1RPWA

Crystal structure of the multidrug binding protein qacr bound to the diamidine hexamidine
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator qacR
publication title Crystal structures of QacR-diamidine complexes reveal additional multidrug-binding modes and a novel mechanism of drug charge neutralization.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 63
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rpwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1rpwA02
3BR1A 1MH3A 4DYQA 5M5XJ 1IDYA 2G3BA 5D1RA 2EH3A 5JLXA 2XPUA 5EZHA 2HOAA 4FE7A 5GPCA 1XS9A 5IYDJ 2QOPA 2CUEA 2IU5A 3QKXA 3KNWA 4C3HJ 2Y9YA 4D5FA 5F0FA 5F27A 3JR9A 1GUUA 4M3EA 1ETQA 1X2NA 3G1OA 3JRIA 4AYBN 1RKWA 2ID3A 4GFLA 5CW8A 2E2HJ 3GTKJ 3TW7A 2FJ1A 1IV6A 2GUHA 1JKOC 1JT6A 1TWGJ 1LFUP 1WPKA 5GP9A 1BL0A 4BY1J 1TWAJ 2JA7J 1RR7A 4JX5A 1D5YA 2CUFA 3NAUA 2EZIA 5E3LA 1OCPA 2DMQA 1ZTRA 1IG7A 4AC6A 1ZK8A 2O7TA 3NPIA 1RESA 1IGNA 3BRUA 2Y31A 3MVPA 2NS8A 3S5RA 1QRYA 2ZOZA 5FKLA 3D1NI 3BTIA 2GFNA 3PM1A 5DS9A 4Y7NJ 2DA3A 5IP6A 2COBA 3QQAA 3BQZA 4G12A 3L1PA 2TCTA 4NDLA 3M4OJ 2PZ9A 2QKOA 2UXUA 1TWFJ 3IUVA 3HGYA 1BW6A 4EEFG 2MSYA 2XDNA 3BTCA 3C2BA 3GTQJ 2L0KA 3HTIA 4JX4A 2DA7A 1ITYA 5EEAA 4KWAA 2LD5A 3HOUJ 5IOYA 4MK6A 2DA4A 2DG7A 1SANA 1LFBA 2LP0A 4AC0A 4IHYA 2HKUA 5EDNA 2GBYA 2M2EA 5HAWA 1FTTA 1JJ6C 3LWJA 1Y1VJ 2LLKA 1I50J 2DA1A 3ZQFA 5H9TA 4CYCB 3BG9A 2LVSA 4M3GA 1AKHA 3V6GA 1HOMA 1HCRA 2L7FP 5F04A 1VFCA 3W6VA 4HNVA 4J19A 4DYRA 2ECBA 2R5YB 3DCFA 1W0UA 1WGXA 2V57A 3O8HA 3RZDJ 5IOZA 3HIMA 1U78A 2G0EA 4M3BA 1U9NA 3OIOA 2XB5A 3SFIA 3JRGA 3B81A 1O4XA 2X48A 2ZB9A 2D6YA 2XB0X 5CXGA 4IEJA 2NP5A 4MIMA 3FISA 3ZQLA 1GT0C 4L5EA 1YRNA 2VUMJ 1ZKGA 1FIAA 5J3LA 3GTMJ 1IJWC 2JK3A 3HOZJ 5C4YA 1H88C 5EFYA 4MFEA 1ZR4A 2CU7A 4MLOA 5HODA 2NVYJ 1IC8A 2R0QC 1RPWA 2HQ5A 2M0CA 4X1EA 2JA5J 2M9HA 1B8IA 1MSFC 3NNRA 1PUFA 2DA6A 3B6AA 3JRCA 5E3NA 3LNQA 1K61A 2DA2A 1HLVA 3HEFA 4JP0A 2D5VA 2JA6J 3S16J 4V2FA 3TEDA 4IHVA 3OSGA 5IYCJ 4MFDA 2VI6A 1RKTA 5F0HA 3IV5A 2YVEA 1CQTA 2YVHA 3BTLA 5FJ8J 2MG4A 5FHPA 2E2IJ 3LSRA 3S1NJ 4MXMA 4RBOA 1RETA 2O7OA 3Q3SA 1LE8B 3VW1A 3WHCA 2REKA 5HBUA 3BT9A 2EZLA 1BW5A 3BCGA 5C3EJ 4BKXA 5EGOB 3VPRA 2QIBA 4UUSA 2FX0A 3WHBA 2OI8A 4I6ZA 5FKOA 1S7EA 1VF9A 3BR3A 3TP0A 2H8RA 3M3YJ 2G7SA 4V2GA 4W1UA 3CMYA 1WI3A 1GDTA 2XGEA 3GTLJ 3DEWA 1JUSA 2XGDA 1MH4A 3JRBA 1EF4A 1MBFA 2H1KA 4JKZA 4PXIA 2YUSA 3MNLA 2R92J 3BR6A 5E3OA 3LSPA 4GCKA 2CQXA 4A93J 2HXOA 3JRHA 3F0CA 1JTXA 1X2MA 3JREA 3GTJJ 3V78A 3IH3A 5C44J 4A69C 2W48A 1HDDC 5EYRA 1TC3C 2QWTA 2WB1N 2GLOA 2QF7A 2EZKA 1Q1VA 5DTDA 2DN0A 3S14J 1VNDA 2P81A 4A3MJ 3PPBA 1MBEA 3A01B 5M3MJ 3FK7A 3E7LA 2XRLA 2HOSA 1A5JA 1I6HJ 4D7NA 5FKMA 4A3GJ 4JL3A 2KT0A 3RQIA 2F07A 5IYBJ 3HOXJ 3NI7A 2Y30A 3HKZN 4FCYA 3HE0A 4A3KJ 2I10A 2DJNA 1R9TJ 5FMPA 3OSFA 3BTJA 3TW6A 1F43A 3BHQA 1QVTA 3RZOJ 4BBRJ 3VW2A 5FGLA 3JRAA 1JTYA 3BQYA 2ZOYA 3CRJA 4QTRA 2O9LA 3G56A 4UUTA 1JKPC 4M6VA 2K40A 1BJZA 1Z77A 2Y2ZA 1JT0A 3S2HJ 1ENHA 1QVUA 1VI0A 3DPJA 2QCOA 4GFKA 3H0GJ 1WH7A 2OPTA 5D18A 2OF7A 4A3IJ 1OCTC 1HF0A 3MKLA 2XPVA 3BR2A 3CCYA 4L62A 2WV1A 2LKXA 3GTGJ 3HGGA 4W97A 5EG0A 1GV5A 2NP3A 4C3JJ 4C2MJ 3A02A 4JNNA 1GV2A 1XG1A 2E2JJ 2R5ZA 3AQSA 1POGA 3ZOBA 4FTHA 1H8AC 3S2DJ 2XPWA 2M8GX 5C4JJ 2PBXA 4CGRA 5F1JA 2NVQJ 3HOYJ 1JUMA 2FBQA 3VVZA 1BA5A 3GZIA 5EZGA 5F08A 3K2AA 2KDZA 2UXPA 5M5YJ 1I3QJ 2L7ZA 2Y0SN 2JWTA 3SJMA 2ELKA 3ZQGA 3S1QJ 3T6NA 2XGCA 4BXXJ 2L9RA 3S15J 1UMQA 2NVTJ 3NARA 2XSDC 1MNMC 3IH4A 5C4XJ 3LOCA 4DYCA 2CRGA 2JMWA 4B1RA 3MN2A 2R93J 3S17J 3K7AJ 5D19A 2PMZN 1QPIA 5GPAA 3S1MJ 2HXIA 2M34A 3BR0A 1FJLA 1NK2P 3ZQHA 4AUXA 2UXIA 4RDUA 1ETOA 2LR8A 3I4NJ 2DMUA 2JJ7A 3ANGA 2W53A 4IHXA 3P9TA 1B72A 1UG2A 2DA5A 3LHQA 4GCLA 1X58A 2RHAA 2VPRA 3FKIJ 1OFCX 3LJLA 4ME9A 2MW8A 2LK2A 3IH2A 1IDZA 2HI3A 1UHSA 1Y1WJ 1ETKA 3E7QA 2WUIA 3ZQIA 1U9OA 3VIBA 3VUQA 3VP5A 1AKHB 3BR5A 1UI5A 4FISA 1OJLA 5IP9J 4XRSA 5CXIA 3ON4A 4JYKA 2ME6A 1HDPA 1XC5A 3HM5A 2YS9A 2R5YA 4DW6A 4LOCA 4B3AA 3VOXA 2K9SA 2WGBA 1TWHJ 2ZCXA 3QBMA 4NELA 4BBSJ 1AHDP 4YZEA 5EG0B 1NK3P 2E1OA 1K83J 2EBIA 2X6OA 2LFBA 4A3JJ 3S1RJ 1YRNB 3FRQA 3O60A 3VVYA 1ZGWA 3HOVJ 5FLVA 2O8KA 9ANTA 2R5ZB 3CJDA 1FTZA 2K9NA 2Y9ZA 4M3FA 4B4CA 2GENA 1B8IB 1ETVA 2HYJA 2IEKA 1PUFB 3BJBA 3NRGA 3QPLA 4GCTA 2AO9A 3HTHA 3JRFA 1IRZA 2FD5A 1MSEC 3OOUA 3FIWA 3PO2J 5BNGA 2Q24A 2VKVA 4C3IJ 2GM4A 3NXCA 1A6IA 2CQQA 3TP3A 4ACIA 4DZJA 3RKQA 1SGMA 1MBKA 3B6CA 5FLMJ 1E3OC 3VVXA 5M3FJ 4MO7A 1JKRC 2ECCA 3ANPA 2X9DA 2N8GA 4IHWA 2RAEA 5FKKA 1NTCA 1ZQ3P 2OERA 3SDGA 3FK6A 2JA8J 3LSGA 3GTPJ 2HYTA 4QIWN 3BG3A 1ETYA 4A3CJ 2ID6A 1WCMJ 3Q0UA 4AF5A 2TRTA 1UI6A 4ICHA 1ORKA 4FE4A 3EUPA 1B72B 3I4MJ 1LE8A 5K58A 1ETWA 5M5WJ 3BNIA 4XIDA 3KKDA 1G2HA 4XK4A 4S0HB 5HSZA 4A3BJ 2G7GA 5J1UA 5JLWA 1FIPA 2JN6A 4D5CA 3GBGA 3Q0VA 1MBHA 2R7ZJ 3VOKA 3HB9A 3PASA 1GVDA 4UUSB 5EGOA 5AQCA 3RH2A 3RD3A 1H89C 4HKUA 3G1LA 3JSJA 1JUPA 3H3VK 4A3DJ 3G7RA 4A3FJ 2G7LA 1U8BA 2DTZA 4Y52J 4NN1A 4DZPA 5K7ZA 2DMTA 2UXHA 2B63J 4A3LJ 3HTJA 2ZCNA 1T33A 2FQ4A 4JX6A 2QTQA 3HDDA 2NX4A 3CDLA 3QPSA 1P7JA 1JJ8C 2YU9J 1TWCJ 1WH5A 5FKNA 1JGGA 3O8GA 5F0CA 2HDDA 5IPAA 3EGQA 1MBGA 1DU6A 2IBDA 4XRMA 3C07A 4D7MA 5K7HA 4I76A 3UKGA 1SFOJ 3F1BA 3KZ9A 3KKCA 4BY7J 2LY9A 3HBLA 3LSJA 4XRSG 3JRDA 2UXOA 3ON2A 2LTPA 5J1YA 4X6AJ 1DU0A 2IAIA 3HTAA 2ME0A 3PO3J 5IP7J 1FEXA 5DAJA 2E19A 1ZR2A 4A3EJ 3CWRA 3A01A 2EZHA 1F36A 2VKEA 4QSHA 2CJJA 2RASA 2DMNA 4ABZA 2NS7A 5J1RA 3AQTA 3GEUA 2WAQN 1P7IA 2AHQA 4M3DA 2K9QA 1AU7A 1JKQC 2MGQA 2EQRA 2HOTA 2L7MP 4XICA 3G1MA 3A03A 2DG8A 2NVXJ 3COLA 3HOWJ 1ETXA 1IUFA 5EF6A 3VW0A 4UDSA 2ZCMA 1Z0XA 2NOGA 1APLC 3BG5A 1T56A 5E3MA 3Q0WA 1W0TA 4CYCA 1MBJA 2DMPA 5K7FA 4GFBA 3CQZJ 3GTOJ 3ZQCA
chains in the Genus database with same CATH superfamily
4DYQA 4HOBA 5M5XJ 1IDYA 2QSHX 5FFZA 1SD6A 4HX8A 5D1RA 3HRUA 5JLXA 2XPUA 4A6EA 3FX3A 2CUEA 3QKXA 3KNWA 5CVIA 3HJEA 4D5FA 1I5ZA 5F0FA 3K70D 3JR9A 3LFUA 1X2NA 3JRIA 5CW8A 4GFLA 3ONQA 3EYYA 2UXXA 2VT2A 2HVQA 3ESWB 2GUHA 2Z16A 3V7SA 1TNSA 1TWGJ 5D6EA 1Z1DA 4BH9A 3P5JA 4BY1J 1JHFA 1BL0A 3ECHA 1IW7F 3RTRA 1FOKA 2F6CA 1CGPA 2W24A 2J5PA 2XUBA 1ZTRA 2O7TA 1WFXA 3IAS2 4XMYA 1FYMA 4LLNA 1G59A 3S5RA 2ZOZA 2GFNA 1UHMA 3DWLE 3L2QA 5IP6A 5HDNA 2EPFA 3RKYA 1JHHA 1HW1A 3DTKA 3KIOA 3IUVA 2DQLA 1BJAA 1FYKA 5IT9K 1D1BA 4ZYHA 2F4MB 1Q1HA 2D2WA 3B02A 2ZXJA 5B1AH 1ITYA 1Z9CA 1FMVA 4OIPF 2LD5A 2QUFA 4QLCU 3M9AA 2VC1A 4MK6A 2LP0A 2VE8A 4GYIA 4IHYA 2HKUA 3ZGKA 3KLOA 1R5GA 4Z2YA 1EH6A 4CZCA 4HRIA 3SWHA 4Q47A 1YQAA 4HW0A 1I50J 4Y17A 3ZQFA 4DBRA 2XAFA 4CYCB 4E7JA 5H9TA 3NRVA 2P6TA 3SQNA 4NC8A 3L2UA 2D45A 4EQQA 2VIXA 1QO0D 3G3ZA 1JXSA 1X3UA 1VFCA 3W6VA 2E34A 2X85A 1MMNA 4J19A 1W0UA 2ECBA 2V57A 1YITI 4KUMA 1KU7A 1U78A 2L2OA 4P96A 3MKYB 3OYEA 3PSFA 2XB5A 2K9LA 2H8WA 3B81A 3COAC 3K70C 1SFUA 2D6YA 1W7PA 1RRJA 2DPUA 2XB0X 5CXGA 3JTHA 5E18F 1B6AA 3ZQLA 3AG2H 2VBZA 3SZPA 2XRNA 3R60A 5FD6A 3GTMJ 1IJWC 2LDUA 4MFEA 3BDDA 1RR8C 2COMA 4MLOA 5H6RA 5HODA 1Y56A 2HQ5A 2IP2A 2M0CA 3OIQA 4X1EA 3G4SI 2JA5J 2M9HA 1N78A 2IS4A 1PUFA 4M71A 5JVGF 2QKMB 4WF2A 2DA6A 1TQIA 3HRMA 3GCMA 3M1CA 1WJEA 1HLVA 5DDGA 5CVVA 2D1VA 2JA6J 2BY3A 3TEDA 3O3KA 2HPMA 3I64A 2V9PA 5IYCJ 2VI6A 4V19K 4XRFA 1TZLA 4MEXF 1NG7A 2P7CB 3E0JB 2J5OA 4EVIA 3EUAA 3QOPA 1RETA 1TW2A 4GXOA 3Q3SA 2FBHA 1LFPA 1WVRA 3WHCA 3JAMK 4D9JA 2Z3YA 4XOTA 3HUGB 4ENMA 1BW5A 1USSA 2P4WA 3EUHA 3J80K 3QP6A 5HS7A 4HG2A 1QBJA 3VPRA 2QIBA 2DQRA 2CFOA 2CQNA 1XX5A 2GZWA 3RIRA 1KONA 1MKMA 5FKOA 1S7EA 4AIDA 3VYUB 3FMRA 4KT6A 3TP0A 3N4MA 3RYPA 4E70A 5LLQA 2XVCA 3K4BA 3CMYA 4BDYA 2ESNA 1FOWA 1MMDA 4AVPA 1MMGA 3FF5A 1VQ4I 2Z2SB 2XGDA 1MH4A 2A68F 4JKZA 3S93A 2AQFA 5E3OA 4CICA 4WWCA 3PIOF 3CD6I 1O3QA 3CJQB 4Y13A 3JRHA 1VQ8I 1JTXA 4QWQA 1KU2A 1HDDC 3CC4I 2W48A 3LWFA 5EYRA 4ZJZA 2QWTA 4HPQA 3I53A 2OZ6A 5DTDA 2DN0A 3S14J 2HU9A 3E7LA 2D1HA 2KZGA 3DPLC 4RB1A 1A5JA 4FASD 3DKXA 3DPUA 2ZJPF 2KT0A 2DFHA 2DLLA 4XLAA 3HHGA 5KAIC 3HE0A 3QYBA 2HTJA 4PJNA 2ZJQF 3OS0A 2DJNA 1HKQA 5JFRA 1OYYA 2HYGD 2Q2EA 3CUQC 5ICEA 3OSFA 5BPIA 4BBRJ 3ERED 2XF7A 1XTAA 3VW2A 2JSPA 1FBSA 2QSGX 1BIBA 3DBRB 4HLYA 3ABTA 2P5LC 2DDBA 2A3SA 3NWSA 1KYZA 3PQJA 2K40A 3S2HJ 1MMSA 4U7DA 3BPXA 2LG4A 4ON0A 4A3IJ 2K86A 4E6KG 1YE9A 4HZFA 4P55A 4P5OA 1UHWA 2VXZA 3HGGA 4W97A 2W57A 3F8CA 5DCFA 4FX0A 4PCQA 4C2MJ 4IOCF 5D5XB 4EJVA 4NC7A 1Y6IA 4ZDOA 1RUOA 2R5ZA 3NEUA 4IXAA 1S8NA 2XPWA 1D5VA 4CGRA 1T0FC 3EETA 1YG2A 2NVQJ 1JUMA 3GZIA 5ERIA 1D0XA 2O5RA 3K2AA 3MD2A 5ILUA 2UXPA 2Y0SN 2JWTA 3FKJA 2WB1A 2CH0A 4QPQA 1FC3A 4JQFA 3P9IA 3RPUD 4BQQA 2V4JC 2XGCA 3R61A 2L9RA 1ZREA 5BS6A 3U9GA 4N4OB 1K7AA 1UMQA 3LAJA 2DODA 4XN0A 2CWEA 4HDVA 2R93J 2KIQA 3K7AJ 3F6OA 5D19A 1QPIA 2HXIA 3GWZA 3BR0A 1NK2P 4BL0B 2BXYA 3HKZA 2UXIA 3U1DA 2DMUA 3V7CA 4J00A 3CC2I 3P9TA 3T0YA 3T8TA 2E5NA 1FMWA 1UG2A 2EFPA 2YU3A 4L9TA 4LFUA 3FKIJ 1ZHFA 3M8FA 2HVRA 2ELJA 4BUPA 3E7QA 3ZQIA 2FMLA 2OV7A 3GZ6A 4EMSA 3BR5A 1AKHB 1E3HA 2LSOA 2VXDA 4U0VA 4E7SA 5IP9J 4XRSA 4E7IA 3CDIA 3ON4A 5CXIA 4I99C 1QZYA 1Z7UA 5K5QA 2A2FX 1E2XA 3HM5A 3VEPA 2XV4S 1R4NB 2CW8A 4GYGA 2EIMH 4B3AA 3VOXA 2K9SA 2CO5A 2KHMA 1IV8A 4CCLA 2JPBA 3H9GA 3IWFA 3ASOH 3KEYA 2ZKZA 1KZHA 2EBIA 4A3JJ 2X6OA 4CCOA 2DPDA 1YRNB 3O60A 3OYLA 3ZMVA 5FLVA 2K4JA 2O8KA 1XCBA 1BI1A 1FWZA 3CCVI 1FTZA 4G7ZF 1YYVA 4UY8I 4M3FA 4U0WA 4G7HF 2EFOA 5F1RA 1B8IB 2C6YA 4GGGA 2IEKA 1U5TC 1W36D 2FA5A 4GCTA 2K27A 2R4GA 4XSXF 2EV6A 3F9KA 1OMIA 1XDSA 2IGNA 1IRXA 3RQ4A 3FIWA 2K02A 2ZXIA 3PNYA 3PO2J 2CUJA 2VKVA 3GFJA 4JBAA 5KCMA 2JT1A 3TP3A 2GM4A 3NXCA 2VASA 2W1OA 1DDNA 4MGRA 5IY5H 2Z9OA 2R7OA 4IHSA 1JKRC 2O8XA 3GYHX 2NRAC 2X9DA 2N8GA 4H4KC 3A0BC 2RAEA 3MEXA 5FKKA 1ZQ3P 1ZGJA 3FK6A 4EM0B 3GTPJ 2KMUA 1F4KA 1LDJA 4RB3C 4CZZA 2KZVA 1R5ID 3MZHA 4U9LA 1QA6A 1ETWA 2XAHA 5M5WJ 3CO7C 3BNIA 3KKDA 2HPIA 4LLGF 1WQ2A 4S0HB 3WTYC 4A3BJ 3HUGA 1R23A 3T5XA 4CSWA 3GBGA 2EIKH 2BXZA 3GO5A 3OR2C 3VOKA 2MH9A 3HB9A 4YIIA 2ACJA 3S32A 3PASA 4UUSB 2B1EA 5AQCA 1Y0NA 5FFXA 1H89C 3MFKA 2DFEA 2RVCA 4OMZA 5FRNA 3H3VK 1XDUA 2BV6A 3G7RA 4A3FJ 5B66C 2CV2A 2VODA 2A61A 4XBFA 2E71A 4Y52J 2B0LA 1AA7A 5L3EA 1GHCA 3E1SA 2FQ4A 3JSOA 2L9NA 3KCCA 1YX5A 2W84A 4EJOA 1WKMA 1P7JA 1JGGA 5J47A 3O8GA 2IBDA 2QM3A 2IA1A 3E6BA 3RJPA 3R6SA 1SFOJ 3SZGA 3PSIA 1ACIA 2V1NA 3KKCA 4ENJA 1DPUA 2DOFA 4TV7A 1UZCA 5J1YA 3DPTA 4UXNA 1DU0A 3OIPA 3C2HA 3KYCB 2ME0A 2DCEA 2L3DA 3PO3J 4AVZA 5DAJA 1ZR2A 1YHQI 2V6CA 2EZHA 1F36A 4I0AA 4ABZA 2NS7A 5J1RA 1VQNI 1YS7A 5TGTA 3GEUA 2HTSA 3ML6A 1P7IA 2AHQA 1V3FA 1KQ9A 4M3DA 4BAYA 2O3FA 4XLNF 2X6WA 4A5MA 2OA4A 2K9MA 4LB6B 3K2ZA 2HOTA 4HDUA 2ZBKA 2ZSIB 4ZYDA 1I6XA 3COLA 3BROA 5B5EC 3FHZA 3GFMA 3HOWJ 5EF6A 5H6QA 5E20A 2O61A 4F3QA 2NOGA 2BY0A 1MJ9A 1APLC 1W1WE 2I8DA 1T56A 3Q0WA 4DGWB 3J7ZI 2K7LA 2DMPA 1HW5A 1J5YA 1W0TA 4I2OA 2E1MC 2M7BA 2Y69H 1WJFA 3BR1A 4NNJA 3HPGA 2QEXI 1XGMA 3M1EA 4RA2A 5ED4A 1J0RA 3BJ6A 1TT5B 4X0GA 2G3BA 2A5WA 2EH3A 4IX7A 5EZHA 5GPCA 2QOPA 1XSXA 1R58A 2RC4A 1A35A 1MNDA 3ABKH 1P9QC 3FXUA 1NH3A 5F27A 4KFCA 3G1OA 1IRGA 3SYTA 1U2WA 3VYSB 3IKVA 1XD7A 4NC6A 4RAZA 2FJ1A 2NYXA 5DYMA 1JKOC 3RSNA 4HEA2 3CJTB 3WU2C 5GP9A 3CCRI 1TWAJ 1ZN2A 4JX5A 3PNVA 5F64A 1D5YA 4ZYGA 3VOEA 5E3LA 2CYYA 3VWBA 1OCPA 4HNTA 1S7OA 1PYVA 4ZZDA 1HSTA 1T95A 1IGNA 2NS8A 2FXAA 1QRYA 1SFKA 2FOKA 2H27A 3J7YJ 4ESBA 3PM1A 1KA8A 1TL8A 1B9NA 2DA3A 3K1MA 1FPQA 4A0YA 1LB2A 2VQCA 4IRIA 1BW6A 4EEFG 2MSYA 5J8CA 2ZJRF 2MABA 2CUZA 3C2BA 5BOXA 2L0KA 3GTQJ 3HTIA 4RAFA 1VQOI 3EPZA 2R7FA 2Z1DA 1XPXA 1NG6A 4N0BA 5EEAA 2DOAA 3HOUJ 2BW3B 3W6KB 3GEZA 2M1BA 4NBQA 1LFBA 1OPCA 3E97A 3UNGC 1VQLI 4AC0A 2WC2A 2M87A 5LFAA 5EDNA 1YJNI 4L5IA 3F22A 3SHFA 2ZMEB 4UB6C 3GZ5A 2GBYA 3WTSC 5B3SH 2STTA 1FTTA 4AD9A 1JJ6C 3ECOA 2CW7A 2LLKA 3F8FA 3LWJA 4B47A 3H3UA 2XAJA 1VQ6I 2JZYA 1XSDA 1AKHA 4I7HA 1A04A 2M0MA 1W5TA 1U5TB 1HCRA 3S3MA 3S3NA 1HBXG 4BNCA 4M6XA 4F91B 1LKXA 1WGXA 4HF0A 3CC7I 3ZMTA 5IOZA 1X19A 3I58A 1U9NA 4I02A 4YELA 3OIOA 2KFDA 2DTRA 4AYBA 3JRGA 2ZB9A 5FD5A 1J59A 3BOQA 2UXNA 4KITB 1K78A 2RQQA 2NP5A 5KAFC 4IF4A 3FM3A 4EJTA 1LVAA 1MW7A 3K4NA 1VQ9I 4L5EA 1YRNA 2VUMJ 3N05A 3U21A 1FIAA 1R1VA 3S2WA 3DLLF 1H88C 4F92B 4E7ZA 2F5CA 2A6EF 1RPWA 3DU6A 2PI0A 4OD5A 3KYDB 2G7HA 4ANJA 4WIBA 1B8IA 3NNRA 1B1BA 4PJMA 2M8EA 2PJPA 2P5KA 3H5AA 5E3NA 3HSRA 3LNQA 2KIUA 2DOEA 3HEFA 3E6DA 1XGNA 2B9SA 3S16J 1ZLKA 2HEOA 1G3WA 5B1BH 3OSGA 4IHVA 4DQ2A 3QOEA 4YFXF 4A2UA 2PN6A 1ODDA 2F4OB 1WJDA 2STWA 3IP4B 4KMFA 2E7XA 3LA7A 2MG4A 2KQRA 3CDHA 1SAUA 5TJJA 4DJAA 2BY2A 3LSRA 3DU5A 4OIOF 3S1NJ 1X1CA 3CMAI 3BWGA 3VSLA 4B48A 4B44A 3VW1A 2EIJH 3IRRA 3KEOA 1FBUA 4P9FA 2EZLA 4XORA 2Z33A 2VPLA 1TQPA 1N77A 4KIGA 2VBYA 1T6SA 2NS0A 5CKTA 4PJ0C 3V7RA 2X51A 2L9SA 3CP2A 4UUSA 3WHBA 2OI8A 2HFHA 4IHTA 3WG7H 1I3AA 2V79A 2VKDA 4HAMA 1VF9A 1S5LC 3QYFA 2VJJA 3BZCA 4GO1A 3OV8A 3K4KA 1D8JA 1P92A 1T08B 4AIHA 2XGEA 3GTLJ 2KPMA 1JUSA 5E17F 2V6EA 3SDBA 3RCOA 2R7VA 1MBFA 1OYIA 1YJWI 1SVLA 2VBXA 3MNLA 4GCKA 1G4DA 4M9SA 3CCSI 3ZMSA 2QQAA 3OR1C 5CPRB 2H6CA 4XNFA 3V78A 4I0BA 1FY7A 2MC4A 4BU2A 3MZ8A 2XAQA 2WB1N 5DD8A 2QF7A 4AWXB 2GLOA 4KYWA 4WX9A 1F9NA 2XDVA 1VNDA 4A3MJ 4MQVA 2IPQX 3BLYA 1WJCA 2DDAA 3FK7A 5CQGA 3BG7A 2MD0A 2XRLA 2HOSA 2XKPA 3ABMH 1I6HJ 5JVTA 3HSFA 3GFIA 3M7GA 5E1WA 3RQIA 5LGTA 2F07A 3IRQA 2Y30A 3HKZN 1XMKA 4BYYA 4CYDA 1I27A 2LKPA 3RYRA 1BC8C 2F4IA 4Y33A 5FMPA 1F43A 2TDXA 2KJCA 2GA2A 1LJ9A 4IZZA 2FQ3A 1OR7C 3L2RA 3DBLB 1J9IA 1M1EB 3CRJA 2G9WA 3G56A 1BJZA 1Z77A 1R1UA 1ENHA 1QVUA 1U0JA 4GFKA 2HYFA 1WH7A 2OPTA 3LQQA 5D18A 2VC0A 4IRGA 1A6QA 2L7KA 1IN5A 3MKLA 1MDMA 4RGUA 4IKFA 2WV1A 4RM3A 2LKXA 5EEGA 3GTGJ 1RC9A 3RPQA 4KN4X 2QENA 4JNNA 2FU4A 2FNPA 1GV2A 3I9V2 5D8KB 3G2BA 1FOYA 2A69F 3K4LA 3LA2A 3AQSA 2LF8A 3PQKA 1POGA 1LVKA 4Q5SF 1KU9A 4BHCA 1R00A 3E5UA 1A36A 3KP2A 3HOYJ 2FBQA 3VVZA 2JUCA 5F08A 2MLGA 5KK1A 1IN7A 4U87A 4XKVA 3WGGA 3OYGA 1MMAA 1AOYA 4NQWB 2ELKA 3ZQGA 5HLTA 2DI3A 2HWVA 5D4SA 4BXXJ 2IW5A 3S15J 3A0HC 1T8IA 1ULYA 2OQRA 2RKHA 3NARA 2XSDC 1SMTA 4MHGA 2JMWA 2DW4A 4KA4A 1IAWA 3HZJA 3WE2A 2DJIA 1ERDA 1J75A 4PUSA 4HF1A 5GPAA 3S1MJ 2M34A 4D1QA 2BW3A 4N9IA 4AUXA 1ETOA 1G3YA 5TRDA 1F1ZA 1KYWA 1FOXA 3DKYA 4GCLA 3DQVC 3LHQA 1X58A 2P0WA 2RHAA 3HRTA 1FP2A 4ME9A 1FBQA 1X3WB 4BXUA 2ZMEA 4LD5A 4OWRB 4M6YA 4IOAF 2GQQA 4E7HA 2QWWA 5J4YA 1UHSA 3OS2A 1ETKA 3VUQA 1YW8A 4MEYF 3DF8A 3F21A 1UI5A 2K85A 2JRTA 1WI9A 2NNYA 4G9YA 4JYKA 3JW4A 2UZKA 4LGWA 2LRDA 1OCZH 1Z7LA 3OL3A 1DP7P 4ESJA 2YS9A 1LNWA 1T2KA 3BC8A 4IQJA 3I0TA 1UB9A 1CF7B 2WGBA 1HA8A 2H6BA 4U9NA 1WJAA 3L00A 5D4RA 4YZEA 5EG0B 2E1OA 3OYHA 3S1RJ 1TP4A 1UCRA 4IL6C 1B59A 2LY2A 2NXNB 4HQMA 2QQBA 3IL2A 3BCAA 5KVRA 3M8JA 4IJAA 9ANTA 5JHFA 1K4SA 5HS8A 2JSCA 2ISZA 5HVQC 1AWCA 4BS9A 3QYEA 1YJ9I 3OYMA 1MZBA 3NRGA 1UJ8A 3F72A 3QPLA 3H5RA 4RGSA 3JRFA 2FD5A 3OOUA 2R7UA 3C18A 3GLLA 1SFEA 4CCNA 2E7WA 5J8FA 1GVJA 4BJ6C 4C3IJ 3I54A 4XLEA 2EV0A 3RKQA 1W7PD 1MBKA 4XM3A 5BMZA 3PFYA 5HDGA 5LEKA 3B6CA 5FLMJ 4UNOA 1FT9A 1V5EA 3I4PA 4ZDPA 3VVXA 5DUIA 4MO7A 3SEQA 2FEZA 3ANPA 4FT8A 2PMZA 3CCQI 4B8XA 2OERA 2K3PA 2NOJB 3FBNB 2JA8J 3J81Z 4L0ZB 2LC2A 3HXLA 3S3OA 1WCMJ 1UI6A 1B72B 1I1GA 2QKLB 2NNNA 3WTZA 2PMHA 5J1UA 2XC7A 3VYRB 2IS1A 4BE0A 1B9MA 1MBHA 1R4MB 3Q0VA 2R7ZJ 1EV7A 2RV8A 1XSVA 1R1TA 3JSJA 1C0WA 4KIBA 4ZZLA 5K1YA 4XLHA 3MZYA 4K2EA 2WBMA 1U8BA 5FRMA 5L3DA 4NN1A 5HNHA 1YX3A 2DMTA 2GA1A 4RAGA 4A3LJ 4YIFA 2ZCNA 4MNUA 1SVOA 4BEHB 1JI8A 4PSWA 3HDDA 2NX4A 3QPSA 4OOIA 1KU3A 1MNEA 1TWCJ 1WH5A 2RNJA 5F0CA 3SEZA 5IPAA 1TT0A 3VODA 3CJRB 1ZRDA 4XRMA 4ZTFA 4I76A 2IT0A 4LLLA 3KZ9A 2V1UA 3JRDA 2XROA 1H9TA 4RMNA 4F7ZA 2YR2A 2LY1A 1OQYA 2IAIA 3HTAA 2W4SA 4OINF 4E7LA 2V9KA 2IA0A 5LEJA 2ZO4A 3FWEA 3FHNA 4OAZA 3CMEI 2ZXHA 1QZZA 4XKWA 3A2KA 4N9HA 1OISA 1DQUA 5E1XA 2K9QA 5DCMB 1AU7A 2EQRA 3KEQA 4F55A 2F5FA 4ENKA 3G1MA 2DK5A 4LIVA 4Q48A 4BJTA 4DBQA 4PK4A 4ETSA 1ZYRF 5AIPA 4UDSA 1HW2A 4A0ZA 2Q0OA 2MBFA 1N75A 1SEUA 5E3MA 4CYCA 3WGIA 1V55H 2V9VA 4HLXA 2CSOA 1KQ0A 4KIFA 3ZQCA 5CJ9A 2ZFWA 4EJWA 4IO9F 3AG3H 2LH9A 4NUBA 1BR4A 4Y15A 5H2FC 4P9UA 4U7BA 2HOAA 4FE7A 3LSMA 5D5WB 4PGHA 2IU5A 4XLPF 1USTA 2Y9YA 5E8IA 4AYBN 1RKWA 2ID3A 3VTIA 1IV6A 1MJAA 2M4GA 3MCZA 2OCCH 5FO5A 2ADUA 1LFUP 2JA7J 3KPHA 3VFZA 3EQLF 5E8GA 2CUFA 3NAUA 3D0SA 3K9TA 2PG4A 4F52A 1ZK8A 2VQHA 2BOLA 3NPIA 5CVJA 3Q9SA 1OLTA 2EA4A 2Y31A 3MVPA 4XOPA 3JSPA 2EK5A 1DPRA 5FKLA 3SXYA 4FX4A 2H1LA 3EUHC 4NQWA 4G12A 4RGXA 2CG4A 2DU9A 3L1PA 2TCTA 2FSWA 1YTYA 2PZ9A 3KP6A 1TWFJ 2XASA 4G6TB 1Z3YA 1MIJA 1H0MA 2XDNA 1BI2A 3H9QA 3CJNA 2M3AA 5LHGA 2HQAA 2WAQA 3H92A 4JX4A 4L9JA 2VONA 4G6DA 3OYDA 4C2MA 2QVOA 1QQIA 4BQOA 3DTEA 4KWAA 4JK1X 2DO7A 3T1BA 1SC7A 2DG7A 1SANA 3K1NA 1VQ5I 4M9XA 4LK0F 4BE2A 2HOEA 2JA2A 4LITA 2AXTC 3DEEA 2M2EA 2DFIA 1FSHA 2OC6A 5HAWA 3NS4A 2EFNA 3CESA 2VJ5A 1BR1A 4LMYA 1Z05A 2H09A 2OQGA 4M9ZA 2AS5F 4M3GA 2GAUA 3V6GA 3EYIA 1HOMA 2FJI1 2L7FP 5F04A 1O57A 3IHUA 1W5SA 2DT6A 3ZR8X 4L9NA 4DYRA 3HC7A 3DCFA 2MA3A 2LYCA 3DP7A 3HIMA 2BHZA 3OS1A 1O3SA 3AG4H 4M3BA 3FXQA 4C30A 2IXSA 3SFIA 1O4XA 2X48A 4HX7A 3MMYB 2VBWA 3H3ZA 4IEJA 1ON1A 3CUQB 4MIMA 3SFZA 2GIVA 5L3GA 2R7WA 2HDWA 5FROA 3PIPF 2ZC2A 5J3LA 3G73A 3HOZJ 3QU3A 2KL4A 1BI0A 3FXJA 4II2A 3CTAA 2L4AA 3R0AA 3GX4X 2CU7A 1IC8A 2NVYJ 2HQRA 2R0QC 2W00A 1MSFC 2CV1A 3AL0C 4XKCA 1J09A 5ICCA 3H1CA 3OYKA 2HDCA 1E17A 3JRCA 3FMQA 5TISC 1K61A 1X4PA 2IJLA 2A5YB 4JP0A 4A5NA 4DIQA 5GAHJ 2VJ4A 1P4AA 2OZUA 4LIUA 1XN7A 2FUG2 3PUBA 5AIQA 5F0HA 3OYIA 3IV5A 3ZP5A 2WWYA 3BTLA 1ZAOA 5FJ8J 4YFNF 2WAEA 3E6CC 5FHPA 3MKWB 1FZPB 1RUNA 3ABUA 3J7AO 3OYJA 2IA2A 4UV8A 4MXMA 2R7DA 1ZRCA 4C9YA 5FLXK 2IGOA 1FSEA 5A2QK 1WJBA 1SVMA 3Q5FA 2B7EA 5H20A 4WXDA 2YX4A 2KIMA 4XR6A 5ILSA 5EEHA 3WTWC 3BCGA 3MWMA 1OCRH 1P2FA 5EGOB 4LB5A 3DEUA 3OYNA 1U8RA 4CDGA 1J7KA 2HR3A 4XKBA 2JQ7A 4OD4A 2F48A 3E5QA 2H8RA 3M3YJ 5F6FA 2EA2A 4UUVA 2G7SA 2EV5A 4IPAA 4B43A 5HLGA 4W1UA 3K4CA 1SMYF 4IVNA 4YG2F 1BIAA 3IAM2 2H1KA 1EH7A 3I55I 2XIGA 2KRHA 2YUSA 3S8PA 3BR6A 2R92J 3LSPA 2VKHA 4Z6YA 1K4TA 4A93J 4XLCA 1VZ0A 3F0CA 3D5RC 2ZFUA 3JREA 1Y39A 4GCVA 4A69C 1T39A 1EH8A 4EATA 1TC3C 2EZKA 1Q1VA 2CGPA 4PDKA 1L0OC 3F6VA 3PPBA 2MFZA 4ZYEA 1JGSA 1S6LA 2CS3A 4EJUA 3OY9A 2Y0SA 2OJED 5IYBJ 3HOXJ 2K5CA 3I59B 5HLHA 3NI7A 2MLKA 4FCYA 5ILVA 4KNYA 3GVAA 5J4VA 3BTJA 2KIFA 1Z21A 1O7LA 2WY7Q 3KX2A 3TW6A 3ZN0A 1QVTA 3RZOJ 3ZCOA 2R7QA 4KT5C 4XLFA 3ZRGA 1WHUA 4UVCA 1JTYA 2ZOYA 1XB4A 2W7NA 3H36A 4QTRA 2QYOA 2K3FA 2Y2ZA 1OYWA 1SAXA 3FDYA 3MAJA 3SZTA 2OUMA 1IXSB 2OF7A 3JCUC 3PL8A 1OCTC 2XAGA 1EJ9A 6PAXA 3P9CA 5LRRA 3BR2A 5D5VB 2M30A 4L62A 4HV6A 3F3XA 4BQAA 1GV5A 2NP3A 3CMMA 4C3JJ 3A02A 1LEAA 3HOTA 3HHHA 1GXPA 2R7XA 1XG1A 2DK8A 2DAOA 2E2JJ 3C3WA 4FTHA 1SFXA 1H8AC 1S9HA 3LL7A 4ZH4F 2M8GX 2PBXA 5F1JA 3DXJF 4UV9A 2ZNZA 1Z6TA 2ZNYA 1BA5A 3V8LA 3F23A 3HRSA 3LFKA 1K79A 5K5OA 4YFKF 2PQ8A 2L7ZA 1DUXC 4XL9A 3HIFA 3T6NA 2M45A 3K4MA 3ZMUA 4AIJA 2NVTJ 3F8BA 2IVMA 3QRFF 3OOPA 3VSKA 3QU6A 1PP8F 4HBLA 1MNMC 1Y8QB 3LOCA 4M72A 4DYCA 2EJRA 2W82A 3MN2A 3S17J 3NWTA 2PMZN 3EUKL 2XHKA 1IF1A 2RDPA 3WU0A 3DTIA 3FXRA 4CO8A 3ZMZA 3OYCA 3I4NJ 2W53A 4IHXA 2DA5A 1Z3XA 1G3SA 2V1XA 2GOMA 4LG3A 2A6HF 4L0YB 1T98A 5ICGA 1FX7A 1OFCX 3LJLA 1WSUA 1NHAA 2MW8A 5GTIC 2LK2A 3IH2A 5LGUA 1P4XA 1IDZA 2HI3A 2FBKA 3U2RA 3OYBA 3IKTA 2K4BA 2QSFX 1Y1WJ 2GXAA 1U9OA 3VIBA 5IT3A 2X4HA 5DUKA 2KISA 2BYVE 3WODF 2BEOA 4FISA 4YIRX 1OJLA 1IZ1A 2LNBA 4E7KA 2MC3A 4UB8C 4FETA 2ME6A 2Y48A 1HDPA 1XC5A 2LOOA 4DW6A 3M8EA 2E35A 4LOCA 4HF2A 2EB7A 1T38A 3ZPLA 1TWHJ 1XGOA 2H94A 1BBYA 2ZCXA 3QBMA 4BBSJ 4HV5A 3ISPA 3GF2A 2L54A 1NK3P 2LFBA 3CUQA 4BQNA 2DXIA 2Q8KA 3L2WA 3CUOA 3HOVJ 2BY1A 3O6BB 3LMMA 1QZEA 3RDIA 2R5ZB 2E1MB 2CFXA 5HLIA 3KP5A 1KGSA 1PDNC 5J6XA 4CGZA 2Y9ZA 4CUGA 2GENA 3BJOA 4HSTA 1ETVA 1YFHA 1V5FA 2CV0A 2VOPA 1O3RA 3KFWX 3BJBA 2DT7B 3HTHA 1IRZA 1BI3A 2E36A 4BGDA 4UHTA 3P9KA 2Q24A 1A6IA 4WK8F 1SGMA 4AIKA 2PEXA 2VJIA 3GUDA 5M3FJ 3GW2A 4CA0A 2ECCA 1QNTA 4IHWA 4M74A 3K69A 1NTCA 4RGRA 3A1YA 3SDGA 3LSGA 2HYTA 4QIWN 3BG3A 1ETYA 3BG6A 2E5ZA 2ID6A 3Q0UA 3TBIA 2TRTA 5D6FA 2PLYA 3L7WA 1ORKA 1T0FA 4I09A 4FE4A 3N97A 1YO5C 3EUPA 5K58A 3HYIA 1HQCA 2MD5A 2ZCWA 4XK4A 4HYEA 2I5UA 2G7GA 5JLWA 1P6RA 2JN6A 4D5CA 4PZJA 4BHBA 2QBYB 4L18B 3F8NA 5GADJ 2VN2A 3RH2A 3AG1H 2GOXB 5EGOA 1Z91A 2A6TA 3G1LA 4I01A 3OYFA 4A3DJ 2F5EA 5CVUA 2F2EA 3KETA 1ZH5A 2Q1ZB 1B4AA 4UVBA 3V42A 2G7LA 4B09A 1BM9A 5AONA 5KHDA 4PJLA 1S29A 2F5DA 3D5SC 1W5CC 3HTJA 4EV0A 4PFOA 4JX6A 3KE2A 3J81K 3W6JB 3O2PE 3ZQQA 1D0ZA 1K6YA 3CDLA 1S72I 2YU9J 1JJ8C 3VDXA 2KRFA 5FKNA 2DT5A 1GLNA 2HDDA 1HSJA 2LKSA 1MBGA 3EDPA 4A12A 4J01A 4BDZA 3C07A 4ENNA 3R4KA 1YW9A 4O5VA 1ONVA 4BY7J 2LY9A 3LSJA 4XRSG 1BC7C 5FB2A 2X1DA 2E1NA 3PFIA 2JPCA 3TO6A 3JTGA 1LDDA 4XSZF 2QQ9A 2V26A 1FEXA 2E19A 4L5JA 3CWRA 2VKEA 4QSHA 3TOBA 4B3XA 3L2CA 1YLFA 2RASA 3WU1B 3HTSB 4BE1A 2NVUB 4BXFA 2WAQN 2ZSHB 2BZTA 3REOA 5HNFA 1PJRA 1X1DA 1JKQC 2MGQA 5DM7F 2L01A 4XICA 1TW3A 3OL4A 3I59A 3A03A 3K10A 2DG8A 2FE3A 3ELKA 2NVXJ 1A31A 2VOOA 2V7FA 5JR3A 1ETXA 2P6SA 4U0YA 3LSHA 1Z0XA 3FXKA 2BVMA 4RB2C 1UELB 1RZ4A 1MBJA 4NHJA 3FXLA 5K7FA 3CQZJ 1FLIA 2Y0MA 1D1AA 3OMYA 4LJZF 1MH3A 1U5TA 3IUOA 1ZELA 2X1CA 2WV0A 3ERMA 3BY6A 1XS9A 5IYDJ 4OIRF 4KDPA 4C3HJ 1SD7A 5CLSA 2X0LA 3L09A 5K5RA 1D0YA 2DFFA 1GUUA 4M3EA 1ETQA 3RPUA 2MYSA 5IT9Z 4KICA 4II3A 2E2HJ 3GTKJ 3TW7A 3WTVC 1IRFA 4R8HA 2BBYA 2FBIA 4C2TA 1JT6A 4I98B 1WPKA 1RR7A 3QODA 2EZIA 1IXRC 2DMQA 1IG7A 4AC6A 5JI6A 3X2QH 3K6GA 3HL2A 3FXMA 1RESA 1XGSA 4U88A 5E79C 1YI2I 4C2UA 3BRUA 3LQRA 1W4MA 3LSTA 2VQLA 3C2GA 3CLQA 3V8KA 3D1NI 3WG9A 1RI7A 3BTIA 3OYAA 5DS9A 2KKOA 4XQFA 4Y7NJ 4CXFA 1KQ8A 2COBA 3QQAA 3BQZA 3M4OJ 4NDLA 2QKOA 1HKTA 2UXUA 2MH2A 3HGYA 3I3LA 4A0XA 2VB6A 3H9JA 3HPHA 3BTCA 2OAZA 4N4NB 1XCVA 3U1KA 2R7SA 2DA7A 2HKOA 2R7RA 3KZYA 3E5XA 4MQ9F 1I39A 1DP3A 5IOYA 2DA4A 1R36A 2HKXA 2IGMA 3FZVA 1VQKI 2DYSH 4FHTA 2AXLA 4CCJA 2A05A 1IN8A 2PMUA 4MTDA 1FP1D 4A6DA 2UV1A 4OMYA 5LRSA 1Y1VJ 2DA1A 1DGWY 2LF7A 3BG9A 2L02A 3W2AA 2LVSA 5D8LB 3ZMDA 4UVAA 2KJBA 4RB0A 2QQ8A 1PUEE 1RNLA 1TNTA 1SD4A 4HNVA 2R5YB 2FMYA 3O8HA 3RZDJ 4GRIA 2FOWA 5CVRA 5LD2C 3CCMI 2G0EA 5DV5A 2WA0A 2E1CA 3WTTC 4RLFA 1GXQA 2VQGA 4EM2A 3Q9VA 2ZY9A 3HTUA 3FISA 3R0JA 1GT0C 3ULQB 1ZKGA 2G7UA 5FGMA 1LUJB 2OCEA 3B73A 4RLQA 2KLOA 2JK3A 3PUFA 5C4YA 2P7VB 5EFYA 3AFHA 2PJRB 1ZR4A 4KMUX 4ZYAA 3GXOA 3JAMZ 1LEBA 1G3TA 3CCUI 1N25A 2OTJI 4R79A 4DVYP 1R49A 5KNLA 2IS2A 3CCEI 3B6AA 4DOZA 3WE3A 3J80Z 2DA2A 3KLNA 2NAZA 3ZXSA 2D5VA 1D3YA 4V2FA 1V54H 4MFDA 3I5UA 3E3VA 4O3MA 1UAAA 1RKTA 3ZQ7A 1O3TA 3M07A 2LMDA 2ZXWH 2YVEA 1JE8A 1CQTA 5HDKA 2YVHA 1G8XA 5D5UB 2Z99A 2LBFB 3QP5A 5J40A 4NB5A 3K1PA 2E2IJ 3V8JA 1X1PA 2UWMA 2M5WA 1LPQA 2QLZA 1YS6A 4RBOA 2DBBA 2O7OA 5GTHC 1PVEA 1BOAA 4Y3OA 1LE8B 2REKA 5HBUA 3BT9A 4EM1A 2L5QA 1IN4A 5C3EJ 4Y4RA 2QBYA 3KP7A 4BKXA 3HOSA 4D0PA 2FX0A 4LG0B 2EFWA 4I6ZA 2PFVA 3RKWA 1WJ5A 3K0LA 2EINH 3VYTB 4MTEA 3BR3A 2RQPA 2ZJ2A 2EWNA 1O7FA 3W3CA 3FBIB 2WY8Q 1VQ7I 4V2GA 4S04A 5DM6F 1X4OA 2GXBA 1Y0UA 3FXOA 1WI3A 2HNHA 4IQ4A 5GAGJ 1J2XA 1GDTA 2QA4I 3DEWA 2JRMA 3JRBA 1EF4A 5CQEA 1K78B 4PXIA 1BR2A 1YW7A 2XKOA 1BOBA 2CQXA 3BZ6A 2HXOA 1ZLJA 1K6OA 2ZMEC 3AAFA 4BACA 2WADA 1X2MA 3GTJJ 3PJRA 3DFGA 1D8KA 2HZTA 3IH3A 5C44J 1ZRFA 1UG0A 2EILH 2P81A 1QU3A 1MBEA 4CHUA 3A01B 5HOOA 4ASNA 5M3MJ 3CZ6A 3CLOA 1OCOH 2PBIA 1QPMA 1L3LA 2VL8A 3HG9A 3ZN1A 4D7NA 5FKMA 3DBHB 4E4HA 4A3GJ 4IRHA 4JL3A 3RI4A 4YEJA 3MQ0A 1Z6RA 2FF4A 3IC7A 5E1ZB 3K4JA 2W25A 4A3KJ 2I10A 1X1AA 2L4MA 3D5LA 4HX4A 2QZ8A 3LA3A 1V4RA 5DEQA 1R9TJ 3BHQA 2M7AA 4ESFA 3CCJI 3WGHA 2XGXA 3QWLA 1LQ1A 3C1DA 5FGLA 1YIOA 1IN6A 3JRAA 3CP8A 3BQYA 3GFLA 2O9LA 4QPOA 4ZTJA 4UUTA 1JKPC 1U3EM 4M6VA 1JT0A 5EJCA 1VI0A 3MKZA 4PJJA 2QCOA 3VB2A 3DPJA 3H0GJ 1FYLA 3H35A 1YIJI 4HQEA 1HF0A 3W2VA 2HZDA 2IRFG 2UUZA 1CF7A 1Z67A 1XMXA 2XPVA 2BGCA 1R7JA 2V1DA 2KP6A 3CCYA 3ROUA 3TQNA 3H0DA 2DYRH 1ZG3A 5EG0A 5JHUA 2ICWG 4ITVA 1HXDA 2QGUA 1HKSA 3BPVA 1REPC 4KJZA 1XMAA 2F5VA 3IWZA 5ICFA 3ZOBA 4PSXA 3AKZA 3FM5A 2YVXA 3S2DJ 1SD5A 2CQ7A 1TLHB 2WTEA 5C4JJ 1ZG1A 4AM3A 2OTLI 5L3BA 2A07F 3GLXA 4G6QA 5EZGA 2KDZA 1MD0A 2ELHA 1I3QJ 3A4CA 4BJ5C 5M5YJ 3SJMA 3TOAA 4S05A 2KRCA 5L3CA 4RAYA 3S1QJ 4EGYA 1ZG5A 2JTVA 1UFMA 3BZKA 1ON2A 2ETHA 2RREA 1QHHD 3F8MA 4P1WA 3IH4A 5C4XJ 2CRGA 3ASNH 4B1RA 3CO6C 2JUGA 5L3FA 1W36C 1ZGAA 5BPDA 1X3ZB 2P8TA 1YOVB 4OAYA 1FJLA 3ZQHA 1OCCH 2LR8A 4RDUA 1IUYA 2BVLA 2JJ7A 3ANGA 3CF5F 1B72A 4XN3A 2OD5A 4G8XA 3TDUC 1EA3A 2ISYA 2VPRA 4ZC3A 4F93B 2XF6A 4JOMA 1R5HA 4CCKA 4H0EA 3LAPA 3TKYA 2WUIA 5LHIA 4AU7A 3VP5A 2O0YA 1S7AA 2OBPA 2JVHA 1TBXA 3KZZA 3TDZC 3V4GA 4DNCA 2O6GE 3KP3A 4RM2A 3BJAA 4WCGA 3G71I 2IS6A 1WWXA 2VT3A 3QPHA 2YX7A 2R5YA 1MDMB 2OU2A 4BEHA 2ESHA 2O03A 1W7PB 2CQKA 4NELA 2X6YA 1AHDP 2BHYA 3BCBA 2CMPA 1K83J 3FRQA 3VVYA 1ZGWA 4LK1F 3TGNA 1OR7A 3CF2A 3J7AY 1LDKB 2CW0F 4HNUA 3CJDA 3KP4A 3TL4X 4L9VA 1MGTA 2K9NA 3RKXA 2PJRA 4B4CA 1VTNC 3PNTA 5GAEJ 2HYJA 1OKRA 1PUFB 2Y75A 2VLAA 2XF5A 2AO9A 3W2WA 4WXHA 3TO7A 2X1EA 1MSEC 4G7OF 2FNAA 2X6XA 4KISA 3CCLI 4EGZA 3C7JA 5BNGA 2XSJC 5DCMA 1PP7U 5CYVA 2CQQA 4ACIA 1TQMA 4DZJA 1RIOH 4XONA 3TO9A 3T8RA 5BQTA 5HS9A 1E0EA 4FQGA 3E6MA 3I71A 1MJBA 1E3OC 4WXCA 2RNGA 1G6NA 5LBQA 1H9GA 2LBFA 1BN5A 3DKWA 4KN7X 2R3SA 1DGRM 2LREA 2R7TA 4A3CJ 1F5TA 4AF5A 2XAUA 4ICHA 2PX9A 1P4WA 1IXCA 1LE8A 1U6GA 3I4MJ 4XIDA 3ABLH 1G2HA 5HSZA 2Z5UA 2WAFA 2HQNA 1FIPA 1R6RA 4G94A 2VE9A 1I1SA 1GVDA 3RD3A 3L9FA 4HKUA 2KDOA 4LG0A 1JUPA 5LHHA 1VQPI 2FRHA 3DV8A 3HSEA 2BE5F 2DTZA 3QPTA 5LGNA 3DLAA 1ZARA 2JVGA 3GMEA 1FNNA 4PGGA 2PFBA 2RGVA 4DZPA 2YPRA 5K7ZA 4OIQF 1VQMI 2B63J 2UXHA 1T33A 2HVSA 2GXGA 4HSRA 2QTQA 3LSIA 3KYLA 4YRVA 4R1HA 1WRJA 4RS8A 4ZDLA 5DD4A 2W85A 3GZNB 2L9VA 1TTYA 3EGQA 1Y8RB 1S3JA 1DU6A 4IRVA 2M4KA 4D7MA 5K7HA 2AQEA 3WTUC 1V5GA 3UKGA 3TMOA 2GIZA 4HA8A 1R71A 3F1BA 3L2VA 3HBLA 2RN7A 3KZIC 3FMSA 3LSKA 2UXOA 3ON2A 2LTPA 4X6AJ 1R22A 2EFQA 5FLXZ 1HC8A 5IP7J 1STZA 4M73A 1QHGA 4O6JA 5A2QZ 3A01A 4A3EJ 1IO2A 1QGPA 3OWTA 2CJJA 2DMNA 3P7NA 2E60A 3AQTA 2B3WA 4Q4ZF 2IGKA 3WTXC 3I56I 2L7MP 3BP8A 3K8PC 1E3PA 2Q2EB 3NQOA 1IUFA 2GWRA 3VW0A 4PFPA 2ZCMA 4CH7A 2YSRA 4CCMA 4OU0A 3UR3C 1EKEA 3H5NA 2HS5A 3BG5A 2P5VA 3QAHA 4GDFA 1X1BA 4GFBA 3G6EI 1WZ2A 4BHPA 3GTOJ 2HGCA 1D1CA 3AL0B
chains in the Genus database with same CATH topology
3BR1A 1MH3A 4DYQA 5M5XJ 1IDYA 2G3BA 5D1RA 2EH3A 5JLXA 2XPUA 5EZHA 2HOAA 4FE7A 5GPCA 1XS9A 5IYDJ 2QOPA 2CUEA 2IU5A 3QKXA 3KNWA 4C3HJ 2Y9YA 4D5FA 5F0FA 5F27A 3JR9A 1GUUA 4M3EA 1ETQA 1X2NA 3G1OA 3JRIA 4AYBN 1RKWA 2ID3A 4GFLA 5CW8A 2E2HJ 3GTKJ 3TW7A 2FJ1A 1IV6A 2GUHA 1JKOC 1JT6A 1TWGJ 1LFUP 1WPKA 5GP9A 1BL0A 4BY1J 1TWAJ 2JA7J 1RR7A 4JX5A 1D5YA 2CUFA 3NAUA 2EZIA 5E3LA 1OCPA 2DMQA 1ZTRA 1IG7A 4AC6A 1ZK8A 2O7TA 3NPIA 1RESA 1IGNA 3BRUA 2Y31A 3MVPA 2NS8A 3S5RA 1QRYA 2ZOZA 5FKLA 3D1NI 3BTIA 2GFNA 3PM1A 5DS9A 4Y7NJ 2DA3A 5IP6A 2COBA 3QQAA 3BQZA 4G12A 3L1PA 2TCTA 4NDLA 3M4OJ 2PZ9A 2QKOA 2UXUA 1TWFJ 3IUVA 3HGYA 1BW6A 4EEFG 2MSYA 2XDNA 3BTCA 3C2BA 3GTQJ 2L0KA 3HTIA 4JX4A 2DA7A 1ITYA 5EEAA 4KWAA 2LD5A 3HOUJ 5IOYA 4MK6A 2DA4A 2DG7A 1SANA 1LFBA 2LP0A 4AC0A 4IHYA 2HKUA 5EDNA 2GBYA 2M2EA 5HAWA 1FTTA 1JJ6C 3LWJA 1Y1VJ 2LLKA 1I50J 2DA1A 3ZQFA 5H9TA 4CYCB 3BG9A 2LVSA 4M3GA 1AKHA 3V6GA 1HOMA 1HCRA 2L7FP 5F04A 1VFCA 3W6VA 4HNVA 4J19A 4DYRA 2ECBA 2R5YB 3DCFA 1W0UA 1WGXA 2V57A 3O8HA 3RZDJ 5IOZA 3HIMA 1U78A 2G0EA 4M3BA 1U9NA 3OIOA 2XB5A 3SFIA 3JRGA 3B81A 1O4XA 2X48A 2ZB9A 2D6YA 2XB0X 5CXGA 4IEJA 2NP5A 4MIMA 3FISA 3ZQLA 1GT0C 4L5EA 1YRNA 2VUMJ 1ZKGA 1FIAA 5J3LA 3GTMJ 1IJWC 2JK3A 3HOZJ 5C4YA 1H88C 5EFYA 4MFEA 1ZR4A 2CU7A 4MLOA 5HODA 2NVYJ 1IC8A 2R0QC 1RPWA 2HQ5A 2M0CA 4X1EA 2JA5J 2M9HA 1B8IA 1MSFC 3NNRA 1PUFA 2DA6A 3B6AA 3JRCA 5E3NA 3LNQA 1K61A 2DA2A 1HLVA 3HEFA 4JP0A 2D5VA 2JA6J 3S16J 4V2FA 3TEDA 4IHVA 3OSGA 5IYCJ 4MFDA 2VI6A 1RKTA 5F0HA 3IV5A 2YVEA 1CQTA 2YVHA 3BTLA 5FJ8J 2MG4A 5FHPA 2E2IJ 3LSRA 3S1NJ 4MXMA 4RBOA 1RETA 2O7OA 3Q3SA 1LE8B 3VW1A 3WHCA 2REKA 5HBUA 3BT9A 2EZLA 1BW5A 3BCGA 5C3EJ 4BKXA 5EGOB 3VPRA 2QIBA 4UUSA 2FX0A 3WHBA 2OI8A 4I6ZA 5FKOA 1S7EA 1VF9A 3BR3A 3TP0A 2H8RA 3M3YJ 2G7SA 4V2GA 4W1UA 3CMYA 1WI3A 1GDTA 2XGEA 3GTLJ 3DEWA 1JUSA 2XGDA 1MH4A 3JRBA 1EF4A 1MBFA 2H1KA 4JKZA 4PXIA 2YUSA 3MNLA 2R92J 3BR6A 5E3OA 3LSPA 4GCKA 2CQXA 4A93J 2HXOA 3JRHA 3F0CA 1JTXA 1X2MA 3JREA 3GTJJ 3V78A 3IH3A 5C44J 4A69C 2W48A 1HDDC 5EYRA 1TC3C 2QWTA 2WB1N 2GLOA 2QF7A 2EZKA 1Q1VA 5DTDA 2DN0A 3S14J 1VNDA 2P81A 4A3MJ 3PPBA 1MBEA 3A01B 5M3MJ 3FK7A 3E7LA 2XRLA 2HOSA 1A5JA 1I6HJ 4D7NA 5FKMA 4A3GJ 4JL3A 2KT0A 3RQIA 2F07A 5IYBJ 3HOXJ 3NI7A 2Y30A 3HKZN 4FCYA 3HE0A 4A3KJ 2I10A 2DJNA 1R9TJ 5FMPA 3OSFA 3BTJA 3TW6A 1F43A 3BHQA 1QVTA 3RZOJ 4BBRJ 3VW2A 5FGLA 3JRAA 1JTYA 3BQYA 2ZOYA 3CRJA 4QTRA 2O9LA 3G56A 4UUTA 1JKPC 4M6VA 2K40A 1BJZA 1Z77A 2Y2ZA 1JT0A 3S2HJ 1ENHA 1QVUA 1VI0A 3DPJA 2QCOA 4GFKA 3H0GJ 1WH7A 2OPTA 5D18A 2OF7A 4A3IJ 1OCTC 1HF0A 3MKLA 2XPVA 3BR2A 3CCYA 4L62A 2WV1A 2LKXA 3GTGJ 3HGGA 4W97A 5EG0A 1GV5A 2NP3A 4C3JJ 4C2MJ 3A02A 4JNNA 1GV2A 1XG1A 2E2JJ 2R5ZA 3AQSA 1POGA 3ZOBA 4FTHA 1H8AC 3S2DJ 2XPWA 2M8GX 5C4JJ 2PBXA 4CGRA 5F1JA 2NVQJ 3HOYJ 1JUMA 2FBQA 3VVZA 1BA5A 3GZIA 5EZGA 5F08A 3K2AA 2KDZA 2UXPA 5M5YJ 1I3QJ 2L7ZA 2Y0SN 2JWTA 3SJMA 2ELKA 3ZQGA 3S1QJ 3T6NA 2XGCA 4BXXJ 2L9RA 3S15J 1UMQA 2NVTJ 3NARA 2XSDC 1MNMC 3IH4A 5C4XJ 3LOCA 4DYCA 2CRGA 2JMWA 4B1RA 3MN2A 2R93J 3S17J 3K7AJ 5D19A 2PMZN 1QPIA 5GPAA 3S1MJ 2HXIA 2M34A 3BR0A 1FJLA 1NK2P 3ZQHA 4AUXA 2UXIA 4RDUA 1ETOA 2LR8A 3I4NJ 2DMUA 2JJ7A 3ANGA 2W53A 4IHXA 3P9TA 1B72A 1UG2A 2DA5A 3LHQA 4GCLA 1X58A 2RHAA 2VPRA 3FKIJ 1OFCX 3LJLA 4ME9A 2MW8A 2LK2A 3IH2A 1IDZA 2HI3A 1UHSA 1Y1WJ 1ETKA 3E7QA 2WUIA 3ZQIA 1U9OA 3VIBA 3VUQA 3VP5A 1AKHB 3BR5A 1UI5A 4FISA 1OJLA 5IP9J 4XRSA 5CXIA 3ON4A 4JYKA 2ME6A 1HDPA 1XC5A 3HM5A 2YS9A 2R5YA 4DW6A 4LOCA 4B3AA 3VOXA 2K9SA 2WGBA 1TWHJ 2ZCXA 3QBMA 4NELA 4BBSJ 1AHDP 4YZEA 5EG0B 1NK3P 2E1OA 1K83J 2EBIA 2X6OA 2LFBA 4A3JJ 3S1RJ 1YRNB 3FRQA 3O60A 3VVYA 1ZGWA 3HOVJ 5FLVA 2O8KA 9ANTA 2R5ZB 3CJDA 1FTZA 2K9NA 2Y9ZA 4M3FA 4B4CA 2GENA 1B8IB 1ETVA 2HYJA 2IEKA 1PUFB 3BJBA 3NRGA 3QPLA 4GCTA 2AO9A 3HTHA 3JRFA 1IRZA 2FD5A 1MSEC 3OOUA 3FIWA 3PO2J 5BNGA 2Q24A 2VKVA 4C3IJ 2GM4A 3NXCA 1A6IA 2CQQA 3TP3A 4ACIA 4DZJA 3RKQA 1SGMA 1MBKA 3B6CA 5FLMJ 1E3OC 3VVXA 5M3FJ 4MO7A 1JKRC 2ECCA 3ANPA 2X9DA 2N8GA 4IHWA 2RAEA 5FKKA 1NTCA 1ZQ3P 2OERA 3SDGA 3FK6A 2JA8J 3LSGA 3GTPJ 2HYTA 4QIWN 3BG3A 1ETYA 4A3CJ 2ID6A 1WCMJ 3Q0UA 4AF5A 2TRTA 1UI6A 4ICHA 1ORKA 4FE4A 3EUPA 1B72B 3I4MJ 1LE8A 5K58A 1ETWA 5M5WJ 3BNIA 4XIDA 3KKDA 1G2HA 4XK4A 4S0HB 5HSZA 4A3BJ 2G7GA 5J1UA 5JLWA 1FIPA 2JN6A 4D5CA 3GBGA 3Q0VA 1MBHA 2R7ZJ 3VOKA 3HB9A 3PASA 1GVDA 4UUSB 5EGOA 5AQCA 3RH2A 3RD3A 1H89C 4HKUA 3G1LA 3JSJA 1JUPA 3H3VK 4A3DJ 3G7RA 4A3FJ 2G7LA 1U8BA 2DTZA 4Y52J 4NN1A 4DZPA 5K7ZA 2DMTA 2UXHA 2B63J 4A3LJ 3HTJA 2ZCNA 1T33A 2FQ4A 4JX6A 2QTQA 3HDDA 2NX4A 3CDLA 3QPSA 1P7JA 1JJ8C 2YU9J 1TWCJ 1WH5A 5FKNA 1JGGA 3O8GA 5F0CA 2HDDA 5IPAA 3EGQA 1MBGA 1DU6A 2IBDA 4XRMA 3C07A 4D7MA 5K7HA 4I76A 3UKGA 1SFOJ 3F1BA 3KZ9A 3KKCA 4BY7J 2LY9A 3HBLA 3LSJA 4XRSG 3JRDA 2UXOA 3ON2A 2LTPA 5J1YA 4X6AJ 1DU0A 2IAIA 3HTAA 2ME0A 3PO3J 5IP7J 1FEXA 5DAJA 2E19A 1ZR2A 4A3EJ 3CWRA 3A01A 2EZHA 1F36A 2VKEA 4QSHA 2CJJA 2RASA 2DMNA 4ABZA 2NS7A 5J1RA 3AQTA 3GEUA 2WAQN 1P7IA 2AHQA 4M3DA 2K9QA 1AU7A 1JKQC 2MGQA 2EQRA 2HOTA 2L7MP 4XICA 3G1MA 3A03A 2DG8A 2NVXJ 3COLA 3HOWJ 1ETXA 1IUFA 5EF6A 3VW0A 4UDSA 2ZCMA 1Z0XA 2NOGA 1APLC 3BG5A 1T56A 5E3MA 3Q0WA 1W0TA 4CYCA 1MBJA 2DMPA 5K7FA 4GFBA 3CQZJ 3GTOJ 3ZQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR1 A;  1MH3 A;  4DYQ A;  5M5X J;  1IDY A;  2G3B A;  5D1R A;  2EH3 A;  5JLX A;  2XPU A;  5EZH A;  2HOA A;  4FE7 A;  5GPC A;  1XS9 A;  5IYD J;  2QOP A;  2CUE A;  2IU5 A;  3QKX A;  3KNW A;  4C3H J;  2Y9Y A;  4D5F A;  5F0F A;  5F27 A;  3JR9 A;  1GUU A;  4M3E A;  1ETQ A;  1X2N A;  3G1O A;  3JRI A;  4AYB N;  1RKW A;  2ID3 A;  4GFL A;  5CW8 A;  2E2H J;  3GTK J;  3TW7 A;  2FJ1 A;  1IV6 A;  2GUH A;  1JKO C;  1JT6 A;  1TWG J;  1LFU P;  1WPK A;  5GP9 A;  1BL0 A;  4BY1 J;  1TWA J;  2JA7 J;  1RR7 A;  4JX5 A;  1D5Y A;  2CUF A;  3NAU A;  2EZI A;  5E3L A;  1OCP A;  2DMQ A;  1ZTR A;  1IG7 A;  4AC6 A;  1ZK8 A;  2O7T A;  3NPI A;  1RES A;  1IGN A;  3BRU A;  2Y31 A;  3MVP A;  2NS8 A;  3S5R A;  1QRY A;  2ZOZ A;  5FKL A;  3D1N I;  3BTI A;  2GFN A;  3PM1 A;  5DS9 A;  4Y7N J;  2DA3 A;  5IP6 A;  2COB A;  3QQA A;  3BQZ A;  4G12 A;  3L1P A;  2TCT A;  4NDL A;  3M4O J;  2PZ9 A;  2QKO A;  2UXU A;  1TWF J;  3IUV A;  3HGY A;  1BW6 A;  4EEF G;  2MSY A;  2XDN A;  3BTC A;  3C2B A;  3GTQ J;  2L0K A;  3HTI A;  4JX4 A;  2DA7 A;  1ITY A;  5EEA A;  4KWA A;  2LD5 A;  3HOU J;  5IOY A;  4MK6 A;  2DA4 A;  2DG7 A;  1SAN A;  1LFB A;  2LP0 A;  4AC0 A;  4IHY A;  2HKU A;  5EDN A;  2GBY A;  2M2E A;  5HAW A;  1FTT A;  1JJ6 C;  3LWJ A;  1Y1V J;  2LLK A;  1I50 J;  2DA1 A;  3ZQF A;  5H9T A;  4CYC B;  3BG9 A;  2LVS A;  4M3G A;  1AKH A;  3V6G A;  1HOM A;  1HCR A;  2L7F P;  5F04 A;  1VFC A;  3W6V A;  4HNV A;  4J19 A;  4DYR A;  2ECB A;  2R5Y B;  3DCF A;  1W0U A;  1WGX A;  2V57 A;  3O8H A;  3RZD J;  5IOZ A;  3HIM A;  1U78 A;  2G0E A;  4M3B A;  1U9N A;  3OIO A;  2XB5 A;  3SFI A;  3JRG A;  3B81 A;  1O4X A;  2X48 A;  2ZB9 A;  2D6Y A;  2XB0 X;  5CXG A;  4IEJ A;  2NP5 A;  4MIM A;  3FIS A;  3ZQL A;  1GT0 C;  4L5E A;  1YRN A;  2VUM J;  1ZKG A;  1FIA A;  5J3L A;  3GTM J;  1IJW C;  2JK3 A;  3HOZ J;  5C4Y A;  1H88 C;  5EFY A;  4MFE A;  1ZR4 A;  2CU7 A;  4MLO A;  5HOD A;  2NVY J;  1IC8 A;  2R0Q C;  1RPW A;  2HQ5 A;  2M0C A;  4X1E A;  2JA5 J;  2M9H A;  1B8I A;  1MSF C;  3NNR A;  1PUF A;  2DA6 A;  3B6A A;  3JRC A;  5E3N A;  3LNQ A;  1K61 A;  2DA2 A;  1HLV A;  3HEF A;  4JP0 A;  2D5V A;  2JA6 J;  3S16 J;  4V2F A;  3TED A;  4IHV A;  3OSG A;  5IYC J;  4MFD A;  2VI6 A;  1RKT A;  5F0H A;  3IV5 A;  2YVE A;  1CQT A;  2YVH A;  3BTL A;  5FJ8 J;  2MG4 A;  5FHP A;  2E2I J;  3LSR A;  3S1N J;  4MXM A;  4RBO A;  1RET A;  2O7O A;  3Q3S A;  1LE8 B;  3VW1 A;  3WHC A;  2REK A;  5HBU A;  3BT9 A;  2EZL A;  1BW5 A;  3BCG A;  5C3E J;  4BKX A;  5EGO B;  3VPR A;  2QIB A;  4UUS A;  2FX0 A;  3WHB A;  2OI8 A;  4I6Z A;  5FKO A;  1S7E A;  1VF9 A;  3BR3 A;  3TP0 A;  2H8R A;  3M3Y J;  2G7S A;  4V2G A;  4W1U A;  3CMY A;  1WI3 A;  1GDT A;  2XGE A;  3GTL J;  3DEW A;  1JUS A;  2XGD A;  1MH4 A;  3JRB A;  1EF4 A;  1MBF A;  2H1K A;  4JKZ A;  4PXI A;  2YUS A;  3MNL A;  2R92 J;  3BR6 A;  5E3O A;  3LSP A;  4GCK A;  2CQX A;  4A93 J;  2HXO A;  3JRH A;  3F0C A;  1JTX A;  1X2M A;  3JRE A;  3GTJ J;  3V78 A;  3IH3 A;  5C44 J;  4A69 C;  2W48 A;  1HDD C;  5EYR A;  1TC3 C;  2QWT A;  2WB1 N;  2GLO A;  2QF7 A;  2EZK A;  1Q1V A;  5DTD A;  2DN0 A;  3S14 J;  1VND A;  2P81 A;  4A3M J;  3PPB A;  1MBE A;  3A01 B;  5M3M J;  3FK7 A;  3E7L A;  2XRL A;  2HOS A;  1A5J A;  1I6H J;  4D7N A;  5FKM A;  4A3G J;  4JL3 A;  2KT0 A;  3RQI A;  2F07 A;  5IYB J;  3HOX J;  3NI7 A;  2Y30 A;  3HKZ N;  4FCY A;  3HE0 A;  4A3K J;  2I10 A;  2DJN A;  1R9T J;  5FMP A;  3OSF A;  3BTJ A;  3TW6 A;  1F43 A;  3BHQ A;  1QVT A;  3RZO J;  4BBR J;  3VW2 A;  5FGL A;  3JRA A;  1JTY A;  3BQY A;  2ZOY A;  3CRJ A;  4QTR A;  2O9L A;  3G56 A;  4UUT A;  1JKP C;  4M6V A;  2K40 A;  1BJZ A;  1Z77 A;  2Y2Z A;  1JT0 A;  3S2H J;  1ENH A;  1QVU A;  1VI0 A;  3DPJ A;  2QCO A;  4GFK A;  3H0G J;  1WH7 A;  2OPT A;  5D18 A;  2OF7 A;  4A3I J;  1OCT C;  1HF0 A;  3MKL A;  2XPV A;  3BR2 A;  3CCY A;  4L62 A;  2WV1 A;  2LKX A;  3GTG J;  3HGG A;  4W97 A;  5EG0 A;  1GV5 A;  2NP3 A;  4C3J J;  4C2M J;  3A02 A;  4JNN A;  1GV2 A;  1XG1 A;  2E2J J;  2R5Z A;  3AQS A;  1POG A;  3ZOB A;  4FTH A;  1H8A C;  3S2D J;  2XPW A;  2M8G X;  5C4J J;  2PBX A;  4CGR A;  5F1J A;  2NVQ J;  3HOY J;  1JUM A;  2FBQ A;  3VVZ A;  1BA5 A;  3GZI A;  5EZG A;  5F08 A;  3K2A A;  2KDZ A;  2UXP A;  5M5Y J;  1I3Q J;  2L7Z A;  2Y0S N;  2JWT A;  3SJM A;  2ELK A;  3ZQG A;  3S1Q J;  3T6N A;  2XGC A;  4BXX J;  2L9R A;  3S15 J;  1UMQ A;  2NVT J;  3NAR A;  2XSD C;  1MNM C;  3IH4 A;  5C4X J;  3LOC A;  4DYC A;  2CRG A;  2JMW A;  4B1R A;  3MN2 A;  2R93 J;  3S17 J;  3K7A J;  5D19 A;  2PMZ N;  1QPI A;  5GPA A;  3S1M J;  2HXI A;  2M34 A;  3BR0 A;  1FJL A;  1NK2 P;  3ZQH A;  4AUX A;  2UXI A;  4RDU A;  1ETO A;  2LR8 A;  3I4N J;  2DMU A;  2JJ7 A;  3ANG A;  2W53 A;  4IHX A;  3P9T A;  1B72 A;  1UG2 A;  2DA5 A;  3LHQ A;  4GCL A;  1X58 A;  2RHA A;  2VPR A;  3FKI J;  1OFC X;  3LJL A;  4ME9 A;  2MW8 A;  2LK2 A;  3IH2 A;  1IDZ A;  2HI3 A;  1UHS A;  1Y1W J;  1ETK A;  3E7Q A;  2WUI A;  3ZQI A;  1U9O A;  3VIB A;  3VUQ A;  3VP5 A;  1AKH B;  3BR5 A;  1UI5 A;  4FIS A;  1OJL A;  5IP9 J;  4XRS A;  5CXI A;  3ON4 A;  4JYK A;  2ME6 A;  1HDP A;  1XC5 A;  3HM5 A;  2YS9 A;  2R5Y A;  4DW6 A;  4LOC A;  4B3A A;  3VOX A;  2K9S A;  2WGB A;  1TWH J;  2ZCX A;  3QBM A;  4NEL A;  4BBS J;  1AHD P;  4YZE A;  5EG0 B;  1NK3 P;  2E1O A;  1K83 J;  2EBI A;  2X6O A;  2LFB A;  4A3J J;  3S1R J;  1YRN B;  3FRQ A;  3O60 A;  3VVY A;  1ZGW A;  3HOV J;  5FLV A;  2O8K A;  9ANT A;  2R5Z B;  3CJD A;  1FTZ A;  2K9N A;  2Y9Z A;  4M3F A;  4B4C A;  2GEN A;  1B8I B;  1ETV A;  2HYJ A;  2IEK A;  1PUF B;  3BJB A;  3NRG A;  3QPL A;  4GCT A;  2AO9 A;  3HTH A;  3JRF A;  1IRZ A;  2FD5 A;  1MSE C;  3OOU A;  3FIW A;  3PO2 J;  5BNG A;  2Q24 A;  2VKV A;  4C3I J;  2GM4 A;  3NXC A;  1A6I A;  2CQQ A;  3TP3 A;  4ACI A;  4DZJ A;  3RKQ A;  1SGM A;  1MBK A;  3B6C A;  5FLM J;  1E3O C;  3VVX A;  5M3F J;  4MO7 A;  1JKR C;  2ECC A;  3ANP A;  2X9D A;  2N8G A;  4IHW A;  2RAE A;  5FKK A;  1NTC A;  1ZQ3 P;  2OER A;  3SDG A;  3FK6 A;  2JA8 J;  3LSG A;  3GTP J;  2HYT A;  4QIW N;  3BG3 A;  1ETY A;  4A3C J;  2ID6 A;  1WCM J;  3Q0U A;  4AF5 A;  2TRT A;  1UI6 A;  4ICH A;  1ORK A;  4FE4 A;  3EUP A;  1B72 B;  3I4M J;  1LE8 A;  5K58 A;  1ETW A;  5M5W J;  3BNI A;  4XID A;  3KKD A;  1G2H A;  4XK4 A;  4S0H B;  5HSZ A;  4A3B J;  2G7G A;  5J1U A;  5JLW A;  1FIP A;  2JN6 A;  4D5C A;  3GBG A;  3Q0V A;  1MBH A;  2R7Z J;  3VOK A;  3HB9 A;  3PAS A;  1GVD A;  4UUS B;  5EGO A;  5AQC A;  3RH2 A;  3RD3 A;  1H89 C;  4HKU A;  3G1L A;  3JSJ A;  1JUP A;  3H3V K;  4A3D J;  3G7R A;  4A3F J;  2G7L A;  1U8B A;  2DTZ A;  4Y52 J;  4NN1 A;  4DZP A;  5K7Z A;  2DMT A;  2UXH A;  2B63 J;  4A3L J;  3HTJ A;  2ZCN A;  1T33 A;  2FQ4 A;  4JX6 A;  2QTQ A;  3HDD A;  2NX4 A;  3CDL A;  3QPS A;  1P7J A;  1JJ8 C;  2YU9 J;  1TWC J;  1WH5 A;  5FKN A;  1JGG A;  3O8G A;  5F0C A;  2HDD A;  5IPA A;  3EGQ A;  1MBG A;  1DU6 A;  2IBD A;  4XRM A;  3C07 A;  4D7M A;  5K7H A;  4I76 A;  3UKG A;  1SFO J;  3F1B A;  3KZ9 A;  3KKC A;  4BY7 J;  2LY9 A;  3HBL A;  3LSJ A;  4XRS G;  3JRD A;  2UXO A;  3ON2 A;  2LTP A;  5J1Y A;  4X6A J;  1DU0 A;  2IAI A;  3HTA A;  2ME0 A;  3PO3 J;  5IP7 J;  1FEX A;  5DAJ A;  2E19 A;  1ZR2 A;  4A3E J;  3CWR A;  3A01 A;  2EZH A;  1F36 A;  2VKE A;  4QSH A;  2CJJ A;  2RAS A;  2DMN A;  4ABZ A;  2NS7 A;  5J1R A;  3AQT A;  3GEU A;  2WAQ N;  1P7I A;  2AHQ A;  4M3D A;  2K9Q A;  1AU7 A;  1JKQ C;  2MGQ A;  2EQR A;  2HOT A;  2L7M P;  4XIC A;  3G1M A;  3A03 A;  2DG8 A;  2NVX J;  3COL A;  3HOW J;  1ETX A;  1IUF A;  5EF6 A;  3VW0 A;  4UDS A;  2ZCM A;  1Z0X A;  2NOG A;  1APL C;  3BG5 A;  1T56 A;  5E3M A;  3Q0W A;  1W0T A;  4CYC A;  1MBJ A;  2DMP A;  5K7F A;  4GFB A;  3CQZ J;  3GTO J;  3ZQC A; 
#chains in the Genus database with same CATH topology
 4DYQ A;  4HOB A;  5M5X J;  1IDY A;  2QSH X;  5FFZ A;  1SD6 A;  4HX8 A;  5D1R A;  3HRU A;  5JLX A;  2XPU A;  4A6E A;  3FX3 A;  2CUE A;  3QKX A;  3KNW A;  5CVI A;  3HJE A;  4D5F A;  1I5Z A;  5F0F A;  3K70 D;  3JR9 A;  3LFU A;  1X2N A;  3JRI A;  5CW8 A;  4GFL A;  3ONQ A;  3EYY A;  2UXX A;  2VT2 A;  2HVQ A;  3ESW B;  2GUH A;  2Z16 A;  3V7S A;  1TNS A;  1TWG J;  5D6E A;  1Z1D A;  4BH9 A;  3P5J A;  4BY1 J;  1JHF A;  1BL0 A;  3ECH A;  1IW7 F;  3RTR A;  1FOK A;  2F6C A;  1CGP A;  2W24 A;  2J5P A;  2XUB A;  1ZTR A;  2O7T A;  1WFX A;  3IAS 2;  4XMY A;  1FYM A;  4LLN A;  1G59 A;  3S5R A;  2ZOZ A;  2GFN A;  1UHM A;  3DWL E;  3L2Q A;  5IP6 A;  5HDN A;  2EPF A;  3RKY A;  1JHH A;  1HW1 A;  3DTK A;  3KIO A;  3IUV A;  2DQL A;  1BJA A;  1FYK A;  5IT9 K;  1D1B A;  4ZYH A;  2F4M B;  1Q1H A;  2D2W A;  3B02 A;  2ZXJ A;  5B1A H;  1ITY A;  1Z9C A;  1FMV A;  4OIP F;  2LD5 A;  2QUF A;  4QLC U;  3M9A A;  2VC1 A;  4MK6 A;  2LP0 A;  2VE8 A;  4GYI A;  4IHY A;  2HKU A;  3ZGK A;  3KLO A;  1R5G A;  4Z2Y A;  1EH6 A;  4CZC A;  4HRI A;  3SWH A;  4Q47 A;  1YQA A;  4HW0 A;  1I50 J;  4Y17 A;  3ZQF A;  4DBR A;  2XAF A;  4CYC B;  4E7J A;  5H9T A;  3NRV A;  2P6T A;  3SQN A;  4NC8 A;  3L2U A;  2D45 A;  4EQQ A;  2VIX A;  1QO0 D;  3G3Z A;  1JXS A;  1X3U A;  1VFC A;  3W6V A;  2E34 A;  2X85 A;  1MMN A;  4J19 A;  1W0U A;  2ECB A;  2V57 A;  1YIT I;  4KUM A;  1KU7 A;  1U78 A;  2L2O A;  4P96 A;  3MKY B;  3OYE A;  3PSF A;  2XB5 A;  2K9L A;  2H8W A;  3B81 A;  3COA C;  3K70 C;  1SFU A;  2D6Y A;  1W7P A;  1RRJ A;  2DPU A;  2XB0 X;  5CXG A;  3JTH A;  5E18 F;  1B6A A;  3ZQL A;  3AG2 H;  2VBZ A;  3SZP A;  2XRN A;  3R60 A;  5FD6 A;  3GTM J;  1IJW C;  2LDU A;  4MFE A;  3BDD A;  1RR8 C;  2COM A;  4MLO A;  5H6R A;  5HOD A;  1Y56 A;  2HQ5 A;  2IP2 A;  2M0C A;  3OIQ A;  4X1E A;  3G4S I;  2JA5 J;  2M9H A;  1N78 A;  2IS4 A;  1PUF A;  4M71 A;  5JVG F;  2QKM B;  4WF2 A;  2DA6 A;  1TQI A;  3HRM A;  3GCM A;  3M1C A;  1WJE A;  1HLV A;  5DDG A;  5CVV A;  2D1V A;  2JA6 J;  2BY3 A;  3TED A;  3O3K A;  2HPM A;  3I64 A;  2V9P A;  5IYC J;  2VI6 A;  4V19 K;  4XRF A;  1TZL A;  4MEX F;  1NG7 A;  2P7C B;  3E0J B;  2J5O A;  4EVI A;  3EUA A;  3QOP A;  1RET A;  1TW2 A;  4GXO A;  3Q3S A;  2FBH A;  1LFP A;  1WVR A;  3WHC A;  3JAM K;  4D9J A;  2Z3Y A;  4XOT A;  3HUG B;  4ENM A;  1BW5 A;  1USS A;  2P4W A;  3EUH A;  3J80 K;  3QP6 A;  5HS7 A;  4HG2 A;  1QBJ A;  3VPR A;  2QIB A;  2DQR A;  2CFO A;  2CQN A;  1XX5 A;  2GZW A;  3RIR A;  1KON A;  1MKM A;  5FKO A;  1S7E A;  4AID A;  3VYU B;  3FMR A;  4KT6 A;  3TP0 A;  3N4M A;  3RYP A;  4E70 A;  5LLQ A;  2XVC A;  3K4B A;  3CMY A;  4BDY A;  2ESN A;  1FOW A;  1MMD A;  4AVP A;  1MMG A;  3FF5 A;  1VQ4 I;  2Z2S B;  2XGD A;  1MH4 A;  2A68 F;  4JKZ A;  3S93 A;  2AQF A;  5E3O A;  4CIC A;  4WWC A;  3PIO F;  3CD6 I;  1O3Q A;  3CJQ B;  4Y13 A;  3JRH A;  1VQ8 I;  1JTX A;  4QWQ A;  1KU2 A;  1HDD C;  3CC4 I;  2W48 A;  3LWF A;  5EYR A;  4ZJZ A;  2QWT A;  4HPQ A;  3I53 A;  2OZ6 A;  5DTD A;  2DN0 A;  3S14 J;  2HU9 A;  3E7L A;  2D1H A;  2KZG A;  3DPL C;  4RB1 A;  1A5J A;  4FAS D;  3DKX A;  3DPU A;  2ZJP F;  2KT0 A;  2DFH A;  2DLL A;  4XLA A;  3HHG A;  5KAI C;  3HE0 A;  3QYB A;  2HTJ A;  4PJN A;  2ZJQ F;  3OS0 A;  2DJN A;  1HKQ A;  5JFR A;  1OYY A;  2HYG D;  2Q2E A;  3CUQ C;  5ICE A;  3OSF A;  5BPI A;  4BBR J;  3ERE D;  2XF7 A;  1XTA A;  3VW2 A;  2JSP A;  1FBS A;  2QSG X;  1BIB A;  3DBR B;  4HLY A;  3ABT A;  2P5L C;  2DDB A;  2A3S A;  3NWS A;  1KYZ A;  3PQJ A;  2K40 A;  3S2H J;  1MMS A;  4U7D A;  3BPX A;  2LG4 A;  4ON0 A;  4A3I J;  2K86 A;  4E6K G;  1YE9 A;  4HZF A;  4P55 A;  4P5O A;  1UHW A;  2VXZ A;  3HGG A;  4W97 A;  2W57 A;  3F8C A;  5DCF A;  4FX0 A;  4PCQ A;  4C2M J;  4IOC F;  5D5X B;  4EJV A;  4NC7 A;  1Y6I A;  4ZDO A;  1RUO A;  2R5Z A;  3NEU A;  4IXA A;  1S8N A;  2XPW A;  1D5V A;  4CGR A;  1T0F C;  3EET A;  1YG2 A;  2NVQ J;  1JUM A;  3GZI A;  5ERI A;  1D0X A;  2O5R A;  3K2A A;  3MD2 A;  5ILU A;  2UXP A;  2Y0S N;  2JWT A;  3FKJ A;  2WB1 A;  2CH0 A;  4QPQ A;  1FC3 A;  4JQF A;  3P9I A;  3RPU D;  4BQQ A;  2V4J C;  2XGC A;  3R61 A;  2L9R A;  1ZRE A;  5BS6 A;  3U9G A;  4N4O B;  1K7A A;  1UMQ A;  3LAJ A;  2DOD A;  4XN0 A;  2CWE A;  4HDV A;  2R93 J;  2KIQ A;  3K7A J;  3F6O A;  5D19 A;  1QPI A;  2HXI A;  3GWZ A;  3BR0 A;  1NK2 P;  4BL0 B;  2BXY A;  3HKZ A;  2UXI A;  3U1D A;  2DMU A;  3V7C A;  4J00 A;  3CC2 I;  3P9T A;  3T0Y A;  3T8T A;  2E5N A;  1FMW A;  1UG2 A;  2EFP A;  2YU3 A;  4L9T A;  4LFU A;  3FKI J;  1ZHF A;  3M8F A;  2HVR A;  2ELJ A;  4BUP A;  3E7Q A;  3ZQI A;  2FML A;  2OV7 A;  3GZ6 A;  4EMS A;  3BR5 A;  1AKH B;  1E3H A;  2LSO A;  2VXD A;  4U0V A;  4E7S A;  5IP9 J;  4XRS A;  4E7I A;  3CDI A;  3ON4 A;  5CXI A;  4I99 C;  1QZY A;  1Z7U A;  5K5Q A;  2A2F X;  1E2X A;  3HM5 A;  3VEP A;  2XV4 S;  1R4N B;  2CW8 A;  4GYG A;  2EIM H;  4B3A A;  3VOX A;  2K9S A;  2CO5 A;  2KHM A;  1IV8 A;  4CCL A;  2JPB A;  3H9G A;  3IWF A;  3ASO H;  3KEY A;  2ZKZ A;  1KZH A;  2EBI A;  4A3J J;  2X6O A;  4CCO A;  2DPD A;  1YRN B;  3O60 A;  3OYL A;  3ZMV A;  5FLV A;  2K4J A;  2O8K A;  1XCB A;  1BI1 A;  1FWZ A;  3CCV I;  1FTZ A;  4G7Z F;  1YYV A;  4UY8 I;  4M3F A;  4U0W A;  4G7H F;  2EFO A;  5F1R A;  1B8I B;  2C6Y A;  4GGG A;  2IEK A;  1U5T C;  1W36 D;  2FA5 A;  4GCT A;  2K27 A;  2R4G A;  4XSX F;  2EV6 A;  3F9K A;  1OMI A;  1XDS A;  2IGN A;  1IRX A;  3RQ4 A;  3FIW A;  2K02 A;  2ZXI A;  3PNY A;  3PO2 J;  2CUJ A;  2VKV A;  3GFJ A;  4JBA A;  5KCM A;  2JT1 A;  3TP3 A;  2GM4 A;  3NXC A;  2VAS A;  2W1O A;  1DDN A;  4MGR A;  5IY5 H;  2Z9O A;  2R7O A;  4IHS A;  1JKR C;  2O8X A;  3GYH X;  2NRA C;  2X9D A;  2N8G A;  4H4K C;  3A0B C;  2RAE A;  3MEX A;  5FKK A;  1ZQ3 P;  1ZGJ A;  3FK6 A;  4EM0 B;  3GTP J;  2KMU A;  1F4K A;  1LDJ A;  4RB3 C;  4CZZ A;  2KZV A;  1R5I D;  3MZH A;  4U9L A;  1QA6 A;  1ETW A;  2XAH A;  5M5W J;  3CO7 C;  3BNI A;  3KKD A;  2HPI A;  4LLG F;  1WQ2 A;  4S0H B;  3WTY C;  4A3B J;  3HUG A;  1R23 A;  3T5X A;  4CSW A;  3GBG A;  2EIK H;  2BXZ A;  3GO5 A;  3OR2 C;  3VOK A;  2MH9 A;  3HB9 A;  4YII A;  2ACJ A;  3S32 A;  3PAS A;  4UUS B;  2B1E A;  5AQC A;  1Y0N A;  5FFX A;  1H89 C;  3MFK A;  2DFE A;  2RVC A;  4OMZ A;  5FRN A;  3H3V K;  1XDU A;  2BV6 A;  3G7R A;  4A3F J;  5B66 C;  2CV2 A;  2VOD A;  2A61 A;  4XBF A;  2E71 A;  4Y52 J;  2B0L A;  1AA7 A;  5L3E A;  1GHC A;  3E1S A;  2FQ4 A;  3JSO A;  2L9N A;  3KCC A;  1YX5 A;  2W84 A;  4EJO A;  1WKM A;  1P7J A;  1JGG A;  5J47 A;  3O8G A;  2IBD A;  2QM3 A;  2IA1 A;  3E6B A;  3RJP A;  3R6S A;  1SFO J;  3SZG A;  3PSI A;  1ACI A;  2V1N A;  3KKC A;  4ENJ A;  1DPU A;  2DOF A;  4TV7 A;  1UZC A;  5J1Y A;  3DPT A;  4UXN A;  1DU0 A;  3OIP A;  3C2H A;  3KYC B;  2ME0 A;  2DCE A;  2L3D A;  3PO3 J;  4AVZ A;  5DAJ A;  1ZR2 A;  1YHQ I;  2V6C A;  2EZH A;  1F36 A;  4I0A A;  4ABZ A;  2NS7 A;  5J1R A;  1VQN I;  1YS7 A;  5TGT A;  3GEU A;  2HTS A;  3ML6 A;  1P7I A;  2AHQ A;  1V3F A;  1KQ9 A;  4M3D A;  4BAY A;  2O3F A;  4XLN F;  2X6W A;  4A5M A;  2OA4 A;  2K9M A;  4LB6 B;  3K2Z A;  2HOT A;  4HDU A;  2ZBK A;  2ZSI B;  4ZYD A;  1I6X A;  3COL A;  3BRO A;  5B5E C;  3FHZ A;  3GFM A;  3HOW J;  5EF6 A;  5H6Q A;  5E20 A;  2O61 A;  4F3Q A;  2NOG A;  2BY0 A;  1MJ9 A;  1APL C;  1W1W E;  2I8D A;  1T56 A;  3Q0W A;  4DGW B;  3J7Z I;  2K7L A;  2DMP A;  1HW5 A;  1J5Y A;  1W0T A;  4I2O A;  2E1M C;  2M7B A;  2Y69 H;  1WJF A;  3BR1 A;  4NNJ A;  3HPG A;  2QEX I;  1XGM A;  3M1E A;  4RA2 A;  5ED4 A;  1J0R A;  3BJ6 A;  1TT5 B;  4X0G A;  2G3B A;  2A5W A;  2EH3 A;  4IX7 A;  5EZH A;  5GPC A;  2QOP A;  1XSX A;  1R58 A;  2RC4 A;  1A35 A;  1MND A;  3ABK H;  1P9Q C;  3FXU A;  1NH3 A;  5F27 A;  4KFC A;  3G1O A;  1IRG A;  3SYT A;  1U2W A;  3VYS B;  3IKV A;  1XD7 A;  4NC6 A;  4RAZ A;  2FJ1 A;  2NYX A;  5DYM A;  1JKO C;  3RSN A;  4HEA 2;  3CJT B;  3WU2 C;  5GP9 A;  3CCR I;  1TWA J;  1ZN2 A;  4JX5 A;  3PNV A;  5F64 A;  1D5Y A;  4ZYG A;  3VOE A;  5E3L A;  2CYY A;  3VWB A;  1OCP A;  4HNT A;  1S7O A;  1PYV A;  4ZZD A;  1HST A;  1T95 A;  1IGN A;  2NS8 A;  2FXA A;  1QRY A;  1SFK A;  2FOK A;  2H27 A;  3J7Y J;  4ESB A;  3PM1 A;  1KA8 A;  1TL8 A;  1B9N A;  2DA3 A;  3K1M A;  1FPQ A;  4A0Y A;  1LB2 A;  2VQC A;  4IRI A;  1BW6 A;  4EEF G;  2MSY A;  5J8C A;  2ZJR F;  2MAB A;  2CUZ A;  3C2B A;  5BOX A;  2L0K A;  3GTQ J;  3HTI A;  4RAF A;  1VQO I;  3EPZ A;  2R7F A;  2Z1D A;  1XPX A;  1NG6 A;  4N0B A;  5EEA A;  2DOA A;  3HOU J;  2BW3 B;  3W6K B;  3GEZ A;  2M1B A;  4NBQ A;  1LFB A;  1OPC A;  3E97 A;  3UNG C;  1VQL I;  4AC0 A;  2WC2 A;  2M87 A;  5LFA A;  5EDN A;  1YJN I;  4L5I A;  3F22 A;  3SHF A;  2ZME B;  4UB6 C;  3GZ5 A;  2GBY A;  3WTS C;  5B3S H;  2STT A;  1FTT A;  4AD9 A;  1JJ6 C;  3ECO A;  2CW7 A;  2LLK A;  3F8F A;  3LWJ A;  4B47 A;  3H3U A;  2XAJ A;  1VQ6 I;  2JZY A;  1XSD A;  1AKH A;  4I7H A;  1A04 A;  2M0M A;  1W5T A;  1U5T B;  1HCR A;  3S3M A;  3S3N A;  1HBX G;  4BNC A;  4M6X A;  4F91 B;  1LKX A;  1WGX A;  4HF0 A;  3CC7 I;  3ZMT A;  5IOZ A;  1X19 A;  3I58 A;  1U9N A;  4I02 A;  4YEL A;  3OIO A;  2KFD A;  2DTR A;  4AYB A;  3JRG A;  2ZB9 A;  5FD5 A;  1J59 A;  3BOQ A;  2UXN A;  4KIT B;  1K78 A;  2RQQ A;  2NP5 A;  5KAF C;  4IF4 A;  3FM3 A;  4EJT A;  1LVA A;  1MW7 A;  3K4N A;  1VQ9 I;  4L5E A;  1YRN A;  2VUM J;  3N05 A;  3U21 A;  1FIA A;  1R1V A;  3S2W A;  3DLL F;  1H88 C;  4F92 B;  4E7Z A;  2F5C A;  2A6E F;  1RPW A;  3DU6 A;  2PI0 A;  4OD5 A;  3KYD B;  2G7H A;  4ANJ A;  4WIB A;  1B8I A;  3NNR A;  1B1B A;  4PJM A;  2M8E A;  2PJP A;  2P5K A;  3H5A A;  5E3N A;  3HSR A;  3LNQ A;  2KIU A;  2DOE A;  3HEF A;  3E6D A;  1XGN A;  2B9S A;  3S16 J;  1ZLK A;  2HEO A;  1G3W A;  5B1B H;  3OSG A;  4IHV A;  4DQ2 A;  3QOE A;  4YFX F;  4A2U A;  2PN6 A;  1ODD A;  2F4O B;  1WJD A;  2STW A;  3IP4 B;  4KMF A;  2E7X A;  3LA7 A;  2MG4 A;  2KQR A;  3CDH A;  1SAU A;  5TJJ A;  4DJA A;  2BY2 A;  3LSR A;  3DU5 A;  4OIO F;  3S1N J;  1X1C A;  3CMA I;  3BWG A;  3VSL A;  4B48 A;  4B44 A;  3VW1 A;  2EIJ H;  3IRR A;  3KEO A;  1FBU A;  4P9F A;  2EZL A;  4XOR A;  2Z33 A;  2VPL A;  1TQP A;  1N77 A;  4KIG A;  2VBY A;  1T6S A;  2NS0 A;  5CKT A;  4PJ0 C;  3V7R A;  2X51 A;  2L9S A;  3CP2 A;  4UUS A;  3WHB A;  2OI8 A;  2HFH A;  4IHT A;  3WG7 H;  1I3A A;  2V79 A;  2VKD A;  4HAM A;  1VF9 A;  1S5L C;  3QYF A;  2VJJ A;  3BZC A;  4GO1 A;  3OV8 A;  3K4K A;  1D8J A;  1P92 A;  1T08 B;  4AIH A;  2XGE A;  3GTL J;  2KPM A;  1JUS A;  5E17 F;  2V6E A;  3SDB A;  3RCO A;  2R7V A;  1MBF A;  1OYI A;  1YJW I;  1SVL A;  2VBX A;  3MNL A;  4GCK A;  1G4D A;  4M9S A;  3CCS I;  3ZMS A;  2QQA A;  3OR1 C;  5CPR B;  2H6C A;  4XNF A;  3V78 A;  4I0B A;  1FY7 A;  2MC4 A;  4BU2 A;  3MZ8 A;  2XAQ A;  2WB1 N;  5DD8 A;  2QF7 A;  4AWX B;  2GLO A;  4KYW A;  4WX9 A;  1F9N A;  2XDV A;  1VND A;  4A3M J;  4MQV A;  2IPQ X;  3BLY A;  1WJC A;  2DDA A;  3FK7 A;  5CQG A;  3BG7 A;  2MD0 A;  2XRL A;  2HOS A;  2XKP A;  3ABM H;  1I6H J;  5JVT A;  3HSF A;  3GFI A;  3M7G A;  5E1W A;  3RQI A;  5LGT A;  2F07 A;  3IRQ A;  2Y30 A;  3HKZ N;  1XMK A;  4BYY A;  4CYD A;  1I27 A;  2LKP A;  3RYR A;  1BC8 C;  2F4I A;  4Y33 A;  5FMP A;  1F43 A;  2TDX A;  2KJC A;  2GA2 A;  1LJ9 A;  4IZZ A;  2FQ3 A;  1OR7 C;  3L2R A;  3DBL B;  1J9I A;  1M1E B;  3CRJ A;  2G9W A;  3G56 A;  1BJZ A;  1Z77 A;  1R1U A;  1ENH A;  1QVU A;  1U0J A;  4GFK A;  2HYF A;  1WH7 A;  2OPT A;  3LQQ A;  5D18 A;  2VC0 A;  4IRG A;  1A6Q A;  2L7K A;  1IN5 A;  3MKL A;  1MDM A;  4RGU A;  4IKF A;  2WV1 A;  4RM3 A;  2LKX A;  5EEG A;  3GTG J;  1RC9 A;  3RPQ A;  4KN4 X;  2QEN A;  4JNN A;  2FU4 A;  2FNP A;  1GV2 A;  3I9V 2;  5D8K B;  3G2B A;  1FOY A;  2A69 F;  3K4L A;  3LA2 A;  3AQS A;  2LF8 A;  3PQK A;  1POG A;  1LVK A;  4Q5S F;  1KU9 A;  4BHC A;  1R00 A;  3E5U A;  1A36 A;  3KP2 A;  3HOY J;  2FBQ A;  3VVZ A;  2JUC A;  5F08 A;  2MLG A;  5KK1 A;  1IN7 A;  4U87 A;  4XKV A;  3WGG A;  3OYG A;  1MMA A;  1AOY A;  4NQW B;  2ELK A;  3ZQG A;  5HLT A;  2DI3 A;  2HWV A;  5D4S A;  4BXX J;  2IW5 A;  3S15 J;  3A0H C;  1T8I A;  1ULY A;  2OQR A;  2RKH A;  3NAR A;  2XSD C;  1SMT A;  4MHG A;  2JMW A;  2DW4 A;  4KA4 A;  1IAW A;  3HZJ A;  3WE2 A;  2DJI A;  1ERD A;  1J75 A;  4PUS A;  4HF1 A;  5GPA A;  3S1M J;  2M34 A;  4D1Q A;  2BW3 A;  4N9I A;  4AUX A;  1ETO A;  1G3Y A;  5TRD A;  1F1Z A;  1KYW A;  1FOX A;  3DKY A;  4GCL A;  3DQV C;  3LHQ A;  1X58 A;  2P0W A;  2RHA A;  3HRT A;  1FP2 A;  4ME9 A;  1FBQ A;  1X3W B;  4BXU A;  2ZME A;  4LD5 A;  4OWR B;  4M6Y A;  4IOA F;  2GQQ A;  4E7H A;  2QWW A;  5J4Y A;  1UHS A;  3OS2 A;  1ETK A;  3VUQ A;  1YW8 A;  4MEY F;  3DF8 A;  3F21 A;  1UI5 A;  2K85 A;  2JRT A;  1WI9 A;  2NNY A;  4G9Y A;  4JYK A;  3JW4 A;  2UZK A;  4LGW A;  2LRD A;  1OCZ H;  1Z7L A;  3OL3 A;  1DP7 P;  4ESJ A;  2YS9 A;  1LNW A;  1T2K A;  3BC8 A;  4IQJ A;  3I0T A;  1UB9 A;  1CF7 B;  2WGB A;  1HA8 A;  2H6B A;  4U9N A;  1WJA A;  3L00 A;  5D4R A;  4YZE A;  5EG0 B;  2E1O A;  3OYH A;  3S1R J;  1TP4 A;  1UCR A;  4IL6 C;  1B59 A;  2LY2 A;  2NXN B;  4HQM A;  2QQB A;  3IL2 A;  3BCA A;  5KVR A;  3M8J A;  4IJA A;  9ANT A;  5JHF A;  1K4S A;  5HS8 A;  2JSC A;  2ISZ A;  5HVQ C;  1AWC A;  4BS9 A;  3QYE A;  1YJ9 I;  3OYM A;  1MZB A;  3NRG A;  1UJ8 A;  3F72 A;  3QPL A;  3H5R A;  4RGS A;  3JRF A;  2FD5 A;  3OOU A;  2R7U A;  3C18 A;  3GLL A;  1SFE A;  4CCN A;  2E7W A;  5J8F A;  1GVJ A;  4BJ6 C;  4C3I J;  3I54 A;  4XLE A;  2EV0 A;  3RKQ A;  1W7P D;  1MBK A;  4XM3 A;  5BMZ A;  3PFY A;  5HDG A;  5LEK A;  3B6C A;  5FLM J;  4UNO A;  1FT9 A;  1V5E A;  3I4P A;  4ZDP A;  3VVX A;  5DUI A;  4MO7 A;  3SEQ A;  2FEZ A;  3ANP A;  4FT8 A;  2PMZ A;  3CCQ I;  4B8X A;  2OER A;  2K3P A;  2NOJ B;  3FBN B;  2JA8 J;  3J81 Z;  4L0Z B;  2LC2 A;  3HXL A;  3S3O A;  1WCM J;  1UI6 A;  1B72 B;  1I1G A;  2QKL B;  2NNN A;  3WTZ A;  2PMH A;  5J1U A;  2XC7 A;  3VYR B;  2IS1 A;  4BE0 A;  1B9M A;  1MBH A;  1R4M B;  3Q0V A;  2R7Z J;  1EV7 A;  2RV8 A;  1XSV A;  1R1T A;  3JSJ A;  1C0W A;  4KIB A;  4ZZL A;  5K1Y A;  4XLH A;  3MZY A;  4K2E A;  2WBM A;  1U8B A;  5FRM A;  5L3D A;  4NN1 A;  5HNH A;  1YX3 A;  2DMT A;  2GA1 A;  4RAG A;  4A3L J;  4YIF A;  2ZCN A;  4MNU A;  1SVO A;  4BEH B;  1JI8 A;  4PSW A;  3HDD A;  2NX4 A;  3QPS A;  4OOI A;  1KU3 A;  1MNE A;  1TWC J;  1WH5 A;  2RNJ A;  5F0C A;  3SEZ A;  5IPA A;  1TT0 A;  3VOD A;  3CJR B;  1ZRD A;  4XRM A;  4ZTF A;  4I76 A;  2IT0 A;  4LLL A;  3KZ9 A;  2V1U A;  3JRD A;  2XRO A;  1H9T A;  4RMN A;  4F7Z A;  2YR2 A;  2LY1 A;  1OQY A;  2IAI A;  3HTA A;  2W4S A;  4OIN F;  4E7L A;  2V9K A;  2IA0 A;  5LEJ A;  2ZO4 A;  3FWE A;  3FHN A;  4OAZ A;  3CME I;  2ZXH A;  1QZZ A;  4XKW A;  3A2K A;  4N9H A;  1OIS A;  1DQU A;  5E1X A;  2K9Q A;  5DCM B;  1AU7 A;  2EQR A;  3KEQ A;  4F55 A;  2F5F A;  4ENK A;  3G1M A;  2DK5 A;  4LIV A;  4Q48 A;  4BJT A;  4DBQ A;  4PK4 A;  4ETS A;  1ZYR F;  5AIP A;  4UDS A;  1HW2 A;  4A0Z A;  2Q0O A;  2MBF A;  1N75 A;  1SEU A;  5E3M A;  4CYC A;  3WGI A;  1V55 H;  2V9V A;  4HLX A;  2CSO A;  1KQ0 A;  4KIF A;  3ZQC A;  5CJ9 A;  2ZFW A;  4EJW A;  4IO9 F;  3AG3 H;  2LH9 A;  4NUB A;  1BR4 A;  4Y15 A;  5H2F C;  4P9U A;  4U7B A;  2HOA A;  4FE7 A;  3LSM A;  5D5W B;  4PGH A;  2IU5 A;  4XLP F;  1UST A;  2Y9Y A;  5E8I A;  4AYB N;  1RKW A;  2ID3 A;  3VTI A;  1IV6 A;  1MJA A;  2M4G A;  3MCZ A;  2OCC H;  5FO5 A;  2ADU A;  1LFU P;  2JA7 J;  3KPH A;  3VFZ A;  3EQL F;  5E8G A;  2CUF A;  3NAU A;  3D0S A;  3K9T A;  2PG4 A;  4F52 A;  1ZK8 A;  2VQH A;  2BOL A;  3NPI A;  5CVJ A;  3Q9S A;  1OLT A;  2EA4 A;  2Y31 A;  3MVP A;  4XOP A;  3JSP A;  2EK5 A;  1DPR A;  5FKL A;  3SXY A;  4FX4 A;  2H1L A;  3EUH C;  4NQW A;  4G12 A;  4RGX A;  2CG4 A;  2DU9 A;  3L1P A;  2TCT A;  2FSW A;  1YTY A;  2PZ9 A;  3KP6 A;  1TWF J;  2XAS A;  4G6T B;  1Z3Y A;  1MIJ A;  1H0M A;  2XDN A;  1BI2 A;  3H9Q A;  3CJN A;  2M3A A;  5LHG A;  2HQA A;  2WAQ A;  3H92 A;  4JX4 A;  4L9J A;  2VON A;  4G6D A;  3OYD A;  4C2M A;  2QVO A;  1QQI A;  4BQO A;  3DTE A;  4KWA A;  4JK1 X;  2DO7 A;  3T1B A;  1SC7 A;  2DG7 A;  1SAN A;  3K1N A;  1VQ5 I;  4M9X A;  4LK0 F;  4BE2 A;  2HOE A;  2JA2 A;  4LIT A;  2AXT C;  3DEE A;  2M2E A;  2DFI A;  1FSH A;  2OC6 A;  5HAW A;  3NS4 A;  2EFN A;  3CES A;  2VJ5 A;  1BR1 A;  4LMY A;  1Z05 A;  2H09 A;  2OQG A;  4M9Z A;  2AS5 F;  4M3G A;  2GAU A;  3V6G A;  3EYI A;  1HOM A;  2FJI 1;  2L7F P;  5F04 A;  1O57 A;  3IHU A;  1W5S A;  2DT6 A;  3ZR8 X;  4L9N A;  4DYR A;  3HC7 A;  3DCF A;  2MA3 A;  2LYC A;  3DP7 A;  3HIM A;  2BHZ A;  3OS1 A;  1O3S A;  3AG4 H;  4M3B A;  3FXQ A;  4C30 A;  2IXS A;  3SFI A;  1O4X A;  2X48 A;  4HX7 A;  3MMY B;  2VBW A;  3H3Z A;  4IEJ A;  1ON1 A;  3CUQ B;  4MIM A;  3SFZ A;  2GIV A;  5L3G A;  2R7W A;  2HDW A;  5FRO A;  3PIP F;  2ZC2 A;  5J3L A;  3G73 A;  3HOZ J;  3QU3 A;  2KL4 A;  1BI0 A;  3FXJ A;  4II2 A;  3CTA A;  2L4A A;  3R0A A;  3GX4 X;  2CU7 A;  1IC8 A;  2NVY J;  2HQR A;  2R0Q C;  2W00 A;  1MSF C;  2CV1 A;  3AL0 C;  4XKC A;  1J09 A;  5ICC A;  3H1C A;  3OYK A;  2HDC A;  1E17 A;  3JRC A;  3FMQ A;  5TIS C;  1K61 A;  1X4P A;  2IJL A;  2A5Y B;  4JP0 A;  4A5N A;  4DIQ A;  5GAH J;  2VJ4 A;  1P4A A;  2OZU A;  4LIU A;  1XN7 A;  2FUG 2;  3PUB A;  5AIQ A;  5F0H A;  3OYI A;  3IV5 A;  3ZP5 A;  2WWY A;  3BTL A;  1ZAO A;  5FJ8 J;  4YFN F;  2WAE A;  3E6C C;  5FHP A;  3MKW B;  1FZP B;  1RUN A;  3ABU A;  3J7A O;  3OYJ A;  2IA2 A;  4UV8 A;  4MXM A;  2R7D A;  1ZRC A;  4C9Y A;  5FLX K;  2IGO A;  1FSE A;  5A2Q K;  1WJB A;  1SVM A;  3Q5F A;  2B7E A;  5H20 A;  4WXD A;  2YX4 A;  2KIM A;  4XR6 A;  5ILS A;  5EEH A;  3WTW C;  3BCG A;  3MWM A;  1OCR H;  1P2F A;  5EGO B;  4LB5 A;  3DEU A;  3OYN A;  1U8R A;  4CDG A;  1J7K A;  2HR3 A;  4XKB A;  2JQ7 A;  4OD4 A;  2F48 A;  3E5Q A;  2H8R A;  3M3Y J;  5F6F A;  2EA2 A;  4UUV A;  2G7S A;  2EV5 A;  4IPA A;  4B43 A;  5HLG A;  4W1U A;  3K4C A;  1SMY F;  4IVN A;  4YG2 F;  1BIA A;  3IAM 2;  2H1K A;  1EH7 A;  3I55 I;  2XIG A;  2KRH A;  2YUS A;  3S8P A;  3BR6 A;  2R92 J;  3LSP A;  2VKH A;  4Z6Y A;  1K4T A;  4A93 J;  4XLC A;  1VZ0 A;  3F0C A;  3D5R C;  2ZFU A;  3JRE A;  1Y39 A;  4GCV A;  4A69 C;  1T39 A;  1EH8 A;  4EAT A;  1TC3 C;  2EZK A;  1Q1V A;  2CGP A;  4PDK A;  1L0O C;  3F6V A;  3PPB A;  2MFZ A;  4ZYE A;  1JGS A;  1S6L A;  2CS3 A;  4EJU A;  3OY9 A;  2Y0S A;  2OJE D;  5IYB J;  3HOX J;  2K5C A;  3I59 B;  5HLH A;  3NI7 A;  2MLK A;  4FCY A;  5ILV A;  4KNY A;  3GVA A;  5J4V A;  3BTJ A;  2KIF A;  1Z21 A;  1O7L A;  2WY7 Q;  3KX2 A;  3TW6 A;  3ZN0 A;  1QVT A;  3RZO J;  3ZCO A;  2R7Q A;  4KT5 C;  4XLF A;  3ZRG A;  1WHU A;  4UVC A;  1JTY A;  2ZOY A;  1XB4 A;  2W7N A;  3H36 A;  4QTR A;  2QYO A;  2K3F A;  2Y2Z A;  1OYW A;  1SAX A;  3FDY A;  3MAJ A;  3SZT A;  2OUM A;  1IXS B;  2OF7 A;  3JCU C;  3PL8 A;  1OCT C;  2XAG A;  1EJ9 A;  6PAX A;  3P9C A;  5LRR A;  3BR2 A;  5D5V B;  2M30 A;  4L62 A;  4HV6 A;  3F3X A;  4BQA A;  1GV5 A;  2NP3 A;  3CMM A;  4C3J J;  3A02 A;  1LEA A;  3HOT A;  3HHH A;  1GXP A;  2R7X A;  1XG1 A;  2DK8 A;  2DAO A;  2E2J J;  3C3W A;  4FTH A;  1SFX A;  1H8A C;  1S9H A;  3LL7 A;  4ZH4 F;  2M8G X;  2PBX A;  5F1J A;  3DXJ F;  4UV9 A;  2ZNZ A;  1Z6T A;  2ZNY A;  1BA5 A;  3V8L A;  3F23 A;  3HRS A;  3LFK A;  1K79 A;  5K5O A;  4YFK F;  2PQ8 A;  2L7Z A;  1DUX C;  4XL9 A;  3HIF A;  3T6N A;  2M45 A;  3K4M A;  3ZMU A;  4AIJ A;  2NVT J;  3F8B A;  2IVM A;  3QRF F;  3OOP A;  3VSK A;  3QU6 A;  1PP8 F;  4HBL A;  1MNM C;  1Y8Q B;  3LOC A;  4M72 A;  4DYC A;  2EJR A;  2W82 A;  3MN2 A;  3S17 J;  3NWT A;  2PMZ N;  3EUK L;  2XHK A;  1IF1 A;  2RDP A;  3WU0 A;  3DTI A;  3FXR A;  4CO8 A;  3ZMZ A;  3OYC A;  3I4N J;  2W53 A;  4IHX A;  2DA5 A;  1Z3X A;  1G3S A;  2V1X A;  2GOM A;  4LG3 A;  2A6H F;  4L0Y B;  1T98 A;  5ICG A;  1FX7 A;  1OFC X;  3LJL A;  1WSU A;  1NHA A;  2MW8 A;  5GTI C;  2LK2 A;  3IH2 A;  5LGU A;  1P4X A;  1IDZ A;  2HI3 A;  2FBK A;  3U2R A;  3OYB A;  3IKT A;  2K4B A;  2QSF X;  1Y1W J;  2GXA A;  1U9O A;  3VIB A;  5IT3 A;  2X4H A;  5DUK A;  2KIS A;  2BYV E;  3WOD F;  2BEO A;  4FIS A;  4YIR X;  1OJL A;  1IZ1 A;  2LNB A;  4E7K A;  2MC3 A;  4UB8 C;  4FET A;  2ME6 A;  2Y48 A;  1HDP A;  1XC5 A;  2LOO A;  4DW6 A;  3M8E A;  2E35 A;  4LOC A;  4HF2 A;  2EB7 A;  1T38 A;  3ZPL A;  1TWH J;  1XGO A;  2H94 A;  1BBY A;  2ZCX A;  3QBM A;  4BBS J;  4HV5 A;  3ISP A;  3GF2 A;  2L54 A;  1NK3 P;  2LFB A;  3CUQ A;  4BQN A;  2DXI A;  2Q8K A;  3L2W A;  3CUO A;  3HOV J;  2BY1 A;  3O6B B;  3LMM A;  1QZE A;  3RDI A;  2R5Z B;  2E1M B;  2CFX A;  5HLI A;  3KP5 A;  1KGS A;  1PDN C;  5J6X A;  4CGZ A;  2Y9Z A;  4CUG A;  2GEN A;  3BJO A;  4HST A;  1ETV A;  1YFH A;  1V5F A;  2CV0 A;  2VOP A;  1O3R A;  3KFW X;  3BJB A;  2DT7 B;  3HTH A;  1IRZ A;  1BI3 A;  2E36 A;  4BGD A;  4UHT A;  3P9K A;  2Q24 A;  1A6I A;  4WK8 F;  1SGM A;  4AIK A;  2PEX A;  2VJI A;  3GUD A;  5M3F J;  3GW2 A;  4CA0 A;  2ECC A;  1QNT A;  4IHW A;  4M74 A;  3K69 A;  1NTC A;  4RGR A;  3A1Y A;  3SDG A;  3LSG A;  2HYT A;  4QIW N;  3BG3 A;  1ETY A;  3BG6 A;  2E5Z A;  2ID6 A;  3Q0U A;  3TBI A;  2TRT A;  5D6F A;  2PLY A;  3L7W A;  1ORK A;  1T0F A;  4I09 A;  4FE4 A;  3N97 A;  1YO5 C;  3EUP A;  5K58 A;  3HYI A;  1HQC A;  2MD5 A;  2ZCW A;  4XK4 A;  4HYE A;  2I5U A;  2G7G A;  5JLW A;  1P6R A;  2JN6 A;  4D5C A;  4PZJ A;  4BHB A;  2QBY B;  4L18 B;  3F8N A;  5GAD J;  2VN2 A;  3RH2 A;  3AG1 H;  2GOX B;  5EGO A;  1Z91 A;  2A6T A;  3G1L A;  4I01 A;  3OYF A;  4A3D J;  2F5E A;  5CVU A;  2F2E A;  3KET A;  1ZH5 A;  2Q1Z B;  1B4A A;  4UVB A;  3V42 A;  2G7L A;  4B09 A;  1BM9 A;  5AON A;  5KHD A;  4PJL A;  1S29 A;  2F5D A;  3D5S C;  1W5C C;  3HTJ A;  4EV0 A;  4PFO A;  4JX6 A;  3KE2 A;  3J81 K;  3W6J B;  3O2P E;  3ZQQ A;  1D0Z A;  1K6Y A;  3CDL A;  1S72 I;  2YU9 J;  1JJ8 C;  3VDX A;  2KRF A;  5FKN A;  2DT5 A;  1GLN A;  2HDD A;  1HSJ A;  2LKS A;  1MBG A;  3EDP A;  4A12 A;  4J01 A;  4BDZ A;  3C07 A;  4ENN A;  3R4K A;  1YW9 A;  4O5V A;  1ONV A;  4BY7 J;  2LY9 A;  3LSJ A;  4XRS G;  1BC7 C;  5FB2 A;  2X1D A;  2E1N A;  3PFI A;  2JPC A;  3TO6 A;  3JTG A;  1LDD A;  4XSZ F;  2QQ9 A;  2V26 A;  1FEX A;  2E19 A;  4L5J A;  3CWR A;  2VKE A;  4QSH A;  3TOB A;  4B3X A;  3L2C A;  1YLF A;  2RAS A;  3WU1 B;  3HTS B;  4BE1 A;  2NVU B;  4BXF A;  2WAQ N;  2ZSH B;  2BZT A;  3REO A;  5HNF A;  1PJR A;  1X1D A;  1JKQ C;  2MGQ A;  5DM7 F;  2L01 A;  4XIC A;  1TW3 A;  3OL4 A;  3I59 A;  3A03 A;  3K10 A;  2DG8 A;  2FE3 A;  3ELK A;  2NVX J;  1A31 A;  2VOO A;  2V7F A;  5JR3 A;  1ETX A;  2P6S A;  4U0Y A;  3LSH A;  1Z0X A;  3FXK A;  2BVM A;  4RB2 C;  1UEL B;  1RZ4 A;  1MBJ A;  4NHJ A;  3FXL A;  5K7F A;  3CQZ J;  1FLI A;  2Y0M A;  1D1A A;  3OMY A;  4LJZ F;  1MH3 A;  1U5T A;  3IUO A;  1ZEL A;  2X1C A;  2WV0 A;  3ERM A;  3BY6 A;  1XS9 A;  5IYD J;  4OIR F;  4KDP A;  4C3H J;  1SD7 A;  5CLS A;  2X0L A;  3L09 A;  5K5R A;  1D0Y A;  2DFF A;  1GUU A;  4M3E A;  1ETQ A;  3RPU A;  2MYS A;  5IT9 Z;  4KIC A;  4II3 A;  2E2H J;  3GTK J;  3TW7 A;  3WTV C;  1IRF A;  4R8H A;  2BBY A;  2FBI A;  4C2T A;  1JT6 A;  4I98 B;  1WPK A;  1RR7 A;  3QOD A;  2EZI A;  1IXR C;  2DMQ A;  1IG7 A;  4AC6 A;  5JI6 A;  3X2Q H;  3K6G A;  3HL2 A;  3FXM A;  1RES A;  1XGS A;  4U88 A;  5E79 C;  1YI2 I;  4C2U A;  3BRU A;  3LQR A;  1W4M A;  3LST A;  2VQL A;  3C2G A;  3CLQ A;  3V8K A;  3D1N I;  3WG9 A;  1RI7 A;  3BTI A;  3OYA A;  5DS9 A;  2KKO A;  4XQF A;  4Y7N J;  4CXF A;  1KQ8 A;  2COB A;  3QQA A;  3BQZ A;  3M4O J;  4NDL A;  2QKO A;  1HKT A;  2UXU A;  2MH2 A;  3HGY A;  3I3L A;  4A0X A;  2VB6 A;  3H9J A;  3HPH A;  3BTC A;  2OAZ A;  4N4N B;  1XCV A;  3U1K A;  2R7S A;  2DA7 A;  2HKO A;  2R7R A;  3KZY A;  3E5X A;  4MQ9 F;  1I39 A;  1DP3 A;  5IOY A;  2DA4 A;  1R36 A;  2HKX A;  2IGM A;  3FZV A;  1VQK I;  2DYS H;  4FHT A;  2AXL A;  4CCJ A;  2A05 A;  1IN8 A;  2PMU A;  4MTD A;  1FP1 D;  4A6D A;  2UV1 A;  4OMY A;  5LRS A;  1Y1V J;  2DA1 A;  1DGW Y;  2LF7 A;  3BG9 A;  2L02 A;  3W2A A;  2LVS A;  5D8L B;  3ZMD A;  4UVA A;  2KJB A;  4RB0 A;  2QQ8 A;  1PUE E;  1RNL A;  1TNT A;  1SD4 A;  4HNV A;  2R5Y B;  2FMY A;  3O8H A;  3RZD J;  4GRI A;  2FOW A;  5CVR A;  5LD2 C;  3CCM I;  2G0E A;  5DV5 A;  2WA0 A;  2E1C A;  3WTT C;  4RLF A;  1GXQ A;  2VQG A;  4EM2 A;  3Q9V A;  2ZY9 A;  3HTU A;  3FIS A;  3R0J A;  1GT0 C;  3ULQ B;  1ZKG A;  2G7U A;  5FGM A;  1LUJ B;  2OCE A;  3B73 A;  4RLQ A;  2KLO A;  2JK3 A;  3PUF A;  5C4Y A;  2P7V B;  5EFY A;  3AFH A;  2PJR B;  1ZR4 A;  4KMU X;  4ZYA A;  3GXO A;  3JAM Z;  1LEB A;  1G3T A;  3CCU I;  1N25 A;  2OTJ I;  4R79 A;  4DVY P;  1R49 A;  5KNL A;  2IS2 A;  3CCE I;  3B6A A;  4DOZ A;  3WE3 A;  3J80 Z;  2DA2 A;  3KLN A;  2NAZ A;  3ZXS A;  2D5V A;  1D3Y A;  4V2F A;  1V54 H;  4MFD A;  3I5U A;  3E3V A;  4O3M A;  1UAA A;  1RKT A;  3ZQ7 A;  1O3T A;  3M07 A;  2LMD A;  2ZXW H;  2YVE A;  1JE8 A;  1CQT A;  5HDK A;  2YVH A;  1G8X A;  5D5U B;  2Z99 A;  2LBF B;  3QP5 A;  5J40 A;  4NB5 A;  3K1P A;  2E2I J;  3V8J A;  1X1P A;  2UWM A;  2M5W A;  1LPQ A;  2QLZ A;  1YS6 A;  4RBO A;  2DBB A;  2O7O A;  5GTH C;  1PVE A;  1BOA A;  4Y3O A;  1LE8 B;  2REK A;  5HBU A;  3BT9 A;  4EM1 A;  2L5Q A;  1IN4 A;  5C3E J;  4Y4R A;  2QBY A;  3KP7 A;  4BKX A;  3HOS A;  4D0P A;  2FX0 A;  4LG0 B;  2EFW A;  4I6Z A;  2PFV A;  3RKW A;  1WJ5 A;  3K0L A;  2EIN H;  3VYT B;  4MTE A;  3BR3 A;  2RQP A;  2ZJ2 A;  2EWN A;  1O7F A;  3W3C A;  3FBI B;  2WY8 Q;  1VQ7 I;  4V2G A;  4S04 A;  5DM6 F;  1X4O A;  2GXB A;  1Y0U A;  3FXO A;  1WI3 A;  2HNH A;  4IQ4 A;  5GAG J;  1J2X A;  1GDT A;  2QA4 I;  3DEW A;  2JRM A;  3JRB A;  1EF4 A;  5CQE A;  1K78 B;  4PXI A;  1BR2 A;  1YW7 A;  2XKO A;  1BOB A;  2CQX A;  3BZ6 A;  2HXO A;  1ZLJ A;  1K6O A;  2ZME C;  3AAF A;  4BAC A;  2WAD A;  1X2M A;  3GTJ J;  3PJR A;  3DFG A;  1D8K A;  2HZT A;  3IH3 A;  5C44 J;  1ZRF A;  1UG0 A;  2EIL H;  2P81 A;  1QU3 A;  1MBE A;  4CHU A;  3A01 B;  5HOO A;  4ASN A;  5M3M J;  3CZ6 A;  3CLO A;  1OCO H;  2PBI A;  1QPM A;  1L3L A;  2VL8 A;  3HG9 A;  3ZN1 A;  4D7N A;  5FKM A;  3DBH B;  4E4H A;  4A3G J;  4IRH A;  4JL3 A;  3RI4 A;  4YEJ A;  3MQ0 A;  1Z6R A;  2FF4 A;  3IC7 A;  5E1Z B;  3K4J A;  2W25 A;  4A3K J;  2I10 A;  1X1A A;  2L4M A;  3D5L A;  4HX4 A;  2QZ8 A;  3LA3 A;  1V4R A;  5DEQ A;  1R9T J;  3BHQ A;  2M7A A;  4ESF A;  3CCJ I;  3WGH A;  2XGX A;  3QWL A;  1LQ1 A;  3C1D A;  5FGL A;  1YIO A;  1IN6 A;  3JRA A;  3CP8 A;  3BQY A;  3GFL A;  2O9L A;  4QPO A;  4ZTJ A;  4UUT A;  1JKP C;  1U3E M;  4M6V A;  1JT0 A;  5EJC A;  1VI0 A;  3MKZ A;  4PJJ A;  2QCO A;  3VB2 A;  3DPJ A;  3H0G J;  1FYL A;  3H35 A;  1YIJ I;  4HQE A;  1HF0 A;  3W2V A;  2HZD A;  2IRF G;  2UUZ A;  1CF7 A;  1Z67 A;  1XMX A;  2XPV A;  2BGC A;  1R7J A;  2V1D A;  2KP6 A;  3CCY A;  3ROU A;  3TQN A;  3H0D A;  2DYR H;  1ZG3 A;  5EG0 A;  5JHU A;  2ICW G;  4ITV A;  1HXD A;  2QGU A;  1HKS A;  3BPV A;  1REP C;  4KJZ A;  1XMA A;  2F5V A;  3IWZ A;  5ICF A;  3ZOB A;  4PSX A;  3AKZ A;  3FM5 A;  2YVX A;  3S2D J;  1SD5 A;  2CQ7 A;  1TLH B;  2WTE A;  5C4J J;  1ZG1 A;  4AM3 A;  2OTL I;  5L3B A;  2A07 F;  3GLX A;  4G6Q A;  5EZG A;  2KDZ A;  1MD0 A;  2ELH A;  1I3Q J;  3A4C A;  4BJ5 C;  5M5Y J;  3SJM A;  3TOA A;  4S05 A;  2KRC A;  5L3C A;  4RAY A;  3S1Q J;  4EGY A;  1ZG5 A;  2JTV A;  1UFM A;  3BZK A;  1ON2 A;  2ETH A;  2RRE A;  1QHH D;  3F8M A;  4P1W A;  3IH4 A;  5C4X J;  2CRG A;  3ASN H;  4B1R A;  3CO6 C;  2JUG A;  5L3F A;  1W36 C;  1ZGA A;  5BPD A;  1X3Z B;  2P8T A;  1YOV B;  4OAY A;  1FJL A;  3ZQH A;  1OCC H;  2LR8 A;  4RDU A;  1IUY A;  2BVL A;  2JJ7 A;  3ANG A;  3CF5 F;  1B72 A;  4XN3 A;  2OD5 A;  4G8X A;  3TDU C;  1EA3 A;  2ISY A;  2VPR A;  4ZC3 A;  4F93 B;  2XF6 A;  4JOM A;  1R5H A;  4CCK A;  4H0E A;  3LAP A;  3TKY A;  2WUI A;  5LHI A;  4AU7 A;  3VP5 A;  2O0Y A;  1S7A A;  2OBP A;  2JVH A;  1TBX A;  3KZZ A;  3TDZ C;  3V4G A;  4DNC A;  2O6G E;  3KP3 A;  4RM2 A;  3BJA A;  4WCG A;  3G71 I;  2IS6 A;  1WWX A;  2VT3 A;  3QPH A;  2YX7 A;  2R5Y A;  1MDM B;  2OU2 A;  4BEH A;  2ESH A;  2O03 A;  1W7P B;  2CQK A;  4NEL A;  2X6Y A;  1AHD P;  2BHY A;  3BCB A;  2CMP A;  1K83 J;  3FRQ A;  3VVY A;  1ZGW A;  4LK1 F;  3TGN A;  1OR7 A;  3CF2 A;  3J7A Y;  1LDK B;  2CW0 F;  4HNU A;  3CJD A;  3KP4 A;  3TL4 X;  4L9V A;  1MGT A;  2K9N A;  3RKX A;  2PJR A;  4B4C A;  1VTN C;  3PNT A;  5GAE J;  2HYJ A;  1OKR A;  1PUF B;  2Y75 A;  2VLA A;  2XF5 A;  2AO9 A;  3W2W A;  4WXH A;  3TO7 A;  2X1E A;  1MSE C;  4G7O F;  2FNA A;  2X6X A;  4KIS A;  3CCL I;  4EGZ A;  3C7J A;  5BNG A;  2XSJ C;  5DCM A;  1PP7 U;  5CYV A;  2CQQ A;  4ACI A;  1TQM A;  4DZJ A;  1RIO H;  4XON A;  3TO9 A;  3T8R A;  5BQT A;  5HS9 A;  1E0E A;  4FQG A;  3E6M A;  3I71 A;  1MJB A;  1E3O C;  4WXC A;  2RNG A;  1G6N A;  5LBQ A;  1H9G A;  2LBF A;  1BN5 A;  3DKW A;  4KN7 X;  2R3S A;  1DGR M;  2LRE A;  2R7T A;  4A3C J;  1F5T A;  4AF5 A;  2XAU A;  4ICH A;  2PX9 A;  1P4W A;  1IXC A;  1LE8 A;  1U6G A;  3I4M J;  4XID A;  3ABL H;  1G2H A;  5HSZ A;  2Z5U A;  2WAF A;  2HQN A;  1FIP A;  1R6R A;  4G94 A;  2VE9 A;  1I1S A;  1GVD A;  3RD3 A;  3L9F A;  4HKU A;  2KDO A;  4LG0 A;  1JUP A;  5LHH A;  1VQP I;  2FRH A;  3DV8 A;  3HSE A;  2BE5 F;  2DTZ A;  3QPT A;  5LGN A;  3DLA A;  1ZAR A;  2JVG A;  3GME A;  1FNN A;  4PGG A;  2PFB A;  2RGV A;  4DZP A;  2YPR A;  5K7Z A;  4OIQ F;  1VQM I;  2B63 J;  2UXH A;  1T33 A;  2HVS A;  2GXG A;  4HSR A;  2QTQ A;  3LSI A;  3KYL A;  4YRV A;  4R1H A;  1WRJ A;  4RS8 A;  4ZDL A;  5DD4 A;  2W85 A;  3GZN B;  2L9V A;  1TTY A;  3EGQ A;  1Y8R B;  1S3J A;  1DU6 A;  4IRV A;  2M4K A;  4D7M A;  5K7H A;  2AQE A;  3WTU C;  1V5G A;  3UKG A;  3TMO A;  2GIZ A;  4HA8 A;  1R71 A;  3F1B A;  3L2V A;  3HBL A;  2RN7 A;  3KZI C;  3FMS A;  3LSK A;  2UXO A;  3ON2 A;  2LTP A;  4X6A J;  1R22 A;  2EFQ A;  5FLX Z;  1HC8 A;  5IP7 J;  1STZ A;  4M73 A;  1QHG A;  4O6J A;  5A2Q Z;  3A01 A;  4A3E J;  1IO2 A;  1QGP A;  3OWT A;  2CJJ A;  2DMN A;  3P7N A;  2E60 A;  3AQT A;  2B3W A;  4Q4Z F;  2IGK A;  3WTX C;  3I56 I;  2L7M P;  3BP8 A;  3K8P C;  1E3P A;  2Q2E B;  3NQO A;  1IUF A;  2GWR A;  3VW0 A;  4PFP A;  2ZCM A;  4CH7 A;  2YSR A;  4CCM A;  4OU0 A;  3UR3 C;  1EKE A;  3H5N A;  2HS5 A;  3BG5 A;  2P5V A;  3QAH A;  4GDF A;  1X1B A;  4GFB A;  3G6E I;  1WZ2 A;  4BHP A;  3GTO J;  2HGC A;  1D1C A;  3AL0 B; 
#chains in the Genus database with same CATH homology
 3BR1 A;  1MH3 A;  4DYQ A;  5M5X J;  1IDY A;  2G3B A;  5D1R A;  2EH3 A;  5JLX A;  2XPU A;  5EZH A;  2HOA A;  4FE7 A;  5GPC A;  1XS9 A;  5IYD J;  2QOP A;  2CUE A;  2IU5 A;  3QKX A;  3KNW A;  4C3H J;  2Y9Y A;  4D5F A;  5F0F A;  5F27 A;  3JR9 A;  1GUU A;  4M3E A;  1ETQ A;  1X2N A;  3G1O A;  3JRI A;  4AYB N;  1RKW A;  2ID3 A;  4GFL A;  5CW8 A;  2E2H J;  3GTK J;  3TW7 A;  2FJ1 A;  1IV6 A;  2GUH A;  1JKO C;  1JT6 A;  1TWG J;  1LFU P;  1WPK A;  5GP9 A;  1BL0 A;  4BY1 J;  1TWA J;  2JA7 J;  1RR7 A;  4JX5 A;  1D5Y A;  2CUF A;  3NAU A;  2EZI A;  5E3L A;  1OCP A;  2DMQ A;  1ZTR A;  1IG7 A;  4AC6 A;  1ZK8 A;  2O7T A;  3NPI A;  1RES A;  1IGN A;  3BRU A;  2Y31 A;  3MVP A;  2NS8 A;  3S5R A;  1QRY A;  2ZOZ A;  5FKL A;  3D1N I;  3BTI A;  2GFN A;  3PM1 A;  5DS9 A;  4Y7N J;  2DA3 A;  5IP6 A;  2COB A;  3QQA A;  3BQZ A;  4G12 A;  3L1P A;  2TCT A;  4NDL A;  3M4O J;  2PZ9 A;  2QKO A;  2UXU A;  1TWF J;  3IUV A;  3HGY A;  1BW6 A;  4EEF G;  2MSY A;  2XDN A;  3BTC A;  3C2B A;  3GTQ J;  2L0K A;  3HTI A;  4JX4 A;  2DA7 A;  1ITY A;  5EEA A;  4KWA A;  2LD5 A;  3HOU J;  5IOY A;  4MK6 A;  2DA4 A;  2DG7 A;  1SAN A;  1LFB A;  2LP0 A;  4AC0 A;  4IHY A;  2HKU A;  5EDN A;  2GBY A;  2M2E A;  5HAW A;  1FTT A;  1JJ6 C;  3LWJ A;  1Y1V J;  2LLK A;  1I50 J;  2DA1 A;  3ZQF A;  5H9T A;  4CYC B;  3BG9 A;  2LVS A;  4M3G A;  1AKH A;  3V6G A;  1HOM A;  1HCR A;  2L7F P;  5F04 A;  1VFC A;  3W6V A;  4HNV A;  4J19 A;  4DYR A;  2ECB A;  2R5Y B;  3DCF A;  1W0U A;  1WGX A;  2V57 A;  3O8H A;  3RZD J;  5IOZ A;  3HIM A;  1U78 A;  2G0E A;  4M3B A;  1U9N A;  3OIO A;  2XB5 A;  3SFI A;  3JRG A;  3B81 A;  1O4X A;  2X48 A;  2ZB9 A;  2D6Y A;  2XB0 X;  5CXG A;  4IEJ A;  2NP5 A;  4MIM A;  3FIS A;  3ZQL A;  1GT0 C;  4L5E A;  1YRN A;  2VUM J;  1ZKG A;  1FIA A;  5J3L A;  3GTM J;  1IJW C;  2JK3 A;  3HOZ J;  5C4Y A;  1H88 C;  5EFY A;  4MFE A;  1ZR4 A;  2CU7 A;  4MLO A;  5HOD A;  2NVY J;  1IC8 A;  2R0Q C;  1RPW A;  2HQ5 A;  2M0C A;  4X1E A;  2JA5 J;  2M9H A;  1B8I A;  1MSF C;  3NNR A;  1PUF A;  2DA6 A;  3B6A A;  3JRC A;  5E3N A;  3LNQ A;  1K61 A;  2DA2 A;  1HLV A;  3HEF A;  4JP0 A;  2D5V A;  2JA6 J;  3S16 J;  4V2F A;  3TED A;  4IHV A;  3OSG A;  5IYC J;  4MFD A;  2VI6 A;  1RKT A;  5F0H A;  3IV5 A;  2YVE A;  1CQT A;  2YVH A;  3BTL A;  5FJ8 J;  2MG4 A;  5FHP A;  2E2I J;  3LSR A;  3S1N J;  4MXM A;  4RBO A;  1RET A;  2O7O A;  3Q3S A;  1LE8 B;  3VW1 A;  3WHC A;  2REK A;  5HBU A;  3BT9 A;  2EZL A;  1BW5 A;  3BCG A;  5C3E J;  4BKX A;  5EGO B;  3VPR A;  2QIB A;  4UUS A;  2FX0 A;  3WHB A;  2OI8 A;  4I6Z A;  5FKO A;  1S7E A;  1VF9 A;  3BR3 A;  3TP0 A;  2H8R A;  3M3Y J;  2G7S A;  4V2G A;  4W1U A;  3CMY A;  1WI3 A;  1GDT A;  2XGE A;  3GTL J;  3DEW A;  1JUS A;  2XGD A;  1MH4 A;  3JRB A;  1EF4 A;  1MBF A;  2H1K A;  4JKZ A;  4PXI A;  2YUS A;  3MNL A;  2R92 J;  3BR6 A;  5E3O A;  3LSP A;  4GCK A;  2CQX A;  4A93 J;  2HXO A;  3JRH A;  3F0C A;  1JTX A;  1X2M A;  3JRE A;  3GTJ J;  3V78 A;  3IH3 A;  5C44 J;  4A69 C;  2W48 A;  1HDD C;  5EYR A;  1TC3 C;  2QWT A;  2WB1 N;  2GLO A;  2QF7 A;  2EZK A;  1Q1V A;  5DTD A;  2DN0 A;  3S14 J;  1VND A;  2P81 A;  4A3M J;  3PPB A;  1MBE A;  3A01 B;  5M3M J;  3FK7 A;  3E7L A;  2XRL A;  2HOS A;  1A5J A;  1I6H J;  4D7N A;  5FKM A;  4A3G J;  4JL3 A;  2KT0 A;  3RQI A;  2F07 A;  5IYB J;  3HOX J;  3NI7 A;  2Y30 A;  3HKZ N;  4FCY A;  3HE0 A;  4A3K J;  2I10 A;  2DJN A;  1R9T J;  5FMP A;  3OSF A;  3BTJ A;  3TW6 A;  1F43 A;  3BHQ A;  1QVT A;  3RZO J;  4BBR J;  3VW2 A;  5FGL A;  3JRA A;  1JTY A;  3BQY A;  2ZOY A;  3CRJ A;  4QTR A;  2O9L A;  3G56 A;  4UUT A;  1JKP C;  4M6V A;  2K40 A;  1BJZ A;  1Z77 A;  2Y2Z A;  1JT0 A;  3S2H J;  1ENH A;  1QVU A;  1VI0 A;  3DPJ A;  2QCO A;  4GFK A;  3H0G J;  1WH7 A;  2OPT A;  5D18 A;  2OF7 A;  4A3I J;  1OCT C;  1HF0 A;  3MKL A;  2XPV A;  3BR2 A;  3CCY A;  4L62 A;  2WV1 A;  2LKX A;  3GTG J;  3HGG A;  4W97 A;  5EG0 A;  1GV5 A;  2NP3 A;  4C3J J;  4C2M J;  3A02 A;  4JNN A;  1GV2 A;  1XG1 A;  2E2J J;  2R5Z A;  3AQS A;  1POG A;  3ZOB A;  4FTH A;  1H8A C;  3S2D J;  2XPW A;  2M8G X;  5C4J J;  2PBX A;  4CGR A;  5F1J A;  2NVQ J;  3HOY J;  1JUM A;  2FBQ A;  3VVZ A;  1BA5 A;  3GZI A;  5EZG A;  5F08 A;  3K2A A;  2KDZ A;  2UXP A;  5M5Y J;  1I3Q J;  2L7Z A;  2Y0S N;  2JWT A;  3SJM A;  2ELK A;  3ZQG A;  3S1Q J;  3T6N A;  2XGC A;  4BXX J;  2L9R A;  3S15 J;  1UMQ A;  2NVT J;  3NAR A;  2XSD C;  1MNM C;  3IH4 A;  5C4X J;  3LOC A;  4DYC A;  2CRG A;  2JMW A;  4B1R A;  3MN2 A;  2R93 J;  3S17 J;  3K7A J;  5D19 A;  2PMZ N;  1QPI A;  5GPA A;  3S1M J;  2HXI A;  2M34 A;  3BR0 A;  1FJL A;  1NK2 P;  3ZQH A;  4AUX A;  2UXI A;  4RDU A;  1ETO A;  2LR8 A;  3I4N J;  2DMU A;  2JJ7 A;  3ANG A;  2W53 A;  4IHX A;  3P9T A;  1B72 A;  1UG2 A;  2DA5 A;  3LHQ A;  4GCL A;  1X58 A;  2RHA A;  2VPR A;  3FKI J;  1OFC X;  3LJL A;  4ME9 A;  2MW8 A;  2LK2 A;  3IH2 A;  1IDZ A;  2HI3 A;  1UHS A;  1Y1W J;  1ETK A;  3E7Q A;  2WUI A;  3ZQI A;  1U9O A;  3VIB A;  3VUQ A;  3VP5 A;  1AKH B;  3BR5 A;  1UI5 A;  4FIS A;  1OJL A;  5IP9 J;  4XRS A;  5CXI A;  3ON4 A;  4JYK A;  2ME6 A;  1HDP A;  1XC5 A;  3HM5 A;  2YS9 A;  2R5Y A;  4DW6 A;  4LOC A;  4B3A A;  3VOX A;  2K9S A;  2WGB A;  1TWH J;  2ZCX A;  3QBM A;  4NEL A;  4BBS J;  1AHD P;  4YZE A;  5EG0 B;  1NK3 P;  2E1O A;  1K83 J;  2EBI A;  2X6O A;  2LFB A;  4A3J J;  3S1R J;  1YRN B;  3FRQ A;  3O60 A;  3VVY A;  1ZGW A;  3HOV J;  5FLV A;  2O8K A;  9ANT A;  2R5Z B;  3CJD A;  1FTZ A;  2K9N A;  2Y9Z A;  4M3F A;  4B4C A;  2GEN A;  1B8I B;  1ETV A;  2HYJ A;  2IEK A;  1PUF B;  3BJB A;  3NRG A;  3QPL A;  4GCT A;  2AO9 A;  3HTH A;  3JRF A;  1IRZ A;  2FD5 A;  1MSE C;  3OOU A;  3FIW A;  3PO2 J;  5BNG A;  2Q24 A;  2VKV A;  4C3I J;  2GM4 A;  3NXC A;  1A6I A;  2CQQ A;  3TP3 A;  4ACI A;  4DZJ A;  3RKQ A;  1SGM A;  1MBK A;  3B6C A;  5FLM J;  1E3O C;  3VVX A;  5M3F J;  4MO7 A;  1JKR C;  2ECC A;  3ANP A;  2X9D A;  2N8G A;  4IHW A;  2RAE A;  5FKK A;  1NTC A;  1ZQ3 P;  2OER A;  3SDG A;  3FK6 A;  2JA8 J;  3LSG A;  3GTP J;  2HYT A;  4QIW N;  3BG3 A;  1ETY A;  4A3C J;  2ID6 A;  1WCM J;  3Q0U A;  4AF5 A;  2TRT A;  1UI6 A;  4ICH A;  1ORK A;  4FE4 A;  3EUP A;  1B72 B;  3I4M J;  1LE8 A;  5K58 A;  1ETW A;  5M5W J;  3BNI A;  4XID A;  3KKD A;  1G2H A;  4XK4 A;  4S0H B;  5HSZ A;  4A3B J;  2G7G A;  5J1U A;  5JLW A;  1FIP A;  2JN6 A;  4D5C A;  3GBG A;  3Q0V A;  1MBH A;  2R7Z J;  3VOK A;  3HB9 A;  3PAS A;  1GVD A;  4UUS B;  5EGO A;  5AQC A;  3RH2 A;  3RD3 A;  1H89 C;  4HKU A;  3G1L A;  3JSJ A;  1JUP A;  3H3V K;  4A3D J;  3G7R A;  4A3F J;  2G7L A;  1U8B A;  2DTZ A;  4Y52 J;  4NN1 A;  4DZP A;  5K7Z A;  2DMT A;  2UXH A;  2B63 J;  4A3L J;  3HTJ A;  2ZCN A;  1T33 A;  2FQ4 A;  4JX6 A;  2QTQ A;  3HDD A;  2NX4 A;  3CDL A;  3QPS A;  1P7J A;  1JJ8 C;  2YU9 J;  1TWC J;  1WH5 A;  5FKN A;  1JGG A;  3O8G A;  5F0C A;  2HDD A;  5IPA A;  3EGQ A;  1MBG A;  1DU6 A;  2IBD A;  4XRM A;  3C07 A;  4D7M A;  5K7H A;  4I76 A;  3UKG A;  1SFO J;  3F1B A;  3KZ9 A;  3KKC A;  4BY7 J;  2LY9 A;  3HBL A;  3LSJ A;  4XRS G;  3JRD A;  2UXO A;  3ON2 A;  2LTP A;  5J1Y A;  4X6A J;  1DU0 A;  2IAI A;  3HTA A;  2ME0 A;  3PO3 J;  5IP7 J;  1FEX A;  5DAJ A;  2E19 A;  1ZR2 A;  4A3E J;  3CWR A;  3A01 A;  2EZH A;  1F36 A;  2VKE A;  4QSH A;  2CJJ A;  2RAS A;  2DMN A;  4ABZ A;  2NS7 A;  5J1R A;  3AQT A;  3GEU A;  2WAQ N;  1P7I A;  2AHQ A;  4M3D A;  2K9Q A;  1AU7 A;  1JKQ C;  2MGQ A;  2EQR A;  2HOT A;  2L7M P;  4XIC A;  3G1M A;  3A03 A;  2DG8 A;  2NVX J;  3COL A;  3HOW J;  1ETX A;  1IUF A;  5EF6 A;  3VW0 A;  4UDS A;  2ZCM A;  1Z0X A;  2NOG A;  1APL C;  3BG5 A;  1T56 A;  5E3M A;  3Q0W A;  1W0T A;  4CYC A;  1MBJ A;  2DMP A;  5K7F A;  4GFB A;  3CQZ J;  3GTO J;  3ZQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...