1RQAB

Crystallographic analysis of the interaction of nitric oxide with quaternary-t human hemoglobin. beta w73e hemoglobin exposed to no under anaerobic conditions
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
146
structure length
146
Chain Sequence
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPETQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the interaction of nitric oxide with quaternary-T human hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxygen storage/transport
molecule keywords Hemoglobin alpha chain
total genus 57
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1rqaB00
4PNJA 1J52A 4FH7A 1NZ3A 2VLYA 2MGBA 3MJPA 3WHMB 1UVXA 4U8UB 4YU3B 2QU0B 1G0AB 1J7YB 4N7PA 3UHDA 1LH1A 1Y4VB 2HBDA 2VM0A 5KERA 3S48C 1CMYA 3V2VA 4O1TA 1M9PA 1SDKA 3EU1B 1G08B 1G9VA 1Y85B 5AB8A 2GTLC 3ONZB 1C7CB 2MYAA 1QSIB 107MA 1DLWA 5CN9A 2DXMB 2DC3A 3MOUA 1J3ZA 2V1HA 4HHBB 1YHEA 3UHQA 1XZ4B 2NRMA 5CNCA 3A5BA 3KUOA 2QMBB 1FAWB 2XKHA 3GQGA 4QAUA 1FN3B 3UHHA 3IXFA 1VXHA 3NL7B 1HBBA 1NAZA 2OLPA 3CY5B 3GK9A 1JL7A 4F6JA 1R1YB 1YCAA 1YENA 1JEBB 1H97A 1BZ1B 2B7HA 3TM9A 1UIWB 1YEVA 4MPMA 4FWXA 2GRFA 1MLHA 1Y09B 3D4XB 1HDAA 3PELB 1J3YB 1NQPA 3WCTB 1BINA 1QXEA 2VEBA 2ZT4A 4H07A 1HGAB 2V1GA 2R80B 3BJ1B 2GDMA 4JYQA 1OFJA 1YFFA 3EOKB 1KD2B 1Y4RB 2G14A 1J7WB 3MKBA 2H8FB 1DLYA 5KERB 1BUWA 1Y4FA 1VXEA 1YDZA 3UH5A 3FS4A 2SPLA 1COHA 2LHBA 1YMAA 1M9PB 3LQDB 4MQHA 2EVPA 1LH5A 2GTLA 1YZIA 2NX0A 1HDBA 4TYXA 1J40A 3R5IA 1DWSA 3WCPA 5HBIA 7HBIA 1JZKA 3CIUA 3QM7A 2LH7A 1ECDA 5CN4A 2ZS0C 3A0GA 5JOMA 5IKSA 1ABWB 3OO5B 3H58A 1T1NB 1RVWA 1UFPA 2ZSTA 3P5QA 1X3KA 3WCUA 4MQIB 3WCWD 3NL7A 5AZQA 1HV4A 1F63A 1Y4GA 5SW7A 1BZZA 3GKVB 3UH3A 1YE2B 1NIHB 1NEJA 2MGMA 3HF4A 4F6IA 2ZFOB 2YRSB 2R4XA 2O5MX 1Y7CB 2MGCA 2C0KA 1YE0B 1DXCA 1HBHA 1Y8WA 1CIOA 2W6VB 2ZS0A 3MJPB 3AQ8A 2VHBA 1V75B 1THBB 4ROMB 1LFLB 2V1IA 2D2ND 1FHJA 4G1VA 1UMOA 1VXBA 3LR9A 1K1KA 1TU9A 1D8UA 1DTIA 4N8TA 3ONZA 3ZOMA 4F4OA 1HCOA 2VEEA 111MA 1O16A 110MA 2GTLB 2WTHA 3A59A 1Y5FB 1HDBB 1R1XB 2ZLVA 4FC3A 1Y7ZA 3D7OB 2MYCA 1LFTA 1YVQA 1CLSB 1HBSA 2W72A 1MLMA 3D1KB 2DN2B 2ZLXB 3ARJA 3NFEA 1XY0A 3ARKA 2EF2A 1UT0A 4NI0A 4U8UC 1T1NA 4U8UD 4IROB 1YG5A 4MXKA 5JDOC 4WCHD 3LB1A 1MYJA 1YIEA 1AZIA 3UHNA 5CN8A 2W6XA 1NS9B 1RQ3A 3FH9B 1V4UB 1HDAB 3D4XA 2HBSA 4ESAA 1GCWB 1A3OA 4KJTA 1HGAA 1O1JB 2PGHB 3QJCB 3WTGB 5ILEA 1DXDA 1F65A 3QJEA 4MBAA 5E83A 3W4UB 3WFXA 3OZUA 1Y4BA 4MQKA 105MA 2W6YA 3HEPA 1VREA 3MKBB 2D60A 2MYEA 1A6KA 103MA 3HHBA 1UX9A 2RI4B 3B75A 3TLDA 4L7YA 1G08A 2ZLUB 1WLAA 2DHBA 3BOMB 5EUIB 4BJAA 4M4BB 1DO1A 3ZJIA 3ZHWA 3WCPB 1XZVA 1DO7A 2HBFA 1MNHA 2AURA 4NXAA 2GNWA 1CH5A 2BK9A 4L2MA 3UHZA 1LH3A 3MYMA 4FC3B 2HHEB 2EVKA 1HABA 3AQ6A 3TM3A 1RSEA 2HCOA 1VWTB 3A9MA 1JP9A 2G0XA 3D1KA 3UHWA 1HGBB 1MOAA 5D1VA 1LA6B 4DWTA 1B86A 1VXGA 3ZJLA 3DUTA 3E55A 2V1EA 4PQCA 4N7OB 1DTMA 1QSHA 1YEQA 2ZT1A 2QSSB 5EQMA 3R0GA 1S56A 3LR7A 1MLQA 4MQJA 3PT7B 5MBAA 3G4YA 1IWHB 2YRSA 2D6CA 3VRGB 2NSRA 1NS9A 1BZ0A 1F5PA 1O1LB 1XXTB 3WHMA 1Y8IB 2ZS0B 1HLBA 3NMMA 1O1KB 4F69A 5EYSA 3UHXA 1IT2A 1YFFB 3EOKA 2MGIA 2R50A 4HSXA 3MBAA 3LB4A 5E83B 3W4UA 1EW6A 1MNKA 2LH1A 1A0ZB 2ZLWA 1YDZB 2FRKX 1Y7GA 1C7BA 2HZ3A 2MB5A 3UGYA 1NWNA 3GQPB 4ZVBA 4H2LA 3HEOA 4MAXA 1MOBA 1QI8A 5E29B 1UX8A 2HHBA 2ZLVB 1NPFA 1LUEA 2W31A 2BLJM 1OUUB 1J3FA 1Y8HA 1BZ6A 3CY5A 5HU6A 1NPGA 4ZVAA 1A3NB 3UH7A 3P5QB 3MN0A 3E5IA 2ZLTA 1VWTA 1MLOA 2VYYA 1TESA 2FRIX 2ZT2A 1DO3A 1KFRA 1N9IA 1ABYB 3UHSA 3WCWC 1Y45B 4KN3A 3HYUB 1RQAB 4F6FA 1BABB 3PI2A 1Y09A 1Y2ZA 2LH3A 1A9WE 4ROLA 3FH9A 3ARLA 3ZJNA 1YEUB 1Y0CB 3BJ1A 4UURA 2W6VA 3ZJOA 1C7DB 1MZ0A 3ZJMA 2Z6TA 3GDJA 4H0BA 2DN1A 3U3EA 1A6GA 1FHJB 1Y0WB 1VHBA 4MQCB 3UHBA 1MTIA 2FALA 1MLNA 5EETA 6HBWB 3GOUA 1S5XB 1COHB 3G4RA 4FH6A 1M6CA 1YOHA 4U8UA 4MQGA 1A0ZA 2LH5A 1FLPA 1SWMA 1S5YA 3K8BA 4G1BA 2D2MC 2G0VA 1Y4QB 2PEGB 1ECNA 1SDKB 3WR1B 5E29A 1JDOA 1BBBA 3PT8A 3LB2A 1H1XA 1V4XA 1MWBA 1XY0B 1YIHA 2ZSSA 5HU6B 1FDHA 2XKIA 1HGCB 4GZGA 2QSPB 1XZ2A 1BVCA 3PI8B 1ABYA 2ZFOA 3UHVA 112MA 3QJDA 1IDRA 3A2GA 4FWYA 1RQ3B 1Y2ZB 1Y31B 3QMAA 3NMLA 4ILZA 3ZJJA 1GDJA 1JEBA 3PIAA 1RTEA 1SPGB 3QM5A 1YHUC 1YHUD 3NG6A 3OZWA 3UH6A 3MJUB 1CH4A 3GDJB 5CNEA 5C6EB 1BJEA 4N7PB 1HBGA 1HHOB 1L2KA 3WCTA 1FSLA 3S1IA 2XKGA 2HZ2A 1BZRA 1YMCA 2FRFA 6HBWA 2VRYA 1C40A 5F0BA 3QZZA 1A00B 3G4QA 3A59B 1CG5A 1NWIA 1Y5JB 2OHBA 5HLUA 3ASEA 2D5ZA 1YVQB 1DXUB 2SPNA 5CHRA 3OZVA 1JY7A 2ZT0A 3OO4A 1YHEB 4O4TA 1GLIB 2BWHA 2NSSA 2OH9A 1MOCA 1CH9A 2EKUA 3SDHA 4HRTA 3WCTD 4F68A 1YG5B 3GQGB 3S66B 3AT6A 3M39A 1YHRA 1Y4PA 3DHRB 3OGBA 3BJ3B 1CPWA 1YVTB 2AV0A 1LHSA 1HGCA 3UHYA 2IG3A 1RPSA 1DWRA 2ZSQA 1BABA 1Y83B 1CO8A 1V4UA 3WCUD 1DO4A 4ESAB 2GRZA 3UBCA 3WCUC 4MQIA 1XZ7A 3QJDB 1NGKA 2H35A 3ZJHA 3D17A 1BZZB 1EBCA 3WI8A 1YEOB 3GKVA 1QPWB 5JGGA 5JDOE 1A4FB 3UHTA 3WCVB 1GZXB 5EE4C 1GBUA 1MYIA 1MGNA 1FSXA 1G0BA 2GKNA 4M4AA 1LFVB 2AUPA 4YU4A 3K8BB 4H2LB 1MYFA 1IT3A 2V1KA 3SZKB 4HBIA 1EWAA 2HZ1A 4N8TB 2ZFBB 1CH7A 2QMBA 2D2NB 4UIQA 1A0UB 1S61A 2GRHA 1RTXA 2D5XA 1Y8HB 2VLZA 3HRWA 1A3NA 2VLXA 2MYDA 1LTWA 5CMVA 1MWDA 5B84A 5CHQA 2ZFOC 1QSHB 1YEQB 3ZOLA 1N9XA 2VYWA 3DHRA 1HV4B 3M3BA 3S65B 1MLKA 1IWHA 2VYZA 1NXFA 3BJ2A 1YEVB 5CNFA 1Y22B 3WCVC 1MYMA 1JF4A 1G09A 3GKTA 1X9FD 1NEJB 2BMMA 3G4VA 3HENA 1Y0DA 3ECLA 4B3WA 2ZWJA 3RJNB 1F5OA 3GQRA 3QJBA 3K3UA 2R1HA 1NZ4A 1LJWB 2QLSA 4DC7A 1MNIA 3AQ7A 1GCVA 4XS0B 5HY8A 1HDSB 5CN6A 1MLLA 2ZLWB 3VAUA 4C44A 3EDBA 4C0NA 1NS6A 1G9VB 2MHBA 1IOPA 1A00A 4NZIA 1V4WA 1S5YB 1Y4BB 1NZ2A 3ECZA 1Y4VA 2HBDB 2ZS0D 1YCBA 3QQRA 3UHUA 2RI4A 1XZ4A 3B75B 1N9FA 3E5OA 3A0GB 1R1XA 1XYEA 2AV3A 1MODA 4B4YA 1A6MA 4NK2A 1V4XB 2ZLTB 1RVWB 4HRTB 3WCTC 3K9ZA 3S66A 2KSCA 3G52A 2DN2A 3ZJQA 1LFQA 1OJ6A 1Y4PB 1JL6A 3ZJPA 1S0HA 2R4ZA 1O1OB 2ZS1B 4ODCB 3UGZA 2ZSRA 1MLJA 2QSPA 3UHGA 3GLNA 5CN5A 4HHBA 1YHUA 4JACA 4ROLB 1OUTA 1WMUB 2BLIA 4KMWA 2Z85A 3HF4B 1FN3A 1PMBA 4OODA 2EB9A 1MCYA 1CP0A 5HLXA 1X9FA 1G09B 1S6AA 1Y8WB 1MBAA 1X9FC 1QXEB 106MA 1AJHA 1GCWA 1CP5A 3G46A 2DN1B 1GZXA 1Y0WA 1Y7DA 1FSXB 1G0BB 3PT7A 4WJG1 4MQCA 2MBWA 2ZSPA 1XZUA 1CIKA 3QQQA 5CN7A 1S5XA 2OHAA 5C6EA 1BZ0B 5EYJA 1Y0TA 2D60B 1GVHA 2O58X 1HDSA 2O5QX 1J3YA 4FWZA 3PI1A 1XQ5A 2EB8A 4O4ZA 4F4OB 1NS6B 1JZMA 3PI4A 2LH2A 1HCOB 3ZH0A 1YZIB 1G0AA 3BOMA 1IRDB 4M4BA 2DN3A 3WR1A 5HLQA 1DM1A 3D7OA 1XZVB 1BUWB 1O1IA 3DR9A 2ZSZA 2ZLXA 1XYEB 2G3HA 3ZJSA 3SDNA 3UHRA 3LQDA 4NI0B 1HABB 2WTGA 1XZ5B 3M38A 1AJ9A 1HACA 3UHCA 1HBAB 2Z6NA 1SI4B 1LFQB 1Y4GB 4NI1B 6HBIA 5SW7B 1ABSA 1UFJA 3LHBA 1HBRB 3CIUB 1RPSB 3IC2A 4O2GA 3UHEA 2G0RA 1Y22A 2QSSA 1QXDA 2FRJX 2MGJA 3AT5A 1DXVA 1VXCA 1O1MB 2R4WA 2MGLA 3EDAA 1B0BA 1MLFA 1A3OB 1A9WA 1WVPA 1MKOB 1ECAA 1GDKA 1O1JA 1RQ4B 1X9FB 3VRFA 1YENB 1BZPA 3WCVA 2OH8A 1V07A 1IBEA 1O1PA 1V75A 3QJEB 1ECOA 3GYSB 2MGKA 1NIHA 3WCWB 5C6YA 1XZUB 1LH6A 2R4YA 4YU4B 1MBNA 1THBA 4ROMA 1DXUA 2H8DB 5EOHA 3LB3A 1DKEA 3GOUB 5CNBA 1J7WA 1GDLA 1K1KB 2DN3B 1J7SB 1QI8B 1LFTB 1LH7A 1Y4FB 2D2MB 4MQGB 2XYKA 3HRWB 1O1IB 1OUUA 1J41A 2ZSXA 2HBCB 1K0YB 3BJ3A 1CG8A 1Y8KA 3RJ6A 2ZS1A 4ODCA 4IROA 3DUTB 1HACB 3G53A 1Y5FA 1YGDA 4UZVA 3OJ1A 3ORDA 3PT8B 4TWVA 3KMFC 4TWUA 2BNLA 1N9HA 2IN4A 3O7NA 1HBBB 5KKKA 3QM8A 3QM9A 2RAOB 2CMMA 1QXDB 1XXTA 3ZJRA 5KDQA 1I3DA 1Y5KB 1LH2A 2B7HB 1RQ4A 3VREA 1FCSA 1OR6A 1JP8A 5D5RA 1YE2A 2V1JA 1DXTB 4OF9A 3D1AB 4VHBA 1CQ2A 1IRCA 4O35A 1DUOA 5EUIA 1C7CA 3WFUA 3PI9B 1IRDA 2O5TX 2JHOA 1HHOA 5ILPA 1MYZA 1Y4QA 2HBEA 1J7SA 2HHDB 4MQHB 2QRWA 3WFWA 1FAWA 2DHBB 4HRRA 1HGBA 1Z8UB 2Z6NB 1S0HB 2HBCA 1LA6A 1CQXA 1CH1A 2LH6A 2MGFA 3HXNB 2HBFB 1R1YA 1HLMA 1V9QA 3IC2B 1YGDB 4WJGA 2HHEA 3M3AA 2NRLA 5F2AA 1A01B 1UIWA 1Y0AA 3NFEB 1YGFA 4MU5A 4G51A 1VXDA 1CBMA 109MA 1MBDA 4X0LB 1YEUA 1SPEA 1KR7A 1B86B 3PELA 1O1NB 2ZFOD 2BKMA 1MOHA 1NQPB 1Y83A 1SPGA 1MTJA 1URVA 5HY8B 2FAMA 2ZT3A 3WCVD 1URYA 3VRGA 1HBHB 3MJUA 2AA1B 2H8FA 3ODQB 1O1LA 2O5BX 1W92A 2W72C 1GJNA 3H57A 1MBCA 3D1AA 2PGHA 3QJCA 1LFLA 3WTGA 3GQPA 1DUKA 3QZXA 5MBNA 1MBIA 1CO9A 1MNJA 1U7SA 1JPBA 1LFVA 2PEGA 3A5AA 1BIJA 4F6GA 1BVDA 2D2MA 1CBLA 5E6EA 1XCHA 1MYGA 1YH9B 5HAVA 4N7NB 2ZLUA 1Y46A 3EU1A 3OO5A 1GBVA 2G10A 1Y8KB 2W6WA 1Y85A 1AJ9B 4KMVA 5ILMA 3RGKA 1HRMA 1MWCA 3PI3A 4AVDA 2MGGA 3AT6B 1OUTB 1WMUA 2GTLD 4NI1A 1J3ZB 1HBRA 1A0UA 1VRFA 3PI8A 2D5XB 2QFNA 1EMYA 3AT5B 3BCQB 1HJTA 1DXVB 1S69A 3UBVA 1Y0CA 1Y7CA 1Y7DB 1YE0A 5KDQB 1C7DA 3BJ2B 1DWTA 1RQAA 1LFZA 2ZSNA 1Y0TB 1SHRA 3DHTB 1DXTA 3WCWA 2G0SA 2QFKA 4MBNA 1VXAA 5ILRA 1Y0DB 1MLSA 2O5SX 1U7RA 2AA1A 3VHBA 2R1HB 1I3EA 3NMMB 3G4UA 2G12A 2MGEA 2ZS1D 1VXFA 2QU0A 4DWUA 1J7YA 1LFYB 1MNOA 2R80A 3MVCA 108MA 3AQ9A 3HHBB 1OR4A 2ZSYA 5CNGA 3AG0A 2MYBA 1JY7B 3AQ5A 101MA 2SPMA 1BIJB 2ZFBA 1BBBB 1C7BB 1QSIA 1HBSB 2W72B 4HSWA 1SI4A 1J41B 1OFKA 3FS4B 1CG8B 3KUNA 4N7NA 4AVEA 2Z8AA 4XDIA 1J40B 1JW8A 1UVYA 5B85A 1Q1FA 1Y35A 1YIEB 3IC0A 1A01A 1Y0AB 2O5OX 2BLHA 1JWNA 4X0LA 3G4WA 3D17B 3BCQA 1O1NA 3KMFA 1IBEB 1O1PB 3PIAB 1GBUB 4MQJB 1UC3A 1PBXA 3HYUA 1LHTA 2EKTA 1A6NA 1HBIA 2ZS1C 4NXCA 1OBMA 5EE4D 1LFZB 5CNDA 1MLGA 1Y31A 4MQKB 104MA 1GCVB 1V5HA 1Y8IA 2O5LX 1NZ5A 4XS0A 4PQBA 4NK1A 3WFTA 2M6ZA 2OIFA 2MGAA 2H8DA 4L7YB 1GDIA 1MLUA 1JZLA 4YU3A 1YOIA 3O89A 3PI9A 1MBSA 1Y5JA 3OK5A 2D5ZB 4DC8A 3V2ZA 3QM6A 5EV5A 1ITHA 1XQ5B 3OO4B 5E6EB 2HBGA 1C40B 2GNVA 2G0ZA 3UHIA 1X46A 1GBVB 2GLNA 1MYTA 1CG5B 2HHBB 1CH2A 5JDOD 1M6MA 3HXNA 1CH3A 2SPOA 4SDHA 1YOGA 2E2YA 2RAOA 1ABWA 1Y7ZB 3HC9A 1CLSA 1XZ7B 1Y35B 1HBAA 1YIHB 5M3SA 1MYHA 1Y5KA 3VREB 1MDNA 1XZ2B 2GKMA 3UI0A 1O1KA 1SDLB 1YMBA 1BZ1A 3ECXA 3DHTA 1SHRB 102MA 1PBXB 1O1MA 2G11A 3S1JA 2H35B 5EU2A 3VRFB 2MHBB 1YEOA 3IA3B 1QPWA 5JGGB 2MGHA 2D2NC 1A4FA 1MBOA 1ASHA 1Y7GB 1V4WB 3E4NA 1LFYA 2M6ZB 1CMYB 3NG6B 4M4AB 1KD2A 1EBTA 4F6BA 1Y4RA 1MTKA 1MLRA 2HBEB 4PQ6A 2HHDA 3MYNA 4IT8A 2ZSOA 2D2MD 1AJGA 2DXMA 4HRRB 1YH9A 5AZRA 1Y46B 4F6DA 1DKEB 1O1OA 3SZKA 1XZ5A 3R5IB 2AUQA 1HSYA 1YHUB 2D2NA 2WY4A 2MGDA 1Y45A 2BW9M 3A5GA 1YGFB 4G51B 1GLIA 3IC0B 1K0YA 3ED9A 1JP6A 4NS2A 1Y01B 3WCUB 2HCOB 2V1FA 1YHRB 2GL3A 3OVUC 3BA2A 1FDHG 1MKOA 1YVTA 3GQRB 3QJBB 3S65A 5JDOF 1JF3A 4N7OA 1LJWA 2AUOA 2QLSB 2Z6SA 4MXLA 1SDLA 3GYSA 3ODQA 3UHKA 4LPIA 2HBSB
chains in the Genus database with same CATH superfamily
4PNJA 1J52A 4FH7A 1NZ3A 4A8YA 2X4AA 2VLYA 2MGBA 2UUMA 3MJPA 3WHMB 1UVXA 4U8UB 4YU3B 2QU0B 1G0AB 1J7YB 4N7PA 3UHDA 1LH1A 1Y4VB 2HBDA 2VM0A 5KERA 3S48C 1CMYA 3V2VA 4O1TA 1M9PA 1SDKA 3EU1B 1G08B 1G9VA 1Y85B 5AB8A 2GTLC 3ONZB 1C7CB 2MYAA 1QSIB 107MA 1DLWA 5CN9A 2DXMB 2C7LB 2DC3A 3MOUA 1J3ZA 2V1HA 4HHBB 1YHEA 3UHQA 1XZ4B 2NRMA 5CNCA 3A5BA 3KUOA 1PHNB 2QMBB 1FAWB 2XKHA 3GQGA 4QAUA 1FN3B 4XXIA 3UHHA 3IXFA 1VXHA 3NL7B 1HBBA 1NAZA 2OLPA 4LMXB 3CY5B 3GK9A 1KTPA 2VJTA 1JL7A 4F6JA 1R1YB 1YCAA 1YENA 1JEBB 1H97A 1BZ1B 2B7HA 3TM9A 1UIWB 3DBJB 1YEVA 4MPMA 4FWXA 2GRFA 1MLHA 1Y09B 3D4XB 1HDAA 3PELB 1J3YB 4H0MA 1NQPA 3WCTB 1BINA 1QXEA 2VEBA 2ZT4A 4H07A 1HGAB 2V1GA 2R80B 3BJ1B 4ESUA 2GDMA 4JYQA 2UUMB 1OFJA 1YFFA 1GH0A 3EOKB 1KD2B 1Y4RB 2G14A 1J7WB 3MKBA 2H8FB 1DLYA 5KERB 1BUWA 1Y4FA 1VXEA 1YDZA 3UH5A 3FS4A 1HI8A 4N6SB 1B33B 2SPLA 1COHA 2LHBA 1YMAA 1M9PB 3LQDB 4MQHA 2EVPA 1LH5A 2GTLA 1YZIA 2NX0A 1HDBA 4RMPB 4TYXA 1J40A 3R5IA 1DWSA 3WCPA 5HBIA 7HBIA 1JZKA 3CIUA 3QM7A 2LH7A 1ECDA 5CN4A 2ZS0C 3A0GA 5JOMA 2VJRA 5IKSA 4F0UA 1ABWB 3OO5B 4A8WA 3H58A 1T1NB 1RVWA 1UFPA 2JL9A 2ZSTA 3P5QA 1X3KA 3WCUA 4MQIB 3WCWD 3NL7A 5AZQA 1HV4A 1F63A 1Y4GA 5SW7A 1BZZA 3GKVB 1ALLB 3UH3A 1YE2B 1NIHB 4YJJB 1NEJA 2MGMA 3HF4A 4F6IA 2ZFOB 2YRSB 1XG0C 2R4XA 2O5MX 1Y7CB 2MGCA 2C0KA 1YE0B 1DXCA 1HBHA 1Y8WA 1CIOA 2W6VB 2ZS0A 3MJPB 3AQ8A 2VHBA 3V57A 1V75B 1THBB 4ROMB 1LFLB 2V1IA 2D2ND 1FHJA 4G1VA 1UMOA 1VXBA 3LR9A 1K1KA 1TU9A 1D8UA 1DTIA 4N8TA 2C7KA 3ONZA 3ZOMA 4F4OA 1HCOA 2VEEA 111MA 1O16A 110MA 2GTLB 4B02A 2WTHA 3A59A 1Y5FB 1HDBB 1R1XB 1TOXA 2ZLVA 4FC3A 1Y7ZA 3D7OB 2MYCA 1LFTA 1YVQA 1CLSB 1HBSA 2W72A 1MLMA 3D1KB 2DN2B 2ZLXB 3ARJA 3NFEA 1XY0A 3ARKA 2EF2A 1UT0A 4NI0A 4U8UC 1T1NA 4U8UD 4IROB 1YG5A 4MXKA 5JDOC 4Q70B 1I7YA 4WCHD 3LB1A 1MYJA 1YIEA 1AZIA 2C7JA 3UHNA 5CN8A 2W6XA 1NS9B 1RQ3A 3FH9B 4YJJA 1V4UB 1HDAB 3D4XA 2HBSA 4ESAA 1GCWB 1A3OA 4KJTA 1HGAA 1O1JB 2PGHB 3QJCB 3WTGB 5ILEA 1DXDA 1F65A 3QJEA 2VMLB 4MBAA 5E83A 3W4UB 3WFXA 3OZUA 1Y4BA 4MQKA 105MA 2W6YA 3HEPA 1VREA 3MKBB 2D60A 2MYEA 1A6KA 103MA 3HHBA 1UX9A 2RI4B 3B75A 3TLDA 4L7YA 1G08A 2ZLUB 1WLAA 2DHBA 3BOMB 5EUIB 4BJAA 4M4BB 1DO1A 3ZJIA 3ZHWA 3WCPB 1XZVA 1DO7A 2HBFA 1MNHA 2AURA 4NXAA 2GNWA 1CH5A 2BK9A 4L2MA 3UHZA 1UVMA 1LH3A 3MYMA 4FC3B 2HHEB 2EVKA 1HABA 3AQ6A 1EYXA 3TM3A 1RSEA 2HCOA 1VWTB 3A9MA 1JP9A 2G0XA 3D1KA 3UHWA 1KTPB 1HGBB 1MOAA 5D1VA 1LA6B 4DWTA 1B86A 1VXGA 3ZJLA 3DUTA 3E55A 2V1EA 4PQCA 4N7OB 1DTMA 4A8QA 1QSHA 1YEQA 2ZT1A 2QSSB 4L1EA 3R0GA 5EQMA 1S56A 3LR7A 1MLQA 4MQJA 3PT7B 5MBAA 3G4YA 1IWHB 2V8AA 2YRSA 2D6CA 3VRGB 2NSRA 1NS9A 1BZ0A 1F5PA 1O1LB 2WCRA 1XXTB 3WHMA 1Y8IB 2ZS0B 1HLBA 3NMMA 1O1KB 4F69A 3V57B 5EYSA 3UHXA 1IT2A 1YFFB 3EOKA 2MGIA 2R50A 4HSXA 3MBAA 3LB4A 5E83B 3W4UA 3LQ9A 1EW6A 1MNKA 2LH1A 1A0ZB 3O2CA 2ZLWA 1YDZB 2FRKX 1Y7GA 1C7BA 2HZ3A 2MB5A 3UGYA 1NWNA 3GQPB 4ZVBA 1JBOB 4H2LA 3HEOA 4MAXA 1MOBA 4ETVA 1QI8A 5E29B 1UX8A 2HHBA 2ZLVB 1NPFA 1UVNA 2UUNA 1LUEA 2W31A 2BLJM 1OUUB 1J3FA 1Y8HA 1BZ6A 3CY5A 5HU6A 1NPGA 4ZVAA 1A3NB 3UH7A 3P5QB 3MN0A 1UVLA 3E5IA 2ZLTA 1VWTA 1MLOA 2VYYA 1TESA 2FRIX 2ZT2A 1DO3A 1KFRA 1N9IA 1ABYB 3UHSA 3WCWC 1Y45B 4KN3A 3V58A 4A8OA 3HYUB 1RQAB 4F6FA 1BABB 3PI2A 1Y09A 1Y2ZA 2LH3A 1A9WE 4ROLA 3L0FA 3FH9A 1QGWC 3ARLA 5B13A 3ZJNA 1YEUB 1Y0CB 3BJ1A 4UURA 2W6VA 2I88A 3ZJOA 1C7DB 1MZ0A 3ZJMA 2Z6TA 4AE1A 3GDJA 4H0BA 2DN1A 3U3EA 1A6GA 1FHJB 1Y0WB 1VHBA 4MQCB 3UHBA 1MTIA 2FALA 1MLNA 5EETA 6HBWB 3GOUA 4N6SA 1S5XB 1COHB 3G4RA 4FH6A 1M6CA 1YOHA 4U8UA 4MQGA 1A0ZA 2LH5A 1FLPA 1SWMA 3NUHB 1S5YA 3K8BA 4G1BA 2D2MC 2G0VA 1Y4QB 2PEGB 2VJRB 1ECNA 1SDKB 3WR1B 5E29A 1ON7A 1JDOA 1BBBA 3PT8A 1LIAB 3LB2A 1H1XA 1V4XA 4LM6B 1MWBA 1XY0B 1YIHA 2ZSSA 2VJHB 5HU6B 1FDHA 2XKIA 1HGCB 1B8DA 4GZGA 2QSPB 4ERVA 1XZ2A 1BVCA 3PI8B 1ABYA 2ZFOA 3UHVA 112MA 1HI0P 3QJDA 1IDRA 3A2GA 4FWYA 1RQ3B 1Y2ZB 1Y31B 3QMAA 3NMLA 4ILZA 4HH0A 3ZJJA 1GDJA 1JEBA 3PIAA 1RTEA 1SPGB 3QM5A 1YHUC 1YHUD 3NG6A 3OZWA 3UH6A 3MJUB 1CH4A 3GDJB 5CNEA 5C6EB 1BJEA 4N7PB 4XXKA 1HBGA 1CPCA 1HHOB 1L2KA 3WCTA 1FSLA 3S1IA 2XKGA 2HZ2A 1BZRA 1YMCA 2FRFA 6HBWA 2VRYA 1C40A 5F0BA 3QZZA 1A00B 3FEWX 3G4QA 1JBOA 3A59B 1CG5A 1NWIA 1Y5JB 2OHBA 5HLUA 3GUQA 3ASEA 2D5ZA 1YVQB 1DXUB 2SPNA 2UUNB 5CHRA 3OZVA 1JY7A 2ZT0A 3OO4A 1YHEB 4O4TA 1GLIB 2BWHA 2NSSA 3KVSB 2OH9A 1MOCA 1CH9A 1CIIA 2EKUA 3SDHA 4HRTA 3WCTD 4F68A 1YG5B 3GQGB 3S66B 3AT6A 3M39A 1YHRA 1Y4PA 3DHRB 3OGBA 3BJ3B 1CPWA 1KN1A 1YVTB 2AV0A 1LHSA 1HGCA 3UHYA 2IG3A 1RPSA 1DWRA 2ZSQA 1BABA 1Y83B 1CO8A 1V4UA 3WCUD 1DO4A 4ESAB 2GRZA 3UBCA 3WCUC 4MQIA 1XZ7A 1XDTT 1NGKA 3QJDB 2H35A 3ZJHA 5AQDA 3D17A 1BZZB 1EBCA 3WI8A 1YEOB 3GKVA 1QPWB 5JGGA 5JDOE 1A4FB 3UHTA 3WCVB 1GZXB 5EE4C 4A8KA 1GBUA 1MYIA 1F99B 1MGNA 1FSXA 1G0BA 3O18A 2GKNA 4M4AA 1LFVB 2AUPA 4YU4A 3K8BB 4BS9A 4H2LB 1MYFA 1IT3A 2V1KA 3SZKB 4HBIA 1EWAA 2HZ1A 4N8TB 2ZFBB 1CH7A 2QMBA 2D2NB 4UIQA 1A0UB 1S61A 2GRHA 1RTXA 2D5XA 1Y8HB 2VLZA 3HRWA 1A3NA 2VLXA 2MYDA 1LTWA 1MWDA 5CMVA 3GIOA 5B84A 5CHQA 2ZFOC 1B8DB 1QSHB 1YEQB 3ZOLA 1N9XA 2VYWA 3DHRA 1HV4B 3M3BA 2BV8B 3S65B 1MLKA 1IWHA 2VYZA 4HH1A 1NXFA 3BJ2A 1YEVB 5CNFA 1Y22B 3WCVC 1MYMA 1JF4A 1G09A 3GKTA 1X9FD 1NEJB 4Z8KB 2BMMA 3G4VA 3HENA 1Y0DA 3ECLA 4B3WA 2ZWJA 3RJNB 1F5OA 4BJUA 3GQRA 3QJBA 3K3UA 2DKCA 3BRPA 2R1HA 1NZ4A 1LJWB 2QLSA 4DC7A 1MNIA 3AQ7A 1GCVA 4AE0A 4XS0B 5HY8A 1HDSB 5CN6A 1MLLA 2ZLWB 3VAUA 4C44A 3PMDA 3EDBA 4C0NA 1NS6A 1DDTA 1G9VB 1HA7B 2MHBA 1IOPA 1A00A 4NZIA 4RMPA 1V4WA 1S5YB 1Y4BB 1NZ2A 3ECZA 1Y4VA 2HBDB 2ZS0D 1YCBA 3QQRA 3UHUA 2RI4A 1XZ4A 3B75B 1N9FA 3E5OA 3A0GB 1R1XA 1PHNA 1XYEA 2AV3A 1MODA 4B4YA 1A6MA 4NK2A 1V4XB 2ZLTB 1RVWB 4HRTB 3WCTC 3K9ZA 3S66A 2KSCA 3G52A 2DN2A 3ZJQA 1LFQA 1OJ6A 1Y4PB 1JL6A 3ZJPA 1S0HA 2R4ZA 1O1OB 2ZS1B 4ODCB 3UGZA 2ZSRA 1MLJA 2QSPA 3UHGA 3GLNA 5CN5A 4HHBA 1YHUA 1ALLA 5FVBM 4JACA 4ROLB 1OUTA 1WMUB 2BLIA 4KMWA 2Z85A 3HF4B 1FN3A 1PMBA 2JLGA 4OODA 2C7JB 2EB9A 1MCYA 1CP0A 5HLXA 1X9FA 1G09B 1S6AA 1Y8WB 1MBAA 1X9FC 1QXEB 106MA 4Z8KA 1AJHA 1GCWA 1CP5A 3G46A 2DN1B 1GZXA 1Y0WA 1Y7DA 1FSXB 1G0BB 3PT7A 4WJG1 4MQCA 1GH0B 2MBWA 2ZSPA 1XZUA 1CIKA 3QQQA 5CN7A 1S5XA 2OHAA 5C6EA 1BZ0B 5EYJA 1Y0TA 2D60B 1GVHA 2O58X 1HDSA 2O5QX 1J3YA 4H0MB 4FWZA 3PI1A 1XQ5A 2EB8A 4O4ZA 4F4OB 1RH1A 1NS6B 1JZMA 3PI4A 2LH2A 1HCOB 1HA7A 3ZH0A 1YZIB 1G0AA 3BOMA 1IRDB 4M4BA 2DN3A 3WR1A 5HLQA 1DM1A 3D7OA 3O2CB 1XZVB 1BUWB 4PO5A 1O1IA 3DR9A 2ZSZA 2ZLXA 1B33A 1XYEB 2G3HA 3ZJSA 3SDNA 3UHRA 3LQDA 4NI0B 1HABB 2WTGA 1XZ5B 3M38A 1AJ9A 1HACA 3UHCA 1HBAB 2Z6NA 1SI4B 1LFQB 1Y4GB 2UUMX 4NI1B 6HBIA 5SW7B 1ABSA 1UFJA 3LHBA 1HBRB 3CIUB 2DKDA 1RPSB 3IC2A 4O2GA 3UHEA 2G0RA 1Y22A 2QSSA 4L1EB 1QXDA 2FRJX 2MGJA 3AT5A 1DXVA 1VXCA 1O1MB 2R4WA 2MGLA 3ZTAA 3EDAA 1B0BA 1MLFA 1A3OB 1A9WA 1WVPA 3PMCA 1MKOB 1ECAA 1GDKA 1O1JA 1RQ4B 1X9FB 3VRFA 1YENB 3BRPB 1BZPA 3WCVA 2OH8A 1V07A 1IBEA 1O1PA 1V75A 3QJEB 1ECOA 3GYSB 1NY9A 2MGKA 1NIHA 3WCWB 5C6YA 4A8FA 1XZUB 1LH6A 1COLA 2R4YA 4YU4B 1MBNA 1THBA 4ROMA 1DXUA 2H8DB 5EOHA 3LB3A 1DKEA 3GOUB 5CNBA 1MDTA 1J7WA 1GDLA 1K1KB 2DN3B 1J7SB 1QI8B 1LFTB 1LH7A 1Y4FB 2D2MB 4MQGB 2XYKA 3HRWB 1O1IB 1OUUA 1J41A 2ZSXA 2HBCB 1K0YB 3BJ3A 1CG8A 1Y8KA 3RJ6A 1UVJA 2ZS1A 4ODCA 4IROA 3DUTB 1HACB 3G53A 1Y5FA 1YGDA 4UZVA 3OJ1A 3ORDA 3PT8B 4F0TA 4TWVA 3KMFC 4TWUA 2BNLA 1A87A 1N9HA 2IN4A 3O7NA 1HBBB 5KKKA 2UULC 2YSKA 3QM8A 3QM9A 2RAOB 2CMMA 1QXDB 1XXTA 3ZJRA 5KDQA 1I3DA 1Y5KB 1LH2A 2B7HB 1RQ4A 1XF6C 3VREA 1FCSA 1OR6A 1JP8A 1YE2A 2V1JA 5D5RA 1DXTB 4ZIZA 4OF9A 3D1AB 4VHBA 4ETUA 1CQ2A 1IRCA 4O35A 1DUOA 5EUIA 1C7CA 4TMAB 3WFUA 3PI9B 1IRDA 2O5TX 1CPCB 2JHOA 1HHOA 5ILPA 1MYZA 1Y4QA 2HBEA 5AQDM 1J7SA 2HHDB 4MQHB 2QRWA 3WFWA 1FAWA 2DHBB 4HRRA 1HGBA 1Z8UB 2Z6NB 1S0HB 2HBCA 2X49A 1LA6A 1CQXA 1CH1A 2VJTB 2LH6A 2MGFA 3HXNB 2HBFB 1R1YA 1HLMA 1V9QA 3IC2B 1YGDB 4WJGA 2HHEA 3M3AA 1EYXB 2NRLA 5F2AA 1A01B 1UIWA 1Y0AA 3DBJA 3NFEB 1YGFA 5B13G 4MU5A 4G51A 1VXDA 1CBMA 109MA 1MBDA 2UULB 4X0LB 1YEUA 1SGKA 1SPEA 1KR7A 1B86B 3PELA 1O1NB 2ZFOD 2BKMA 2DKAA 1MOHA 1NQPB 1Y83A 4GY3A 1SPGA 1MTJA 1URVA 5HY8B 2FAMA 2ZT3A 3WCVD 4ERTA 1URYA 1F0LA 3VRGA 1HBHB 3MJUA 4GXEA 2AA1B 2H8FA 3ODQB 1O1LA 2O5BX 1W92A 2W72C 1GJNA 3H57A 1MBCA 3D1AA 2PGHA 3QJCA 1LFLA 2WCQA 3WTGA 3GQPA 2J96A 1DUKA 3QZXA 5MBNA 1MBIA 1CO9A 1MNJA 1U7SA 1JPBA 1LFVA 2PEGA 3A5AA 1BIJA 4F6GA 1BVDA 2D2MA 4PO5B 1CBLA 5E6EA 1XCHA 1MYGA 1YH9B 5HAVA 4N7NB 4F0UB 2ZLUA 1Y46A 3EU1A 3OO5A 1GBVA 2G10A 1Y8KB 2W6WA 1Y85A 1AJ9B 4KMVA 5ILMA 3RGKA 1HRMA 1MWCA 3PI3A 4AVDA 2MGGA 3AT6B 1OUTB 1WMUA 2GTLD 4NI1A 1J3ZB 1HBRA 1A0UA 1VRFA 3PI8A 4F0TB 2D5XB 2QFNA 1EMYA 3AT5B 3BCQB 2UULD 1HJTA 1DXVB 1S69A 3UBVA 1Y0CA 1Y7CA 1Y7DB 1YE0A 5KDQB 1C7DA 3BJ2B 1DWTA 3V58B 1RQAA 1LFZA 2ZSNA 1Y0TB 1SHRA 3DHTB 1DXTA 3WCWA 2G0SA 2QFKA 4MBNA 1VXAA 5ILRA 1Y0DB 1MLSA 2O5SX 1U7RA 4GXEB 2AA1A 3VHBA 2R1HB 1I3EA 2VMLA 3NMMB 3G4UA 2G12A 2MGEA 2ZS1D 1VXFA 2QU0A 5FVBA 4DWUA 1J7YA 1LFYB 1MNOA 1WACA 2R80A 3MVCA 108MA 3AQ9A 3HHBB 1OR4A 2ZSYA 5CNGA 3AG0A 2MYBA 1JY7B 3AQ5A 101MA 2SPMA 1BIJB 2ZFBA 1BBBB 1LIAA 1C7BB 1QSIA 1HBSB 2W72B 4HSWA 1SI4A 1J41B 1OFKA 3FS4B 1CG8B 3KUNA 4N7NA 4AVEA 2Z8AA 4XDIA 1J40B 3VNCA 1JW8A 1UVYA 5B85A 1Q1FA 1Y35A 1YIEB 3IC0A 2UULH 1A01A 1Y0AB 1UVIA 2O5OX 2BLHA 1JWNA 2UULA 4X0LA 3G4WA 3D17B 3BCQA 1O1NA 3KMFA 1IBEB 1O1PB 3PIAB 1GBUB 4MQJB 1UC3A 1PBXA 2UUND 2V8AB 3HYUA 1LHTA 2EKTA 1A6NA 1HBIA 2ZS1C 4NXCA 1OBMA 5EE4D 1LFZB 5CNDA 1MLGA 1Y31A 4MQKB 104MA 1GCVB 1V5HA 1Y8IA 2O5LX 1NZ5A 4XS0A 4PQBA 4NK1A 3WFTA 2M6ZA 2OIFA 2MGAA 2H8DA 4L7YB 1GDIA 1MLUA 1JZLA 4YU3A 1YOIA 3O89A 3PI9A 4ETTA 1MBSA 1Y5JA 3OK5A 2D5ZB 4DC8A 3V2ZA 1HI1A 3QM6A 5EV5A 1ITHA 1XQ5B 1UVKA 3OO4B 5E6EB 2HBGA 3KVSA 1C40B 2GNVA 2G0ZA 3UHIA 3RQRA 1X46A 1GBVB 2C7KB 2GLNA 1MYTA 1CG5B 2HHBB 1CH2A 5JDOD 1M6MA 1HHSA 3HXNA 1CH3A 2SPOA 4SDHA 1YOGA 2E2YA 2RAOA 1ABWA 1Y7ZB 1HHTP 3HC9A 1CLSA 1XZ7B 1Y35B 1HBAA 1YIHB 3MWNA 4A8SA 5M3SA 1MYHA 1Y5KA 3VREB 1MDNA 1XZ2B 2GKMA 3UI0A 1F99A 1O1KA 4A8MP 4ZIZB 1SDLB 1YMBA 1BZ1A 3ECXA 3DHTA 1SHRB 102MA 1PBXB 1O1MA 2G11A 3S1JA 2H35B 5EU2A 3VRFB 2MHBB 1YEOA 3IA3B 1QPWA 5JGGB 2MGHA 2D2NC 1A4FA 1MBOA 1ASHA 1Y7GB 1V4WB 3E4NA 1LFYA 2M6ZB 1CMYB 3O18B 3NG6B 4M4AB 1KD2A 1EBTA 4F6BA 1Y4RA 1MTKA 1MLRA 2HBEB 4PQ6A 2HHDA 3MYNA 4IT8A 2ZSOA 2D2MD 1AJGA 2DXMA 4HRRB 2C7LA 1YH9A 5AZRA 1Y46B 4F6DA 1DKEB 1O1OA 3SZKA 1XZ5A 3R5IB 2AUQA 1HSYA 4LMSB 1YHUB 1ON7B 2D2NA 2WY4A 2MGDA 1Y45A 2BW9M 3A5GA 1YGFB 4G51B 1GLIA 3IC0B 1K0YA 3ED9A 1JP6A 2VJHA 4NS2A 1Y01B 3L0FB 3WCUB 2HCOB 2V1FA 1YHRB 2GL3A 4GY3B 4Q70A 2JLFA 3OVUC 3BA2A 1FDHG 1I7YB 1MKOA 1KN1B 1YVTA 3GQRB 3QJBB 2BV8A 3S65A 5JDOF 1JF3A 4N7OA 1LJWA 2AUOA 2QLSB 2Z6SA 4MXLA 1SDLA 3GYSA 3ODQA 3UHKA 4LPIA 2HBSB
chains in the Genus database with same CATH topology
4PNJA 1J52A 4FH7A 1NZ3A 2VLYA 2MGBA 3MJPA 3WHMB 1UVXA 4U8UB 4YU3B 2QU0B 1G0AB 1J7YB 4N7PA 3UHDA 1LH1A 1Y4VB 2HBDA 2VM0A 5KERA 3S48C 1CMYA 3V2VA 4O1TA 1M9PA 1SDKA 3EU1B 1G08B 1G9VA 1Y85B 5AB8A 2GTLC 3ONZB 1C7CB 2MYAA 1QSIB 107MA 1DLWA 5CN9A 2DXMB 2DC3A 3MOUA 1J3ZA 2V1HA 4HHBB 1YHEA 3UHQA 1XZ4B 2NRMA 5CNCA 3A5BA 3KUOA 2QMBB 1FAWB 2XKHA 3GQGA 4QAUA 1FN3B 3UHHA 3IXFA 1VXHA 3NL7B 1HBBA 1NAZA 2OLPA 3CY5B 3GK9A 1JL7A 4F6JA 1R1YB 1YCAA 1YENA 1JEBB 1H97A 1BZ1B 2B7HA 3TM9A 1UIWB 1YEVA 4MPMA 4FWXA 2GRFA 1MLHA 1Y09B 3D4XB 1HDAA 3PELB 1J3YB 1NQPA 3WCTB 1BINA 1QXEA 2VEBA 2ZT4A 4H07A 1HGAB 2V1GA 2R80B 3BJ1B 2GDMA 4JYQA 1OFJA 1YFFA 3EOKB 1KD2B 1Y4RB 2G14A 1J7WB 3MKBA 2H8FB 1DLYA 5KERB 1BUWA 1Y4FA 1VXEA 1YDZA 3UH5A 3FS4A 2SPLA 1COHA 2LHBA 1YMAA 1M9PB 3LQDB 4MQHA 2EVPA 1LH5A 2GTLA 1YZIA 2NX0A 1HDBA 4TYXA 1J40A 3R5IA 1DWSA 3WCPA 5HBIA 7HBIA 1JZKA 3CIUA 3QM7A 2LH7A 1ECDA 5CN4A 2ZS0C 3A0GA 5JOMA 5IKSA 1ABWB 3OO5B 3H58A 1T1NB 1RVWA 1UFPA 2ZSTA 3P5QA 1X3KA 3WCUA 4MQIB 3WCWD 3NL7A 5AZQA 1HV4A 1F63A 1Y4GA 5SW7A 1BZZA 3GKVB 3UH3A 1YE2B 1NIHB 1NEJA 2MGMA 3HF4A 4F6IA 2ZFOB 2YRSB 2R4XA 2O5MX 1Y7CB 2MGCA 2C0KA 1YE0B 1DXCA 1HBHA 1Y8WA 1CIOA 2W6VB 2ZS0A 3MJPB 3AQ8A 2VHBA 1V75B 1THBB 4ROMB 1LFLB 2V1IA 2D2ND 1FHJA 4G1VA 1UMOA 1VXBA 3LR9A 1K1KA 1TU9A 1D8UA 1DTIA 4N8TA 3ONZA 3ZOMA 4F4OA 1HCOA 2VEEA 111MA 1O16A 110MA 2GTLB 2WTHA 3A59A 1Y5FB 1HDBB 1R1XB 2ZLVA 4FC3A 1Y7ZA 3D7OB 2MYCA 1LFTA 1YVQA 1CLSB 1HBSA 2W72A 1MLMA 3D1KB 2DN2B 2ZLXB 3ARJA 3NFEA 1XY0A 3ARKA 2EF2A 1UT0A 4NI0A 4U8UC 1T1NA 4U8UD 4IROB 1YG5A 4MXKA 5JDOC 4WCHD 3LB1A 1MYJA 1YIEA 1AZIA 3UHNA 5CN8A 2W6XA 1NS9B 1RQ3A 3FH9B 1V4UB 1HDAB 3D4XA 2HBSA 4ESAA 1GCWB 1A3OA 4KJTA 1HGAA 1O1JB 2PGHB 3QJCB 3WTGB 5ILEA 1DXDA 1F65A 3QJEA 4MBAA 5E83A 3W4UB 3WFXA 3OZUA 1Y4BA 4MQKA 105MA 2W6YA 3HEPA 1VREA 3MKBB 2D60A 2MYEA 1A6KA 103MA 3HHBA 1UX9A 2RI4B 3B75A 3TLDA 4L7YA 1G08A 2ZLUB 1WLAA 2DHBA 3BOMB 5EUIB 4BJAA 4M4BB 1DO1A 3ZJIA 3ZHWA 3WCPB 1XZVA 1DO7A 2HBFA 1MNHA 2AURA 4NXAA 2GNWA 1CH5A 2BK9A 4L2MA 3UHZA 1LH3A 3MYMA 4FC3B 2HHEB 2EVKA 1HABA 3AQ6A 3TM3A 1RSEA 2HCOA 1VWTB 3A9MA 1JP9A 2G0XA 3D1KA 3UHWA 1HGBB 1MOAA 5D1VA 1LA6B 4DWTA 1B86A 1VXGA 3ZJLA 3DUTA 3E55A 2V1EA 4PQCA 4N7OB 1DTMA 1QSHA 1YEQA 2ZT1A 2QSSB 5EQMA 3R0GA 1S56A 3LR7A 1MLQA 4MQJA 3PT7B 5MBAA 3G4YA 1IWHB 2YRSA 2D6CA 3VRGB 2NSRA 1NS9A 1BZ0A 1F5PA 1O1LB 1XXTB 3WHMA 1Y8IB 2ZS0B 1HLBA 3NMMA 1O1KB 4F69A 5EYSA 3UHXA 1IT2A 1YFFB 3EOKA 2MGIA 2R50A 4HSXA 3MBAA 3LB4A 5E83B 3W4UA 1EW6A 1MNKA 2LH1A 1A0ZB 2ZLWA 1YDZB 2FRKX 1Y7GA 1C7BA 2HZ3A 2MB5A 3UGYA 1NWNA 3GQPB 4ZVBA 4H2LA 3HEOA 4MAXA 1MOBA 1QI8A 5E29B 1UX8A 2HHBA 2ZLVB 1NPFA 1LUEA 2W31A 2BLJM 1OUUB 1J3FA 1Y8HA 1BZ6A 3CY5A 5HU6A 1NPGA 4ZVAA 1A3NB 3UH7A 3P5QB 3MN0A 3E5IA 2ZLTA 1VWTA 1MLOA 2VYYA 1TESA 2FRIX 2ZT2A 1DO3A 1KFRA 1N9IA 1ABYB 3UHSA 3WCWC 1Y45B 4KN3A 3HYUB 1RQAB 4F6FA 1BABB 3PI2A 1Y09A 1Y2ZA 2LH3A 1A9WE 4ROLA 3FH9A 3ARLA 3ZJNA 1YEUB 1Y0CB 3BJ1A 4UURA 2W6VA 3ZJOA 1C7DB 1MZ0A 3ZJMA 2Z6TA 3GDJA 4H0BA 2DN1A 3U3EA 1A6GA 1FHJB 1Y0WB 1VHBA 4MQCB 3UHBA 1MTIA 2FALA 1MLNA 5EETA 6HBWB 3GOUA 1S5XB 1COHB 3G4RA 4FH6A 1M6CA 1YOHA 4U8UA 4MQGA 1A0ZA 2LH5A 1FLPA 1SWMA 1S5YA 3K8BA 4G1BA 2D2MC 2G0VA 1Y4QB 2PEGB 1ECNA 1SDKB 3WR1B 5E29A 1JDOA 1BBBA 3PT8A 3LB2A 1H1XA 1V4XA 1MWBA 1XY0B 1YIHA 2ZSSA 5HU6B 1FDHA 2XKIA 1HGCB 4GZGA 2QSPB 1XZ2A 1BVCA 3PI8B 1ABYA 2ZFOA 3UHVA 112MA 3QJDA 1IDRA 3A2GA 4FWYA 1RQ3B 1Y2ZB 1Y31B 3QMAA 3NMLA 4ILZA 3ZJJA 1GDJA 1JEBA 3PIAA 1RTEA 1SPGB 3QM5A 1YHUC 1YHUD 3NG6A 3OZWA 3UH6A 3MJUB 1CH4A 3GDJB 5CNEA 5C6EB 1BJEA 4N7PB 1HBGA 1HHOB 1L2KA 3WCTA 1FSLA 3S1IA 2XKGA 2HZ2A 1BZRA 1YMCA 2FRFA 6HBWA 2VRYA 1C40A 5F0BA 3QZZA 1A00B 3G4QA 3A59B 1CG5A 1NWIA 1Y5JB 2OHBA 5HLUA 3ASEA 2D5ZA 1YVQB 1DXUB 2SPNA 5CHRA 3OZVA 1JY7A 2ZT0A 3OO4A 1YHEB 4O4TA 1GLIB 2BWHA 2NSSA 2OH9A 1MOCA 1CH9A 2EKUA 3SDHA 4HRTA 3WCTD 4F68A 1YG5B 3GQGB 3S66B 3AT6A 3M39A 1YHRA 1Y4PA 3DHRB 3OGBA 3BJ3B 1CPWA 1YVTB 2AV0A 1LHSA 1HGCA 3UHYA 2IG3A 1RPSA 1DWRA 2ZSQA 1BABA 1Y83B 1CO8A 1V4UA 3WCUD 1DO4A 4ESAB 2GRZA 3UBCA 3WCUC 4MQIA 1XZ7A 3QJDB 1NGKA 2H35A 3ZJHA 3D17A 1BZZB 1EBCA 3WI8A 1YEOB 3GKVA 1QPWB 5JGGA 5JDOE 1A4FB 3UHTA 3WCVB 1GZXB 5EE4C 1GBUA 1MYIA 1MGNA 1FSXA 1G0BA 2GKNA 4M4AA 1LFVB 2AUPA 4YU4A 3K8BB 4H2LB 1MYFA 1IT3A 2V1KA 3SZKB 4HBIA 1EWAA 2HZ1A 4N8TB 2ZFBB 1CH7A 2QMBA 2D2NB 4UIQA 1A0UB 1S61A 2GRHA 1RTXA 2D5XA 1Y8HB 2VLZA 3HRWA 1A3NA 2VLXA 2MYDA 1LTWA 5CMVA 1MWDA 5B84A 5CHQA 2ZFOC 1QSHB 1YEQB 3ZOLA 1N9XA 2VYWA 3DHRA 1HV4B 3M3BA 3S65B 1MLKA 1IWHA 2VYZA 1NXFA 3BJ2A 1YEVB 5CNFA 1Y22B 3WCVC 1MYMA 1JF4A 1G09A 3GKTA 1X9FD 1NEJB 2BMMA 3G4VA 3HENA 1Y0DA 3ECLA 4B3WA 2ZWJA 3RJNB 1F5OA 3GQRA 3QJBA 3K3UA 2R1HA 1NZ4A 1LJWB 2QLSA 4DC7A 1MNIA 3AQ7A 1GCVA 4XS0B 5HY8A 1HDSB 5CN6A 1MLLA 2ZLWB 3VAUA 4C44A 3EDBA 4C0NA 1NS6A 1G9VB 2MHBA 1IOPA 1A00A 4NZIA 1V4WA 1S5YB 1Y4BB 1NZ2A 3ECZA 1Y4VA 2HBDB 2ZS0D 1YCBA 3QQRA 3UHUA 2RI4A 1XZ4A 3B75B 1N9FA 3E5OA 3A0GB 1R1XA 1XYEA 2AV3A 1MODA 4B4YA 1A6MA 4NK2A 1V4XB 2ZLTB 1RVWB 4HRTB 3WCTC 3K9ZA 3S66A 2KSCA 3G52A 2DN2A 3ZJQA 1LFQA 1OJ6A 1Y4PB 1JL6A 3ZJPA 1S0HA 2R4ZA 1O1OB 2ZS1B 4ODCB 3UGZA 2ZSRA 1MLJA 2QSPA 3UHGA 3GLNA 5CN5A 4HHBA 1YHUA 4JACA 4ROLB 1OUTA 1WMUB 2BLIA 4KMWA 2Z85A 3HF4B 1FN3A 1PMBA 4OODA 2EB9A 1MCYA 1CP0A 5HLXA 1X9FA 1G09B 1S6AA 1Y8WB 1MBAA 1X9FC 1QXEB 106MA 1AJHA 1GCWA 1CP5A 3G46A 2DN1B 1GZXA 1Y0WA 1Y7DA 1FSXB 1G0BB 3PT7A 4WJG1 4MQCA 2MBWA 2ZSPA 1XZUA 1CIKA 3QQQA 5CN7A 1S5XA 2OHAA 5C6EA 1BZ0B 5EYJA 1Y0TA 2D60B 1GVHA 2O58X 1HDSA 2O5QX 1J3YA 4FWZA 3PI1A 1XQ5A 2EB8A 4O4ZA 4F4OB 1NS6B 1JZMA 3PI4A 2LH2A 1HCOB 3ZH0A 1YZIB 1G0AA 3BOMA 1IRDB 4M4BA 2DN3A 3WR1A 5HLQA 1DM1A 3D7OA 1XZVB 1BUWB 1O1IA 3DR9A 2ZSZA 2ZLXA 1XYEB 2G3HA 3ZJSA 3SDNA 3UHRA 3LQDA 4NI0B 1HABB 2WTGA 1XZ5B 3M38A 1AJ9A 1HACA 3UHCA 1HBAB 2Z6NA 1SI4B 1LFQB 1Y4GB 4NI1B 6HBIA 5SW7B 1ABSA 1UFJA 3LHBA 1HBRB 3CIUB 1RPSB 3IC2A 4O2GA 3UHEA 2G0RA 1Y22A 2QSSA 1QXDA 2FRJX 2MGJA 3AT5A 1DXVA 1VXCA 1O1MB 2R4WA 2MGLA 3EDAA 1B0BA 1MLFA 1A3OB 1A9WA 1WVPA 1MKOB 1ECAA 1GDKA 1O1JA 1RQ4B 1X9FB 3VRFA 1YENB 1BZPA 3WCVA 2OH8A 1V07A 1IBEA 1O1PA 1V75A 3QJEB 1ECOA 3GYSB 2MGKA 1NIHA 3WCWB 5C6YA 1XZUB 1LH6A 2R4YA 4YU4B 1MBNA 1THBA 4ROMA 1DXUA 2H8DB 5EOHA 3LB3A 1DKEA 3GOUB 5CNBA 1J7WA 1GDLA 1K1KB 2DN3B 1J7SB 1QI8B 1LFTB 1LH7A 1Y4FB 2D2MB 4MQGB 2XYKA 3HRWB 1O1IB 1OUUA 1J41A 2ZSXA 2HBCB 1K0YB 3BJ3A 1CG8A 1Y8KA 3RJ6A 2ZS1A 4ODCA 4IROA 3DUTB 1HACB 3G53A 1Y5FA 1YGDA 4UZVA 3OJ1A 3ORDA 3PT8B 4TWVA 3KMFC 4TWUA 2BNLA 1N9HA 2IN4A 3O7NA 1HBBB 5KKKA 3QM8A 3QM9A 2RAOB 2CMMA 1QXDB 1XXTA 3ZJRA 5KDQA 1I3DA 1Y5KB 1LH2A 2B7HB 1RQ4A 3VREA 1FCSA 1OR6A 1JP8A 5D5RA 1YE2A 2V1JA 1DXTB 4OF9A 3D1AB 4VHBA 1CQ2A 1IRCA 4O35A 1DUOA 5EUIA 1C7CA 3WFUA 3PI9B 1IRDA 2O5TX 2JHOA 1HHOA 5ILPA 1MYZA 1Y4QA 2HBEA 1J7SA 2HHDB 4MQHB 2QRWA 3WFWA 1FAWA 2DHBB 4HRRA 1HGBA 1Z8UB 2Z6NB 1S0HB 2HBCA 1LA6A 1CQXA 1CH1A 2LH6A 2MGFA 3HXNB 2HBFB 1R1YA 1HLMA 1V9QA 3IC2B 1YGDB 4WJGA 2HHEA 3M3AA 2NRLA 5F2AA 1A01B 1UIWA 1Y0AA 3NFEB 1YGFA 4MU5A 4G51A 1VXDA 1CBMA 109MA 1MBDA 4X0LB 1YEUA 1SPEA 1KR7A 1B86B 3PELA 1O1NB 2ZFOD 2BKMA 1MOHA 1NQPB 1Y83A 1SPGA 1MTJA 1URVA 5HY8B 2FAMA 2ZT3A 3WCVD 1URYA 3VRGA 1HBHB 3MJUA 2AA1B 2H8FA 3ODQB 1O1LA 2O5BX 1W92A 2W72C 1GJNA 3H57A 1MBCA 3D1AA 2PGHA 3QJCA 1LFLA 3WTGA 3GQPA 1DUKA 3QZXA 5MBNA 1MBIA 1CO9A 1MNJA 1U7SA 1JPBA 1LFVA 2PEGA 3A5AA 1BIJA 4F6GA 1BVDA 2D2MA 1CBLA 5E6EA 1XCHA 1MYGA 1YH9B 5HAVA 4N7NB 2ZLUA 1Y46A 3EU1A 3OO5A 1GBVA 2G10A 1Y8KB 2W6WA 1Y85A 1AJ9B 4KMVA 5ILMA 3RGKA 1HRMA 1MWCA 3PI3A 4AVDA 2MGGA 3AT6B 1OUTB 1WMUA 2GTLD 4NI1A 1J3ZB 1HBRA 1A0UA 1VRFA 3PI8A 2D5XB 2QFNA 1EMYA 3AT5B 3BCQB 1HJTA 1DXVB 1S69A 3UBVA 1Y0CA 1Y7CA 1Y7DB 1YE0A 5KDQB 1C7DA 3BJ2B 1DWTA 1RQAA 1LFZA 2ZSNA 1Y0TB 1SHRA 3DHTB 1DXTA 3WCWA 2G0SA 2QFKA 4MBNA 1VXAA 5ILRA 1Y0DB 1MLSA 2O5SX 1U7RA 2AA1A 3VHBA 2R1HB 1I3EA 3NMMB 3G4UA 2G12A 2MGEA 2ZS1D 1VXFA 2QU0A 4DWUA 1J7YA 1LFYB 1MNOA 2R80A 3MVCA 108MA 3AQ9A 3HHBB 1OR4A 2ZSYA 5CNGA 3AG0A 2MYBA 1JY7B 3AQ5A 101MA 2SPMA 1BIJB 2ZFBA 1BBBB 1C7BB 1QSIA 1HBSB 2W72B 4HSWA 1SI4A 1J41B 1OFKA 3FS4B 1CG8B 3KUNA 4N7NA 4AVEA 2Z8AA 4XDIA 1J40B 1JW8A 1UVYA 5B85A 1Q1FA 1Y35A 1YIEB 3IC0A 1A01A 1Y0AB 2O5OX 2BLHA 1JWNA 4X0LA 3G4WA 3D17B 3BCQA 1O1NA 3KMFA 1IBEB 1O1PB 3PIAB 1GBUB 4MQJB 1UC3A 1PBXA 3HYUA 1LHTA 2EKTA 1A6NA 1HBIA 2ZS1C 4NXCA 1OBMA 5EE4D 1LFZB 5CNDA 1MLGA 1Y31A 4MQKB 104MA 1GCVB 1V5HA 1Y8IA 2O5LX 1NZ5A 4XS0A 4PQBA 4NK1A 3WFTA 2M6ZA 2OIFA 2MGAA 2H8DA 4L7YB 1GDIA 1MLUA 1JZLA 4YU3A 1YOIA 3O89A 3PI9A 1MBSA 1Y5JA 3OK5A 2D5ZB 4DC8A 3V2ZA 3QM6A 5EV5A 1ITHA 1XQ5B 3OO4B 5E6EB 2HBGA 1C40B 2GNVA 2G0ZA 3UHIA 1X46A 1GBVB 2GLNA 1MYTA 1CG5B 2HHBB 1CH2A 5JDOD 1M6MA 3HXNA 1CH3A 2SPOA 4SDHA 1YOGA 2E2YA 2RAOA 1ABWA 1Y7ZB 3HC9A 1CLSA 1XZ7B 1Y35B 1HBAA 1YIHB 5M3SA 1MYHA 1Y5KA 3VREB 1MDNA 1XZ2B 2GKMA 3UI0A 1O1KA 1SDLB 1YMBA 1BZ1A 3ECXA 3DHTA 1SHRB 102MA 1PBXB 1O1MA 2G11A 3S1JA 2H35B 5EU2A 3VRFB 2MHBB 1YEOA 3IA3B 1QPWA 5JGGB 2MGHA 2D2NC 1A4FA 1MBOA 1ASHA 1Y7GB 1V4WB 3E4NA 1LFYA 2M6ZB 1CMYB 3NG6B 4M4AB 1KD2A 1EBTA 4F6BA 1Y4RA 1MTKA 1MLRA 2HBEB 4PQ6A 2HHDA 3MYNA 4IT8A 2ZSOA 2D2MD 1AJGA 2DXMA 4HRRB 1YH9A 5AZRA 1Y46B 4F6DA 1DKEB 1O1OA 3SZKA 1XZ5A 3R5IB 2AUQA 1HSYA 1YHUB 2D2NA 2WY4A 2MGDA 1Y45A 2BW9M 3A5GA 1YGFB 4G51B 1GLIA 3IC0B 1K0YA 3ED9A 1JP6A 4NS2A 1Y01B 3WCUB 2HCOB 2V1FA 1YHRB 2GL3A 3OVUC 3BA2A 1FDHG 1MKOA 1YVTA 3GQRB 3QJBB 3S65A 5JDOF 1JF3A 4N7OA 1LJWA 2AUOA 2QLSB 2Z6SA 4MXLA 1SDLA 3GYSA 3ODQA 3UHKA 4LPIA 2HBSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNJ A;  1J52 A;  4FH7 A;  1NZ3 A;  2VLY A;  2MGB A;  3MJP A;  3WHM B;  1UVX A;  4U8U B;  4YU3 B;  2QU0 B;  1G0A B;  1J7Y B;  4N7P A;  3UHD A;  1LH1 A;  1Y4V B;  2HBD A;  2VM0 A;  5KER A;  3S48 C;  1CMY A;  3V2V A;  4O1T A;  1M9P A;  1SDK A;  3EU1 B;  1G08 B;  1G9V A;  1Y85 B;  5AB8 A;  2GTL C;  3ONZ B;  1C7C B;  2MYA A;  1QSI B;  107M A;  1DLW A;  5CN9 A;  2DXM B;  2DC3 A;  3MOU A;  1J3Z A;  2V1H A;  4HHB B;  1YHE A;  3UHQ A;  1XZ4 B;  2NRM A;  5CNC A;  3A5B A;  3KUO A;  2QMB B;  1FAW B;  2XKH A;  3GQG A;  4QAU A;  1FN3 B;  3UHH A;  3IXF A;  1VXH A;  3NL7 B;  1HBB A;  1NAZ A;  2OLP A;  3CY5 B;  3GK9 A;  1JL7 A;  4F6J A;  1R1Y B;  1YCA A;  1YEN A;  1JEB B;  1H97 A;  1BZ1 B;  2B7H A;  3TM9 A;  1UIW B;  1YEV A;  4MPM A;  4FWX A;  2GRF A;  1MLH A;  1Y09 B;  3D4X B;  1HDA A;  3PEL B;  1J3Y B;  1NQP A;  3WCT B;  1BIN A;  1QXE A;  2VEB A;  2ZT4 A;  4H07 A;  1HGA B;  2V1G A;  2R80 B;  3BJ1 B;  2GDM A;  4JYQ A;  1OFJ A;  1YFF A;  3EOK B;  1KD2 B;  1Y4R B;  2G14 A;  1J7W B;  3MKB A;  2H8F B;  1DLY A;  5KER B;  1BUW A;  1Y4F A;  1VXE A;  1YDZ A;  3UH5 A;  3FS4 A;  2SPL A;  1COH A;  2LHB A;  1YMA A;  1M9P B;  3LQD B;  4MQH A;  2EVP A;  1LH5 A;  2GTL A;  1YZI A;  2NX0 A;  1HDB A;  4TYX A;  1J40 A;  3R5I A;  1DWS A;  3WCP A;  5HBI A;  7HBI A;  1JZK A;  3CIU A;  3QM7 A;  2LH7 A;  1ECD A;  5CN4 A;  2ZS0 C;  3A0G A;  5JOM A;  5IKS A;  1ABW B;  3OO5 B;  3H58 A;  1T1N B;  1RVW A;  1UFP A;  2ZST A;  3P5Q A;  1X3K A;  3WCU A;  4MQI B;  3WCW D;  3NL7 A;  5AZQ A;  1HV4 A;  1F63 A;  1Y4G A;  5SW7 A;  1BZZ A;  3GKV B;  3UH3 A;  1YE2 B;  1NIH B;  1NEJ A;  2MGM A;  3HF4 A;  4F6I A;  2ZFO B;  2YRS B;  2R4X A;  2O5M X;  1Y7C B;  2MGC A;  2C0K A;  1YE0 B;  1DXC A;  1HBH A;  1Y8W A;  1CIO A;  2W6V B;  2ZS0 A;  3MJP B;  3AQ8 A;  2VHB A;  1V75 B;  1THB B;  4ROM B;  1LFL B;  2V1I A;  2D2N D;  1FHJ A;  4G1V A;  1UMO A;  1VXB A;  3LR9 A;  1K1K A;  1TU9 A;  1D8U A;  1DTI A;  4N8T A;  3ONZ A;  3ZOM A;  4F4O A;  1HCO A;  2VEE A;  111M A;  1O16 A;  110M A;  2GTL B;  2WTH A;  3A59 A;  1Y5F B;  1HDB B;  1R1X B;  2ZLV A;  4FC3 A;  1Y7Z A;  3D7O B;  2MYC A;  1LFT A;  1YVQ A;  1CLS B;  1HBS A;  2W72 A;  1MLM A;  3D1K B;  2DN2 B;  2ZLX B;  3ARJ A;  3NFE A;  1XY0 A;  3ARK A;  2EF2 A;  1UT0 A;  4NI0 A;  4U8U C;  1T1N A;  4U8U D;  4IRO B;  1YG5 A;  4MXK A;  5JDO C;  4WCH D;  3LB1 A;  1MYJ A;  1YIE A;  1AZI A;  3UHN A;  5CN8 A;  2W6X A;  1NS9 B;  1RQ3 A;  3FH9 B;  1V4U B;  1HDA B;  3D4X A;  2HBS A;  4ESA A;  1GCW B;  1A3O A;  4KJT A;  1HGA A;  1O1J B;  2PGH B;  3QJC B;  3WTG B;  5ILE A;  1DXD A;  1F65 A;  3QJE A;  4MBA A;  5E83 A;  3W4U B;  3WFX A;  3OZU A;  1Y4B A;  4MQK A;  105M A;  2W6Y A;  3HEP A;  1VRE A;  3MKB B;  2D60 A;  2MYE A;  1A6K A;  103M A;  3HHB A;  1UX9 A;  2RI4 B;  3B75 A;  3TLD A;  4L7Y A;  1G08 A;  2ZLU B;  1WLA A;  2DHB A;  3BOM B;  5EUI B;  4BJA A;  4M4B B;  1DO1 A;  3ZJI A;  3ZHW A;  3WCP B;  1XZV A;  1DO7 A;  2HBF A;  1MNH A;  2AUR A;  4NXA A;  2GNW A;  1CH5 A;  2BK9 A;  4L2M A;  3UHZ A;  1LH3 A;  3MYM A;  4FC3 B;  2HHE B;  2EVK A;  1HAB A;  3AQ6 A;  3TM3 A;  1RSE A;  2HCO A;  1VWT B;  3A9M A;  1JP9 A;  2G0X A;  3D1K A;  3UHW A;  1HGB B;  1MOA A;  5D1V A;  1LA6 B;  4DWT A;  1B86 A;  1VXG A;  3ZJL A;  3DUT A;  3E55 A;  2V1E A;  4PQC A;  4N7O B;  1DTM A;  1QSH A;  1YEQ A;  2ZT1 A;  2QSS B;  5EQM A;  3R0G A;  1S56 A;  3LR7 A;  1MLQ A;  4MQJ A;  3PT7 B;  5MBA A;  3G4Y A;  1IWH B;  2YRS A;  2D6C A;  3VRG B;  2NSR A;  1NS9 A;  1BZ0 A;  1F5P A;  1O1L B;  1XXT B;  3WHM A;  1Y8I B;  2ZS0 B;  1HLB A;  3NMM A;  1O1K B;  4F69 A;  5EYS A;  3UHX A;  1IT2 A;  1YFF B;  3EOK A;  2MGI A;  2R50 A;  4HSX A;  3MBA A;  3LB4 A;  5E83 B;  3W4U A;  1EW6 A;  1MNK A;  2LH1 A;  1A0Z B;  2ZLW A;  1YDZ B;  2FRK X;  1Y7G A;  1C7B A;  2HZ3 A;  2MB5 A;  3UGY A;  1NWN A;  3GQP B;  4ZVB A;  4H2L A;  3HEO A;  4MAX A;  1MOB A;  1QI8 A;  5E29 B;  1UX8 A;  2HHB A;  2ZLV B;  1NPF A;  1LUE A;  2W31 A;  2BLJ M;  1OUU B;  1J3F A;  1Y8H A;  1BZ6 A;  3CY5 A;  5HU6 A;  1NPG A;  4ZVA A;  1A3N B;  3UH7 A;  3P5Q B;  3MN0 A;  3E5I A;  2ZLT A;  1VWT A;  1MLO A;  2VYY A;  1TES A;  2FRI X;  2ZT2 A;  1DO3 A;  1KFR A;  1N9I A;  1ABY B;  3UHS A;  3WCW C;  1Y45 B;  4KN3 A;  3HYU B;  1RQA B;  4F6F A;  1BAB B;  3PI2 A;  1Y09 A;  1Y2Z A;  2LH3 A;  1A9W E;  4ROL A;  3FH9 A;  3ARL A;  3ZJN A;  1YEU B;  1Y0C B;  3BJ1 A;  4UUR A;  2W6V A;  3ZJO A;  1C7D B;  1MZ0 A;  3ZJM A;  2Z6T A;  3GDJ A;  4H0B A;  2DN1 A;  3U3E A;  1A6G A;  1FHJ B;  1Y0W B;  1VHB A;  4MQC B;  3UHB A;  1MTI A;  2FAL A;  1MLN A;  5EET A;  6HBW B;  3GOU A;  1S5X B;  1COH B;  3G4R A;  4FH6 A;  1M6C A;  1YOH A;  4U8U A;  4MQG A;  1A0Z A;  2LH5 A;  1FLP A;  1SWM A;  1S5Y A;  3K8B A;  4G1B A;  2D2M C;  2G0V A;  1Y4Q B;  2PEG B;  1ECN A;  1SDK B;  3WR1 B;  5E29 A;  1JDO A;  1BBB A;  3PT8 A;  3LB2 A;  1H1X A;  1V4X A;  1MWB A;  1XY0 B;  1YIH A;  2ZSS A;  5HU6 B;  1FDH A;  2XKI A;  1HGC B;  4GZG A;  2QSP B;  1XZ2 A;  1BVC A;  3PI8 B;  1ABY A;  2ZFO A;  3UHV A;  112M A;  3QJD A;  1IDR A;  3A2G A;  4FWY A;  1RQ3 B;  1Y2Z B;  1Y31 B;  3QMA A;  3NML A;  4ILZ A;  3ZJJ A;  1GDJ A;  1JEB A;  3PIA A;  1RTE A;  1SPG B;  3QM5 A;  1YHU C;  1YHU D;  3NG6 A;  3OZW A;  3UH6 A;  3MJU B;  1CH4 A;  3GDJ B;  5CNE A;  5C6E B;  1BJE A;  4N7P B;  1HBG A;  1HHO B;  1L2K A;  3WCT A;  1FSL A;  3S1I A;  2XKG A;  2HZ2 A;  1BZR A;  1YMC A;  2FRF A;  6HBW A;  2VRY A;  1C40 A;  5F0B A;  3QZZ A;  1A00 B;  3G4Q A;  3A59 B;  1CG5 A;  1NWI A;  1Y5J B;  2OHB A;  5HLU A;  3ASE A;  2D5Z A;  1YVQ B;  1DXU B;  2SPN A;  5CHR A;  3OZV A;  1JY7 A;  2ZT0 A;  3OO4 A;  1YHE B;  4O4T A;  1GLI B;  2BWH A;  2NSS A;  2OH9 A;  1MOC A;  1CH9 A;  2EKU A;  3SDH A;  4HRT A;  3WCT D;  4F68 A;  1YG5 B;  3GQG B;  3S66 B;  3AT6 A;  3M39 A;  1YHR A;  1Y4P A;  3DHR B;  3OGB A;  3BJ3 B;  1CPW A;  1YVT B;  2AV0 A;  1LHS A;  1HGC A;  3UHY A;  2IG3 A;  1RPS A;  1DWR A;  2ZSQ A;  1BAB A;  1Y83 B;  1CO8 A;  1V4U A;  3WCU D;  1DO4 A;  4ESA B;  2GRZ A;  3UBC A;  3WCU C;  4MQI A;  1XZ7 A;  3QJD B;  1NGK A;  2H35 A;  3ZJH A;  3D17 A;  1BZZ B;  1EBC A;  3WI8 A;  1YEO B;  3GKV A;  1QPW B;  5JGG A;  5JDO E;  1A4F B;  3UHT A;  3WCV B;  1GZX B;  5EE4 C;  1GBU A;  1MYI A;  1MGN A;  1FSX A;  1G0B A;  2GKN A;  4M4A A;  1LFV B;  2AUP A;  4YU4 A;  3K8B B;  4H2L B;  1MYF A;  1IT3 A;  2V1K A;  3SZK B;  4HBI A;  1EWA A;  2HZ1 A;  4N8T B;  2ZFB B;  1CH7 A;  2QMB A;  2D2N B;  4UIQ A;  1A0U B;  1S61 A;  2GRH A;  1RTX A;  2D5X A;  1Y8H B;  2VLZ A;  3HRW A;  1A3N A;  2VLX A;  2MYD A;  1LTW A;  5CMV A;  1MWD A;  5B84 A;  5CHQ A;  2ZFO C;  1QSH B;  1YEQ B;  3ZOL A;  1N9X A;  2VYW A;  3DHR A;  1HV4 B;  3M3B A;  3S65 B;  1MLK A;  1IWH A;  2VYZ A;  1NXF A;  3BJ2 A;  1YEV B;  5CNF A;  1Y22 B;  3WCV C;  1MYM A;  1JF4 A;  1G09 A;  3GKT A;  1X9F D;  1NEJ B;  2BMM A;  3G4V A;  3HEN A;  1Y0D A;  3ECL A;  4B3W A;  2ZWJ A;  3RJN B;  1F5O A;  3GQR A;  3QJB A;  3K3U A;  2R1H A;  1NZ4 A;  1LJW B;  2QLS A;  4DC7 A;  1MNI A;  3AQ7 A;  1GCV A;  4XS0 B;  5HY8 A;  1HDS B;  5CN6 A;  1MLL A;  2ZLW B;  3VAU A;  4C44 A;  3EDB A;  4C0N A;  1NS6 A;  1G9V B;  2MHB A;  1IOP A;  1A00 A;  4NZI A;  1V4W A;  1S5Y B;  1Y4B B;  1NZ2 A;  3ECZ A;  1Y4V A;  2HBD B;  2ZS0 D;  1YCB A;  3QQR A;  3UHU A;  2RI4 A;  1XZ4 A;  3B75 B;  1N9F A;  3E5O A;  3A0G B;  1R1X A;  1XYE A;  2AV3 A;  1MOD A;  4B4Y A;  1A6M A;  4NK2 A;  1V4X B;  2ZLT B;  1RVW B;  4HRT B;  3WCT C;  3K9Z A;  3S66 A;  2KSC A;  3G52 A;  2DN2 A;  3ZJQ A;  1LFQ A;  1OJ6 A;  1Y4P B;  1JL6 A;  3ZJP A;  1S0H A;  2R4Z A;  1O1O B;  2ZS1 B;  4ODC B;  3UGZ A;  2ZSR A;  1MLJ A;  2QSP A;  3UHG A;  3GLN A;  5CN5 A;  4HHB A;  1YHU A;  4JAC A;  4ROL B;  1OUT A;  1WMU B;  2BLI A;  4KMW A;  2Z85 A;  3HF4 B;  1FN3 A;  1PMB A;  4OOD A;  2EB9 A;  1MCY A;  1CP0 A;  5HLX A;  1X9F A;  1G09 B;  1S6A A;  1Y8W B;  1MBA A;  1X9F C;  1QXE B;  106M A;  1AJH A;  1GCW A;  1CP5 A;  3G46 A;  2DN1 B;  1GZX A;  1Y0W A;  1Y7D A;  1FSX B;  1G0B B;  3PT7 A;  4WJG 1;  4MQC A;  2MBW A;  2ZSP A;  1XZU A;  1CIK A;  3QQQ A;  5CN7 A;  1S5X A;  2OHA A;  5C6E A;  1BZ0 B;  5EYJ A;  1Y0T A;  2D60 B;  1GVH A;  2O58 X;  1HDS A;  2O5Q X;  1J3Y A;  4FWZ A;  3PI1 A;  1XQ5 A;  2EB8 A;  4O4Z A;  4F4O B;  1NS6 B;  1JZM A;  3PI4 A;  2LH2 A;  1HCO B;  3ZH0 A;  1YZI B;  1G0A A;  3BOM A;  1IRD B;  4M4B A;  2DN3 A;  3WR1 A;  5HLQ A;  1DM1 A;  3D7O A;  1XZV B;  1BUW B;  1O1I A;  3DR9 A;  2ZSZ A;  2ZLX A;  1XYE B;  2G3H A;  3ZJS A;  3SDN A;  3UHR A;  3LQD A;  4NI0 B;  1HAB B;  2WTG A;  1XZ5 B;  3M38 A;  1AJ9 A;  1HAC A;  3UHC A;  1HBA B;  2Z6N A;  1SI4 B;  1LFQ B;  1Y4G B;  4NI1 B;  6HBI A;  5SW7 B;  1ABS A;  1UFJ A;  3LHB A;  1HBR B;  3CIU B;  1RPS B;  3IC2 A;  4O2G A;  3UHE A;  2G0R A;  1Y22 A;  2QSS A;  1QXD A;  2FRJ X;  2MGJ A;  3AT5 A;  1DXV A;  1VXC A;  1O1M B;  2R4W A;  2MGL A;  3EDA A;  1B0B A;  1MLF A;  1A3O B;  1A9W A;  1WVP A;  1MKO B;  1ECA A;  1GDK A;  1O1J A;  1RQ4 B;  1X9F B;  3VRF A;  1YEN B;  1BZP A;  3WCV A;  2OH8 A;  1V07 A;  1IBE A;  1O1P A;  1V75 A;  3QJE B;  1ECO A;  3GYS B;  2MGK A;  1NIH A;  3WCW B;  5C6Y A;  1XZU B;  1LH6 A;  2R4Y A;  4YU4 B;  1MBN A;  1THB A;  4ROM A;  1DXU A;  2H8D B;  5EOH A;  3LB3 A;  1DKE A;  3GOU B;  5CNB A;  1J7W A;  1GDL A;  1K1K B;  2DN3 B;  1J7S B;  1QI8 B;  1LFT B;  1LH7 A;  1Y4F B;  2D2M B;  4MQG B;  2XYK A;  3HRW B;  1O1I B;  1OUU A;  1J41 A;  2ZSX A;  2HBC B;  1K0Y B;  3BJ3 A;  1CG8 A;  1Y8K A;  3RJ6 A;  2ZS1 A;  4ODC A;  4IRO A;  3DUT B;  1HAC B;  3G53 A;  1Y5F A;  1YGD A;  4UZV A;  3OJ1 A;  3ORD A;  3PT8 B;  4TWV A;  3KMF C;  4TWU A;  2BNL A;  1N9H A;  2IN4 A;  3O7N A;  1HBB B;  5KKK A;  3QM8 A;  3QM9 A;  2RAO B;  2CMM A;  1QXD B;  1XXT A;  3ZJR A;  5KDQ A;  1I3D A;  1Y5K B;  1LH2 A;  2B7H B;  1RQ4 A;  3VRE A;  1FCS A;  1OR6 A;  1JP8 A;  5D5R A;  1YE2 A;  2V1J A;  1DXT B;  4OF9 A;  3D1A B;  4VHB A;  1CQ2 A;  1IRC A;  4O35 A;  1DUO A;  5EUI A;  1C7C A;  3WFU A;  3PI9 B;  1IRD A;  2O5T X;  2JHO A;  1HHO A;  5ILP A;  1MYZ A;  1Y4Q A;  2HBE A;  1J7S A;  2HHD B;  4MQH B;  2QRW A;  3WFW A;  1FAW A;  2DHB B;  4HRR A;  1HGB A;  1Z8U B;  2Z6N B;  1S0H B;  2HBC A;  1LA6 A;  1CQX A;  1CH1 A;  2LH6 A;  2MGF A;  3HXN B;  2HBF B;  1R1Y A;  1HLM A;  1V9Q A;  3IC2 B;  1YGD B;  4WJG A;  2HHE A;  3M3A A;  2NRL A;  5F2A A;  1A01 B;  1UIW A;  1Y0A A;  3NFE B;  1YGF A;  4MU5 A;  4G51 A;  1VXD A;  1CBM A;  109M A;  1MBD A;  4X0L B;  1YEU A;  1SPE A;  1KR7 A;  1B86 B;  3PEL A;  1O1N B;  2ZFO D;  2BKM A;  1MOH A;  1NQP B;  1Y83 A;  1SPG A;  1MTJ A;  1URV A;  5HY8 B;  2FAM A;  2ZT3 A;  3WCV D;  1URY A;  3VRG A;  1HBH B;  3MJU A;  2AA1 B;  2H8F A;  3ODQ B;  1O1L A;  2O5B X;  1W92 A;  2W72 C;  1GJN A;  3H57 A;  1MBC A;  3D1A A;  2PGH A;  3QJC A;  1LFL A;  3WTG A;  3GQP A;  1DUK A;  3QZX A;  5MBN A;  1MBI A;  1CO9 A;  1MNJ A;  1U7S A;  1JPB A;  1LFV A;  2PEG A;  3A5A A;  1BIJ A;  4F6G A;  1BVD A;  2D2M A;  1CBL A;  5E6E A;  1XCH A;  1MYG A;  1YH9 B;  5HAV A;  4N7N B;  2ZLU A;  1Y46 A;  3EU1 A;  3OO5 A;  1GBV A;  2G10 A;  1Y8K B;  2W6W A;  1Y85 A;  1AJ9 B;  4KMV A;  5ILM A;  3RGK A;  1HRM A;  1MWC A;  3PI3 A;  4AVD A;  2MGG A;  3AT6 B;  1OUT B;  1WMU A;  2GTL D;  4NI1 A;  1J3Z B;  1HBR A;  1A0U A;  1VRF A;  3PI8 A;  2D5X B;  2QFN A;  1EMY A;  3AT5 B;  3BCQ B;  1HJT A;  1DXV B;  1S69 A;  3UBV A;  1Y0C A;  1Y7C A;  1Y7D B;  1YE0 A;  5KDQ B;  1C7D A;  3BJ2 B;  1DWT A;  1RQA A;  1LFZ A;  2ZSN A;  1Y0T B;  1SHR A;  3DHT B;  1DXT A;  3WCW A;  2G0S A;  2QFK A;  4MBN A;  1VXA A;  5ILR A;  1Y0D B;  1MLS A;  2O5S X;  1U7R A;  2AA1 A;  3VHB A;  2R1H B;  1I3E A;  3NMM B;  3G4U A;  2G12 A;  2MGE A;  2ZS1 D;  1VXF A;  2QU0 A;  4DWU A;  1J7Y A;  1LFY B;  1MNO A;  2R80 A;  3MVC A;  108M A;  3AQ9 A;  3HHB B;  1OR4 A;  2ZSY A;  5CNG A;  3AG0 A;  2MYB A;  1JY7 B;  3AQ5 A;  101M A;  2SPM A;  1BIJ B;  2ZFB A;  1BBB B;  1C7B B;  1QSI A;  1HBS B;  2W72 B;  4HSW A;  1SI4 A;  1J41 B;  1OFK A;  3FS4 B;  1CG8 B;  3KUN A;  4N7N A;  4AVE A;  2Z8A A;  4XDI A;  1J40 B;  1JW8 A;  1UVY A;  5B85 A;  1Q1F A;  1Y35 A;  1YIE B;  3IC0 A;  1A01 A;  1Y0A B;  2O5O X;  2BLH A;  1JWN A;  4X0L A;  3G4W A;  3D17 B;  3BCQ A;  1O1N A;  3KMF A;  1IBE B;  1O1P B;  3PIA B;  1GBU B;  4MQJ B;  1UC3 A;  1PBX A;  3HYU A;  1LHT A;  2EKT A;  1A6N A;  1HBI A;  2ZS1 C;  4NXC A;  1OBM A;  5EE4 D;  1LFZ B;  5CND A;  1MLG A;  1Y31 A;  4MQK B;  104M A;  1GCV B;  1V5H A;  1Y8I A;  2O5L X;  1NZ5 A;  4XS0 A;  4PQB A;  4NK1 A;  3WFT A;  2M6Z A;  2OIF A;  2MGA A;  2H8D A;  4L7Y B;  1GDI A;  1MLU A;  1JZL A;  4YU3 A;  1YOI A;  3O89 A;  3PI9 A;  1MBS A;  1Y5J A;  3OK5 A;  2D5Z B;  4DC8 A;  3V2Z A;  3QM6 A;  5EV5 A;  1ITH A;  1XQ5 B;  3OO4 B;  5E6E B;  2HBG A;  1C40 B;  2GNV A;  2G0Z A;  3UHI A;  1X46 A;  1GBV B;  2GLN A;  1MYT A;  1CG5 B;  2HHB B;  1CH2 A;  5JDO D;  1M6M A;  3HXN A;  1CH3 A;  2SPO A;  4SDH A;  1YOG A;  2E2Y A;  2RAO A;  1ABW A;  1Y7Z B;  3HC9 A;  1CLS A;  1XZ7 B;  1Y35 B;  1HBA A;  1YIH B;  5M3S A;  1MYH A;  1Y5K A;  3VRE B;  1MDN A;  1XZ2 B;  2GKM A;  3UI0 A;  1O1K A;  1SDL B;  1YMB A;  1BZ1 A;  3ECX A;  3DHT A;  1SHR B;  102M A;  1PBX B;  1O1M A;  2G11 A;  3S1J A;  2H35 B;  5EU2 A;  3VRF B;  2MHB B;  1YEO A;  3IA3 B;  1QPW A;  5JGG B;  2MGH A;  2D2N C;  1A4F A;  1MBO A;  1ASH A;  1Y7G B;  1V4W B;  3E4N A;  1LFY A;  2M6Z B;  1CMY B;  3NG6 B;  4M4A B;  1KD2 A;  1EBT A;  4F6B A;  1Y4R A;  1MTK A;  1MLR A;  2HBE B;  4PQ6 A;  2HHD A;  3MYN A;  4IT8 A;  2ZSO A;  2D2M D;  1AJG A;  2DXM A;  4HRR B;  1YH9 A;  5AZR A;  1Y46 B;  4F6D A;  1DKE B;  1O1O A;  3SZK A;  1XZ5 A;  3R5I B;  2AUQ A;  1HSY A;  1YHU B;  2D2N A;  2WY4 A;  2MGD A;  1Y45 A;  2BW9 M;  3A5G A;  1YGF B;  4G51 B;  1GLI A;  3IC0 B;  1K0Y A;  3ED9 A;  1JP6 A;  4NS2 A;  1Y01 B;  3WCU B;  2HCO B;  2V1F A;  1YHR B;  2GL3 A;  3OVU C;  3BA2 A;  1FDH G;  1MKO A;  1YVT A;  3GQR B;  3QJB B;  3S65 A;  5JDO F;  1JF3 A;  4N7O A;  1LJW A;  2AUO A;  2QLS B;  2Z6S A;  4MXL A;  1SDL A;  3GYS A;  3ODQ A;  3UHK A;  4LPI A;  2HBS B; 
#chains in the Genus database with same CATH topology
 4PNJ A;  1J52 A;  4FH7 A;  1NZ3 A;  4A8Y A;  2X4A A;  2VLY A;  2MGB A;  2UUM A;  3MJP A;  3WHM B;  1UVX A;  4U8U B;  4YU3 B;  2QU0 B;  1G0A B;  1J7Y B;  4N7P A;  3UHD A;  1LH1 A;  1Y4V B;  2HBD A;  2VM0 A;  5KER A;  3S48 C;  1CMY A;  3V2V A;  4O1T A;  1M9P A;  1SDK A;  3EU1 B;  1G08 B;  1G9V A;  1Y85 B;  5AB8 A;  2GTL C;  3ONZ B;  1C7C B;  2MYA A;  1QSI B;  107M A;  1DLW A;  5CN9 A;  2DXM B;  2C7L B;  2DC3 A;  3MOU A;  1J3Z A;  2V1H A;  4HHB B;  1YHE A;  3UHQ A;  1XZ4 B;  2NRM A;  5CNC A;  3A5B A;  3KUO A;  1PHN B;  2QMB B;  1FAW B;  2XKH A;  3GQG A;  4QAU A;  1FN3 B;  4XXI A;  3UHH A;  3IXF A;  1VXH A;  3NL7 B;  1HBB A;  1NAZ A;  2OLP A;  4LMX B;  3CY5 B;  3GK9 A;  1KTP A;  2VJT A;  1JL7 A;  4F6J A;  1R1Y B;  1YCA A;  1YEN A;  1JEB B;  1H97 A;  1BZ1 B;  2B7H A;  3TM9 A;  1UIW B;  3DBJ B;  1YEV A;  4MPM A;  4FWX A;  2GRF A;  1MLH A;  1Y09 B;  3D4X B;  1HDA A;  3PEL B;  1J3Y B;  4H0M A;  1NQP A;  3WCT B;  1BIN A;  1QXE A;  2VEB A;  2ZT4 A;  4H07 A;  1HGA B;  2V1G A;  2R80 B;  3BJ1 B;  4ESU A;  2GDM A;  4JYQ A;  2UUM B;  1OFJ A;  1YFF A;  1GH0 A;  3EOK B;  1KD2 B;  1Y4R B;  2G14 A;  1J7W B;  3MKB A;  2H8F B;  1DLY A;  5KER B;  1BUW A;  1Y4F A;  1VXE A;  1YDZ A;  3UH5 A;  3FS4 A;  1HI8 A;  4N6S B;  1B33 B;  2SPL A;  1COH A;  2LHB A;  1YMA A;  1M9P B;  3LQD B;  4MQH A;  2EVP A;  1LH5 A;  2GTL A;  1YZI A;  2NX0 A;  1HDB A;  4RMP B;  4TYX A;  1J40 A;  3R5I A;  1DWS A;  3WCP A;  5HBI A;  7HBI A;  1JZK A;  3CIU A;  3QM7 A;  2LH7 A;  1ECD A;  5CN4 A;  2ZS0 C;  3A0G A;  5JOM A;  2VJR A;  5IKS A;  4F0U A;  1ABW B;  3OO5 B;  4A8W A;  3H58 A;  1T1N B;  1RVW A;  1UFP A;  2JL9 A;  2ZST A;  3P5Q A;  1X3K A;  3WCU A;  4MQI B;  3WCW D;  3NL7 A;  5AZQ A;  1HV4 A;  1F63 A;  1Y4G A;  5SW7 A;  1BZZ A;  3GKV B;  1ALL B;  3UH3 A;  1YE2 B;  1NIH B;  4YJJ B;  1NEJ A;  2MGM A;  3HF4 A;  4F6I A;  2ZFO B;  2YRS B;  1XG0 C;  2R4X A;  2O5M X;  1Y7C B;  2MGC A;  2C0K A;  1YE0 B;  1DXC A;  1HBH A;  1Y8W A;  1CIO A;  2W6V B;  2ZS0 A;  3MJP B;  3AQ8 A;  2VHB A;  3V57 A;  1V75 B;  1THB B;  4ROM B;  1LFL B;  2V1I A;  2D2N D;  1FHJ A;  4G1V A;  1UMO A;  1VXB A;  3LR9 A;  1K1K A;  1TU9 A;  1D8U A;  1DTI A;  4N8T A;  2C7K A;  3ONZ A;  3ZOM A;  4F4O A;  1HCO A;  2VEE A;  111M A;  1O16 A;  110M A;  2GTL B;  4B02 A;  2WTH A;  3A59 A;  1Y5F B;  1HDB B;  1R1X B;  1TOX A;  2ZLV A;  4FC3 A;  1Y7Z A;  3D7O B;  2MYC A;  1LFT A;  1YVQ A;  1CLS B;  1HBS A;  2W72 A;  1MLM A;  3D1K B;  2DN2 B;  2ZLX B;  3ARJ A;  3NFE A;  1XY0 A;  3ARK A;  2EF2 A;  1UT0 A;  4NI0 A;  4U8U C;  1T1N A;  4U8U D;  4IRO B;  1YG5 A;  4MXK A;  5JDO C;  4Q70 B;  1I7Y A;  4WCH D;  3LB1 A;  1MYJ A;  1YIE A;  1AZI A;  2C7J A;  3UHN A;  5CN8 A;  2W6X A;  1NS9 B;  1RQ3 A;  3FH9 B;  4YJJ A;  1V4U B;  1HDA B;  3D4X A;  2HBS A;  4ESA A;  1GCW B;  1A3O A;  4KJT A;  1HGA A;  1O1J B;  2PGH B;  3QJC B;  3WTG B;  5ILE A;  1DXD A;  1F65 A;  3QJE A;  2VML B;  4MBA A;  5E83 A;  3W4U B;  3WFX A;  3OZU A;  1Y4B A;  4MQK A;  105M A;  2W6Y A;  3HEP A;  1VRE A;  3MKB B;  2D60 A;  2MYE A;  1A6K A;  103M A;  3HHB A;  1UX9 A;  2RI4 B;  3B75 A;  3TLD A;  4L7Y A;  1G08 A;  2ZLU B;  1WLA A;  2DHB A;  3BOM B;  5EUI B;  4BJA A;  4M4B B;  1DO1 A;  3ZJI A;  3ZHW A;  3WCP B;  1XZV A;  1DO7 A;  2HBF A;  1MNH A;  2AUR A;  4NXA A;  2GNW A;  1CH5 A;  2BK9 A;  4L2M A;  3UHZ A;  1UVM A;  1LH3 A;  3MYM A;  4FC3 B;  2HHE B;  2EVK A;  1HAB A;  3AQ6 A;  1EYX A;  3TM3 A;  1RSE A;  2HCO A;  1VWT B;  3A9M A;  1JP9 A;  2G0X A;  3D1K A;  3UHW A;  1KTP B;  1HGB B;  1MOA A;  5D1V A;  1LA6 B;  4DWT A;  1B86 A;  1VXG A;  3ZJL A;  3DUT A;  3E55 A;  2V1E A;  4PQC A;  4N7O B;  1DTM A;  4A8Q A;  1QSH A;  1YEQ A;  2ZT1 A;  2QSS B;  4L1E A;  3R0G A;  5EQM A;  1S56 A;  3LR7 A;  1MLQ A;  4MQJ A;  3PT7 B;  5MBA A;  3G4Y A;  1IWH B;  2V8A A;  2YRS A;  2D6C A;  3VRG B;  2NSR A;  1NS9 A;  1BZ0 A;  1F5P A;  1O1L B;  2WCR A;  1XXT B;  3WHM A;  1Y8I B;  2ZS0 B;  1HLB A;  3NMM A;  1O1K B;  4F69 A;  3V57 B;  5EYS A;  3UHX A;  1IT2 A;  1YFF B;  3EOK A;  2MGI A;  2R50 A;  4HSX A;  3MBA A;  3LB4 A;  5E83 B;  3W4U A;  3LQ9 A;  1EW6 A;  1MNK A;  2LH1 A;  1A0Z B;  3O2C A;  2ZLW A;  1YDZ B;  2FRK X;  1Y7G A;  1C7B A;  2HZ3 A;  2MB5 A;  3UGY A;  1NWN A;  3GQP B;  4ZVB A;  1JBO B;  4H2L A;  3HEO A;  4MAX A;  1MOB A;  4ETV A;  1QI8 A;  5E29 B;  1UX8 A;  2HHB A;  2ZLV B;  1NPF A;  1UVN A;  2UUN A;  1LUE A;  2W31 A;  2BLJ M;  1OUU B;  1J3F A;  1Y8H A;  1BZ6 A;  3CY5 A;  5HU6 A;  1NPG A;  4ZVA A;  1A3N B;  3UH7 A;  3P5Q B;  3MN0 A;  1UVL A;  3E5I A;  2ZLT A;  1VWT A;  1MLO A;  2VYY A;  1TES A;  2FRI X;  2ZT2 A;  1DO3 A;  1KFR A;  1N9I A;  1ABY B;  3UHS A;  3WCW C;  1Y45 B;  4KN3 A;  3V58 A;  4A8O A;  3HYU B;  1RQA B;  4F6F A;  1BAB B;  3PI2 A;  1Y09 A;  1Y2Z A;  2LH3 A;  1A9W E;  4ROL A;  3L0F A;  3FH9 A;  1QGW C;  3ARL A;  5B13 A;  3ZJN A;  1YEU B;  1Y0C B;  3BJ1 A;  4UUR A;  2W6V A;  2I88 A;  3ZJO A;  1C7D B;  1MZ0 A;  3ZJM A;  2Z6T A;  4AE1 A;  3GDJ A;  4H0B A;  2DN1 A;  3U3E A;  1A6G A;  1FHJ B;  1Y0W B;  1VHB A;  4MQC B;  3UHB A;  1MTI A;  2FAL A;  1MLN A;  5EET A;  6HBW B;  3GOU A;  4N6S A;  1S5X B;  1COH B;  3G4R A;  4FH6 A;  1M6C A;  1YOH A;  4U8U A;  4MQG A;  1A0Z A;  2LH5 A;  1FLP A;  1SWM A;  3NUH B;  1S5Y A;  3K8B A;  4G1B A;  2D2M C;  2G0V A;  1Y4Q B;  2PEG B;  2VJR B;  1ECN A;  1SDK B;  3WR1 B;  5E29 A;  1ON7 A;  1JDO A;  1BBB A;  3PT8 A;  1LIA B;  3LB2 A;  1H1X A;  1V4X A;  4LM6 B;  1MWB A;  1XY0 B;  1YIH A;  2ZSS A;  2VJH B;  5HU6 B;  1FDH A;  2XKI A;  1HGC B;  1B8D A;  4GZG A;  2QSP B;  4ERV A;  1XZ2 A;  1BVC A;  3PI8 B;  1ABY A;  2ZFO A;  3UHV A;  112M A;  1HI0 P;  3QJD A;  1IDR A;  3A2G A;  4FWY A;  1RQ3 B;  1Y2Z B;  1Y31 B;  3QMA A;  3NML A;  4ILZ A;  4HH0 A;  3ZJJ A;  1GDJ A;  1JEB A;  3PIA A;  1RTE A;  1SPG B;  3QM5 A;  1YHU C;  1YHU D;  3NG6 A;  3OZW A;  3UH6 A;  3MJU B;  1CH4 A;  3GDJ B;  5CNE A;  5C6E B;  1BJE A;  4N7P B;  4XXK A;  1HBG A;  1CPC A;  1HHO B;  1L2K A;  3WCT A;  1FSL A;  3S1I A;  2XKG A;  2HZ2 A;  1BZR A;  1YMC A;  2FRF A;  6HBW A;  2VRY A;  1C40 A;  5F0B A;  3QZZ A;  1A00 B;  3FEW X;  3G4Q A;  1JBO A;  3A59 B;  1CG5 A;  1NWI A;  1Y5J B;  2OHB A;  5HLU A;  3GUQ A;  3ASE A;  2D5Z A;  1YVQ B;  1DXU B;  2SPN A;  2UUN B;  5CHR A;  3OZV A;  1JY7 A;  2ZT0 A;  3OO4 A;  1YHE B;  4O4T A;  1GLI B;  2BWH A;  2NSS A;  3KVS B;  2OH9 A;  1MOC A;  1CH9 A;  1CII A;  2EKU A;  3SDH A;  4HRT A;  3WCT D;  4F68 A;  1YG5 B;  3GQG B;  3S66 B;  3AT6 A;  3M39 A;  1YHR A;  1Y4P A;  3DHR B;  3OGB A;  3BJ3 B;  1CPW A;  1KN1 A;  1YVT B;  2AV0 A;  1LHS A;  1HGC A;  3UHY A;  2IG3 A;  1RPS A;  1DWR A;  2ZSQ A;  1BAB A;  1Y83 B;  1CO8 A;  1V4U A;  3WCU D;  1DO4 A;  4ESA B;  2GRZ A;  3UBC A;  3WCU C;  4MQI A;  1XZ7 A;  1XDT T;  1NGK A;  3QJD B;  2H35 A;  3ZJH A;  5AQD A;  3D17 A;  1BZZ B;  1EBC A;  3WI8 A;  1YEO B;  3GKV A;  1QPW B;  5JGG A;  5JDO E;  1A4F B;  3UHT A;  3WCV B;  1GZX B;  5EE4 C;  4A8K A;  1GBU A;  1MYI A;  1F99 B;  1MGN A;  1FSX A;  1G0B A;  3O18 A;  2GKN A;  4M4A A;  1LFV B;  2AUP A;  4YU4 A;  3K8B B;  4BS9 A;  4H2L B;  1MYF A;  1IT3 A;  2V1K A;  3SZK B;  4HBI A;  1EWA A;  2HZ1 A;  4N8T B;  2ZFB B;  1CH7 A;  2QMB A;  2D2N B;  4UIQ A;  1A0U B;  1S61 A;  2GRH A;  1RTX A;  2D5X A;  1Y8H B;  2VLZ A;  3HRW A;  1A3N A;  2VLX A;  2MYD A;  1LTW A;  1MWD A;  5CMV A;  3GIO A;  5B84 A;  5CHQ A;  2ZFO C;  1B8D B;  1QSH B;  1YEQ B;  3ZOL A;  1N9X A;  2VYW A;  3DHR A;  1HV4 B;  3M3B A;  2BV8 B;  3S65 B;  1MLK A;  1IWH A;  2VYZ A;  4HH1 A;  1NXF A;  3BJ2 A;  1YEV B;  5CNF A;  1Y22 B;  3WCV C;  1MYM A;  1JF4 A;  1G09 A;  3GKT A;  1X9F D;  1NEJ B;  4Z8K B;  2BMM A;  3G4V A;  3HEN A;  1Y0D A;  3ECL A;  4B3W A;  2ZWJ A;  3RJN B;  1F5O A;  4BJU A;  3GQR A;  3QJB A;  3K3U A;  2DKC A;  3BRP A;  2R1H A;  1NZ4 A;  1LJW B;  2QLS A;  4DC7 A;  1MNI A;  3AQ7 A;  1GCV A;  4AE0 A;  4XS0 B;  5HY8 A;  1HDS B;  5CN6 A;  1MLL A;  2ZLW B;  3VAU A;  4C44 A;  3PMD A;  3EDB A;  4C0N A;  1NS6 A;  1DDT A;  1G9V B;  1HA7 B;  2MHB A;  1IOP A;  1A00 A;  4NZI A;  4RMP A;  1V4W A;  1S5Y B;  1Y4B B;  1NZ2 A;  3ECZ A;  1Y4V A;  2HBD B;  2ZS0 D;  1YCB A;  3QQR A;  3UHU A;  2RI4 A;  1XZ4 A;  3B75 B;  1N9F A;  3E5O A;  3A0G B;  1R1X A;  1PHN A;  1XYE A;  2AV3 A;  1MOD A;  4B4Y A;  1A6M A;  4NK2 A;  1V4X B;  2ZLT B;  1RVW B;  4HRT B;  3WCT C;  3K9Z A;  3S66 A;  2KSC A;  3G52 A;  2DN2 A;  3ZJQ A;  1LFQ A;  1OJ6 A;  1Y4P B;  1JL6 A;  3ZJP A;  1S0H A;  2R4Z A;  1O1O B;  2ZS1 B;  4ODC B;  3UGZ A;  2ZSR A;  1MLJ A;  2QSP A;  3UHG A;  3GLN A;  5CN5 A;  4HHB A;  1YHU A;  1ALL A;  5FVB M;  4JAC A;  4ROL B;  1OUT A;  1WMU B;  2BLI A;  4KMW A;  2Z85 A;  3HF4 B;  1FN3 A;  1PMB A;  2JLG A;  4OOD A;  2C7J B;  2EB9 A;  1MCY A;  1CP0 A;  5HLX A;  1X9F A;  1G09 B;  1S6A A;  1Y8W B;  1MBA A;  1X9F C;  1QXE B;  106M A;  4Z8K A;  1AJH A;  1GCW A;  1CP5 A;  3G46 A;  2DN1 B;  1GZX A;  1Y0W A;  1Y7D A;  1FSX B;  1G0B B;  3PT7 A;  4WJG 1;  4MQC A;  1GH0 B;  2MBW A;  2ZSP A;  1XZU A;  1CIK A;  3QQQ A;  5CN7 A;  1S5X A;  2OHA A;  5C6E A;  1BZ0 B;  5EYJ A;  1Y0T A;  2D60 B;  1GVH A;  2O58 X;  1HDS A;  2O5Q X;  1J3Y A;  4H0M B;  4FWZ A;  3PI1 A;  1XQ5 A;  2EB8 A;  4O4Z A;  4F4O B;  1RH1 A;  1NS6 B;  1JZM A;  3PI4 A;  2LH2 A;  1HCO B;  1HA7 A;  3ZH0 A;  1YZI B;  1G0A A;  3BOM A;  1IRD B;  4M4B A;  2DN3 A;  3WR1 A;  5HLQ A;  1DM1 A;  3D7O A;  3O2C B;  1XZV B;  1BUW B;  4PO5 A;  1O1I A;  3DR9 A;  2ZSZ A;  2ZLX A;  1B33 A;  1XYE B;  2G3H A;  3ZJS A;  3SDN A;  3UHR A;  3LQD A;  4NI0 B;  1HAB B;  2WTG A;  1XZ5 B;  3M38 A;  1AJ9 A;  1HAC A;  3UHC A;  1HBA B;  2Z6N A;  1SI4 B;  1LFQ B;  1Y4G B;  2UUM X;  4NI1 B;  6HBI A;  5SW7 B;  1ABS A;  1UFJ A;  3LHB A;  1HBR B;  3CIU B;  2DKD A;  1RPS B;  3IC2 A;  4O2G A;  3UHE A;  2G0R A;  1Y22 A;  2QSS A;  4L1E B;  1QXD A;  2FRJ X;  2MGJ A;  3AT5 A;  1DXV A;  1VXC A;  1O1M B;  2R4W A;  2MGL A;  3ZTA A;  3EDA A;  1B0B A;  1MLF A;  1A3O B;  1A9W A;  1WVP A;  3PMC A;  1MKO B;  1ECA A;  1GDK A;  1O1J A;  1RQ4 B;  1X9F B;  3VRF A;  1YEN B;  3BRP B;  1BZP A;  3WCV A;  2OH8 A;  1V07 A;  1IBE A;  1O1P A;  1V75 A;  3QJE B;  1ECO A;  3GYS B;  1NY9 A;  2MGK A;  1NIH A;  3WCW B;  5C6Y A;  4A8F A;  1XZU B;  1LH6 A;  1COL A;  2R4Y A;  4YU4 B;  1MBN A;  1THB A;  4ROM A;  1DXU A;  2H8D B;  5EOH A;  3LB3 A;  1DKE A;  3GOU B;  5CNB A;  1MDT A;  1J7W A;  1GDL A;  1K1K B;  2DN3 B;  1J7S B;  1QI8 B;  1LFT B;  1LH7 A;  1Y4F B;  2D2M B;  4MQG B;  2XYK A;  3HRW B;  1O1I B;  1OUU A;  1J41 A;  2ZSX A;  2HBC B;  1K0Y B;  3BJ3 A;  1CG8 A;  1Y8K A;  3RJ6 A;  1UVJ A;  2ZS1 A;  4ODC A;  4IRO A;  3DUT B;  1HAC B;  3G53 A;  1Y5F A;  1YGD A;  4UZV A;  3OJ1 A;  3ORD A;  3PT8 B;  4F0T A;  4TWV A;  3KMF C;  4TWU A;  2BNL A;  1A87 A;  1N9H A;  2IN4 A;  3O7N A;  1HBB B;  5KKK A;  2UUL C;  2YSK A;  3QM8 A;  3QM9 A;  2RAO B;  2CMM A;  1QXD B;  1XXT A;  3ZJR A;  5KDQ A;  1I3D A;  1Y5K B;  1LH2 A;  2B7H B;  1RQ4 A;  1XF6 C;  3VRE A;  1FCS A;  1OR6 A;  1JP8 A;  1YE2 A;  2V1J A;  5D5R A;  1DXT B;  4ZIZ A;  4OF9 A;  3D1A B;  4VHB A;  4ETU A;  1CQ2 A;  1IRC A;  4O35 A;  1DUO A;  5EUI A;  1C7C A;  4TMA B;  3WFU A;  3PI9 B;  1IRD A;  2O5T X;  1CPC B;  2JHO A;  1HHO A;  5ILP A;  1MYZ A;  1Y4Q A;  2HBE A;  5AQD M;  1J7S A;  2HHD B;  4MQH B;  2QRW A;  3WFW A;  1FAW A;  2DHB B;  4HRR A;  1HGB A;  1Z8U B;  2Z6N B;  1S0H B;  2HBC A;  2X49 A;  1LA6 A;  1CQX A;  1CH1 A;  2VJT B;  2LH6 A;  2MGF A;  3HXN B;  2HBF B;  1R1Y A;  1HLM A;  1V9Q A;  3IC2 B;  1YGD B;  4WJG A;  2HHE A;  3M3A A;  1EYX B;  2NRL A;  5F2A A;  1A01 B;  1UIW A;  1Y0A A;  3DBJ A;  3NFE B;  1YGF A;  5B13 G;  4MU5 A;  4G51 A;  1VXD A;  1CBM A;  109M A;  1MBD A;  2UUL B;  4X0L B;  1YEU A;  1SGK A;  1SPE A;  1KR7 A;  1B86 B;  3PEL A;  1O1N B;  2ZFO D;  2BKM A;  2DKA A;  1MOH A;  1NQP B;  1Y83 A;  4GY3 A;  1SPG A;  1MTJ A;  1URV A;  5HY8 B;  2FAM A;  2ZT3 A;  3WCV D;  4ERT A;  1URY A;  1F0L A;  3VRG A;  1HBH B;  3MJU A;  4GXE A;  2AA1 B;  2H8F A;  3ODQ B;  1O1L A;  2O5B X;  1W92 A;  2W72 C;  1GJN A;  3H57 A;  1MBC A;  3D1A A;  2PGH A;  3QJC A;  1LFL A;  2WCQ A;  3WTG A;  3GQP A;  2J96 A;  1DUK A;  3QZX A;  5MBN A;  1MBI A;  1CO9 A;  1MNJ A;  1U7S A;  1JPB A;  1LFV A;  2PEG A;  3A5A A;  1BIJ A;  4F6G A;  1BVD A;  2D2M A;  4PO5 B;  1CBL A;  5E6E A;  1XCH A;  1MYG A;  1YH9 B;  5HAV A;  4N7N B;  4F0U B;  2ZLU A;  1Y46 A;  3EU1 A;  3OO5 A;  1GBV A;  2G10 A;  1Y8K B;  2W6W A;  1Y85 A;  1AJ9 B;  4KMV A;  5ILM A;  3RGK A;  1HRM A;  1MWC A;  3PI3 A;  4AVD A;  2MGG A;  3AT6 B;  1OUT B;  1WMU A;  2GTL D;  4NI1 A;  1J3Z B;  1HBR A;  1A0U A;  1VRF A;  3PI8 A;  4F0T B;  2D5X B;  2QFN A;  1EMY A;  3AT5 B;  3BCQ B;  2UUL D;  1HJT A;  1DXV B;  1S69 A;  3UBV A;  1Y0C A;  1Y7C A;  1Y7D B;  1YE0 A;  5KDQ B;  1C7D A;  3BJ2 B;  1DWT A;  3V58 B;  1RQA A;  1LFZ A;  2ZSN A;  1Y0T B;  1SHR A;  3DHT B;  1DXT A;  3WCW A;  2G0S A;  2QFK A;  4MBN A;  1VXA A;  5ILR A;  1Y0D B;  1MLS A;  2O5S X;  1U7R A;  4GXE B;  2AA1 A;  3VHB A;  2R1H B;  1I3E A;  2VML A;  3NMM B;  3G4U A;  2G12 A;  2MGE A;  2ZS1 D;  1VXF A;  2QU0 A;  5FVB A;  4DWU A;  1J7Y A;  1LFY B;  1MNO A;  1WAC A;  2R80 A;  3MVC A;  108M A;  3AQ9 A;  3HHB B;  1OR4 A;  2ZSY A;  5CNG A;  3AG0 A;  2MYB A;  1JY7 B;  3AQ5 A;  101M A;  2SPM A;  1BIJ B;  2ZFB A;  1BBB B;  1LIA A;  1C7B B;  1QSI A;  1HBS B;  2W72 B;  4HSW A;  1SI4 A;  1J41 B;  1OFK A;  3FS4 B;  1CG8 B;  3KUN A;  4N7N A;  4AVE A;  2Z8A A;  4XDI A;  1J40 B;  3VNC A;  1JW8 A;  1UVY A;  5B85 A;  1Q1F A;  1Y35 A;  1YIE B;  3IC0 A;  2UUL H;  1A01 A;  1Y0A B;  1UVI A;  2O5O X;  2BLH A;  1JWN A;  2UUL A;  4X0L A;  3G4W A;  3D17 B;  3BCQ A;  1O1N A;  3KMF A;  1IBE B;  1O1P B;  3PIA B;  1GBU B;  4MQJ B;  1UC3 A;  1PBX A;  2UUN D;  2V8A B;  3HYU A;  1LHT A;  2EKT A;  1A6N A;  1HBI A;  2ZS1 C;  4NXC A;  1OBM A;  5EE4 D;  1LFZ B;  5CND A;  1MLG A;  1Y31 A;  4MQK B;  104M A;  1GCV B;  1V5H A;  1Y8I A;  2O5L X;  1NZ5 A;  4XS0 A;  4PQB A;  4NK1 A;  3WFT A;  2M6Z A;  2OIF A;  2MGA A;  2H8D A;  4L7Y B;  1GDI A;  1MLU A;  1JZL A;  4YU3 A;  1YOI A;  3O89 A;  3PI9 A;  4ETT A;  1MBS A;  1Y5J A;  3OK5 A;  2D5Z B;  4DC8 A;  3V2Z A;  1HI1 A;  3QM6 A;  5EV5 A;  1ITH A;  1XQ5 B;  1UVK A;  3OO4 B;  5E6E B;  2HBG A;  3KVS A;  1C40 B;  2GNV A;  2G0Z A;  3UHI A;  3RQR A;  1X46 A;  1GBV B;  2C7K B;  2GLN A;  1MYT A;  1CG5 B;  2HHB B;  1CH2 A;  5JDO D;  1M6M A;  1HHS A;  3HXN A;  1CH3 A;  2SPO A;  4SDH A;  1YOG A;  2E2Y A;  2RAO A;  1ABW A;  1Y7Z B;  1HHT P;  3HC9 A;  1CLS A;  1XZ7 B;  1Y35 B;  1HBA A;  1YIH B;  3MWN A;  4A8S A;  5M3S A;  1MYH A;  1Y5K A;  3VRE B;  1MDN A;  1XZ2 B;  2GKM A;  3UI0 A;  1F99 A;  1O1K A;  4A8M P;  4ZIZ B;  1SDL B;  1YMB A;  1BZ1 A;  3ECX A;  3DHT A;  1SHR B;  102M A;  1PBX B;  1O1M A;  2G11 A;  3S1J A;  2H35 B;  5EU2 A;  3VRF B;  2MHB B;  1YEO A;  3IA3 B;  1QPW A;  5JGG B;  2MGH A;  2D2N C;  1A4F A;  1MBO A;  1ASH A;  1Y7G B;  1V4W B;  3E4N A;  1LFY A;  2M6Z B;  1CMY B;  3O18 B;  3NG6 B;  4M4A B;  1KD2 A;  1EBT A;  4F6B A;  1Y4R A;  1MTK A;  1MLR A;  2HBE B;  4PQ6 A;  2HHD A;  3MYN A;  4IT8 A;  2ZSO A;  2D2M D;  1AJG A;  2DXM A;  4HRR B;  2C7L A;  1YH9 A;  5AZR A;  1Y46 B;  4F6D A;  1DKE B;  1O1O A;  3SZK A;  1XZ5 A;  3R5I B;  2AUQ A;  1HSY A;  4LMS B;  1YHU B;  1ON7 B;  2D2N A;  2WY4 A;  2MGD A;  1Y45 A;  2BW9 M;  3A5G A;  1YGF B;  4G51 B;  1GLI A;  3IC0 B;  1K0Y A;  3ED9 A;  1JP6 A;  2VJH A;  4NS2 A;  1Y01 B;  3L0F B;  3WCU B;  2HCO B;  2V1F A;  1YHR B;  2GL3 A;  4GY3 B;  4Q70 A;  2JLF A;  3OVU C;  3BA2 A;  1FDH G;  1I7Y B;  1MKO A;  1KN1 B;  1YVT A;  3GQR B;  3QJB B;  2BV8 A;  3S65 A;  5JDO F;  1JF3 A;  4N7O A;  1LJW A;  2AUO A;  2QLS B;  2Z6S A;  4MXL A;  1SDL A;  3GYS A;  3ODQ A;  3UHK A;  4LPI A;  2HBS B; 
#chains in the Genus database with same CATH homology
 4PNJ A;  1J52 A;  4FH7 A;  1NZ3 A;  2VLY A;  2MGB A;  3MJP A;  3WHM B;  1UVX A;  4U8U B;  4YU3 B;  2QU0 B;  1G0A B;  1J7Y B;  4N7P A;  3UHD A;  1LH1 A;  1Y4V B;  2HBD A;  2VM0 A;  5KER A;  3S48 C;  1CMY A;  3V2V A;  4O1T A;  1M9P A;  1SDK A;  3EU1 B;  1G08 B;  1G9V A;  1Y85 B;  5AB8 A;  2GTL C;  3ONZ B;  1C7C B;  2MYA A;  1QSI B;  107M A;  1DLW A;  5CN9 A;  2DXM B;  2DC3 A;  3MOU A;  1J3Z A;  2V1H A;  4HHB B;  1YHE A;  3UHQ A;  1XZ4 B;  2NRM A;  5CNC A;  3A5B A;  3KUO A;  2QMB B;  1FAW B;  2XKH A;  3GQG A;  4QAU A;  1FN3 B;  3UHH A;  3IXF A;  1VXH A;  3NL7 B;  1HBB A;  1NAZ A;  2OLP A;  3CY5 B;  3GK9 A;  1JL7 A;  4F6J A;  1R1Y B;  1YCA A;  1YEN A;  1JEB B;  1H97 A;  1BZ1 B;  2B7H A;  3TM9 A;  1UIW B;  1YEV A;  4MPM A;  4FWX A;  2GRF A;  1MLH A;  1Y09 B;  3D4X B;  1HDA A;  3PEL B;  1J3Y B;  1NQP A;  3WCT B;  1BIN A;  1QXE A;  2VEB A;  2ZT4 A;  4H07 A;  1HGA B;  2V1G A;  2R80 B;  3BJ1 B;  2GDM A;  4JYQ A;  1OFJ A;  1YFF A;  3EOK B;  1KD2 B;  1Y4R B;  2G14 A;  1J7W B;  3MKB A;  2H8F B;  1DLY A;  5KER B;  1BUW A;  1Y4F A;  1VXE A;  1YDZ A;  3UH5 A;  3FS4 A;  2SPL A;  1COH A;  2LHB A;  1YMA A;  1M9P B;  3LQD B;  4MQH A;  2EVP A;  1LH5 A;  2GTL A;  1YZI A;  2NX0 A;  1HDB A;  4TYX A;  1J40 A;  3R5I A;  1DWS A;  3WCP A;  5HBI A;  7HBI A;  1JZK A;  3CIU A;  3QM7 A;  2LH7 A;  1ECD A;  5CN4 A;  2ZS0 C;  3A0G A;  5JOM A;  5IKS A;  1ABW B;  3OO5 B;  3H58 A;  1T1N B;  1RVW A;  1UFP A;  2ZST A;  3P5Q A;  1X3K A;  3WCU A;  4MQI B;  3WCW D;  3NL7 A;  5AZQ A;  1HV4 A;  1F63 A;  1Y4G A;  5SW7 A;  1BZZ A;  3GKV B;  3UH3 A;  1YE2 B;  1NIH B;  1NEJ A;  2MGM A;  3HF4 A;  4F6I A;  2ZFO B;  2YRS B;  2R4X A;  2O5M X;  1Y7C B;  2MGC A;  2C0K A;  1YE0 B;  1DXC A;  1HBH A;  1Y8W A;  1CIO A;  2W6V B;  2ZS0 A;  3MJP B;  3AQ8 A;  2VHB A;  1V75 B;  1THB B;  4ROM B;  1LFL B;  2V1I A;  2D2N D;  1FHJ A;  4G1V A;  1UMO A;  1VXB A;  3LR9 A;  1K1K A;  1TU9 A;  1D8U A;  1DTI A;  4N8T A;  3ONZ A;  3ZOM A;  4F4O A;  1HCO A;  2VEE A;  111M A;  1O16 A;  110M A;  2GTL B;  2WTH A;  3A59 A;  1Y5F B;  1HDB B;  1R1X B;  2ZLV A;  4FC3 A;  1Y7Z A;  3D7O B;  2MYC A;  1LFT A;  1YVQ A;  1CLS B;  1HBS A;  2W72 A;  1MLM A;  3D1K B;  2DN2 B;  2ZLX B;  3ARJ A;  3NFE A;  1XY0 A;  3ARK A;  2EF2 A;  1UT0 A;  4NI0 A;  4U8U C;  1T1N A;  4U8U D;  4IRO B;  1YG5 A;  4MXK A;  5JDO C;  4WCH D;  3LB1 A;  1MYJ A;  1YIE A;  1AZI A;  3UHN A;  5CN8 A;  2W6X A;  1NS9 B;  1RQ3 A;  3FH9 B;  1V4U B;  1HDA B;  3D4X A;  2HBS A;  4ESA A;  1GCW B;  1A3O A;  4KJT A;  1HGA A;  1O1J B;  2PGH B;  3QJC B;  3WTG B;  5ILE A;  1DXD A;  1F65 A;  3QJE A;  4MBA A;  5E83 A;  3W4U B;  3WFX A;  3OZU A;  1Y4B A;  4MQK A;  105M A;  2W6Y A;  3HEP A;  1VRE A;  3MKB B;  2D60 A;  2MYE A;  1A6K A;  103M A;  3HHB A;  1UX9 A;  2RI4 B;  3B75 A;  3TLD A;  4L7Y A;  1G08 A;  2ZLU B;  1WLA A;  2DHB A;  3BOM B;  5EUI B;  4BJA A;  4M4B B;  1DO1 A;  3ZJI A;  3ZHW A;  3WCP B;  1XZV A;  1DO7 A;  2HBF A;  1MNH A;  2AUR A;  4NXA A;  2GNW A;  1CH5 A;  2BK9 A;  4L2M A;  3UHZ A;  1LH3 A;  3MYM A;  4FC3 B;  2HHE B;  2EVK A;  1HAB A;  3AQ6 A;  3TM3 A;  1RSE A;  2HCO A;  1VWT B;  3A9M A;  1JP9 A;  2G0X A;  3D1K A;  3UHW A;  1HGB B;  1MOA A;  5D1V A;  1LA6 B;  4DWT A;  1B86 A;  1VXG A;  3ZJL A;  3DUT A;  3E55 A;  2V1E A;  4PQC A;  4N7O B;  1DTM A;  1QSH A;  1YEQ A;  2ZT1 A;  2QSS B;  5EQM A;  3R0G A;  1S56 A;  3LR7 A;  1MLQ A;  4MQJ A;  3PT7 B;  5MBA A;  3G4Y A;  1IWH B;  2YRS A;  2D6C A;  3VRG B;  2NSR A;  1NS9 A;  1BZ0 A;  1F5P A;  1O1L B;  1XXT B;  3WHM A;  1Y8I B;  2ZS0 B;  1HLB A;  3NMM A;  1O1K B;  4F69 A;  5EYS A;  3UHX A;  1IT2 A;  1YFF B;  3EOK A;  2MGI A;  2R50 A;  4HSX A;  3MBA A;  3LB4 A;  5E83 B;  3W4U A;  1EW6 A;  1MNK A;  2LH1 A;  1A0Z B;  2ZLW A;  1YDZ B;  2FRK X;  1Y7G A;  1C7B A;  2HZ3 A;  2MB5 A;  3UGY A;  1NWN A;  3GQP B;  4ZVB A;  4H2L A;  3HEO A;  4MAX A;  1MOB A;  1QI8 A;  5E29 B;  1UX8 A;  2HHB A;  2ZLV B;  1NPF A;  1LUE A;  2W31 A;  2BLJ M;  1OUU B;  1J3F A;  1Y8H A;  1BZ6 A;  3CY5 A;  5HU6 A;  1NPG A;  4ZVA A;  1A3N B;  3UH7 A;  3P5Q B;  3MN0 A;  3E5I A;  2ZLT A;  1VWT A;  1MLO A;  2VYY A;  1TES A;  2FRI X;  2ZT2 A;  1DO3 A;  1KFR A;  1N9I A;  1ABY B;  3UHS A;  3WCW C;  1Y45 B;  4KN3 A;  3HYU B;  1RQA B;  4F6F A;  1BAB B;  3PI2 A;  1Y09 A;  1Y2Z A;  2LH3 A;  1A9W E;  4ROL A;  3FH9 A;  3ARL A;  3ZJN A;  1YEU B;  1Y0C B;  3BJ1 A;  4UUR A;  2W6V A;  3ZJO A;  1C7D B;  1MZ0 A;  3ZJM A;  2Z6T A;  3GDJ A;  4H0B A;  2DN1 A;  3U3E A;  1A6G A;  1FHJ B;  1Y0W B;  1VHB A;  4MQC B;  3UHB A;  1MTI A;  2FAL A;  1MLN A;  5EET A;  6HBW B;  3GOU A;  1S5X B;  1COH B;  3G4R A;  4FH6 A;  1M6C A;  1YOH A;  4U8U A;  4MQG A;  1A0Z A;  2LH5 A;  1FLP A;  1SWM A;  1S5Y A;  3K8B A;  4G1B A;  2D2M C;  2G0V A;  1Y4Q B;  2PEG B;  1ECN A;  1SDK B;  3WR1 B;  5E29 A;  1JDO A;  1BBB A;  3PT8 A;  3LB2 A;  1H1X A;  1V4X A;  1MWB A;  1XY0 B;  1YIH A;  2ZSS A;  5HU6 B;  1FDH A;  2XKI A;  1HGC B;  4GZG A;  2QSP B;  1XZ2 A;  1BVC A;  3PI8 B;  1ABY A;  2ZFO A;  3UHV A;  112M A;  3QJD A;  1IDR A;  3A2G A;  4FWY A;  1RQ3 B;  1Y2Z B;  1Y31 B;  3QMA A;  3NML A;  4ILZ A;  3ZJJ A;  1GDJ A;  1JEB A;  3PIA A;  1RTE A;  1SPG B;  3QM5 A;  1YHU C;  1YHU D;  3NG6 A;  3OZW A;  3UH6 A;  3MJU B;  1CH4 A;  3GDJ B;  5CNE A;  5C6E B;  1BJE A;  4N7P B;  1HBG A;  1HHO B;  1L2K A;  3WCT A;  1FSL A;  3S1I A;  2XKG A;  2HZ2 A;  1BZR A;  1YMC A;  2FRF A;  6HBW A;  2VRY A;  1C40 A;  5F0B A;  3QZZ A;  1A00 B;  3G4Q A;  3A59 B;  1CG5 A;  1NWI A;  1Y5J B;  2OHB A;  5HLU A;  3ASE A;  2D5Z A;  1YVQ B;  1DXU B;  2SPN A;  5CHR A;  3OZV A;  1JY7 A;  2ZT0 A;  3OO4 A;  1YHE B;  4O4T A;  1GLI B;  2BWH A;  2NSS A;  2OH9 A;  1MOC A;  1CH9 A;  2EKU A;  3SDH A;  4HRT A;  3WCT D;  4F68 A;  1YG5 B;  3GQG B;  3S66 B;  3AT6 A;  3M39 A;  1YHR A;  1Y4P A;  3DHR B;  3OGB A;  3BJ3 B;  1CPW A;  1YVT B;  2AV0 A;  1LHS A;  1HGC A;  3UHY A;  2IG3 A;  1RPS A;  1DWR A;  2ZSQ A;  1BAB A;  1Y83 B;  1CO8 A;  1V4U A;  3WCU D;  1DO4 A;  4ESA B;  2GRZ A;  3UBC A;  3WCU C;  4MQI A;  1XZ7 A;  3QJD B;  1NGK A;  2H35 A;  3ZJH A;  3D17 A;  1BZZ B;  1EBC A;  3WI8 A;  1YEO B;  3GKV A;  1QPW B;  5JGG A;  5JDO E;  1A4F B;  3UHT A;  3WCV B;  1GZX B;  5EE4 C;  1GBU A;  1MYI A;  1MGN A;  1FSX A;  1G0B A;  2GKN A;  4M4A A;  1LFV B;  2AUP A;  4YU4 A;  3K8B B;  4H2L B;  1MYF A;  1IT3 A;  2V1K A;  3SZK B;  4HBI A;  1EWA A;  2HZ1 A;  4N8T B;  2ZFB B;  1CH7 A;  2QMB A;  2D2N B;  4UIQ A;  1A0U B;  1S61 A;  2GRH A;  1RTX A;  2D5X A;  1Y8H B;  2VLZ A;  3HRW A;  1A3N A;  2VLX A;  2MYD A;  1LTW A;  5CMV A;  1MWD A;  5B84 A;  5CHQ A;  2ZFO C;  1QSH B;  1YEQ B;  3ZOL A;  1N9X A;  2VYW A;  3DHR A;  1HV4 B;  3M3B A;  3S65 B;  1MLK A;  1IWH A;  2VYZ A;  1NXF A;  3BJ2 A;  1YEV B;  5CNF A;  1Y22 B;  3WCV C;  1MYM A;  1JF4 A;  1G09 A;  3GKT A;  1X9F D;  1NEJ B;  2BMM A;  3G4V A;  3HEN A;  1Y0D A;  3ECL A;  4B3W A;  2ZWJ A;  3RJN B;  1F5O A;  3GQR A;  3QJB A;  3K3U A;  2R1H A;  1NZ4 A;  1LJW B;  2QLS A;  4DC7 A;  1MNI A;  3AQ7 A;  1GCV A;  4XS0 B;  5HY8 A;  1HDS B;  5CN6 A;  1MLL A;  2ZLW B;  3VAU A;  4C44 A;  3EDB A;  4C0N A;  1NS6 A;  1G9V B;  2MHB A;  1IOP A;  1A00 A;  4NZI A;  1V4W A;  1S5Y B;  1Y4B B;  1NZ2 A;  3ECZ A;  1Y4V A;  2HBD B;  2ZS0 D;  1YCB A;  3QQR A;  3UHU A;  2RI4 A;  1XZ4 A;  3B75 B;  1N9F A;  3E5O A;  3A0G B;  1R1X A;  1XYE A;  2AV3 A;  1MOD A;  4B4Y A;  1A6M A;  4NK2 A;  1V4X B;  2ZLT B;  1RVW B;  4HRT B;  3WCT C;  3K9Z A;  3S66 A;  2KSC A;  3G52 A;  2DN2 A;  3ZJQ A;  1LFQ A;  1OJ6 A;  1Y4P B;  1JL6 A;  3ZJP A;  1S0H A;  2R4Z A;  1O1O B;  2ZS1 B;  4ODC B;  3UGZ A;  2ZSR A;  1MLJ A;  2QSP A;  3UHG A;  3GLN A;  5CN5 A;  4HHB A;  1YHU A;  4JAC A;  4ROL B;  1OUT A;  1WMU B;  2BLI A;  4KMW A;  2Z85 A;  3HF4 B;  1FN3 A;  1PMB A;  4OOD A;  2EB9 A;  1MCY A;  1CP0 A;  5HLX A;  1X9F A;  1G09 B;  1S6A A;  1Y8W B;  1MBA A;  1X9F C;  1QXE B;  106M A;  1AJH A;  1GCW A;  1CP5 A;  3G46 A;  2DN1 B;  1GZX A;  1Y0W A;  1Y7D A;  1FSX B;  1G0B B;  3PT7 A;  4WJG 1;  4MQC A;  2MBW A;  2ZSP A;  1XZU A;  1CIK A;  3QQQ A;  5CN7 A;  1S5X A;  2OHA A;  5C6E A;  1BZ0 B;  5EYJ A;  1Y0T A;  2D60 B;  1GVH A;  2O58 X;  1HDS A;  2O5Q X;  1J3Y A;  4FWZ A;  3PI1 A;  1XQ5 A;  2EB8 A;  4O4Z A;  4F4O B;  1NS6 B;  1JZM A;  3PI4 A;  2LH2 A;  1HCO B;  3ZH0 A;  1YZI B;  1G0A A;  3BOM A;  1IRD B;  4M4B A;  2DN3 A;  3WR1 A;  5HLQ A;  1DM1 A;  3D7O A;  1XZV B;  1BUW B;  1O1I A;  3DR9 A;  2ZSZ A;  2ZLX A;  1XYE B;  2G3H A;  3ZJS A;  3SDN A;  3UHR A;  3LQD A;  4NI0 B;  1HAB B;  2WTG A;  1XZ5 B;  3M38 A;  1AJ9 A;  1HAC A;  3UHC A;  1HBA B;  2Z6N A;  1SI4 B;  1LFQ B;  1Y4G B;  4NI1 B;  6HBI A;  5SW7 B;  1ABS A;  1UFJ A;  3LHB A;  1HBR B;  3CIU B;  1RPS B;  3IC2 A;  4O2G A;  3UHE A;  2G0R A;  1Y22 A;  2QSS A;  1QXD A;  2FRJ X;  2MGJ A;  3AT5 A;  1DXV A;  1VXC A;  1O1M B;  2R4W A;  2MGL A;  3EDA A;  1B0B A;  1MLF A;  1A3O B;  1A9W A;  1WVP A;  1MKO B;  1ECA A;  1GDK A;  1O1J A;  1RQ4 B;  1X9F B;  3VRF A;  1YEN B;  1BZP A;  3WCV A;  2OH8 A;  1V07 A;  1IBE A;  1O1P A;  1V75 A;  3QJE B;  1ECO A;  3GYS B;  2MGK A;  1NIH A;  3WCW B;  5C6Y A;  1XZU B;  1LH6 A;  2R4Y A;  4YU4 B;  1MBN A;  1THB A;  4ROM A;  1DXU A;  2H8D B;  5EOH A;  3LB3 A;  1DKE A;  3GOU B;  5CNB A;  1J7W A;  1GDL A;  1K1K B;  2DN3 B;  1J7S B;  1QI8 B;  1LFT B;  1LH7 A;  1Y4F B;  2D2M B;  4MQG B;  2XYK A;  3HRW B;  1O1I B;  1OUU A;  1J41 A;  2ZSX A;  2HBC B;  1K0Y B;  3BJ3 A;  1CG8 A;  1Y8K A;  3RJ6 A;  2ZS1 A;  4ODC A;  4IRO A;  3DUT B;  1HAC B;  3G53 A;  1Y5F A;  1YGD A;  4UZV A;  3OJ1 A;  3ORD A;  3PT8 B;  4TWV A;  3KMF C;  4TWU A;  2BNL A;  1N9H A;  2IN4 A;  3O7N A;  1HBB B;  5KKK A;  3QM8 A;  3QM9 A;  2RAO B;  2CMM A;  1QXD B;  1XXT A;  3ZJR A;  5KDQ A;  1I3D A;  1Y5K B;  1LH2 A;  2B7H B;  1RQ4 A;  3VRE A;  1FCS A;  1OR6 A;  1JP8 A;  5D5R A;  1YE2 A;  2V1J A;  1DXT B;  4OF9 A;  3D1A B;  4VHB A;  1CQ2 A;  1IRC A;  4O35 A;  1DUO A;  5EUI A;  1C7C A;  3WFU A;  3PI9 B;  1IRD A;  2O5T X;  2JHO A;  1HHO A;  5ILP A;  1MYZ A;  1Y4Q A;  2HBE A;  1J7S A;  2HHD B;  4MQH B;  2QRW A;  3WFW A;  1FAW A;  2DHB B;  4HRR A;  1HGB A;  1Z8U B;  2Z6N B;  1S0H B;  2HBC A;  1LA6 A;  1CQX A;  1CH1 A;  2LH6 A;  2MGF A;  3HXN B;  2HBF B;  1R1Y A;  1HLM A;  1V9Q A;  3IC2 B;  1YGD B;  4WJG A;  2HHE A;  3M3A A;  2NRL A;  5F2A A;  1A01 B;  1UIW A;  1Y0A A;  3NFE B;  1YGF A;  4MU5 A;  4G51 A;  1VXD A;  1CBM A;  109M A;  1MBD A;  4X0L B;  1YEU A;  1SPE A;  1KR7 A;  1B86 B;  3PEL A;  1O1N B;  2ZFO D;  2BKM A;  1MOH A;  1NQP B;  1Y83 A;  1SPG A;  1MTJ A;  1URV A;  5HY8 B;  2FAM A;  2ZT3 A;  3WCV D;  1URY A;  3VRG A;  1HBH B;  3MJU A;  2AA1 B;  2H8F A;  3ODQ B;  1O1L A;  2O5B X;  1W92 A;  2W72 C;  1GJN A;  3H57 A;  1MBC A;  3D1A A;  2PGH A;  3QJC A;  1LFL A;  3WTG A;  3GQP A;  1DUK A;  3QZX A;  5MBN A;  1MBI A;  1CO9 A;  1MNJ A;  1U7S A;  1JPB A;  1LFV A;  2PEG A;  3A5A A;  1BIJ A;  4F6G A;  1BVD A;  2D2M A;  1CBL A;  5E6E A;  1XCH A;  1MYG A;  1YH9 B;  5HAV A;  4N7N B;  2ZLU A;  1Y46 A;  3EU1 A;  3OO5 A;  1GBV A;  2G10 A;  1Y8K B;  2W6W A;  1Y85 A;  1AJ9 B;  4KMV A;  5ILM A;  3RGK A;  1HRM A;  1MWC A;  3PI3 A;  4AVD A;  2MGG A;  3AT6 B;  1OUT B;  1WMU A;  2GTL D;  4NI1 A;  1J3Z B;  1HBR A;  1A0U A;  1VRF A;  3PI8 A;  2D5X B;  2QFN A;  1EMY A;  3AT5 B;  3BCQ B;  1HJT A;  1DXV B;  1S69 A;  3UBV A;  1Y0C A;  1Y7C A;  1Y7D B;  1YE0 A;  5KDQ B;  1C7D A;  3BJ2 B;  1DWT A;  1RQA A;  1LFZ A;  2ZSN A;  1Y0T B;  1SHR A;  3DHT B;  1DXT A;  3WCW A;  2G0S A;  2QFK A;  4MBN A;  1VXA A;  5ILR A;  1Y0D B;  1MLS A;  2O5S X;  1U7R A;  2AA1 A;  3VHB A;  2R1H B;  1I3E A;  3NMM B;  3G4U A;  2G12 A;  2MGE A;  2ZS1 D;  1VXF A;  2QU0 A;  4DWU A;  1J7Y A;  1LFY B;  1MNO A;  2R80 A;  3MVC A;  108M A;  3AQ9 A;  3HHB B;  1OR4 A;  2ZSY A;  5CNG A;  3AG0 A;  2MYB A;  1JY7 B;  3AQ5 A;  101M A;  2SPM A;  1BIJ B;  2ZFB A;  1BBB B;  1C7B B;  1QSI A;  1HBS B;  2W72 B;  4HSW A;  1SI4 A;  1J41 B;  1OFK A;  3FS4 B;  1CG8 B;  3KUN A;  4N7N A;  4AVE A;  2Z8A A;  4XDI A;  1J40 B;  1JW8 A;  1UVY A;  5B85 A;  1Q1F A;  1Y35 A;  1YIE B;  3IC0 A;  1A01 A;  1Y0A B;  2O5O X;  2BLH A;  1JWN A;  4X0L A;  3G4W A;  3D17 B;  3BCQ A;  1O1N A;  3KMF A;  1IBE B;  1O1P B;  3PIA B;  1GBU B;  4MQJ B;  1UC3 A;  1PBX A;  3HYU A;  1LHT A;  2EKT A;  1A6N A;  1HBI A;  2ZS1 C;  4NXC A;  1OBM A;  5EE4 D;  1LFZ B;  5CND A;  1MLG A;  1Y31 A;  4MQK B;  104M A;  1GCV B;  1V5H A;  1Y8I A;  2O5L X;  1NZ5 A;  4XS0 A;  4PQB A;  4NK1 A;  3WFT A;  2M6Z A;  2OIF A;  2MGA A;  2H8D A;  4L7Y B;  1GDI A;  1MLU A;  1JZL A;  4YU3 A;  1YOI A;  3O89 A;  3PI9 A;  1MBS A;  1Y5J A;  3OK5 A;  2D5Z B;  4DC8 A;  3V2Z A;  3QM6 A;  5EV5 A;  1ITH A;  1XQ5 B;  3OO4 B;  5E6E B;  2HBG A;  1C40 B;  2GNV A;  2G0Z A;  3UHI A;  1X46 A;  1GBV B;  2GLN A;  1MYT A;  1CG5 B;  2HHB B;  1CH2 A;  5JDO D;  1M6M A;  3HXN A;  1CH3 A;  2SPO A;  4SDH A;  1YOG A;  2E2Y A;  2RAO A;  1ABW A;  1Y7Z B;  3HC9 A;  1CLS A;  1XZ7 B;  1Y35 B;  1HBA A;  1YIH B;  5M3S A;  1MYH A;  1Y5K A;  3VRE B;  1MDN A;  1XZ2 B;  2GKM A;  3UI0 A;  1O1K A;  1SDL B;  1YMB A;  1BZ1 A;  3ECX A;  3DHT A;  1SHR B;  102M A;  1PBX B;  1O1M A;  2G11 A;  3S1J A;  2H35 B;  5EU2 A;  3VRF B;  2MHB B;  1YEO A;  3IA3 B;  1QPW A;  5JGG B;  2MGH A;  2D2N C;  1A4F A;  1MBO A;  1ASH A;  1Y7G B;  1V4W B;  3E4N A;  1LFY A;  2M6Z B;  1CMY B;  3NG6 B;  4M4A B;  1KD2 A;  1EBT A;  4F6B A;  1Y4R A;  1MTK A;  1MLR A;  2HBE B;  4PQ6 A;  2HHD A;  3MYN A;  4IT8 A;  2ZSO A;  2D2M D;  1AJG A;  2DXM A;  4HRR B;  1YH9 A;  5AZR A;  1Y46 B;  4F6D A;  1DKE B;  1O1O A;  3SZK A;  1XZ5 A;  3R5I B;  2AUQ A;  1HSY A;  1YHU B;  2D2N A;  2WY4 A;  2MGD A;  1Y45 A;  2BW9 M;  3A5G A;  1YGF B;  4G51 B;  1GLI A;  3IC0 B;  1K0Y A;  3ED9 A;  1JP6 A;  4NS2 A;  1Y01 B;  3WCU B;  2HCO B;  2V1F A;  1YHR B;  2GL3 A;  3OVU C;  3BA2 A;  1FDH G;  1MKO A;  1YVT A;  3GQR B;  3QJB B;  3S65 A;  5JDO F;  1JF3 A;  4N7O A;  1LJW A;  2AUO A;  2QLS B;  2Z6S A;  4MXL A;  1SDL A;  3GYS A;  3ODQ A;  3UHK A;  4LPI A;  2HBS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...