 4I09A 3HOYJ 4M6YA 3ERED 3GO5A 2DMUA 2ESNA 4C3JJ 3WU2C 2X4HA 4XRFA 3FDYA 3P9KA 4M3GA 2CRGA 2A2FX 1EV7A 4EJUA 5B1BH 3TGNA 4H4KC 3VIBA 2RKHA 2R3SA 4KNYA 1XGSA 5L3BA 1MBFA 3I54A 4U87A 3KP5A 2GAUA 2ELHA 3VODA 2WGBA 2FE3A 3UNGC 2NS7A 1NK3P 1R1TA 3HEFA 3RYPA 1D8JA 2Q2EA 1I1GA 2WUIA 2G7SA 1QPIA 2P6TA 1QQIA 5H6RA 2FBQA 3O8GA 1XD7A 1HDPA 1L3LA 4XSZF 4O6JA 2J5PA 4M6VA 1D1AA 3HL2A 2EA2A 3OS2A 3A1YA 1BR2A 2Z2SB 1BIBA 3TOBA 5DDGA 3S3MA 5F04A 1X2NA 3AQTA 4A5NA 4EVIA 4NQWA 5FO5A 2V1UA 4L18B 3ZN0A 3CCSI 2HQNA 2ZXHA 4Z2YA 2E1CA 4GDFA 3MAJA 3BJAA 3VOKA 3HM5A 2M0MA 3PO2J 2QM3A 2ID3A 1UHMA 2LKPA 4PJJA 5CKTA 5ERIA 2VJJA 3DEUA 4LGWA 1JHFA 4BU2A 2IGMA 4M71A 4UUSA 2VKVA 2B3WA 1OYIA 3R4KA 1T8IA 2VQLA 4U7DA 1W36D 4MTEA 1YOVB 3ABUA 3H9QA 3OOPA 2UXHA 2E5ZA 3GTOJ 3KCCA 4KJZA 2EZIA 1R6RA 1OR7A 3I53A 5E1ZB 3JRDA 2OTJI 3M3YJ 2RN7A 1QNTA 3E0JB 3TDZC 2Y31A 3HRMA 4E7SA 5ICFA 1W1WE 3E5QA 5C4XJ 5IY5H 4IHSA 1JGSA 2BHZA 3JAMZ 3L2CA 1S72I 3IAS2 2HGCA 5IT9K 3K4BA 3EUPA 3C18A 2W48A 4A3KJ 1HSTA 1U6GA 3K4CA 2VQCA 3OL3A 1IN5A 2HYFA 2BYVE 2JPCA 1OQYA 1APLC 3DXJF 1PUEE 3RQIA 3CC4I 4GFLA 3D5RC 2BHYA 2VC0A 2QTQA 2HTSA 3G2BA 2GFNA 2R7QA 5E17F 5CVRA 2HYJA 3GF2A 4A69C 3IL2A 4UV9A 3K4MA 4NHJA 1JJ6C 2STWA 2O3FA 2Y0SA 2O7OA 2KQRA 2L9VA 2JTVA 2WY7Q 2PFBA 4RAFA 5EZHA 3O2PE 3DKYA 2VB6A 4M9XA 5KCMA 4BQQA 4XRSA 2RREA 1E17A 3VW2A 2D5VA 3JCUC 2L4AA 3B6CA 3BPVA 2CUZA 4IRHA 3BCGA 3RQ4A 3OYJA 4W1UA 4E7HA 3U1KA 1BM9A 3GTQJ 4PSXA 2FOWA 3WTZA 2ECBA 3M07A 1UZCA 2E1MC 2FJI1 2YS9A 4FHTA 2QOPA 3MN2A 1MD0A 2HOEA 3P9IA 3RZDJ 4BJ5C 4OWRB 2R7RA 5EG0A 2P6SA 4XORA 4G6DA 3U2RA 1P4AA 4G8XA 4HF1A 2DQRA 2HU9A 3E7LA 3K2ZA 4CCLA 3BG7A 1CF7A 2E2IJ 1G3WA 5M5XJ 3MZYA 3WTXC 1IAWA 1MNMC 4D7NA 2E7WA 3EUHA 3GLXA 5L3EA 3I0TA 3OYCA 4M9ZA 2IA1A 3FKIJ 2XAHA 4BH9A 5JR3A 4UB8C 4ETSA 4HF2A 1WSUA 3E97A 3AG4H 4DW6A 2ISYA 1RKTA 2P5VA 4CGZA 1UJ8A 2XAQA 3N05A 3H9JA 5CXIA 2DPDA 2G7GA 3V7SA 1ZQ3P 1FNNA 3JR9A 3BRUA 1YW9A 1PUFB 4FQGA 2BXZA 1IV6A 2Q1ZB 4K2EA 3CRJA 1B59A 3DQVC 1J0RA 4PJ0C 2CUFA 3IRRA 4IHWA 2L54A 1IZ1A 4NC8A 2LYCA 2FQ3A 2BVLA 3LSHA 3TBIA 3E5XA 1XG1A 2EFNA 4I98B 4ZJZA 4M9SA 3H1CA 1AKHB 3LWFA 4LD5A 3CCEI 2LR8A 2UXPA 3F8MA 3WTUC 3CF5F 3JSPA 5M5YJ 3AFHA 4LLNA 2CU7A 3K9TA 2UWMA 3SFIA 3CCQI 3S2HJ 3J80K 5M5WJ 4AUXA 2G3BA 4XONA 2HR3A 1JE8A 4XN0A 4UDSA 3JTHA 4PUSA 2ELKA 4FX4A 1J09A 2K3FA 2D2WA 2PZ9A 2CYYA 1TT5B 2GXAA 2KT0A 5DCMB 3V6GA 2PMUA 5JLXA 2XUBA 5CQGA 4HBLA 5CYVA 2FF4A 5HDGA 3I3LA 1WZ2A 5F08A 3EDPA 3LSRA 1HOMA 3DBLB 1XSDA 1JKPC 1GHCA 3NI7A 3V8LA 3OYIA 5CVJA 2GLOA 2JSCA 1WI9A 1FX7A 4LLGF 2JA6J 4V2FA 2VI6A 4PDKA 2PJPA 3QPLA 3AAFA 2DMNA 1FYMA 1SEUA 5H2FC 1H0MA 3DPUA 2VBZA 3FIWA 1VQ6I 5FKKA 4XN3A 1X4OA 2BXYA 1LQ1A 2Y9YA 3K70C 2HVRA 1R58A 4EGZA 5GAGJ 3WHBA 5FGMA 1OLTA 1I5ZA 3KEYA 3CUOA 4BJTA 4HNUA 3BLYA 4ZYEA 2C6YA 1FWZA 1A04A 2HFHA 2DA5A 3FXUA 2E2JJ 2X6YA 4N0BA 4C9YA 5HLHA 3GCMA 3RJPA 2F4MB 5EF6A 3G3ZA 2DT5A 4OAYA 2VBXA 1BL0A 1NTCA 4MFEA 3ZMSA 1G6NA 2R7SA 4YFNF 5FJ8J 3QPTA 2DJIA 4B3XA 4ESFA 4HQEA 1XGOA 2M0CA 2NOGA 5GP9A 3JRCA 5J6XA 5EJCA 4HNVA 2W4SA 1G59A 4HSTA 1JUSA 2WAQN 4A93J 2LY2A 4IPAA 1MW7A 2H8RA 2HDCA 5L3FA 4MGRA 4IHYA 4XMYA 3A0HC 2KZVA 4EM0B 2M3AA 2V9KA 4LJZF 1KU3A 1T56A 5K1YA 2ZJQF 2CH0A 1T0FC 5JHFA 5D5UB 3CC2I 1D0YA 3ERMA 1FIPA 3IAM2 3CCYA 1Y8RB 2OD5A 4YRVA 1OCRH 5HS8A 3J7AY 3D5SC 3MQ0A 2R93J 1PDNC 3V4GA 1P92A 3GMEA 2EILH 2XF5A 2F5CA 4XICA 5B3SH 2DTZA 1KYWA 1P7JA 2COBA 4KIFA 1UI6A 3HRTA 3TW7A 4A3BJ 3TP3A 3RSNA 2E36A 4ZYAA 2COMA 3I4NJ 5J8CA 4BXXJ 2RAEA 5E8GA 3SWHA 5J3LA 3CLQA
chains in the Genus database with same CATH topology
3OIOA 3TW6A 2IAIA 2LY9A 3NNRA 3COLA 3B6AA 3M4OJ 3BQZA 2VKEA 4MO7A 4L5EA 4DYQA 1JUPA 1MBEA 2DA4A 3H0GJ 4J19A 1IG7A 3F0CA 1TWAJ 3S1NJ 2ECCA 3HOWJ 4IHXA 1S7EA 1IRZA 4MXMA 1X58A 3GTGJ 3DPJA 1MBHA 5IP9J 3S2DJ 5J1UA 3BR1A 4JL3A 2L9RA 1SFOJ 3S1MJ 4A3EJ 1ZR2A 2K9SA 2XRLA 4W97A 3LWJA 3SJMA 2YU9J 1IJWC 3CDLA 1VF9A 1H88C 2W53A 1ETXA 3LNQA 3PASA 3HGYA 2OPTA 3T6NA 5HAWA 2K9QA 2R92J 4RDUA 4A3GJ 3G7RA 4A3MJ 2E19A 2LVSA 1WGXA 3IH3A 2MW8A 5FKNA 1ZKGA 1RESA 4M3DA 4V2GA 4A3JJ 2ZCNA 4GCKA 3LOCA 1K61A 1QRYA 3UKGA 2R7ZJ 3GBGA 1GV2A 4ME9A 3PM1A 2M9HA 2AO9A 4FTHA 2UXOA 4AC0A 1VFCA 4IHVA 5FKMA 5K7FA 3QPSA 1LFUP 5D19A 1WH7A 1O4XA 1SANA 3DCFA 1QVUA 5E3NA 2E1OA 3GTKJ 4A3FJ 2B63J 1E3OC 2XPWA 1MBJA 2WV1A 3VUQA 1A6IA 4NDLA 5C4YA 5E3MA 2TCTA 2M2EA 2IBDA 1DU0A 3G1MA 2JA5J 4UUSB 1BA5A 5FKOA 2EH3A 1JGGA 3HOZJ 9ANTA 5IP6A 5HBUA 3G56A 3JSJA 3VPRA 4QTRA 3Q0WA 3LSPA 4FCYA 1K83J 3Q0VA 4CYCB 4JX4A 3KNWA 3FK7A 4XIDA 3ZOBA 4B3AA 2X6OA 4PXIA 1AHDP 3FK6A 2NP3A 1YRNB 2N8GA 1EF4A 2PBXA 3K2AA 1B8IB 4BKXA 1I50J 4S0HB 3HIMA 4MK6A 2HI3A 1MSEC 1U9OA 3JRHA 1GDTA 4M3FA 5K58A 3LSJA 4XK4A 3ZQCA 2MG4A 4X1EA 2JWTA 3O60A 4AF5A 4QSHA 1IDZA 4JX5A 4M3BA 2GENA 2ZCXA 3O8HA 5EGOA 2XDNA 3NRGA 3HTAA 4FE7A 2DA2A 5BNGA 1JJ8C 1AU7A 1G2HA 4AYBN 2K9NA 1SGMA 1RR7A 5FLMJ 3GEUA 4BY7J 5EYRA 4GCTA 1FIAA 4YZEA 2DG7A 4DYCA 1ETQA 4Y52J 5DAJA 1ETOA 3CWRA 2ZB9A 2DMQA 3BG5A 4D5CA 1P7IA 2E2HJ 4I76A 5EGOB 4B4CA 5GPCA 1JTYA 3MNLA 2ME0A 3NAUA 5M3FJ 2UXIA 3Q0UA 4B1RA 2REKA 2DN0A 3OSGA 3A01A 4JKZA 3HOYJ 3Q3SA 3BTCA 2DMUA 4C3JJ 1ETVA 3VVZA 3VP5A 3IV5A 2LKXA 4M3GA 2Y30A 2CRGA 1OCTC 1UI5A 4JX6A 5E3LA 3RD3A 3C07A 3VIBA 2OERA 3S16J 4NN1A 3FISA 5EG0B 3A01B 1MBFA 2JJ7A 1Z77A 2ZOYA 5H9TA 3LHQA 2NVYJ 5CXGA 1W0TA 5F1JA 1HDDC 1NK2P 2WGBA 2NS7A 1NK3P 3I4MJ 3JRIA 3HEFA 3ZQFA 1JTXA 4L62A 1X2MA 2JMWA 3TP0A 3MVPA 2YUSA 4DZJA 2WUIA 2G7SA 4FISA 1JT0A 1QPIA 4XRSG 5J1RA 3HTIA 2FBQA 3O8GA 3IUVA 1ITYA 2EBIA 1HDPA 2FJ1A 2EZLA 4M6VA 3S1QJ 2MSYA 3K7AJ 3RZOJ 3ANPA 3JRBA 5F04A 1FTTA 1X2NA 3AQTA 2O7TA 1GT0C 1WCMJ 3W6VA 2DA7A 3RH2A 5D1RA 2K40A 3BNIA 1HF0A 2M34A 1TC3C 1FTZA 1MBKA 1Q1VA 2ZCMA 3VOKA 3HM5A 2HQ5A 1Y1WJ 2OF7A 3PO2J 2JK3A 5IYCJ 2ID3A 4KWAA 1GV5A 3D1NI 4UUSA 3G1LA 2DMTA 2XGDA 2VKVA 3G1OA 2LK2A 4I6ZA 2FQ4A 1TWFJ 2VPRA 4MLOA 4CYCA 5IOYA 1BJZA 3KKDA 1TWGJ 2XSDC 2R5ZB 2HOSA 1JT6A 3OOUA 1MSFC 2O8KA 3GTMJ 2UXHA 1YRNA 2D6YA 5HODA 2ME6A 4BY1J 3GTOJ 1U78A 1B8IA 3HTJA 2EZIA 3ON4A 3JRDA 5K7ZA 3M3YJ 1I3QJ 4A3LJ 2HDDA 4C2MJ 2Y31A 3BJBA 5C4XJ 2P81A 2NP5A 3VOXA 2QCOA 4RBOA 1XC5A 1WH5A 1HLVA 3HB9A 3EUPA 2W48A 5J1YA 4A3KJ 3ZQLA 2V57A 1H8AC 1APLC 3RQIA 3HKZN 1UHSA 4GFLA 2CJJA 1H89C 3IH4A 2R5YB 2QTQA 3PPBA 2GFNA 2YVHA 1LE8A 2HYJA 4A69C 4Y7NJ 3RKQA 1ETWA 2YVEA 2ZOZA 1ORKA 1JJ6C 4M3EA 4JNNA 3BG3A 2O7OA 3NARA 4JYKA 4GFKA 3CJDA 3BTJA 1GVDA 2HKUA 5EZGA 2DMPA 3QQAA 5EZHA 2EZKA 1ZR4A 2UXUA 4UUTA 4XRSA 1IUFA 3VW2A 4LOCA 3ZQGA 2D5VA 3B6CA 1LE8B 1UMQA 5EDNA 2JA7J 3BCGA 2NVXJ 4AC6A 4W1UA 2CUEA 3S14J 2NVQJ 3GTQJ 1I6HJ 3KKCA 2ECBA 5IOZA 1RPWA 2YS9A 2QF7A 2QOPA 3MN2A 4BBSJ 3JRAA 3RZDJ 4ABZA 1T33A 5EG0A 1FEXA 1W0UA 2CQXA 2JN6A 5J3LA 3E7LA 4HKUA 2E2IJ 3BTLA 2DA1A 3GTLJ 2NX4A 5M5XJ 4DYRA 3QBMA 2Y2ZA 1MNMC 2M8GX 4D7NA 2EZHA 1OFCX 1RETA 2XPVA 3MKLA 5IPAA 3ZQHA 1PUFA 3HOVJ 1OCPA 2LTPA 3FKIJ 3H3VK 2Y0SN 5F0FA 3S5RA 5JLWA 3NXCA 4DW6A 1BW6A 2RHAA 2DJNA 1RKTA 3BR0A 1XS9A 5CXIA 2G7GA 1ZQ3P 3JR9A 1AKHA 3S17J 3BT9A 3BRUA 3JREA 4A3IJ 1PUFB 2HOTA 2DA3A 1IV6A 3CRJA 2L7FP 5CW8A 5IYDJ 1JKRC 2CUFA 2TRTA 2DA6A 3GTJJ 2QKOA 2L7ZA 3HGGA 5FMPA 4IHWA 1DU6A 3VVYA 1XG1A 1Y1VJ 1ZTRA 5GPAA 1AKHB 2DG8A 2LR8A 2UXPA 5M5YJ 5FGLA 2CU7A 3SFIA 1IGNA 2WB1N 3WHCA 2VUMJ 3OSFA 5M5WJ 3S1RJ 4AUXA 3S2HJ 3LSGA 3IH2A 2G3BA 1B72A 2EQRA 2R5ZA 4UDSA 2HOAA 2ELKA 3GTPJ 5HSZA 2PZ9A 3BTIA 3L1PA 3F1BA 1F36A 3BR6A 2I10A 3ZQIA 2R0QC 3E7QA 2KT0A 3V6GA 2GM4A 5JLXA 5C4JJ 1F43A 2CQQA 2XGEA 3SDGA 3FRQA 1U9NA 5F08A 5IYBJ 4BBRJ 3JRFA 4MFDA 3LSRA 1HOMA 1JKPC 3HBLA 3NI7A 4G12A 1B72B 3VVXA 4D5FA 3QKXA 3HOUJ 3BR3A 1ZK8A 2GLOA 2NVTJ 1IDYA 2XGCA 4C3IJ 4A3CJ 3HTHA 1HCRA 2JA6J 4V2FA 2VI6A 4XRMA 2GBYA 1CQTA 1TWCJ 1JKOC 3QPLA 4FE4A 2DMNA 2R5YA 2F07A 3P9TA 3FIWA 4ACIA 5FKKA 3AQSA 2X48A 1BW5A 5EFYA 5C3EJ 3S15J 2Y9YA 1U8BA 3ON2A 4A3DJ 5EEAA 5D18A 4C3HJ 2GUHA 4NELA 1ETKA 5DTDA 2OI8A 3GZIA 5FHPA 2ID6A 3WHBA 3JRGA 3HDDA 2LD5A 2XB0X 1LFBA 3EGQA 4X6AJ 4EEFG 3V78A 2AHQA 2G0EA 3KZ9A 2FD5A 1POGA 5E3OA 5DS9A 2DA5A 3BHQA 1ZGWA 3A03A 5F0CA 2HXOA 2E2JJ 2L7MP 1FJLA 5EF6A 3HE0A 1GUUA 4GCLA 3BR2A 1TWHJ 4IEJA 2QWTA 2IEKA 1UG2A 4ICHA 1BL0A 4QIWN 1WI3A 2IU5A 1NTCA 4MFEA 1WPKA 3TEDA 4D7MA 1RKWA 3PO3J 1A5JA 5FJ8J 5AQCA 2LLKA 1QVTA 5IP7J 4GFBA 2M0CA 2NOGA 5GP9A 1MH4A 3JRCA 1IC8A 3VW0A 2G7LA 2FX0A 5K7HA 3HOXJ 4HNVA 5FLVA 1MH3A 3BR5A 1JKQC 1JUSA 2WAQN 4A93J 1VNDA 5M3MJ 2H8RA 2HYTA 5FKLA 5C44J 2Q24A 2O9LA 2Y9ZA 4IHYA 3A02A 1T56A 1ENHA 1R9TJ 3B81A 4DZPA 2LFBA 3DEWA 1JUMA 1FIPA 2PMZN 3CCYA 2QIBA 5F27A 2JA8J 1D5YA 2H1KA 4JP0A 2XPUA 3C2BA 2R93J 3LJLA 2RASA 3NPIA 2HXIA 1MBGA 2LP0A 2MGQA 4XICA 4CGRA 2DTZA 1P7JA 2COBA 2L0KA 1UI6A 1ETYA 3BG9A 3CQZJ 3TW7A 3TP3A 5F0HA 4A3BJ 3VW1A 3I4NJ 1Z0XA 1VI0A 2X9DA 2KDZA 1OJLA 4BXXJ 3BQYA 2RAEA 4MIMA 3ANGA 2NS8A 2XB5A 3CMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIO A;  3TW6 A;  2IAI A;  2LY9 A;  3NNR A;  3COL A;  3B6A A;  3M4O J;  3BQZ A;  2VKE A;  4MO7 A;  4L5E A;  4DYQ A;  1JUP A;  1MBE A;  2DA4 A;  3H0G J;  4J19 A;  1IG7 A;  3F0C A;  1TWA J;  3S1N J;  2ECC A;  3HOW J;  4IHX A;  1S7E A;  1IRZ A;  4MXM A;  1X58 A;  3GTG J;  3DPJ A;  1MBH A;  5IP9 J;  3S2D J;  5J1U A;  3BR1 A;  4JL3 A;  2L9R A;  1SFO J;  3S1M J;  4A3E J;  1ZR2 A;  2K9S A;  2XRL A;  4W97 A;  3LWJ A;  3SJM A;  2YU9 J;  1IJW C;  3CDL A;  1VF9 A;  1H88 C;  2W53 A;  1ETX A;  3LNQ A;  3PAS A;  3HGY A;  2OPT A;  3T6N A;  5HAW A;  2K9Q A;  2R92 J;  4RDU A;  4A3G J;  3G7R A;  4A3M J;  2E19 A;  2LVS A;  1WGX A;  3IH3 A;  2MW8 A;  5FKN A;  1ZKG A;  1RES A;  4M3D A;  4V2G A;  4A3J J;  2ZCN A;  4GCK A;  3LOC A;  1K61 A;  1QRY A;  3UKG A;  2R7Z J;  3GBG A;  1GV2 A;  4ME9 A;  3PM1 A;  2M9H A;  2AO9 A;  4FTH A;  2UXO A;  4AC0 A;  1VFC A;  4IHV A;  5FKM A;  5K7F A;  3QPS A;  1LFU P;  5D19 A;  1WH7 A;  1O4X A;  1SAN A;  3DCF A;  1QVU A;  5E3N A;  2E1O A;  3GTK J;  4A3F J;  2B63 J;  1E3O C;  2XPW A;  1MBJ A;  2WV1 A;  3VUQ A;  1A6I A;  4NDL A;  5C4Y A;  5E3M A;  2TCT A;  2M2E A;  2IBD A;  1DU0 A;  3G1M A;  2JA5 J;  4UUS B;  1BA5 A;  5FKO A;  2EH3 A;  1JGG A;  3HOZ J;  9ANT A;  5IP6 A;  5HBU A;  3G56 A;  3JSJ A;  3VPR A;  4QTR A;  3Q0W A;  3LSP A;  4FCY A;  1K83 J;  3Q0V A;  4CYC B;  4JX4 A;  3KNW A;  3FK7 A;  4XID A;  3ZOB A;  4B3A A;  2X6O A;  4PXI A;  1AHD P;  3FK6 A;  2NP3 A;  1YRN B;  2N8G A;  1EF4 A;  2PBX A;  3K2A A;  1B8I B;  4BKX A;  1I50 J;  4S0H B;  3HIM A;  4MK6 A;  2HI3 A;  1MSE C;  1U9O A;  3JRH A;  1GDT A;  4M3F A;  5K58 A;  3LSJ A;  4XK4 A;  3ZQC A;  2MG4 A;  4X1E A;  2JWT A;  3O60 A;  4AF5 A;  4QSH A;  1IDZ A;  4JX5 A;  4M3B A;  2GEN A;  2ZCX A;  3O8H A;  5EGO A;  2XDN A;  3NRG A;  3HTA A;  4FE7 A;  2DA2 A;  5BNG A;  1JJ8 C;  1AU7 A;  1G2H A;  4AYB N;  2K9N A;  1SGM A;  1RR7 A;  5FLM J;  3GEU A;  4BY7 J;  5EYR A;  4GCT A;  1FIA A;  4YZE A;  2DG7 A;  4DYC A;  1ETQ A;  4Y52 J;  5DAJ A;  1ETO A;  3CWR A;  2ZB9 A;  2DMQ A;  3BG5 A;  4D5C A;  1P7I A;  2E2H J;  4I76 A;  5EGO B;  4B4C A;  5GPC A;  1JTY A;  3MNL A;  2ME0 A;  3NAU A;  5M3F J;  2UXI A;  3Q0U A;  4B1R A;  2REK A;  2DN0 A;  3OSG A;  3A01 A;  4JKZ A;  3HOY J;  3Q3S A;  3BTC A;  2DMU A;  4C3J J;  1ETV A;  3VVZ A;  3VP5 A;  3IV5 A;  2LKX A;  4M3G A;  2Y30 A;  2CRG A;  1OCT C;  1UI5 A;  4JX6 A;  5E3L A;  3RD3 A;  3C07 A;  3VIB A;  2OER A;  3S16 J;  4NN1 A;  3FIS A;  5EG0 B;  3A01 B;  1MBF A;  2JJ7 A;  1Z77 A;  2ZOY A;  5H9T A;  3LHQ A;  2NVY J;  5CXG A;  1W0T A;  5F1J A;  1HDD C;  1NK2 P;  2WGB A;  2NS7 A;  1NK3 P;  3I4M J;  3JRI A;  3HEF A;  3ZQF A;  1JTX A;  4L62 A;  1X2M A;  2JMW A;  3TP0 A;  3MVP A;  2YUS A;  4DZJ A;  2WUI A;  2G7S A;  4FIS A;  1JT0 A;  1QPI A;  4XRS G;  5J1R A;  3HTI A;  2FBQ A;  3O8G A;  3IUV A;  1ITY A;  2EBI A;  1HDP A;  2FJ1 A;  2EZL A;  4M6V A;  3S1Q J;  2MSY A;  3K7A J;  3RZO J;  3ANP A;  3JRB A;  5F04 A;  1FTT A;  1X2N A;  3AQT A;  2O7T A;  1GT0 C;  1WCM J;  3W6V A;  2DA7 A;  3RH2 A;  5D1R A;  2K40 A;  3BNI A;  1HF0 A;  2M34 A;  1TC3 C;  1FTZ A;  1MBK A;  1Q1V A;  2ZCM A;  3VOK A;  3HM5 A;  2HQ5 A;  1Y1W J;  2OF7 A;  3PO2 J;  2JK3 A;  5IYC J;  2ID3 A;  4KWA A;  1GV5 A;  3D1N I;  4UUS A;  3G1L A;  2DMT A;  2XGD A;  2VKV A;  3G1O A;  2LK2 A;  4I6Z A;  2FQ4 A;  1TWF J;  2VPR A;  4MLO A;  4CYC A;  5IOY A;  1BJZ A;  3KKD A;  1TWG J;  2XSD C;  2R5Z B;  2HOS A;  1JT6 A;  3OOU A;  1MSF C;  2O8K A;  3GTM J;  2UXH A;  1YRN A;  2D6Y A;  5HOD A;  2ME6 A;  4BY1 J;  3GTO J;  1U78 A;  1B8I A;  3HTJ A;  2EZI A;  3ON4 A;  3JRD A;  5K7Z A;  3M3Y J;  1I3Q J;  4A3L J;  2HDD A;  4C2M J;  2Y31 A;  3BJB A;  5C4X J;  2P81 A;  2NP5 A;  3VOX A;  2QCO A;  4RBO A;  1XC5 A;  1WH5 A;  1HLV A;  3HB9 A;  3EUP A;  2W48 A;  5J1Y A;  4A3K J;  3ZQL A;  2V57 A;  1H8A C;  1APL C;  3RQI A;  3HKZ N;  1UHS A;  4GFL A;  2CJJ A;  1H89 C;  3IH4 A;  2R5Y B;  2QTQ A;  3PPB A;  2GFN A;  2YVH A;  1LE8 A;  2HYJ A;  4A69 C;  4Y7N J;  3RKQ A;  1ETW A;  2YVE A;  2ZOZ A;  1ORK A;  1JJ6 C;  4M3E A;  4JNN A;  3BG3 A;  2O7O A;  3NAR A;  4JYK A;  4GFK A;  3CJD A;  3BTJ A;  1GVD A;  2HKU A;  5EZG A;  2DMP A;  3QQA A;  5EZH A;  2EZK A;  1ZR4 A;  2UXU A;  4UUT A;  4XRS A;  1IUF A;  3VW2 A;  4LOC A;  3ZQG A;  2D5V A;  3B6C A;  1LE8 B;  1UMQ A;  5EDN A;  2JA7 J;  3BCG A;  2NVX J;  4AC6 A;  4W1U A;  2CUE A;  3S14 J;  2NVQ J;  3GTQ J;  1I6H J;  3KKC A;  2ECB A;  5IOZ A;  1RPW A;  2YS9 A;  2QF7 A;  2QOP A;  3MN2 A;  4BBS J;  3JRA A;  3RZD J;  4ABZ A;  1T33 A;  5EG0 A;  1FEX A;  1W0U A;  2CQX A;  2JN6 A;  5J3L A;  3E7L A;  4HKU A;  2E2I J;  3BTL A;  2DA1 A;  3GTL J;  2NX4 A;  5M5X J;  4DYR A;  3QBM A;  2Y2Z A;  1MNM C;  2M8G X;  4D7N A;  2EZH A;  1OFC X;  1RET A;  2XPV A;  3MKL A;  5IPA A;  3ZQH A;  1PUF A;  3HOV J;  1OCP A;  2LTP A;  3FKI J;  3H3V K;  2Y0S N;  5F0F A;  3S5R A;  5JLW A;  3NXC A;  4DW6 A;  1BW6 A;  2RHA A;  2DJN A;  1RKT A;  3BR0 A;  1XS9 A;  5CXI A;  2G7G A;  1ZQ3 P;  3JR9 A;  1AKH A;  3S17 J;  3BT9 A;  3BRU A;  3JRE A;  4A3I J;  1PUF B;  2HOT A;  2DA3 A;  1IV6 A;  3CRJ A;  2L7F P;  5CW8 A;  5IYD J;  1JKR C;  2CUF A;  2TRT A;  2DA6 A;  3GTJ J;  2QKO A;  2L7Z A;  3HGG A;  5FMP A;  4IHW A;  1DU6 A;  3VVY A;  1XG1 A;  1Y1V J;  1ZTR A;  5GPA A;  1AKH B;  2DG8 A;  2LR8 A;  2UXP A;  5M5Y J;  5FGL A;  2CU7 A;  3SFI A;  1IGN A;  2WB1 N;  3WHC A;  2VUM J;  3OSF A;  5M5W J;  3S1R J;  4AUX A;  3S2H J;  3LSG A;  3IH2 A;  2G3B A;  1B72 A;  2EQR A;  2R5Z A;  4UDS A;  2HOA A;  2ELK A;  3GTP J;  5HSZ A;  2PZ9 A;  3BTI A;  3L1P A;  3F1B A;  1F36 A;  3BR6 A;  2I10 A;  3ZQI A;  2R0Q C;  3E7Q A;  2KT0 A;  3V6G A;  2GM4 A;  5JLX A;  5C4J J;  1F43 A;  2CQQ A;  2XGE A;  3SDG A;  3FRQ A;  1U9N A;  5F08 A;  5IYB J;  4BBR J;  3JRF A;  4MFD A;  3LSR A;  1HOM A;  1JKP C;  3HBL A;  3NI7 A;  4G12 A;  1B72 B;  3VVX A;  4D5F A;  3QKX A;  3HOU J;  3BR3 A;  1ZK8 A;  2GLO A;  2NVT J;  1IDY A;  2XGC A;  4C3I J;  4A3C J;  3HTH A;  1HCR A;  2JA6 J;  4V2F A;  2VI6 A;  4XRM A;  2GBY A;  1CQT A;  1TWC J;  1JKO C;  3QPL A;  4FE4 A;  2DMN A;  2R5Y A;  2F07 A;  3P9T A;  3FIW A;  4ACI A;  5FKK A;  3AQS A;  2X48 A;  1BW5 A;  5EFY A;  5C3E J;  3S15 J;  2Y9Y A;  1U8B A;  3ON2 A;  4A3D J;  5EEA A;  5D18 A;  4C3H J;  2GUH A;  4NEL A;  1ETK A;  5DTD A;  2OI8 A;  3GZI A;  5FHP A;  2ID6 A;  3WHB A;  3JRG A;  3HDD A;  2LD5 A;  2XB0 X;  1LFB A;  3EGQ A;  4X6A J;  4EEF G;  3V78 A;  2AHQ A;  2G0E A;  3KZ9 A;  2FD5 A;  1POG A;  5E3O A;  5DS9 A;  2DA5 A;  3BHQ A;  1ZGW A;  3A03 A;  5F0C A;  2HXO A;  2E2J J;  2L7M P;  1FJL A;  5EF6 A;  3HE0 A;  1GUU A;  4GCL A;  3BR2 A;  1TWH J;  4IEJ A;  2QWT A;  2IEK A;  1UG2 A;  4ICH A;  1BL0 A;  4QIW N;  1WI3 A;  2IU5 A;  1NTC A;  4MFE A;  1WPK A;  3TED A;  4D7M A;  1RKW A;  3PO3 J;  1A5J A;  5FJ8 J;  5AQC A;  2LLK A;  1QVT A;  5IP7 J;  4GFB A;  2M0C A;  2NOG A;  5GP9 A;  1MH4 A;  3JRC A;  1IC8 A;  3VW0 A;  2G7L A;  2FX0 A;  5K7H A;  3HOX J;  4HNV A;  5FLV A;  1MH3 A;  3BR5 A;  1JKQ C;  1JUS A;  2WAQ N;  4A93 J;  1VND A;  5M3M J;  2H8R A;  2HYT A;  5FKL A;  5C44 J;  2Q24 A;  2O9L A;  2Y9Z A;  4IHY A;  3A02 A;  1T56 A;  1ENH A;  1R9T J;  3B81 A;  4DZP A;  2LFB A;  3DEW A;  1JUM A;  1FIP A;  2PMZ N;  3CCY A;  2QIB A;  5F27 A;  2JA8 J;  1D5Y A;  2H1K A;  4JP0 A;  2XPU A;  3C2B A;  2R93 J;  3LJL A;  2RAS A;  3NPI A;  2HXI A;  1MBG A;  2LP0 A;  2MGQ A;  4XIC A;  4CGR A;  2DTZ A;  1P7J A;  2COB A;  2L0K A;  1UI6 A;  1ETY A;  3BG9 A;  3CQZ J;  3TW7 A;  3TP3 A;  5F0H A;  4A3B J;  3VW1 A;  3I4N J;  1Z0X A;  1VI0 A;  2X9D A;  2KDZ A;  1OJL A;  4BXX J;  3BQY A;  2RAE A;  4MIM A;  3ANG A;  2NS8 A;  2XB5 A;  3CMY A; 
#chains in the Genus database with same CATH topology
 4YFK F;  5CVV A;  2X1D A;  4BXU A;  1ZEL A;  2IAI A;  2LY9 A;  3NNR A;  1K79 A;  3B6A A;  3B73 A;  3BQZ A;  4MO7 A;  1QPM A;  1MBE A;  1W7P A;  5E1W A;  3TL4 X;  3H0G J;  3F0C A;  2VLA A;  1MND A;  4U0V A;  2R7W A;  1O3T A;  2IT0 A;  1U5T B;  2DFE A;  3ZR8 X;  4E7Z A;  2F5D A;  5BOX A;  2L02 A;  3H5R A;  3GFL A;  2A07 F;  2WV0 A;  1MBH A;  3GUD A;  5IP9 J;  4XSX F;  2OJE D;  3BR1 A;  3P5J A;  1I39 A;  1TW3 A;  3EET A;  1SVM A;  1M1E B;  3I58 A;  4YII A;  2VL8 A;  2XRL A;  4W97 A;  3X2Q H;  4AIH A;  4ZZD A;  2FU4 A;  1YHQ I;  2YU9 J;  3CDL A;  2L01 A;  4ZH4 F;  2B1E A;  3HSF A;  1VF9 A;  5FFZ A;  4XLP F;  3KYL A;  2W53 A;  3EUH C;  3SFZ A;  3T6N A;  5HAW A;  4HX8 A;  2V9P A;  2K9Q A;  2M7B A;  3ZXS A;  2EIJ H;  1R71 A;  4OD5 A;  2E19 A;  3FXQ A;  3IH3 A;  2ZNZ A;  5L3D A;  5E79 C;  3CCM I;  1WVR A;  4A3J J;  1PP8 F;  2PEX A;  3ZP5 A;  4YEL A;  4KMU X;  3LOC A;  3DWL E;  4IJA A;  1K61 A;  1MKM A;  1R7J A;  3GBG A;  1GV2 A;  1MMA A;  5B66 C;  1V5F A;  2A05 A;  2M9H A;  4MQ9 F;  3ASN H;  1VFC A;  4L9J A;  2QA4 I;  4XNF A;  3QPS A;  3WU1 B;  4XLF A;  2LH9 A;  3VYR B;  5H6Q A;  1R4N B;  4A5M A;  5E3N A;  1Z6T A;  3FXL A;  1Y0N A;  3ABM H;  1VQP I;  2OBP A;  3QYF A;  4UV8 A;  5AIP A;  3VB2 A;  3RIR A;  4LG3 A;  4R79 A;  2WV1 A;  2VE8 A;  4LK0 F;  2ISZ A;  3L9F A;  5TGT A;  1DU0 A;  1RR8 C;  1YQA A;  2Q0O A;  1VQN I;  5FKO A;  2ZBK A;  2EH3 A;  1PJR A;  3HOZ J;  2IS6 A;  1ON1 A;  2H09 A;  4BXF A;  3J7Y J;  3VPR A;  2CW7 A;  3LSP A;  4FCY A;  4CYC B;  1DP7 P;  3FK7 A;  4XID A;  3F6O A;  4PXI A;  2JA2 A;  3FK6 A;  1YRN B;  3FKJ A;  1EF4 A;  3K4N A;  2PBX A;  5CPR B;  4BKX A;  1I50 J;  5DD8 A;  3TO7 A;  2HI3 A;  1FOW A;  3CJR B;  2DYS H;  3U21 A;  1OYY A;  2ACJ A;  1U9O A;  2STT A;  2OCC H;  1QZZ A;  2CW8 A;  3PNV A;  3JRH A;  1T2K A;  1FOK A;  4XK4 A;  3PJR A;  2CO5 A;  2NYX A;  2KKO A;  5FD6 A;  1J9I A;  2JSP A;  5LGN A;  4U9L A;  4EGY A;  4AF5 A;  2BOL A;  1IDZ A;  2KMU A;  2G9W A;  1RUN A;  5LEK A;  1OCZ H;  2XDN A;  2FNP A;  2VON A;  3OYE A;  2BW3 A;  5BNG A;  3CCV I;  2OZU A;  1G2H A;  4KIS A;  4BY7 J;  2DYR H;  2KDO A;  5ED4 A;  4GCT A;  4YZE A;  2H1L A;  1PVE A;  1ETQ A;  2LG4 A;  4UHT A;  1YJW I;  2DG7 A;  4U7B A;  4PFP A;  2DMQ A;  3BOQ A;  5L3G A;  2F5F A;  3ONQ A;  3RKX A;  4I76 A;  4OU0 A;  5GPC A;  5EGO B;  3AKZ A;  3ZMT A;  2ZCW A;  3HUG B;  5B5E C;  4AIK A;  2REK A;  3FMQ A;  1SD7 A;  2IGO A;  5LRR A;  3I5U A;  3CUQ A;  3Q3S A;  5GAE J;  4KIC A;  2EFO A;  1YJN I;  1GLN A;  4EAT A;  2BEO A;  4M74 A;  5BPD A;  3VP5 A;  2GOM A;  2X1C A;  3J80 Z;  2Y30 A;  4RAG A;  1I3A A;  1OCT C;  1UI5 A;  1YE9 A;  2WB1 A;  5D8L B;  4JX6 A;  2QQ8 A;  5DYM A;  3F23 A;  3F8B A;  3DBR B;  2ZNY A;  2H6B A;  3OIP A;  4PCQ A;  1R5H A;  2ZME B;  4G7H F;  5LFA A;  3S16 J;  1Z77 A;  4KT5 C;  2NVY J;  2JPB A;  2EFP A;  1E0E A;  2DBB A;  4FT8 A;  1Y0U A;  3I56 I;  3F6V A;  4BS9 A;  2JMW A;  3FXR A;  3TP0 A;  3VYT B;  1KQ0 A;  5ICG A;  4B47 A;  1XSX A;  2HS5 A;  4HW0 A;  4WXD A;  4XRS G;  1BR4 A;  1OPC A;  1LDK B;  1ITY A;  1TNT A;  2DOA A;  4BNC A;  4CHU A;  1XN7 A;  1A31 A;  3JRB A;  1TQP A;  2Y0M A;  1FTT A;  2O7T A;  1K6Y A;  1GT0 C;  2EA4 A;  1W5T A;  3W6V A;  3IP4 B;  4HV6 A;  4RM2 A;  2YVX A;  1Y39 A;  3RH2 A;  3BNI A;  1HF0 A;  1O3R A;  4HV5 A;  1Q1V A;  4PFO A;  1R22 A;  2ZCM A;  1B4A A;  5K5R A;  4CSW A;  1TZL A;  2O0Y A;  2JK3 A;  3I71 A;  5IYC J;  1DQU A;  1LJ9 A;  3G1L A;  4OIR F;  2DMT A;  2LSO A;  1NG7 A;  1PYV A;  2LK2 A;  2K27 A;  2FNA A;  4G9Y A;  2F5V A;  3W2A A;  2K86 A;  3SHF A;  2IGK A;  5FD5 A;  2HOS A;  3FXM A;  3GTM J;  1TW2 A;  2DCE A;  1J59 A;  1T08 B;  2ME6 A;  2P7V B;  3HTJ A;  1B8I A;  3WTS C;  2BBY A;  3OL4 A;  3ON4 A;  3KLO A;  4PJN A;  5K7Z A;  4OIO F;  3HC7 A;  1I3Q J;  2PFV A;  1ZRE A;  4C2M J;  3BJB A;  2P81 A;  3K1P A;  2Z16 A;  1BR1 A;  4IOA F;  3VOX A;  1HC8 A;  1QO0 D;  2KJC A;  2QCO A;  3OYF A;  3CCU I;  4BQN A;  1WH5 A;  2PG4 A;  3HB9 A;  2JT1 A;  4IZZ A;  1HKQ A;  2DFH A;  3V7C A;  5J1Y A;  4ZYG A;  2IW5 A;  3BCA A;  3ECH A;  2MFZ A;  3ABK H;  1A35 A;  1I6X A;  1WWX A;  3E3V A;  3GW2 A;  1UHS A;  3RKW A;  2R5Y B;  3A4C A;  3CCJ I;  1U2W A;  2V79 A;  1FP1 D;  2GZW A;  4IKF A;  1HKT A;  1KQ9 A;  1SD5 A;  4Y7N J;  2YVE A;  1SAX A;  4HNT A;  3CO7 C;  4EJW A;  1PP7 U;  4KUM A;  2UXN A;  3BG3 A;  4JYK A;  4GFK A;  1VQ5 I;  1E3H A;  1DDN A;  1H9T A;  3CJD A;  1QBJ A;  2CFO A;  1GVD A;  5EZG A;  3REO A;  2EZK A;  1ZR4 A;  1K4T A;  2QYO A;  3KET A;  4BDZ A;  3ZQG A;  2ZXJ A;  1T6S A;  1UMQ A;  1BN5 A;  2IJL A;  4D0P A;  1XGM A;  2XHK A;  3S14 J;  1I6H J;  3KKC A;  4QLC U;  3C3W A;  5TJJ A;  2XGX A;  3E6D A;  3ESW B;  2RNG A;  3JRA A;  4ABZ A;  3DLA A;  3OYN A;  2LC2 A;  4HKU A;  3BTL A;  3WE3 A;  4NUB A;  4DYR A;  3OS1 A;  2Y2Z A;  2WC2 A;  4AU7 A;  2M8G X;  2KRF A;  2HKX A;  4Q47 A;  2EIK H;  1PUF A;  2R7O A;  2DTR A;  2EJR A;  3DP7 A;  4AVZ A;  5K5Q A;  3N4M A;  2LTP A;  5KAI C;  5FRM A;  2Y0S N;  2CQK A;  4RGR A;  2VXZ A;  3S5R A;  1SVO A;  3CMA I;  2DJN A;  2DW4 A;  4L9V A;  2D1V A;  4ASN A;  2HEO A;  3W3C A;  3HJE A;  1DPU A;  4CCJ A;  2CFX A;  1AKH A;  3S17 J;  4Q5S F;  3TOA A;  3JRE A;  4II3 A;  4A3I J;  5CVU A;  4HEA 2;  2ZO4 A;  2NVU B;  1JKR C;  2QKO A;  4PGH A;  2TDX A;  3GTJ J;  3HGG A;  4JQF A;  3DKX A;  1B9M A;  2AS5 F;  1H9G A;  2VQG A;  4KIG A;  2MLG A;  2FEZ A;  1OCC H;  5GPA A;  4NBQ A;  2M1B A;  2VOO A;  3KZY A;  2HVS A;  1W5S A;  3WHC A;  2VUM J;  3OSF A;  2F6C A;  4Y4R A;  1HA8 A;  4GXO A;  3LSG A;  3IH2 A;  3VFZ A;  4YG2 F;  4P1W A;  3CUQ C;  1SC7 A;  2R5Z A;  1D0X A;  2LMD A;  2KIF A;  2QSH X;  5HSZ A;  5GAD J;  4XL9 A;  3L1P A;  2QLZ A;  3BZ6 A;  1FOY A;  2CUJ A;  3BR6 A;  4ESB A;  2E5N A;  2ZY9 A;  2B7E A;  4KN7 X;  2R7D A;  3K1M A;  4L5I A;  4MEX F;  4P9U A;  1JHH A;  3SDG A;  2DFI A;  3DFG A;  1R5G A;  1U9N A;  3LSK A;  3JW4 A;  1G3Y A;  4IF4 A;  5IYB J;  4BBR J;  2M4K A;  3MKW B;  1BI0 A;  2KL4 A;  4XBF A;  3HBL A;  4G12 A;  4U0W A;  4D5F A;  4BL0 B;  2NVT J;  2R7V A;  1YX3 A;  2VC1 A;  4E7J A;  1X1B A;  2OTL I;  1MNE A;  1Z9C A;  3I55 I;  2ZXW H;  2FXA A;  4LB5 A;  3G6E I;  1TWC J;  3SDB A;  2QQB A;  2KIU A;  3BRO A;  2P5K A;  2OC6 A;  2MA3 A;  2F07 A;  3E1S A;  1WRJ A;  3SEQ A;  2K02 A;  2V6E A;  1LPQ A;  2X48 A;  2X6X A;  5EFY A;  4B8X A;  3S15 J;  5D18 A;  2XSJ C;  4NEL A;  3M8J A;  1MIJ A;  3GZI A;  2ID6 A;  2LD5 A;  2XB0 X;  2LBF B;  4B43 A;  3EGQ A;  4GGG A;  3QYE A;  4OIN F;  4A0Z A;  1VQK I;  2DT7 B;  1F4K A;  1A6Q A;  3CJN A;  4ENK A;  4OIP F;  5GAH J;  3KZ9 A;  5E3O A;  3FHN A;  1VQ8 I;  2CWE A;  2PMZ A;  1ZGW A;  3A03 A;  4ZYD A;  4BUP A;  1ZAR A;  2L7M P;  1HQC A;  4LK1 F;  4B48 A;  1FJL A;  3T5X A;  4ZDO A;  3BR2 A;  3H5A A;  1TWH J;  4IEJ A;  2QWT A;  3MCZ A;  1FMW A;  1IF1 A;  4ICH A;  1TLH B;  4A6D A;  2IU5 A;  3K69 A;  3KZI C;  1A5J A;  3LSI A;  4I0A A;  2E1M B;  2LLK A;  2BY0 A;  3WTV C;  3RYR A;  5IP7 J;  3WTW C;  1XTA A;  3M7G A;  2KIM A;  2RGV A;  1VQ9 I;  3VW0 A;  1IC8 A;  2G7L A;  2FX0 A;  3MWM A;  1ZLJ A;  2CV2 A;  4QPO A;  1MH3 A;  3BR5 A;  1VND A;  2QWW A;  3LFK A;  2HYT A;  4LIT A;  4XR6 A;  2O61 A;  2CS3 A;  2O9L A;  4ZYH A;  1SFU A;  4V19 K;  1EJ9 A;  3CCR I;  3A02 A;  2HZD A;  3H3U A;  4II2 A;  3K8P C;  1ENH A;  2CV1 A;  1X3Z B;  2XRN A;  3HSE A;  3DEW A;  4LIU A;  3IC7 A;  5GTI C;  2H6C A;  4G7Z F;  3HG9 A;  4F52 A;  1NH3 A;  5F27 A;  1ZRC A;  2H1K A;  4IL6 C;  3FBN B;  2OA4 A;  2WBM A;  4BHC A;  2GA1 A;  1YTY A;  4CGR A;  1Z6R A;  2L0K A;  2OUM A;  4BYY A;  4HF0 A;  5ILU A;  3BG9 A;  2DOE A;  1D0Z A;  4F92 B;  1K4S A;  1VI0 A;  5AON A;  2KDZ A;  3QOE A;  3Q9V A;  4CUG A;  3ANG A;  3ELK A;  3KEO A;  1SFK A;  2VN2 A;  4RGS A;  4HQM A;  3E6C C;  3KIO A;  2P4W A;  2RVC A;  1P4W A;  3KZZ A;  3L2U A;  4DYQ A;  3OYK A;  2VXD A;  2K4J A;  4J19 A;  1G4D A;  3OYH A;  4JBA A;  2Q8K A;  4IHX A;  5DUI A;  1IUY A;  2W1O A;  3PUF A;  4HX7 A;  3MKY B;  3F72 A;  3I59 A;  3S2D J;  1TL8 A;  2L9R A;  1V4R A;  4B44 A;  2LF8 A;  1ZR2 A;  2LOO A;  1R36 A;  1D3Y A;  3G4S I;  2YPR A;  3F8F A;  5J4V A;  1G3T A;  1ETX A;  3LNQ A;  2BY2 A;  1L0O C;  2WTE A;  4C2T A;  2VOP A;  1EH6 A;  5LHI A;  2ADU A;  2LVS A;  1ZKG A;  5J40 A;  2A5W A;  2Q2E B;  2R4G A;  2QQA A;  3SZT A;  2K3P A;  3SEZ A;  5F1R A;  4BE1 A;  4IX7 A;  3R6S A;  3AL0 C;  2MH2 A;  4Y17 A;  2V4J C;  1W5C C;  2R7Z J;  3UKG A;  3PM1 A;  2QQ9 A;  3ZRG A;  4ITV A;  2MD0 A;  3HYI A;  3UR3 C;  1IXC A;  5J8F A;  1WH7 A;  5JVG F;  1YIT I;  3HHH A;  4A0Y A;  1Z3Y A;  4Q48 A;  1S5L C;  3OR2 C;  3VYU B;  1HSJ A;  2E1O A;  3S2W A;  1I27 A;  3GFJ A;  2B63 J;  1BI3 A;  3F8N A;  3S3O A;  1DGW Y;  2PJR B;  3VTI A;  2M2E A;  1DPR A;  3G1M A;  3GZ5 A;  3NS4 A;  2OAZ A;  4UUS B;  4H0E A;  1REP C;  3BZK A;  2MAB A;  4N9I A;  3VWB A;  2PN6 A;  1QHG A;  3G56 A;  3JTG A;  5HBU A;  5KK1 A;  2D1H A;  2RDP A;  1KA8 A;  1K83 J;  3KNW A;  1W36 C;  2L9S A;  3V8J A;  2RQP A;  1IXS B;  4B3A A;  4L0Z B;  1AHD P;  4JOM A;  1VQ7 I;  1J5Y A;  2X1E A;  3HOT A;  3BDD A;  2LKS A;  1MDM B;  1YFH A;  1ZG1 A;  4DVY P;  1V54 H;  1MSE C;  3VYS B;  3HXL A;  3OV8 A;  2Z33 A;  2W57 A;  4ESJ A;  1GDT A;  1IRF A;  4HAM A;  5ICC A;  2K85 A;  1ZGA A;  4RAZ A;  4O3M A;  3ZQC A;  2EPF A;  3VSL A;  2W24 A;  4X1E A;  4HG2 A;  3R60 A;  2JWT A;  4C2M A;  4NC6 A;  3O60 A;  3OS0 A;  1OR7 C;  4QWQ A;  3MZ8 A;  2GEN A;  2VJ5 A;  2WY8 Q;  1BIA A;  3PL8 A;  3O8H A;  4CCM A;  5EGO A;  5L3C A;  2B9S A;  1E2X A;  2GWR A;  1ZRF A;  2JQ7 A;  3NRG A;  2KFD A;  3HTA A;  2BVM A;  4FE7 A;  1AU7 A;  3CP8 A;  2LF7 A;  1ZH5 A;  2K9N A;  4HOB A;  3GEU A;  3H35 A;  5EYR A;  3ZCO A;  2L5Q A;  4DYC A;  3AG1 H;  5DAJ A;  2VJ4 A;  2KJB A;  2KLO A;  2ZB9 A;  3I4P A;  1P9Q C;  1F9N A;  1Z3X A;  5DM7 F;  4HDU A;  2QBY A;  2EV5 A;  1LDD A;  2E2H J;  3E5U A;  2YX4 A;  4B4C A;  2ME0 A;  3NAU A;  5J4Y A;  2UXI A;  4B1R A;  1K6O A;  3VOE A;  5FLX K;  2OQG A;  2MYS A;  3WOD F;  2XRO A;  3OSG A;  4BE0 A;  3H92 A;  4RB3 C;  2DDB A;  3GFI A;  2EB7 A;  3IV5 A;  4E6K G;  1FZP B;  1R5I D;  2KIQ A;  1MZB A;  1TQI A;  3HPG A;  2ZJ2 A;  2OER A;  1VQ4 I;  4NN1 A;  4D1Q A;  3FIS A;  5EG0 B;  2JJ7 A;  2ZJP F;  5DM6 F;  3ZGK A;  5CXG A;  3DU6 A;  4N9H A;  1HDD C;  1NK2 P;  1FBU A;  3DEE A;  2O5R A;  4IRV A;  2A6H F;  1ULY A;  3HOS A;  4GYI A;  3U9G A;  4DOZ A;  1D5V A;  1X2M A;  4DZJ A;  5AIQ A;  5A2Q K;  4F91 B;  5J1R A;  4LG0 A;  3IUV A;  3QPH A;  2EBI A;  2FJ1 A;  4UNO A;  2EZL A;  3LQQ A;  3S1Q J;  3RCO A;  2MSY A;  3K7A J;  3RZO J;  1FYK A;  4KIT B;  3Q5F A;  1ON2 A;  1WCM J;  2DA7 A;  1YYV A;  5D1R A;  2K40 A;  5IT9 Z;  2O03 A;  3PUB A;  4MEY F;  4BEH B;  2P5L C;  1FTZ A;  4CCK A;  3DPL C;  1GXQ A;  3QOD A;  2IPQ X;  2FMY A;  2HQR A;  2E71 A;  3NEU A;  3GLL A;  2G7U A;  4I01 A;  4EM2 A;  4KWA A;  1G8X A;  3HKZ A;  4E70 A;  2W7N A;  3D1N I;  3CTA A;  2XGD A;  3ECO A;  4HYE A;  3EUA A;  3G1O A;  1KQ8 A;  3BP8 A;  3FMR A;  5FFX A;  2MLK A;  4KA4 A;  2WWY A;  1TWF J;  2QSF X;  1BJZ A;  1TWG J;  2UUZ A;  3M8F A;  1P2F A;  4XLC A;  1XDU A;  1JT6 A;  3OOU A;  4RLF A;  1MSF C;  2HPI A;  2O8K A;  5FRN A;  2D6Y A;  2F2E A;  3RKY A;  3T8R A;  5HOD A;  1F5T A;  3ZMZ A;  5LLQ A;  2EK5 A;  1EH7 A;  1X1A A;  1LNW A;  2HDD A;  2QGU A;  3LL7 A;  5BQT A;  1XGN A;  4KT6 A;  2QEN A;  3GVA A;  4RBO A;  1XC5 A;  1ZG3 A;  2PMH A;  3H0D A;  1CGP A;  3MZH A;  1C0W A;  1X4P A;  2WA0 A;  3KP6 A;  2V57 A;  2JUG A;  4N4N B;  1N75 A;  1ZYR F;  3V7R A;  3N97 A;  1WJB A;  1H8A C;  1MJB A;  2QKL B;  3PFI A;  2QVO A;  3TDU C;  2CJJ A;  5D6E A;  3GXO A;  4IRG A;  3L2R A;  5JVT A;  1KGS A;  4F7Z A;  1IO2 A;  2VPL A;  2YVH A;  3RKQ A;  1ETW A;  2QZ8 A;  5CJ9 A;  4KYW A;  3ISP A;  2BZT A;  4JNN A;  3NAR A;  3O3K A;  1ZG5 A;  1XSV A;  4IVN A;  1TP4 A;  2K9M A;  1Z7L A;  5DUK A;  4DBQ A;  3WTY C;  1Y8Q B;  1YW8 A;  2HQA A;  2DMP A;  3A0B C;  3DTI A;  3FBI B;  3QQA A;  3L2V A;  1GXP A;  4C30 A;  3IWF A;  4F3Q A;  4LOC A;  2GOX B;  2YSR A;  3WU0 A;  1LE8 B;  5GTH C;  5EDN A;  2JA7 J;  3K4J A;  2XIG A;  3DKW A;  2AQE A;  1D1C A;  4CXF A;  3L2W A;  4KFC A;  3OY9 A;  2NVQ J;  3CJQ B;  1WJE A;  4WXH A;  2D45 A;  3F8C A;  2OQR A;  2DU9 A;  1T33 A;  2BY3 A;  1FEX A;  1W0U A;  2JN6 A;  2XAG A;  2DQL A;  4UB6 C;  5BPI A;  5JI6 A;  2NX4 A;  3QBM A;  2M4G A;  2O6G E;  3G73 A;  1O57 A;  4HA8 A;  2EZH A;  1OFC X;  1RET A;  4E7I A;  2XPV A;  2X6W A;  4PJL A;  4AVP A;  1OCP A;  3HPH A;  1MMN A;  1R1U A;  1P6R A;  4UY8 I;  2DOD A;  2WAD A;  1UCR A;  4AD9 A;  3NXC A;  3FHZ A;  4E7K A;  3HTU A;  4KN4 X;  2XAS A;  2ZXI A;  2Y69 H;  4BGD A;  1WHU A;  1IRG A;  3E6B A;  3LFU A;  4CDG A;  2M5W A;  3TO9 A;  3BT9 A;  2F5E A;  2DA3 A;  3I9V 2;  2VAS A;  4IHT A;  2VE9 A;  4YFX F;  1XCV A;  2HDW A;  2TRT A;  2PI0 A;  2L7Z A;  4XM3 A;  5E18 F;  1DU6 A;  3W2W A;  1KU2 A;  3F22 A;  1D8K A;  3IHU A;  3GYH X;  4DJA A;  2DG8 A;  2LRE A;  4PK4 A;  1XMA A;  4ENN A;  5FGL A;  3CDH A;  1IGN A;  2ZC2 A;  1OMI A;  1UHW A;  3AG2 H;  5CQE A;  4CO8 A;  3S1R J;  1BC7 C;  4OAZ A;  2DXI A;  2H94 A;  5EEG A;  1W7P B;  3GTP J;  3K10 A;  3QP5 A;  3BTI A;  3CF2 A;  1F36 A;  2R0Q C;  4XQF A;  2NNY A;  3MMY B;  5FRO A;  3E7Q A;  3OYD A;  2A3S A;  2PLY A;  5C4J J;  1F43 A;  2ETH A;  2XGE A;  1U0J A;  3FRQ A;  4PJM A;  4XLE A;  3JRF A;  4MFD A;  5D4S A;  2CG4 A;  1QU3 A;  5KHD A;  2ZFW A;  3K1N A;  4ANJ A;  1B72 B;  5F6F A;  1BC8 C;  1MGT A;  1ZK8 A;  3BR3 A;  1IDY A;  4RM3 A;  4A3C J;  5HS7 A;  1BI2 A;  3HZJ A;  2NS0 A;  3V8K A;  3CO6 C;  4I7H A;  1FYL A;  3WGH A;  1CQT A;  3CDI A;  2R7U A;  1ZHF A;  3ZMU A;  2VIX A;  2W25 A;  3P9T A;  2YR2 A;  4ACI A;  4XLA A;  3AQS A;  5C3E J;  2IVM A;  1U8B A;  3ON2 A;  2NOJ B;  4C3H J;  3T8T A;  5ILS A;  5LBQ A;  5DTD A;  4RGX A;  2GUH A;  4Y13 A;  1X3U A;  1JI8 A;  1HW1 A;  4UVB A;  4F93 B;  4X6A J;  4P55 A;  4EEF G;  3FXJ A;  2FOK A;  3LA3 A;  4XKV A;  3V78 A;  2AHQ A;  3ZMD A;  1V5E A;  2FD5 A;  2DI3 A;  3OYG A;  4CZZ A;  1SFE A;  3ABL H;  3LA2 A;  4OD4 A;  4UXN A;  4IQJ A;  4HPQ A;  4P9F A;  3CLO A;  1FSH A;  5FLX Z;  2IEK A;  1QA6 A;  1WI3 A;  2K4B A;  1WPK A;  2OU2 A;  3TED A;  2MD5 A;  1RKW A;  4D7M A;  3PO3 J;  2Y48 A;  1OIS A;  2R7T A;  1HXD A;  2EV0 A;  5K7H A;  3HOX J;  2W84 A;  1ONV A;  2DFF A;  5M3M J;  4XKB A;  5C44 J;  2Q24 A;  1R00 A;  3WGI A;  4MHG A;  2Y9Z A;  2RNJ A;  3BY6 A;  5IT3 A;  2WAF A;  1SMT A;  2Z1D A;  4ENJ A;  4ZZL A;  3B81 A;  4DZP A;  1YS6 A;  2LFB A;  5KVR A;  4L0Y B;  2LNB A;  3M1E A;  3ASO H;  3OYM A;  4LLL A;  3IWZ A;  1WJD A;  2PMZ N;  2QIB A;  5A2Q Z;  1R23 A;  3OMY A;  2CV0 A;  1FLI A;  5D5X B;  3GX4 X;  3FM3 A;  1D5Y A;  2JA8 J;  1K78 B;  2VKH A;  4I0B A;  2HXI A;  3CD6 I;  2MGQ A;  2LP0 A;  3QRF F;  1AOY A;  3QYB A;  4G7O F;  4LB6 B;  1SFX A;  4WWC A;  1ETY A;  2NRA C;  5F0H A;  2L2O A;  1J2X A;  3VW1 A;  1Z0X A;  2X9D A;  1RUO A;  2W00 A;  4BHP A;  2AXL A;  2GXB A;  2FML A;  4JL3 A;  2NS8 A;  2XB5 A;  3KLN A;  5D4R A;  3CMY A;  4IRI A;  1MJ9 A;  3TW6 A;  3PSI A;  3COL A;  3M4O J;  2VKE A;  2ZFU A;  1B9N A;  2LY1 A;  4L5E A;  3G71 I;  2DA4 A;  1MMS A;  1ERD A;  3OYA A;  3CZ6 A;  3KP2 A;  3J81 K;  3IUO A;  3CUQ B;  2ECC A;  3T0Y A;  3HOW J;  1LKX A;  1WKM A;  3FMS A;  5DCM A;  3LST A;  1S7E A;  5KNL A;  2HTJ A;  3ROU A;  1IRZ A;  2MBF A;  1X58 A;  1AA7 A;  3DPJ A;  2FBH A;  4G6Q A;  1ZGJ A;  5HVQ C;  3S1M J;  4A3E J;  1RNL A;  3RI4 A;  2UXX A;  1Z21 A;  3LWJ A;  5D6F A;  1R1V A;  1H88 C;  3P9C A;  2BY1 A;  3PAS A;  2P0W A;  3GZ6 A;  2M45 A;  2NXN B;  2FBI A;  1U3E M;  2R92 J;  3RPU A;  3IKT A;  4A3G J;  4A3M J;  1WGX A;  2YU3 A;  1D1B A;  1W4M A;  4A2U A;  1YJ9 I;  2VOD A;  1Z67 A;  4V2G A;  2ZCN A;  1FBS A;  2K5C A;  3VSK A;  3RPU D;  4DNC A;  3K70 D;  4GCK A;  4EJO A;  4YIR X;  5D8K B;  2W85 A;  1QRY A;  4WK8 F;  2PJR A;  1YO5 C;  1UEL B;  2AO9 A;  1UG0 A;  3CME I;  4FTH A;  4AC0 A;  4IHV A;  2Z3Y A;  2X85 A;  2J5O A;  1WFX A;  1O4X A;  1SAN A;  1TBX A;  3DCF A;  3DU5 A;  1KU9 A;  3TKY A;  5DV5 A;  3GTK J;  3ZQ7 A;  5TIS C;  4KIB A;  2XPW A;  1MBJ A;  1IN4 A;  3VUQ A;  4HZF A;  4CIC A;  2IS4 A;  1VQO I;  4XOP A;  3SZP A;  3M8E A;  3OYL A;  4IQ4 A;  4AYB A;  2IBD A;  1X1D A;  2JA5 J;  1MDM A;  1BA5 A;  3E6M A;  1S3J A;  3EYY A;  9ANT A;  5IP6 A;  2JUC A;  1J75 A;  2KHM A;  4LIV A;  4RMN A;  1QZY A;  1S9H A;  2JZY A;  4ZC3 A;  3Q0W A;  4CCO A;  3Q0V A;  3R0A A;  1KU7 A;  1T0F A;  4CZC A;  1N25 A;  3ZOB A;  5HNF A;  3QU6 A;  4TV7 A;  1T39 A;  1F1Z A;  2A5Y B;  4AM3 A;  4CCN A;  1BI1 A;  4LFU A;  2UZK A;  3K2A A;  1B8I B;  3BZC A;  3HIM A;  1UFM A;  2EV6 A;  3LQR A;  4FET A;  3A2K A;  1SD6 A;  2OCE A;  1Y6I A;  1EH8 A;  1V5G A;  2PQ8 A;  2FBK A;  3LSJ A;  1EKE A;  1N78 A;  2MC3 A;  4QSH A;  3D0S A;  2L3D A;  1BOA A;  3FM5 A;  1JJ8 C;  4WIB A;  1OYW A;  1SGM A;  5FLM J;  1TQM A;  1I1S A;  3BJO A;  2LRD A;  1ETO A;  2OZ6 A;  4D5C A;  1P7I A;  2XC7 A;  2XDV A;  4PZJ A;  1RZ4 A;  4KMF A;  4S05 A;  5DCF A;  3OR1 C;  3NQO A;  1V3F A;  3Q0U A;  3K6G A;  2CGP A;  2DN0 A;  4ENM A;  2DAO A;  3S93 A;  3C1D A;  4JKZ A;  2H27 A;  4BQO A;  3BTC A;  1U5T A;  1ETV A;  3NRV A;  1FP2 A;  3VVZ A;  2LKX A;  3H5N A;  2XAU A;  3VEP A;  5E3L A;  5D5W B;  3RD3 A;  2BE5 F;  3C07 A;  2GIV A;  1KZH A;  1LUJ B;  4XLN F;  3CP2 A;  2FA5 A;  1VZ0 A;  3A01 B;  2ZOY A;  5H9T A;  2A61 A;  3LHQ A;  1W0T A;  3DF8 A;  5F1J A;  1R4M B;  2JVH A;  2Z5U A;  3FX3 A;  2X0L A;  4DIQ A;  4Z6Y A;  3I4M J;  1S7A A;  1Z05 A;  5CLS A;  3ZQF A;  1STZ A;  3JRI A;  4HDV A;  1JTX A;  4ON0 A;  2Z9O A;  4EJT A;  5H20 A;  2ELJ A;  4L62 A;  3MVP A;  2YUS A;  4FIS A;  1JT0 A;  4U9N A;  4BEH A;  4MTD A;  3CMM A;  3KE2 A;  3HTI A;  4UUV A;  6PAX A;  3HSR A;  3EYI A;  2IS2 A;  2VT3 A;  1X1P A;  1A36 A;  3HHG A;  3AL0 B;  3ANP A;  2E7X A;  5HNH A;  1LVK A;  3R61 A;  4RLQ A;  1VQM I;  2VJI A;  1LEB A;  2A6T A;  4U0Y A;  2M8E A;  3DPT A;  3QP6 A;  4E7L A;  2M34 A;  3TQN A;  5LGU A;  1TC3 C;  1MBK A;  2K7L A;  2M7A A;  3WGG A;  1TTY A;  3SYT A;  2GQQ A;  2HQ5 A;  4GRI A;  4L9N A;  1Y1W J;  2OF7 A;  1V55 H;  4M72 A;  2HVQ A;  1O7L A;  1GV5 A;  2HZT A;  1ACI A;  1ZLK A;  2PX9 A;  3M1C A;  4NQW B;  4OMY A;  1N77 A;  5HLG A;  3H3Z A;  3H36 A;  2YX7 A;  4IO9 F;  4I6Z A;  2XAJ A;  3K0L A;  3ML6 A;  2FQ4 A;  1U8R A;  2VPR A;  2BV6 A;  2V1D A;  4MLO A;  2XKP A;  2KRC A;  4AID A;  5IOY A;  2E60 A;  1WQ2 A;  4CYC A;  3WTT C;  3FF5 A;  3KKD A;  1S7O A;  1X19 A;  2XSD C;  2R5Z B;  4X0G A;  4OMZ A;  3LAP A;  3CC7 I;  4NB5 A;  1LDJ A;  2E1N A;  1YRN A;  4MQV A;  4PSW A;  4BY1 J;  1U78 A;  4D9J A;  2IRF G;  1XCB A;  3C2H A;  3LAJ A;  5D5V B;  3WG9 A;  2NP5 A;  1FOX A;  4RAY A;  1HLV A;  2RQQ A;  3LSM A;  3QAH A;  5HDN A;  1DUX C;  3ZQL A;  5F64 A;  1RRJ A;  4OIQ F;  2QKM B;  1MMD A;  3NWS A;  3B02 A;  2CMP A;  3HKZ N;  1H89 C;  3IH4 A;  2V1X A;  2IP2 A;  3BWG A;  3PPB A;  5JFR A;  1RI7 A;  4B09 A;  1LE8 A;  2DK8 A;  4S04 A;  1MJA A;  2ZOZ A;  3KPH A;  1FY7 A;  1ORK A;  2XF7 A;  3ZMV A;  1HW5 A;  4M3E A;  2KRH A;  5E20 A;  3HUG A;  3BTJ A;  2DLL A;  3J7Z I;  2HKU A;  1BJA A;  4MNU A;  3SQN A;  4UUT A;  4E4H A;  2UXU A;  4LMY A;  3PIO F;  1IUF A;  1Y56 A;  4F55 A;  3COA C;  2IS1 A;  1ZRD A;  2HYG D;  3PQK A;  5BMZ A;  1IN8 A;  1DGR M;  3L09 A;  5FB2 A;  4RGU A;  2NVX J;  4AC6 A;  3KP7 A;  2CUE A;  3MEX A;  2F4O B;  2HWV A;  3W6J B;  5ICE A;  1LB2 A;  5IOZ A;  1FSE A;  1RPW A;  2QF7 A;  2XF6 A;  3J81 Z;  4BBS J;  2ZME A;  5HOO A;  4HLX A;  3HRU A;  4FAS D;  1YS7 A;  1SD4 A;  2CQX A;  4DBR A;  3KYC B;  1T98 A;  3FZV A;  1HKS A;  2DA1 A;  3GTL J;  2A6E F;  3O6B B;  4HSR A;  2V1N A;  1GVJ A;  2W82 A;  4Y33 A;  3CCL I;  3MKL A;  5IPA A;  3ZQH A;  3HOV J;  3QU3 A;  3H3V K;  1EA3 A;  2JRM A;  5KAF C;  5F0F A;  5JLW A;  2GIZ A;  1XB4 A;  5EEH A;  1G3S A;  1BW6 A;  2XVC A;  5B1A H;  1CF7 B;  5TRD A;  2RHA A;  3K4K A;  3RTR A;  3S32 A;  3BR0 A;  1XS9 A;  3V42 A;  1YG2 A;  1Z7U A;  1FC3 A;  1P4X A;  2A69 F;  1IN7 A;  2HOT A;  3GZN B;  4JK1 X;  2OV7 A;  4DQ2 A;  2L7F P;  5CW8 A;  5IYD J;  4EMS A;  2DA6 A;  1X3W B;  3LMM A;  1UB9 A;  5FMP A;  3S3N A;  1BOB A;  1S6L A;  3SZG A;  3VVY A;  2V6C A;  4RB2 C;  2VKD A;  1WJ5 A;  1Y1V J;  4ZTF A;  4C2U A;  1ZTR A;  3DLL F;  1Q1H A;  3PQJ A;  4FX0 A;  1FBQ A;  1FPQ A;  1W7P D;  4RS8 A;  2FUG 2;  4A3L J;  2WB1 N;  4HX4 A;  3QWL A;  4QPQ A;  1T38 A;  1B6A A;  2GA2 A;  2L7K A;  1B72 A;  4L5J A;  3HIF A;  2EQR A;  5J47 A;  4WX9 A;  1U5T C;  2HOA A;  3F21 A;  1SVL A;  4EQQ A;  2KP6 A;  2VQH A;  3IKV A;  3F1B A;  3ZQI A;  2I10 A;  2ZSH B;  1ODD A;  3DV8 A;  4R1H A;  2HKO A;  2GM4 A;  1J7K A;  1YLF A;  1DP3 A;  2M87 A;  2CQQ A;  5LEJ A;  2RV8 A;  4XKC A;  3I59 B;  4RB0 A;  3OYB A;  1OCO H;  2DO7 A;  5LD2 C;  3P7N A;  5LRS A;  1YW7 A;  2FSW A;  1WJC A;  4O5V A;  3TO6 A;  2EFW A;  3VVX A;  3RPQ A;  1IV8 A;  1O7F A;  3QKX A;  3HOU J;  3CES A;  1B1B A;  4N4O B;  3R0J A;  1S8N A;  1KON A;  2XGC A;  4XOT A;  4C3I J;  4EM1 A;  1XPX A;  3HTH A;  4YEJ A;  1HCR A;  4XRM A;  5LHG A;  2GBY A;  3C7J A;  4BDY A;  1JKO C;  3CJT B;  4FE4 A;  3DTK A;  1HBX G;  3L7W A;  3SXY A;  2R5Y A;  3PFY A;  1XDS A;  3VDX A;  2WAQ A;  1BW5 A;  1NG6 A;  2XV4 S;  5EEA A;  4A3D J;  5BS6 A;  4BJ6 C;  1ETK A;  4G94 A;  2OI8 A;  5FHP A;  3JRG A;  3ZPL A;  3HDD A;  1LFB A;  3BJ6 A;  5HDK A;  4EV0 A;  1ZAO A;  2E35 A;  2RC4 A;  5HLI A;  2CQ7 A;  4M6X A;  2MH9 A;  2G0E A;  4AIJ A;  2O8X A;  4BQA A;  1OKR A;  2ICW G;  2P8T A;  1POG A;  1WJF A;  3PSF A;  5DS9 A;  4KDP A;  3BHQ A;  5F0C A;  2HXO A;  1E3P A;  1Z91 A;  2L9N A;  3HE0 A;  3ZQQ A;  4HLY A;  1GUU A;  4GCL A;  2G7H A;  4AWX B;  4GO1 A;  1UG2 A;  2HNH A;  2NAZ A;  4QIW N;  3GEZ A;  1QGP A;  4OOI A;  5LGT A;  2XAF A;  5AQC A;  1QVT A;  1HW2 A;  4GFB A;  3M9A A;  3RDI A;  1MH4 A;  3TMO A;  1K7A A;  1FMV A;  3FWE A;  5FLV A;  2WAE A;  1JKQ C;  4ZTJ A;  2UV1 A;  1UAA A;  5FKL A;  2QSG X;  3KFW X;  3JAM K;  1K78 A;  2ESH A;  2IA0 A;  3GFM A;  3EUK L;  2AXT C;  3L2Q A;  3DTE A;  1XX5 A;  1R9T J;  2XKO A;  5LHH A;  5JHU A;  4A12 A;  1JUM A;  4CYD A;  1JXS A;  3S8P A;  4CA0 A;  1QZE A;  4ZDP A;  4DGW B;  1BBY A;  4JP0 A;  2XPU A;  2ZSI B;  1VQL I;  3C2B A;  3LJL A;  3H9G A;  2RAS A;  3W6K B;  1O3S A;  4WXC A;  2A68 F;  3NPI A;  2K9L A;  1MBG A;  5DD4 A;  3I64 A;  3HTS B;  3CQZ J;  2QUF A;  4A6E A;  1OJL A;  4U88 A;  1RC9 A;  3K4L A;  3BQY A;  1IRX A;  4MIM A;  4A0X A;  4BAC A;  2VT2 A;  3PNY A;  1TNS A;  2QBY B;  1T95 A;  3OIO A;  2VBY A;  2CW0 F;  3J7A O;  2HPM A;  3KP4 A;  3LA7 A;  3EQL F;  4I2O A;  1JUP A;  3QOP A;  3F9K A;  1IG7 A;  1TWA J;  3S1N J;  2X51 A;  3BCB A;  4BHB A;  1TT0 A;  2ZJR F;  2P7C B;  4MXM A;  3GTG J;  3KP3 A;  4GYG A;  5J1U A;  3WG7 H;  4UVC A;  2ZME C;  1SFO J;  2MC4 A;  2CSO A;  4CH7 A;  2BGC A;  2K9S A;  3PNT A;  2QEX I;  3SJM A;  3OWT A;  1IJW C;  1LVA A;  3IRQ A;  1YI2 I;  2F48 A;  2EIM H;  3DBH B;  2IA2 A;  3Q9S A;  3HGY A;  2OPT A;  1IXR C;  4RDU A;  3G7R A;  1QHH D;  2M30 A;  2F4I A;  1LEA A;  5HS9 A;  2MW8 A;  3BPX A;  5FKN A;  1RES A;  2B0L A;  2V9V A;  4Y15 A;  2Z99 A;  1XMK A;  4M3D A;  2GXG A;  3ULQ B;  2DDA A;  2AQF A;  3BC8 A;  4LG0 B;  3KYD B;  2R7X A;  1S29 A;  2V26 A;  2VBW A;  4I99 C;  4ME9 A;  1WJA A;  3D5L A;  4J00 A;  2UXO A;  2LBF A;  1IW7 F;  2DT6 A;  2EWN A;  1YIO A;  5FKM A;  5K7F A;  3C2G A;  1LFU P;  2ZKZ A;  5D19 A;  4GCV A;  3PIP F;  2KZG A;  4BAY A;  4EJV A;  2KPM A;  1QVU A;  1RIO H;  1USS A;  2FRH A;  4XKW A;  5DEQ A;  4A3F J;  1R49 A;  4P96 A;  1Z1D A;  1SMY F;  1E3O C;  3JSO A;  4G6T B;  2KIS A;  4J01 A;  2Y75 A;  2PBI A;  3F3X A;  1A6I A;  4NDL A;  5C4Y A;  4BE2 A;  2LDU A;  5E3M A;  1LFP A;  2TCT A;  4XLH A;  4RB1 A;  3MD2 A;  3MKZ A;  3ABT A;  5E1X A;  1JGG A;  1UST A;  2IGN A;  1ZN2 A;  3JSJ A;  1X1C A;  4QTR A;  4JX4 A;  3ZN1 A;  5HLT A;  2EIN H;  3WE2 A;  2L4M A;  3FXO A;  3GWZ A;  4RA2 A;  2X6O A;  1YIJ I;  1IN6 A;  2DK5 A;  4R8H A;  2NP3 A;  2N8G A;  3OIQ A;  4I02 A;  1YX5 A;  4PGG A;  4S0H B;  4MK6 A;  2IXS A;  5ILV A;  2DPU A;  2JVG A;  3W2V A;  2DOF A;  2H8W A;  4M3F A;  5K58 A;  2CQN A;  4P5O A;  3KX2 A;  3EPZ A;  2MG4 A;  3MFK A;  1VTN C;  2EFQ A;  5E8I A;  4HRI A;  2E34 A;  1SAU A;  2JRT A;  5CVI A;  1AWC A;  4IXA A;  4JX5 A;  4M3B A;  2ZCX A;  2I8D A;  3U1D A;  3BG6 A;  4WCG A;  2DA2 A;  2V7F A;  4AYB N;  1RR7 A;  4M73 A;  2I5U A;  1FIA A;  4NC7 A;  4UVA A;  3AG3 H;  1XMX A;  4Y52 J;  3T1B A;  4ZDL A;  4Q4Z F;  3CWR A;  1FT9 A;  2R7F A;  3NWT A;  3BG5 A;  4WF2 A;  1KYZ A;  5K5O A;  2NNN A;  1O3Q A;  1JTY A;  1NHA A;  3L00 A;  4L9T A;  4Y3O A;  5M3F J;  4IOC F;  3MNL A;  2BW3 B;  1MMG A;  3FXK A;  4NNJ A;  3KEQ A;  3HRS A;  4YIF A;  3A01 A;  4I09 A;  3HOY J;  4M6Y A;  3ERE D;  3GO5 A;  2DMU A;  2ESN A;  4C3J J;  3WU2 C;  2X4H A;  4XRF A;  3FDY A;  3P9K A;  4M3G A;  2CRG A;  2A2F X;  1EV7 A;  4EJU A;  5B1B H;  3TGN A;  4H4K C;  3VIB A;  2RKH A;  2R3S A;  4KNY A;  1XGS A;  5L3B A;  1MBF A;  3I54 A;  4U87 A;  3KP5 A;  2GAU A;  2ELH A;  3VOD A;  2WGB A;  2FE3 A;  3UNG C;  2NS7 A;  1NK3 P;  1R1T A;  3HEF A;  3RYP A;  1D8J A;  2Q2E A;  1I1G A;  2WUI A;  2G7S A;  1QPI A;  2P6T A;  1QQI A;  5H6R A;  2FBQ A;  3O8G A;  1XD7 A;  1HDP A;  1L3L A;  4XSZ F;  4O6J A;  2J5P A;  4M6V A;  1D1A A;  3HL2 A;  2EA2 A;  3OS2 A;  3A1Y A;  1BR2 A;  2Z2S B;  1BIB A;  3TOB A;  5DDG A;  3S3M A;  5F04 A;  1X2N A;  3AQT A;  4A5N A;  4EVI A;  4NQW A;  5FO5 A;  2V1U A;  4L18 B;  3ZN0 A;  3CCS I;  2HQN A;  2ZXH A;  4Z2Y A;  2E1C A;  4GDF A;  3MAJ A;  3BJA A;  3VOK A;  3HM5 A;  2M0M A;  3PO2 J;  2QM3 A;  2ID3 A;  1UHM A;  2LKP A;  4PJJ A;  5CKT A;  5ERI A;  2VJJ A;  3DEU A;  4LGW A;  1JHF A;  4BU2 A;  2IGM A;  4M71 A;  4UUS A;  2VKV A;  2B3W A;  1OYI A;  3R4K A;  1T8I A;  2VQL A;  4U7D A;  1W36 D;  4MTE A;  1YOV B;  3ABU A;  3H9Q A;  3OOP A;  2UXH A;  2E5Z A;  3GTO J;  3KCC A;  4KJZ A;  2EZI A;  1R6R A;  1OR7 A;  3I53 A;  5E1Z B;  3JRD A;  2OTJ I;  3M3Y J;  2RN7 A;  1QNT A;  3E0J B;  3TDZ C;  2Y31 A;  3HRM A;  4E7S A;  5ICF A;  1W1W E;  3E5Q A;  5C4X J;  5IY5 H;  4IHS A;  1JGS A;  2BHZ A;  3JAM Z;  3L2C A;  1S72 I;  3IAS 2;  2HGC A;  5IT9 K;  3K4B A;  3EUP A;  3C18 A;  2W48 A;  4A3K J;  1HST A;  1U6G A;  3K4C A;  2VQC A;  3OL3 A;  1IN5 A;  2HYF A;  2BYV E;  2JPC A;  1OQY A;  1APL C;  3DXJ F;  1PUE E;  3RQI A;  3CC4 I;  4GFL A;  3D5R C;  2BHY A;  2VC0 A;  2QTQ A;  2HTS A;  3G2B A;  2GFN A;  2R7Q A;  5E17 F;  5CVR A;  2HYJ A;  3GF2 A;  4A69 C;  3IL2 A;  4UV9 A;  3K4M A;  4NHJ A;  1JJ6 C;  2STW A;  2O3F A;  2Y0S A;  2O7O A;  2KQR A;  2L9V A;  2JTV A;  2WY7 Q;  2PFB A;  4RAF A;  5EZH A;  3O2P E;  3DKY A;  2VB6 A;  4M9X A;  5KCM A;  4BQQ A;  4XRS A;  2RRE A;  1E17 A;  3VW2 A;  2D5V A;  3JCU C;  2L4A A;  3B6C A;  3BPV A;  2CUZ A;  4IRH A;  3BCG A;  3RQ4 A;  3OYJ A;  4W1U A;  4E7H A;  3U1K A;  1BM9 A;  3GTQ J;  4PSX A;  2FOW A;  3WTZ A;  2ECB A;  3M07 A;  1UZC A;  2E1M C;  2FJI 1;  2YS9 A;  4FHT A;  2QOP A;  3MN2 A;  1MD0 A;  2HOE A;  3P9I A;  3RZD J;  4BJ5 C;  4OWR B;  2R7R A;  5EG0 A;  2P6S A;  4XOR A;  4G6D A;  3U2R A;  1P4A A;  4G8X A;  4HF1 A;  2DQR A;  2HU9 A;  3E7L A;  3K2Z A;  4CCL A;  3BG7 A;  1CF7 A;  2E2I J;  1G3W A;  5M5X J;  3MZY A;  3WTX C;  1IAW A;  1MNM C;  4D7N A;  2E7W A;  3EUH A;  3GLX A;  5L3E A;  3I0T A;  3OYC A;  4M9Z A;  2IA1 A;  3FKI J;  2XAH A;  4BH9 A;  5JR3 A;  4UB8 C;  4ETS A;  4HF2 A;  1WSU A;  3E97 A;  3AG4 H;  4DW6 A;  2ISY A;  1RKT A;  2P5V A;  4CGZ A;  1UJ8 A;  2XAQ A;  3N05 A;  3H9J A;  5CXI A;  2DPD A;  2G7G A;  3V7S A;  1ZQ3 P;  1FNN A;  3JR9 A;  3BRU A;  1YW9 A;  1PUF B;  4FQG A;  2BXZ A;  1IV6 A;  2Q1Z B;  4K2E A;  3CRJ A;  1B59 A;  3DQV C;  1J0R A;  4PJ0 C;  2CUF A;  3IRR A;  4IHW A;  2L54 A;  1IZ1 A;  4NC8 A;  2LYC A;  2FQ3 A;  2BVL A;  3LSH A;  3TBI A;  3E5X A;  1XG1 A;  2EFN A;  4I98 B;  4ZJZ A;  4M9S A;  3H1C A;  1AKH B;  3LWF A;  4LD5 A;  3CCE I;  2LR8 A;  2UXP A;  3F8M A;  3WTU C;  3CF5 F;  3JSP A;  5M5Y J;  3AFH A;  4LLN A;  2CU7 A;  3K9T A;  2UWM A;  3SFI A;  3CCQ I;  3S2H J;  3J80 K;  5M5W J;  4AUX A;  2G3B A;  4XON A;  2HR3 A;  1JE8 A;  4XN0 A;  4UDS A;  3JTH A;  4PUS A;  2ELK A;  4FX4 A;  1J09 A;  2K3F A;  2D2W A;  2PZ9 A;  2CYY A;  1TT5 B;  2GXA A;  2KT0 A;  5DCM B;  3V6G A;  2PMU A;  5JLX A;  2XUB A;  5CQG A;  4HBL A;  5CYV A;  2FF4 A;  5HDG A;  3I3L A;  1WZ2 A;  5F08 A;  3EDP A;  3LSR A;  1HOM A;  3DBL B;  1XSD A;  1JKP C;  1GHC A;  3NI7 A;  3V8L A;  3OYI A;  5CVJ A;  2GLO A;  2JSC A;  1WI9 A;  1FX7 A;  4LLG F;  2JA6 J;  4V2F A;  2VI6 A;  4PDK A;  2PJP A;  3QPL A;  3AAF A;  2DMN A;  1FYM A;  1SEU A;  5H2F C;  1H0M A;  3DPU A;  2VBZ A;  3FIW A;  1VQ6 I;  5FKK A;  4XN3 A;  1X4O A;  2BXY A;  1LQ1 A;  2Y9Y A;  3K70 C;  2HVR A;  1R58 A;  4EGZ A;  5GAG J;  3WHB A;  5FGM A;  1OLT A;  1I5Z A;  3KEY A;  3CUO A;  4BJT A;  4HNU A;  3BLY A;  4ZYE A;  2C6Y A;  1FWZ A;  1A04 A;  2HFH A;  2DA5 A;  3FXU A;  2E2J J;  2X6Y A;  4N0B A;  4C9Y A;  5HLH A;  3GCM A;  3RJP A;  2F4M B;  5EF6 A;  3G3Z A;  2DT5 A;  4OAY A;  2VBX A;  1BL0 A;  1NTC A;  4MFE A;  3ZMS A;  1G6N A;  2R7S A;  4YFN F;  5FJ8 J;  3QPT A;  2DJI A;  4B3X A;  4ESF A;  4HQE A;  1XGO A;  2M0C A;  2NOG A;  5GP9 A;  3JRC A;  5J6X A;  5EJC A;  4HNV A;  2W4S A;  1G59 A;  4HST A;  1JUS A;  2WAQ N;  4A93 J;  2LY2 A;  4IPA A;  1MW7 A;  2H8R A;  2HDC A;  5L3F A;  4MGR A;  4IHY A;  4XMY A;  3A0H C;  2KZV A;  4EM0 B;  2M3A A;  2V9K A;  4LJZ F;  1KU3 A;  1T56 A;  5K1Y A;  2ZJQ F;  2CH0 A;  1T0F C;  5JHF A;  5D5U B;  3CC2 I;  1D0Y A;  3ERM A;  1FIP A;  3IAM 2;  3CCY A;  1Y8R B;  2OD5 A;  4YRV A;  1OCR H;  5HS8 A;  3J7A Y;  3D5S C;  3MQ0 A;  2R93 J;  1PDN C;  3V4G A;  1P92 A;  3GME A;  2EIL H;  2XF5 A;  2F5C A;  4XIC A;  5B3S H;  2DTZ A;  1KYW A;  1P7J A;  2COB A;  4KIF A;  1UI6 A;  3HRT A;  3TW7 A;  4A3B J;  3TP3 A;  3RSN A;  2E36 A;  4ZYA A;  2COM A;  3I4N J;  5J8C A;  4BXX J;  2RAE A;  5E8G A;  3SWH A;  5J3L A;  3CLQ A; 
#chains in the Genus database with same CATH homology
 3OIO A;  3TW6 A;  2IAI A;  2LY9 A;  3NNR A;  3COL A;  3B6A A;  3M4O J;  3BQZ A;  2VKE A;  4MO7 A;  4L5E A;  4DYQ A;  1JUP A;  1MBE A;  2DA4 A;  3H0G J;  4J19 A;  1IG7 A;  3F0C A;  1TWA J;  3S1N J;  2ECC A;  3HOW J;  4IHX A;  1S7E A;  1IRZ A;  4MXM A;  1X58 A;  3GTG J;  3DPJ A;  1MBH A;  5IP9 J;  3S2D J;  5J1U A;  3BR1 A;  4JL3 A;  2L9R A;  1SFO J;  3S1M J;  4A3E J;  1ZR2 A;  2K9S A;  2XRL A;  4W97 A;  3LWJ A;  3SJM A;  2YU9 J;  1IJW C;  3CDL A;  1VF9 A;  1H88 C;  2W53 A;  1ETX A;  3LNQ A;  3PAS A;  3HGY A;  2OPT A;  3T6N A;  5HAW A;  2K9Q A;  2R92 J;  4RDU A;  4A3G J;  3G7R A;  4A3M J;  2E19 A;  2LVS A;  1WGX A;  3IH3 A;  2MW8 A;  5FKN A;  1ZKG A;  1RES A;  4M3D A;  4V2G A;  4A3J J;  2ZCN A;  4GCK A;  3LOC A;  1K61 A;  1QRY A;  3UKG A;  2R7Z J;  3GBG A;  1GV2 A;  4ME9 A;  3PM1 A;  2M9H A;  2AO9 A;  4FTH A;  2UXO A;  4AC0 A;  1VFC A;  4IHV A;  5FKM A;  5K7F A;  3QPS A;  1LFU P;  5D19 A;  1WH7 A;  1O4X A;  1SAN A;  3DCF A;  1QVU A;  5E3N A;  2E1O A;  3GTK J;  4A3F J;  2B63 J;  1E3O C;  2XPW A;  1MBJ A;  2WV1 A;  3VUQ A;  1A6I A;  4NDL A;  5C4Y A;  5E3M A;  2TCT A;  2M2E A;  2IBD A;  1DU0 A;  3G1M A;  2JA5 J;  4UUS B;  1BA5 A;  5FKO A;  2EH3 A;  1JGG A;  3HOZ J;  9ANT A;  5IP6 A;  5HBU A;  3G56 A;  3JSJ A;  3VPR A;  4QTR A;  3Q0W A;  3LSP A;  4FCY A;  1K83 J;  3Q0V A;  4CYC B;  4JX4 A;  3KNW A;  3FK7 A;  4XID A;  3ZOB A;  4B3A A;  2X6O A;  4PXI A;  1AHD P;  3FK6 A;  2NP3 A;  1YRN B;  2N8G A;  1EF4 A;  2PBX A;  3K2A A;  1B8I B;  4BKX A;  1I50 J;  4S0H B;  3HIM A;  4MK6 A;  2HI3 A;  1MSE C;  1U9O A;  3JRH A;  1GDT A;  4M3F A;  5K58 A;  3LSJ A;  4XK4 A;  3ZQC A;  2MG4 A;  4X1E A;  2JWT A;  3O60 A;  4AF5 A;  4QSH A;  1IDZ A;  4JX5 A;  4M3B A;  2GEN A;  2ZCX A;  3O8H A;  5EGO A;  2XDN A;  3NRG A;  3HTA A;  4FE7 A;  2DA2 A;  5BNG A;  1JJ8 C;  1AU7 A;  1G2H A;  4AYB N;  2K9N A;  1SGM A;  1RR7 A;  5FLM J;  3GEU A;  4BY7 J;  5EYR A;  4GCT A;  1FIA A;  4YZE A;  2DG7 A;  4DYC A;  1ETQ A;  4Y52 J;  5DAJ A;  1ETO A;  3CWR A;  2ZB9 A;  2DMQ A;  3BG5 A;  4D5C A;  1P7I A;  2E2H J;  4I76 A;  5EGO B;  4B4C A;  5GPC A;  1JTY A;  3MNL A;  2ME0 A;  3NAU A;  5M3F J;  2UXI A;  3Q0U A;  4B1R A;  2REK A;  2DN0 A;  3OSG A;  3A01 A;  4JKZ A;  3HOY J;  3Q3S A;  3BTC A;  2DMU A;  4C3J J;  1ETV A;  3VVZ A;  3VP5 A;  3IV5 A;  2LKX A;  4M3G A;  2Y30 A;  2CRG A;  1OCT C;  1UI5 A;  4JX6 A;  5E3L A;  3RD3 A;  3C07 A;  3VIB A;  2OER A;  3S16 J;  4NN1 A;  3FIS A;  5EG0 B;  3A01 B;  1MBF A;  2JJ7 A;  1Z77 A;  2ZOY A;  5H9T A;  3LHQ A;  2NVY J;  5CXG A;  1W0T A;  5F1J A;  1HDD C;  1NK2 P;  2WGB A;  2NS7 A;  1NK3 P;  3I4M J;  3JRI A;  3HEF A;  3ZQF A;  1JTX A;  4L62 A;  1X2M A;  2JMW A;  3TP0 A;  3MVP A;  2YUS A;  4DZJ A;  2WUI A;  2G7S A;  4FIS A;  1JT0 A;  1QPI A;  4XRS G;  5J1R A;  3HTI A;  2FBQ A;  3O8G A;  3IUV A;  1ITY A;  2EBI A;  1HDP A;  2FJ1 A;  2EZL A;  4M6V A;  3S1Q J;  2MSY A;  3K7A J;  3RZO J;  3ANP A;  3JRB A;  5F04 A;  1FTT A;  1X2N A;  3AQT A;  2O7T A;  1GT0 C;  1WCM J;  3W6V A;  2DA7 A;  3RH2 A;  5D1R A;  2K40 A;  3BNI A;  1HF0 A;  2M34 A;  1TC3 C;  1FTZ A;  1MBK A;  1Q1V A;  2ZCM A;  3VOK A;  3HM5 A;  2HQ5 A;  1Y1W J;  2OF7 A;  3PO2 J;  2JK3 A;  5IYC J;  2ID3 A;  4KWA A;  1GV5 A;  3D1N I;  4UUS A;  3G1L A;  2DMT A;  2XGD A;  2VKV A;  3G1O A;  2LK2 A;  4I6Z A;  2FQ4 A;  1TWF J;  2VPR A;  4MLO A;  4CYC A;  5IOY A;  1BJZ A;  3KKD A;  1TWG J;  2XSD C;  2R5Z B;  2HOS A;  1JT6 A;  3OOU A;  1MSF C;  2O8K A;  3GTM J;  2UXH A;  1YRN A;  2D6Y A;  5HOD A;  2ME6 A;  4BY1 J;  3GTO J;  1U78 A;  1B8I A;  3HTJ A;  2EZI A;  3ON4 A;  3JRD A;  5K7Z A;  3M3Y J;  1I3Q J;  4A3L J;  2HDD A;  4C2M J;  2Y31 A;  3BJB A;  5C4X J;  2P81 A;  2NP5 A;  3VOX A;  2QCO A;  4RBO A;  1XC5 A;  1WH5 A;  1HLV A;  3HB9 A;  3EUP A;  2W48 A;  5J1Y A;  4A3K J;  3ZQL A;  2V57 A;  1H8A C;  1APL C;  3RQI A;  3HKZ N;  1UHS A;  4GFL A;  2CJJ A;  1H89 C;  3IH4 A;  2R5Y B;  2QTQ A;  3PPB A;  2GFN A;  2YVH A;  1LE8 A;  2HYJ A;  4A69 C;  4Y7N J;  3RKQ A;  1ETW A;  2YVE A;  2ZOZ A;  1ORK A;  1JJ6 C;  4M3E A;  4JNN A;  3BG3 A;  2O7O A;  3NAR A;  4JYK A;  4GFK A;  3CJD A;  3BTJ A;  1GVD A;  2HKU A;  5EZG A;  2DMP A;  3QQA A;  5EZH A;  2EZK A;  1ZR4 A;  2UXU A;  4UUT A;  4XRS A;  1IUF A;  3VW2 A;  4LOC A;  3ZQG A;  2D5V A;  3B6C A;  1LE8 B;  1UMQ A;  5EDN A;  2JA7 J;  3BCG A;  2NVX J;  4AC6 A;  4W1U A;  2CUE A;  3S14 J;  2NVQ J;  3GTQ J;  1I6H J;  3KKC A;  2ECB A;  5IOZ A;  1RPW A;  2YS9 A;  2QF7 A;  2QOP A;  3MN2 A;  4BBS J;  3JRA A;  3RZD J;  4ABZ A;  1T33 A;  5EG0 A;  1FEX A;  1W0U A;  2CQX A;  2JN6 A;  5J3L A;  3E7L A;  4HKU A;  2E2I J;  3BTL A;  2DA1 A;  3GTL J;  2NX4 A;  5M5X J;  4DYR A;  3QBM A;  2Y2Z A;  1MNM C;  2M8G X;  4D7N A;  2EZH A;  1OFC X;  1RET A;  2XPV A;  3MKL A;  5IPA A;  3ZQH A;  1PUF A;  3HOV J;  1OCP A;  2LTP A;  3FKI J;  3H3V K;  2Y0S N;  5F0F A;  3S5R A;  5JLW A;  3NXC A;  4DW6 A;  1BW6 A;  2RHA A;  2DJN A;  1RKT A;  3BR0 A;  1XS9 A;  5CXI A;  2G7G A;  1ZQ3 P;  3JR9 A;  1AKH A;  3S17 J;  3BT9 A;  3BRU A;  3JRE A;  4A3I J;  1PUF B;  2HOT A;  2DA3 A;  1IV6 A;  3CRJ A;  2L7F P;  5CW8 A;  5IYD J;  1JKR C;  2CUF A;  2TRT A;  2DA6 A;  3GTJ J;  2QKO A;  2L7Z A;  3HGG A;  5FMP A;  4IHW A;  1DU6 A;  3VVY A;  1XG1 A;  1Y1V J;  1ZTR A;  5GPA A;  1AKH B;  2DG8 A;  2LR8 A;  2UXP A;  5M5Y J;  5FGL A;  2CU7 A;  3SFI A;  1IGN A;  2WB1 N;  3WHC A;  2VUM J;  3OSF A;  5M5W J;  3S1R J;  4AUX A;  3S2H J;  3LSG A;  3IH2 A;  2G3B A;  1B72 A;  2EQR A;  2R5Z A;  4UDS A;  2HOA A;  2ELK A;  3GTP J;  5HSZ A;  2PZ9 A;  3BTI A;  3L1P A;  3F1B A;  1F36 A;  3BR6 A;  2I10 A;  3ZQI A;  2R0Q C;  3E7Q A;  2KT0 A;  3V6G A;  2GM4 A;  5JLX A;  5C4J J;  1F43 A;  2CQQ A;  2XGE A;  3SDG A;  3FRQ A;  1U9N A;  5F08 A;  5IYB J;  4BBR J;  3JRF A;  4MFD A;  3LSR A;  1HOM A;  1JKP C;  3HBL A;  3NI7 A;  4G12 A;  1B72 B;  3VVX A;  4D5F A;  3QKX A;  3HOU J;  3BR3 A;  1ZK8 A;  2GLO A;  2NVT J;  1IDY A;  2XGC A;  4C3I J;  4A3C J;  3HTH A;  1HCR A;  2JA6 J;  4V2F A;  2VI6 A;  4XRM A;  2GBY A;  1CQT A;  1TWC J;  1JKO C;  3QPL A;  4FE4 A;  2DMN A;  2R5Y A;  2F07 A;  3P9T A;  3FIW A;  4ACI A;  5FKK A;  3AQS A;  2X48 A;  1BW5 A;  5EFY A;  5C3E J;  3S15 J;  2Y9Y A;  1U8B A;  3ON2 A;  4A3D J;  5EEA A;  5D18 A;  4C3H J;  2GUH A;  4NEL A;  1ETK A;  5DTD A;  2OI8 A;  3GZI A;  5FHP A;  2ID6 A;  3WHB A;  3JRG A;  3HDD A;  2LD5 A;  2XB0 X;  1LFB A;  3EGQ A;  4X6A J;  4EEF G;  3V78 A;  2AHQ A;  2G0E A;  3KZ9 A;  2FD5 A;  1POG A;  5E3O A;  5DS9 A;  2DA5 A;  3BHQ A;  1ZGW A;  3A03 A;  5F0C A;  2HXO A;  2E2J J;  2L7M P;  1FJL A;  5EF6 A;  3HE0 A;  1GUU A;  4GCL A;  3BR2 A;  1TWH J;  4IEJ A;  2QWT A;  2IEK A;  1UG2 A;  4ICH A;  1BL0 A;  4QIW N;  1WI3 A;  2IU5 A;  1NTC A;  4MFE A;  1WPK A;  3TED A;  4D7M A;  1RKW A;  3PO3 J;  1A5J A;  5FJ8 J;  5AQC A;  2LLK A;  1QVT A;  5IP7 J;  4GFB A;  2M0C A;  2NOG A;  5GP9 A;  1MH4 A;  3JRC A;  1IC8 A;  3VW0 A;  2G7L A;  2FX0 A;  5K7H A;  3HOX J;  4HNV A;  5FLV A;  1MH3 A;  3BR5 A;  1JKQ C;  1JUS A;  2WAQ N;  4A93 J;  1VND A;  5M3M J;  2H8R A;  2HYT A;  5FKL A;  5C44 J;  2Q24 A;  2O9L A;  2Y9Z A;  4IHY A;  3A02 A;  1T56 A;  1ENH A;  1R9T J;  3B81 A;  4DZP A;  2LFB A;  3DEW A;  1JUM A;  1FIP A;  2PMZ N;  3CCY A;  2QIB A;  5F27 A;  2JA8 J;  1D5Y A;  2H1K A;  4JP0 A;  2XPU A;  3C2B A;  2R93 J;  3LJL A;  2RAS A;  3NPI A;  2HXI A;  1MBG A;  2LP0 A;  2MGQ A;  4XIC A;  4CGR A;  2DTZ A;  1P7J A;  2COB A;  2L0K A;  1UI6 A;  1ETY A;  3BG9 A;  3CQZ J;  3TW7 A;  3TP3 A;  5F0H A;  4A3B J;  3VW1 A;  3I4N J;  1Z0X A;  1VI0 A;  2X9D A;  2KDZ A;  1OJL A;  4BXX J;  3BQY A;  2RAE A;  4MIM A;  3ANG A;  2NS8 A;  2XB5 A;  3CMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...