1RQ6A

Solution structure of ribosomal protein s17e from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tt802 / ontario center for structural proteomics target mth0803
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
MGNIRTSFVKRIAKEMIETHPGKFTDDFDTNKKLVEEFSTVSTKHLRNKIAGYITRIISQQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S17e
publication title The solution structure of ribosomal protein S17E from Methanobacterium thermoautotrophicum: a structural homolog of the FF domain.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Translation
total genus 17
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2003-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00833 Ribosomal_S17e Ribosomal S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.20 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Ribosomal protein S17e-like 1rq6A00
3JAMR 3J81R 1RQ6A 3J80R 5FLXR 3J7AW 5A2QR 5IT9R
chains in the Genus database with same CATH superfamily
3A52A 1ON1A 4O5VA 3J81R 4HX4A 2ISZA 1RQ6A 2MVTA 2X98A 4HV6A 4HX7A 1DPRA 1B1BA 2F5CA 2P0TA 2H09A 1G3YA 1G3WA 3R60A 2MZ4A 1FX7A 5FLXR 3J7AW 2EV6A 1C0WA 1F5TA 1XCVA 1BI1A 2EV0A 4HV5A 1BI3A 1U8RA 3R61A 2HYFA 3JAMR 2DTRA 2QQ9A 1BI0A 3J80R 2M35A 4HX8A 1DDNA 2F5FA 5IT9R 2F5DA 2QQBA 1G3SA 1FWZA 5A2QR 2MUNA 2EV5A 3GLXA 2TDXA 4O6JA 1ON2A 1G3TA 1BI2A 2QQAA 2F5EA 2HYGD 1P92A
chains in the Genus database with same CATH topology
3JAMR 3J81R 1RQ6A 3J80R 5FLXR 3J7AW 5A2QR 5IT9R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM R;  3J81 R;  1RQ6 A;  3J80 R;  5FLX R;  3J7A W;  5A2Q R;  5IT9 R; 
#chains in the Genus database with same CATH topology
 3A52 A;  1ON1 A;  4O5V A;  3J81 R;  4HX4 A;  2ISZ A;  1RQ6 A;  2MVT A;  2X98 A;  4HV6 A;  4HX7 A;  1DPR A;  1B1B A;  2F5C A;  2P0T A;  2H09 A;  1G3Y A;  1G3W A;  3R60 A;  2MZ4 A;  1FX7 A;  5FLX R;  3J7A W;  2EV6 A;  1C0W A;  1F5T A;  1XCV A;  1BI1 A;  2EV0 A;  4HV5 A;  1BI3 A;  1U8R A;  3R61 A;  2HYF A;  3JAM R;  2DTR A;  2QQ9 A;  1BI0 A;  3J80 R;  2M35 A;  4HX8 A;  1DDN A;  2F5F A;  5IT9 R;  2F5D A;  2QQB A;  1G3S A;  1FWZ A;  5A2Q R;  2MUN A;  2EV5 A;  3GLX A;  2TDX A;  4O6J A;  1ON2 A;  1G3T A;  1BI2 A;  2QQA A;  2F5E A;  2HYG D;  1P92 A; 
#chains in the Genus database with same CATH homology
 3JAM R;  3J81 R;  1RQ6 A;  3J80 R;  5FLX R;  3J7A W;  5A2Q R;  5IT9 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...