The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
62
|
structure length |
62
|
Chain Sequence |
MGNIRTSFVKRIAKEMIETHPGKFTDDFDTNKKLVEEFSTVSTKHLRNKIAGYITRIISQQK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Translation
|
| molecule keywords |
30S ribosomal protein S17e
|
| publication title |
The solution structure of ribosomal protein S17E from Methanobacterium thermoautotrophicum: a structural homolog of the FF domain.
pubmed doi rcsb |
| source organism |
Methanothermobacter thermautotrophicus
|
| total genus |
17
|
| structure length |
62
|
| sequence length |
62
|
| ec nomenclature | |
| pdb deposition date | 2003-12-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00833 | Ribosomal_S17e | Ribosomal S17 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Diphtheria Toxin Repressor; domain 2 | Ribosomal protein S17e-like |
#chains in the Genus database with same CATH superfamily 5A2Q R; 3J81 R; 1RQ6 A; 3JAM R; 5FLX R; 5IT9 R; 3J7A W; 3J80 R; #chains in the Genus database with same CATH topology 3R60 A; 2HYF A; 1G3T A; 3R61 A; 4O6J A; 2F5F A; 1G3W A; 4HV6 A; 4HX7 A; 3JAM R; 3A52 A; 2QQA A; 1P92 A; 2DTR A; 3J80 R; 3J7A W; 1XCV A; 1BI0 A; 2H09 A; 2P0T A; 4HV5 A; 2QQB A; 4HX8 A; 1FWZ A; 2TDX A; 2EV0 A; 3GLX A; 2M35 A; 1FX7 A; 1G3S A; 2MVT A; 2MUN A; 1BI3 A; 1F5T A; 1RQ6 A; 2F5D A; 2HYG D; 5IT9 R; 2EV6 A; 1U8R A; 1BI2 A; 4O5V A; 2F5E A; 1ON1 A; 4HX4 A; 5A2Q R; 2X98 A; 1G3Y A; 3J81 R; 1DDN A; 2EV5 A; 2F5C A; 1B1B A; 1BI1 A; 1DPR A; 2MZ4 A; 1C0W A; 5FLX R; 2QQ9 A; 2ISZ A; 1ON2 A; #chains in the Genus database with same CATH homology 5A2Q R; 3J81 R; 1RQ6 A; 3JAM R; 5FLX R; 5IT9 R; 3J7A W; 3J80 R;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
