1RQMA

Solution structure of the k18g/r82e alicyclobacillus acidocaldarius thioredoxin mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
ATMTLTDANFQQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Solution Structure and Backbone Dynamics of the K18G/R82E Alicyclobacillus acidocaldarius Thioredoxin Mutant: A Molecular Analysis of Its Reduced Thermal Stability.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Oxidoreductase
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1rqmA00
1PRXA 4RUVA 1GSDA 3APSA 1SL0B 3VI7A 3LEFA 2PMTA 5JCWA 4JRRA 5F05A 3CYNA 4JZQA 3BBYA 4YQUA 1NHOA 3ZREA 1E6BA 1O73A 1A2JA 3RHCA 5B8BA 1K0AA 3KM6A 3O76A 2ES7A 3MSZA 1PKZA 3FRCA 1HNBA 2BMXA 3G7YA 3LORA 1OE8A 4X1UA 1M7TA 3APQA 1TI1A 2PU9C 2PUKC 4MPGA 4AF2A 4ZB6A 2VD1A 2RUFA 1URMA 3GKMA 3IPZA 2TRXA 3TJBA 4PUAA 5J4UA 11GSA 1A24A 1SKWB 1Q98A 18GSA 2OE0A 2XBQA 3E3EA 2WDUA 4EXJA 3P8WA 5H5QA 2DBCA 1GNWA 2PPTA 1FB6A 1X0RA 3G7JA 2H75A 1GH2A 1B8XA 2JZTA 4GQCA 4CW9A 1FVKA 1I5GA 3D4MA 2XPEA 1UVZA 5HR2A 3KMNA 1VRSD 1TXXA 2MMNA 2J9HA 1EP8A 2DJ1A 3L78A 4KGIA 4HJMA 1T4YA 3D5JA 2AYTA 3VLNA 2M80A 4WBJA 1RQMA 1TRUA 5D96A 5IMDA 3DD3A 2VOCA 1GSUA 3F3QA 2P5QA 5CRDA 3BCKA 1HNAA 4K0NA 4ZL9A 1QMVA 4Q5NA 1CQHA 3KH7A 4K8MA 3EU3A 1SKSB 2YWMA 4NAXA 4Q5QA 1VGLA 2EIQA 3ZYWA 5DJMA 1SL1B 3TKRA 2IMEA 1EEJA 3KMOA 3HD5A 4GSNA 3W8JA 5AGYA 3GX8A 1G7OA 3F6DA 1DE1A 1EGOA 4MF5A 3F3RA 2OACA 4O32A 4BL7A 3AY8A 1GTBA 3ZFBA 2H01A 2RUEA 3KEBA 4I8BA 4TN8A 3TJJA 1J9BA 1WPIA 4HEA2 4DSQA 2CVBA 3FHKA 2HSYA 1E2YA 6GSUA 3ZFLA 2LS5A 1X9MB 1ZMAA 3GIXA 1WE0A 2GQMA 1OAZA 2A2RA 2JU5A 4IW9A 4MF6A 1AW9A 3Q19A 3UVHA 1EOGA 2K6VA 1XPVA 3VPTA 1PX6A 2GDRA 2FA8A 2DJKA 5IPHA 2FWFA 2YPMA 4MZBA 2LSTA 3TRPA 2IFQB 1KEBA 4POLA 2C3TA 1SK1A 2H6YA 3TKSA 3EMPA 1F9MA 2X99A 1GTAA 1M0UA 1SJ6A 3PGTA 5AIVA 2IL3A 1EEMA 5C00A 4LMVA 1OYJA 3RPNA 4MH3A 3S9FA 1YQ1A 1H4OA 1J08A 1QQ2A 1YF0A 2WZ9A 1DUGA 3IA1A 2FD3A 3U5RE 1GTIA 3L9VA 3QR6A 3UBKA 5G30A 2YV7A 1Y25A 2GVPA 3IC4A 2TIRA 2IWTA 4RI6A 4XRAA 4IS0A 2PVOC 1ZL9A 2KUCA 2L59A 7GSSA 3M0FA 4XTSA 4L5OA 5FHIA 3M1GA 4KSOA 1I9DA 2H66A 3IHQA 3FR6A 2GT6A 3LJRA 4IJIA 1O85A 4KW6A 1S3CA 2O89A 5KN0A 1TU8A 1MD4A 2LRCA 2C0EA 5DJLA 2WULA 3FYGA 1GWCA 3LG6A 2HI7A 1XIYA 4O92A 2I9HA 5IMFA 1SJZA 2HSHA 2LJRA 2H74A 1G0TA 3K8NA 3W8SA 1YEXA 2H6XA 1FO5A 4WXTA 3LSZA 4G10A 1FOVA 1OC9B 2YV9A 1F3AA 1M99A 4MMMA 4OFTA 1MDJA 1ILOA 4V1Ag 5IO2A 1M9AA 1M9BA 1TK0B 2AHEA 4LL1B 5G5EA 5J5NA 3BD2A 2LNTA 4MP4A 1GLQA 4V2NA 2M46A 2C0FA 3HVSA 3NOFA 2LV3A 2FWGA 5JCGA 3GFKA 3L0HA 1V9WA 2H0GA 2AV4A 2XPDA 3BJ5A 2OE3A 2HLSA 4HQZA 1PSQA 2HT9A 2QC7A 5JWQB 3M8NA 4IN0A 4NV2A 2PBJA 1F6MC 2MYGA 3GMFA 3MNGA 1SYRA 3FEUA 2I1UA 2DJJA 4TOPA 1OKTA 5A4VA 2OBKA 3Q6OA 14GSA 1Z9HA 1DBYA 1F2EA 2YCDA 4XHMA 5A4WA 5ECQB 1ZCPA 3SWLA 3GKXA 6GSSA 2BJXA 4KCAA 3EC3A 4F0CA 3TRXA 2O85A 3TGZA 4XIHA 1YKAA 5CP1A 1T7PB 4GLTA 2GQLA 2IN3A 1ML6A 4FO5A 5COHA 1Z3EA 4EL1A 4POMA 3PINA 4CHSA 4LA1A 1LU4A 2GSRA 3J7Yk 3ERFA 1OC3A 2KP1A 2X8HA 3GX0A 2XHFA 3TUEA 1G6YA 2N5BA 4I5QA 2H30A 2DJ0A 4I2TA 4I6XA 5IQYA 4ECJA 4JEDA 3GSSA 2H72A 4KB3A 3QOUA 5EY6A 4PXOA 2NDOA 3N5OA 3F6FA 2CZ2A 3QAWA 1SL2B 2YZUA 1GSSA 4K0GA 2MMAA 3O6TA 2YJ7A 5D9XA 5KN3A 1TTZA 2YWIA 3APOA 2B5EA 5ABRA 5LCZA 3N9JA 5B7CA 3D22A 3GHAA 1C72A 1PGTA 4IVFA 5D93A 3IXRA 3EVIA 4J56E 3GURA 3IE3A 1GSFA 3UL3A 2LRNA 3GH9A 4Q5FA 4YAPA 4NPBA 5CAXA 4GCIA 1UC7A 4J57E 4V2MA 5INYA 2B3SA 2GTUA 2K8VA 4I2UA 1IYHA 1G6WA 2L4CA 1PN9A 3HY2A 2R2JA 2H70A 5D9TA 1WIKA 2CAQA 4HOJA 4KUNA 5DCHA 2GSSA 4ZBDA 2IMDA 3MWHA 2R3XA 3BOAA 5DBQA 1PL1A 1NW2A 2DLXA 1YJ6A 3GL3A 5A5KA 2H8LA 1ST9A 5ECPB 4NHZA 4XS4B 1TI3A 4OO4A 1AXDA 1O8WA 4IQAA 5LNKe 4FYBA 1ERUA 1JZRA 3IBHA 6GSTA 3TKSC 1M2DA 5ECMB 5D8IA 4TXOB 1Z7RA 1TOFA 1QUWA 3HJOA 4PQIA 2DIYA 5G1LA 4DSRA 1W89A 3RDWA 3VPQA 4IBPA 1ERVA 4G19A 4KA0A 2VCVA 4FH8A 1X5CA 22GSA 4ACSA 2WJUA 3ZITA 4YQMA 4NMUA 3VWXA 4GSTA 2EIOA 4K9ZA 4K7IA 4OCEA 1RW1A 4GF0A 1XOBA 4KX4A 3LYPA 1TK5B 1AQVA 1THOA 2H1DA 6GSVA 3KTLA 2LEGA 4KAEA 4HZ4A 2L6CA 2DMMA 3NZNA 4JR4A 3CSIA 2G0FA 2DJ3A 4IJ3A 1A8LA 3GV1A 3F4TA 3BCIA 4E8EA 2P5RA 4N10A 4ML1A 4HQSA 5H5SA 4X0XA 2E0QA 1XWGA 5ELAA 2QGVA 3A3TA 3WGXA 2GZZA 1B9XC 3EMXA 5IO0A 5HFIA 3GSTA 1HYUA 2AUVA 1SKRB 2WS2A 3F0IA 4HI7A 1PD21 4RQXA 1PL2A 1Z6MA 4N0VA 4EVMA 3GTUA 2YWNA 1V40A 3VWWA 1XWKA 2D2ZA 5CRGA 1LBKA 2VCXA 3VI5A 2C8UA 4X43A 2C3QA 5D9VA 5FT3A 1JZDA 2K9FA 2PN8A 2C0GA 1MDIA 3VWUA 4KNDA 3HZ4A 2B5YA 3I69A 3P90A 1ZOFA 1ACVA 3CTFA 3LWAA 3QDNA 3Q18A 5ECSA 2P31A 3SBCA 4DEJA 8GSSA 1Q4JA 2V2GA 2EIRA 2KLXA 3CMIA 1WP0A 4ZB9A 3KZQA 3PR8A 4JBBA 4WR4A 2VCQA 5IMCA 3CSHA 3KH9A 1XZOA 5D9WA 4EDYA 2H0IA 2JL4A 1GLPA 1AAZA 3JCML 1T1VA 1K3LA 3DWVA 5DAKA 3TKPA 4D73A 1GSYA 3MDKA 3NIVA 5KEJA 1WOUA 3CSJA 1A2MA 5IPGA 2RLIA 3ZMKA 5CO3A 3H8QA 3I43A 2LUSA 4XS1A 2VUPA 5B6MA 2NPBA 3ED3A 3WT1A 5IIZA 2CVKA 5B6NA 4LLRA 5JCUA 2DJ2A 3FZ5A 4TRXA 4OFNA 2H1BA 2JADA 4ID0A 3A2VA 2HZFA 4BWSA 4JR6A 5DDLA 3GN3A 2V41A 1BQ7A 2VCWA 1XFLA 3LQ7A 3E0UA 4FYCA 2V6KA 4TXVA 1HD2A 1U88A 2OADA 1AIUA 3GKNA 2PWJA 1GL8A 2VD0A 1JLVA 4ECIA 2A2SA 2NBSA 3GUSA 5E59A 1BX9A 1AQWA 5GSSA 2PGTA 4K1FA 2CV4A 1ERWA 6GSWA 3LFLA 2CA8A 4XS6A 2VLVA 1YZXA 1K3OA 3HJPA 5HR1A 1TU7A 1EV9A 2YN1A 3F4SA 1X5EA 4F2IA 1S3DA 4O7HA 5GZZB 3C8EA 1NSWA 4KH7A 4IGJA 1SU9A 2LRTA 20GSA 1WWJA 4DSSA 3GL5A 3EINA 4PX1A 1N2AA 2L6DA 3HVXA 4OCFA 3KD0A 2IMKA 1EZKA 4V2LA 4G2EA 2F8AA 1O8XA 2B1KA 2HYXA 1EWXA 3GNJA 4PNGA 2REMA 1QFNA 3UBLA 16GSA 5JWOB 2F8FA 4IQ1A 5D73A 4BVYA 2N5AA 2GZPA 2MZCA 4PGTA 3ME8A 4L0WA 4NV5A 6GSYA 2H6ZA 2DC5A 3HHVA 3RPPA 4TVEA 3CBUA 3D21A 4WEYA 4N0ZA 2AAWA 3L9UA 4N11A 2ZNMA 4HJ2A 4G9HA 5KN1A 2HRNA 2C3NA 1O81A 1YKCA 2X64A 4PQHA 4LMWA 1K0DA 2FLSA 1R5PA 1XBSA 3DRNA 3FK8A 2ZCTA 3TKSE 3CTGA 4ZL8A 4WKWA 1G7EA 3GKKA 1Y6EA 4NXIA 4MK3A 3KXOA 1BAYA 4O5RA 1U87A 3J7Yb 5ID2A 2FNOA 2LNSA 1WMJA 4JE1A 2I4AA 2GGTA 3ERGA 2L57A 5G2ZA 4POBA 1MTCA 5G5FA 1K0NA 4OFMA 4MJCA 4IKHA 2ON7A 3ZL5A 1JLWA 3ME7A 5CRWA 3EE2A 3I6AA 2TRCP 2WRTA 3HVVA 2WCIA 1ERTA 3CRTA 1X9SB 2H76A 1GRXA 2PVQA 4OO5A 1BYEA 1PKWA 4F82A 1XW6A 3ZLPA 2O8VB 4K7OA 1EGRA 2V1MA 4MJAA 4MJBA 1NHYA 2VL3A 3ZIJA 4K6XA 1B4PA 1GTUA 4TR1A 3GA4A 2WGRA 5G1KA 2WFCA 4KE3A 2YZHA 2B5XA 4EC0A 1U3AA 5HR0A 1KTEA 3RBTA 13GSA 1XWAA 2HXKA 3UARA 2CAIA 5ELGA 2B1LA 2ALBA 5IMAA 5IOXA 1F3BA 2H1GA 1FW1A 1MDKA 3DKSA 2R5GA 3TDGA 1PX7A 4PQ1A 5IMZA 3DGQA 2VCTA 3LXZA 2LJAA 3DXBA 3EU4A 3O3TA 2KHPA 4EKZA 3ZTLA 2AB6A 2CX3A 3FZ4A 3KTBA 3C73A 2RM6A 4ULXA 4E8HA 1USBA 4PUFC 5FWGA 3FR3A 3EURA 3HA9A 3L9SA 4Q5RA 2VO4A 2LQOA 1A0FA 4CDOA 3IRAA 4MPFA 2IMIA 2P0GA 4ZILA 4Z7XA 4P3YB 4ZBAA 2V6OA 1OKDA 3GTUB 2FWHA 4KDYA 1LJRA 1OC9A 4NWYA 10GSA 1V58A 3QAVA 1SJIA 3LXTA 1ABAA 3G7IA 4BA7A 1K3YA 2GZYA 4JU5A 1EP7A 2I81A 5J3RA 4ZBBA 3U6VA 2VL2A 2JZSA 3ZRDA 1T8EB 3WT2A 3VWVA 1U3IA 19GSA 2LJKA 5DVBA 3G9BA 1B9YC 2CT6A 3GYKA 4ECBA 5CYYA 5L71A 1TDIA 2L4QA 1K0MA 2JZRA 3QAGA 1N8JA 4F9ZA 4BVXA 4XRDA 1BJXA 3UIWA 5KN2A 2IPAA 2OJLA 1SK0A 4D73B 2A4VA 3A5WA 4KDXA 1O7UA 5F07A 2KOKA 3EYTA 1UN2A 1QXHA 1K0CA 2CX4A 4QL9A 3ERWA 3M9KA 4BWQA 1GULA 2YWOA 2HE3A 1TRWA 4MABA 3IR4A 2Z9SA 2FUG2 4MF7A 2C80A 1A23A 4POKA 1FHEA 9GSSA 2JACA 1FAAA 1XWCA 1ON4A 2V32A 3HXSA 4FIWA 5AN1A 5DALA 2GQKA 4WR5A 1JHBA 2F9SA 2XC2A 3TKQA 1AQXA 5IOWA 3D4TA 4K7NA 3CRUA 4HUAA 3C7MA 1GNEA 2H73A 1T3BA 3ZMLA 1XW9A 3HYPA 1ZYQB 1JFUA 3M3MA 3VURA 2QSIA 5F06A 4YH2A 4IP6A 2HRFA 3US3A 5ECKB 2X8CA 3EWLA 1TRSA 3UVTA 2VLUA 2PERA 3D0ZA 4XCSA 2VAFA 1T4ZA 1GUHA 2DIZA 1FB0A 3GH6A 2JSYA 3DEXA 2VM2A 4EDZA 2HZEA 2YOIA 4DSSB 5ECLB 3R2QA 3VK9A 3KGKA 1YDKA 2C1YA 2FGXA 1A8YA 4HU7A 1YF1A 1SD8A 3HCZA 3TOUA 1VF3A 4MJEA 3F63A 1TRVA 2H0HA 4ZL7A 3IAS2 1MD3A 1TW9A 1B48A 1GP1A 3TRQA 2M72A 3IOSA 2R37A 2L5LA 1R7HA 3IDVA 3FZ9A 3F8UA 2IIYA 1RK4A 4HU9A 4IHUA 1GSQA 4HZ2A 4ILFA 3QPMA 2RIIA 5GSTA 2MBSA 4XS4A 5F8BA 4YAVA 3WGDA 1DE2A 3OR5A 2MMZA 2OE1A 3DIEA 3DVXA 2VIMA 3UJ1A 4GXZA 4TXOA 3DMLA 2O87A 2B6MA 1XVQA 5ECRB 4AGSA 4MA9A 1M2AA 4IELA 2C4JA 5AISA 4L8EA 3P7XA 3A2XA 3LGCA 3RHBA 5ID2B 2FA4A 3ISOA 1ZZYA 2QKEA 4F0BA 3FKFA 3C1SA 2K18A 1FVJA 3WD6A 2JSZA 2CQ9A 3WGEA 2CZ3A 2I3YA 4ZXGA 2GT5A 6GSXA 1QK8A 1HQOA 2DMLA 4ISDA 1ZGNA 4PNFA 2HFDA 2GSTA 4ML6A 1V98A 4YQVA 5HFGA 1GSEA 3TB2A 2E7PA 2CVDA 4MZCA 2YJHA 4TKYA 4WF5A 3D6IA 4LL4B 4ZB8A 17GSA 2G2QA 4RI7A 1OC8A 3KP8A 2VL9A 5DQYA 1KNGA 5ECHB 4N30A 12GSA 1EV4A 4TR1B 4TR3A 3KJYA 1TJDA 2R6KA 5G31A 1IYIA 4NHWA 1CQGA 2NTOA 1V57A 2F51A 1PQNA 1YEPA 3WYWA 5F0GA 3KCMA 2R4VA 4FYUA 1O6JA 5HFKA 4HDEA 3UOMA 1F37A 1SENA 5AIXA 1SYXA 3KIJA 2FY6A 3UEMA 1GUKA 1JZWA 3Q74A 4L0UA 1T00A 1S3AA 2E2MA 4TR4A 2VCZA 1M2BA 1YY7A 5DCGA 2YANA 4KCEA 3QD9A 5IM9A 1XCCA 3CXGA 1J0FA 3UMAA 3VFIA 2H1AA 4BPYA 4MLYA 1K0BA 2VL2C 1U6TA 1W4VA 2X8GA 4QQ7A 5ECIB 3QCPA 4MDCA 2WB9A 5CNWA 4F03A 4TW5A 3RAZA 4ZIJA 4GTUA 1XWBA 1UA5A 1H75A 1PA3A 2IMFA 1XVWA 1R26A 3HZ8A 4MCUA 4EF0A 5A4UA 2YP6A 2K8SA 3UAPA 2H19A 4H86A 3F9UA 4PURA 1TP9A 3FR9A 1NM3A 2E2GA 1V2AA 4DVCA 1BEDA 3H93A 1THXA 1OE7A 2B7KA 1TK8B 1XXUA 1VF2A 3L4NA 3P2AA 2B7JA 3LYKA 2FWEA 2IJYA 4J2FA 1EOHA 4HS1A 5HR3A 2IFQA 3PH9A 1OVNA 1HNCA 3H1NA 2GLRA 2XBIA 4GQFA 3TJKA 4EE0A 1XW5A 2KP2A 2FHEA 4GRFA 3TJFA 1Z5YE 3E9JB 2OKAA 4K2DA 2HNLA 1ZYEA 4IP1A 5B8AA 5EPFA 4RQRA 1A2LA 2FCHA 1GUMA 1R4WA 5H5RA 3QFBC 4I97A 2DSAA 4WF4A 5GAND 3IK7A 3V1WA 3DVWA 2C0DA 1X5DA 3C1RA 2F3MA 5J9CA 2MBTA 5E4WA 4TR0A 5ECNB 1FG4A 3TOTA 2J23A 5DALB 3MAKA 1A0RP 3FZAA 4L5LA 1MEKA 1DSBA 5EL8A 3HJMA 3DYRA 1Z7PA 2GS3A 1KBNA 2GSQA 2MMOA 2YNXA 3IK9A 1QGVA 3FY7A 1Z6NA 1TKDB 4GSSA 1WJKA 1R5AA 3C71A 4V1Ap 2L5OA 3HKRA 5HQPA 2LTKA 2OA7A 1B4QA 3IV4A 3QMXA 3IAM2 2O7KA 5ECOB 5LD0A 3TJGA 1X9WB 2VM1A 3KP9A 1JZOA 5IMVA 3M9JA 5JWRB 4MH2A 1SD9A 4MZWA 4KSMA 3F4RA 4ECCA 3ZZXA 2ZUPA 3H4KA 4EO3A 1PMTA 2RM5A 5ENUA 2AJQB 2ON5A 1AC1A 1SK2A 1VF4A 2HZEB 5CRHA 3GRXA 4WBRD 4AJ8A 3I9V2 2LKUA 5J9BA 3TCOA 2LQQA 4GWRA 2OBIA 4OMVA 2BTOT 5CREA 3ZVJD 1K0OA 4AJ6A 4WETA 3FW2A 5C04A 1WRYA 3A2WA 2N5FA 4KDUA 1VF1A 4OWYA 5J41A 1AUCA 4AJ7A 5DQSA 3W6GA 2NVLA 4EUYA 4QL7A 3H79A 3QFAC 2EC4A 1BG5A 3ZIVA 5GAPD 2H71A 5EVOA 4OD7A 3HDCA 1XOAA 5DAKB 2VLTA 3ZVJA
chains in the Genus database with same CATH superfamily
1PRXA 4RUVA 1GSDA 3APSA 1SL0B 3VI7A 3LEFA 2PMTA 5JCWA 4JRRA 5F05A 3CYNA 4JZQA 3BBYA 4YQUA 1NHOA 3ZREA 1E6BA 1O73A 1A2JA 3RHCA 5B8BA 1K0AA 3KM6A 3O76A 2ES7A 3MSZA 1PKZA 3FRCA 1HNBA 2BMXA 3G7YA 3LORA 1OE8A 4X1UA 1M7TA 3APQA 3MYDA 1TI1A 2PU9C 2PUKC 4MPGA 4AF2A 4ZB6A 2VD1A 2RUFA 1URMA 3GKMA 3IPZA 2TRXA 3TJBA 4PUAA 5J4UA 11GSA 1A24A 1SKWB 1Q98A 18GSA 2OE0A 2XBQA 3E3EA 2WDUA 4EXJA 3P8WA 5H5QA 2DBCA 1GNWA 2PPTA 1FB6A 1X0RA 3G7JA 2H75A 1GH2A 1B8XA 2JZTA 4GQCA 4CW9A 1FVKA 1I5GA 3D4MA 2XPEA 1UVZA 2X4AA 5HR2A 3KMNA 1VRSD 1TXXA 2MMNA 2J9HA 1EP8A 2DJ1A 3L78A 4KGIA 4HJMA 1T4YA 3D5JA 4G0IA 2AYTA 3VLNA 2M80A 4WBJA 1RQMA 1TRUA 5D96A 5IMDA 3DD3A 2VOCA 1GSUA 3F3QA 2P5QA 5CRDA 3BCKA 1HNAA 4K0NA 4ZL9A 1QMVA 2DKIA 4Q5NA 1CQHA 3KH7A 4K8MA 3EU3A 1SKSB 2YWMA 4NAXA 4Q5QA 1VGLA 2EIQA 3ZYWA 5DJMA 1SL1B 4K5RA 3TKRA 2IMEA 1EEJA 4FQUA 3KMOA 3HD5A 4GSNA 3W8JA 5AGYA 3GX8A 1G7OA 1ZYPA 3F6DA 1DE1A 1EGOA 4MF5A 3F3RA 2OACA 4O32A 4BL7A 3AY8A 1GTBA 3ZFBA 2H01A 2RUEA 3KEBA 4I8BA 4TN8A 2HSMA 3TJJA 1J9BA 1WPIA 4HEA2 4DSQA 2CVBA 3FHKA 2HSYA 1E2YA 6GSUA 3ZFLA 2LS5A 1X9MB 1ZMAA 3GIXA 1WE0A 2GQMA 1OAZA 2A2RA 2JU5A 4IW9A 4MF6A 1AW9A 3Q19A 3UVHA 1EOGA 2K6VA 1XPVA 3VPTA 1PX6A 2GDRA 2FA8A 2DJKA 5IPHA 2FWFA 2YPMA 4MZBA 2LSTA 4MNNA 4O5QA 3TRPA 2IFQB 1KEBA 4POLA 2C3TA 1SK1A 2H6YA 3TKSA 3EMPA 4O5UA 1F9MA 2X99A 1GTAA 1M0UA 1SJ6A 3PGTA 5AIVA 2IL3A 1EEMA 5C00A 4LMVA 1OYJA 3RPNA 4MH3A 3S9FA 1YQ1A 1H4OA 1J08A 1QQ2A 1YF0A 2WZ9A 1DUGA 3IA1A 2FD3A 3U5RE 1GTIA 3L9VA 3QR6A 3UBKA 5G30A 2YV7A 1Y25A 2GVPA 3IC4A 2TIRA 2IWTA 4RI6A 4XRAA 4IS0A 2PVOC 1ZL9A 2KUCA 2L59A 7GSSA 3M0FA 4XTSA 4L5OA 5FHIA 3M1GA 4KSOA 1I9DA 2H66A 3IHQA 3FR6A 2GT6A 3LJRA 4IJIA 1O85A 4KW6A 1S3CA 2O89A 5KN0A 1TU8A 1MD4A 2LRCA 2C0EA 5DJLA 2WULA 3FYGA 1GWCA 3LG6A 2HI7A 1XIYA 3PPUA 4O92A 2I9HA 5IMFA 1SJZA 2HSHA 2LJRA 2H74A 1G0TA 4USSA 3K8NA 3W8SA 1YEXA 2H6XA 1FO5A 4WXTA 3LSZA 4G10A 1FOVA 1OC9B 2YV9A 1F3AA 1M99A 4MMMA 4OFTA 1MDJA 1ILOA 4V1Ag 5IO2A 1M9AA 1M9BA 1TK0B 2AHEA 4LL1B 5G5EA 5J5NA 3BD2A 2LNTA 4MP4A 1GLQA 4V2NA 2M46A 2C0FA 3HVSA 3NOFA 2LV3A 2FWGA 5JCGA 3GFKA 3L0HA 1V9WA 2H0GA 2AV4A 2XPDA 3BJ5A 2OE3A 2HLSA 4HQZA 1PSQA 2HT9A 2QC7A 5JWQB 3M8NA 4IN0A 4NV2A 2PBJA 1F6MC 2MYGA 3GMFA 4X4JA 3MNGA 1SYRA 3FEUA 2I1UA 2DJJA 4TOPA 1OKTA 5A4VA 3LW9A 2OBKA 3Q6OA 14GSA 1Z9HA 1DBYA 1F2EA 2YCDA 4XHMA 5A4WA 5ECQB 1ZCPA 3SWLA 3GKXA 6GSSA 1PN0A 2BJXA 4KCAA 3EC3A 4F0CA 3TRXA 2O85A 3TGZA 4XIHA 1YKAA 5CP1A 1T7PB 4GLTA 2GQLA 2IN3A 1ML6A 4FO5A 5COHA 1Z3EA 4EL1A 4POMA 3PINA 4CHSA 4LA1A 1LU4A 2GSRA 3J7Yk 3ERFA 1OC3A 2KP1A 2X8HA 3GX0A 2XHFA 3TUEA 1G6YA 2N5BA 4I5QA 2H30A 2DJ0A 4I2TA 4I6XA 4K5SA 5IQYA 4ECJA 4JEDA 3GSSA 2H72A 4KB3A 3QOUA 5EY6A 4PXOA 2NDOA 3N5OA 3F6FA 2CZ2A 3QAWA 1SL2B 2YZUA 1GSSA 4K0GA 2MMAA 3O6TA 2YJ7A 5D9XA 5KN3A 1TTZA 2YWIA 3APOA 2B5EA 5ABRA 5LCZA 3N9JA 5B7CA 3D22A 3GHAA 1C72A 1PGTA 4IVFA 5D93A 3IXRA 3EVIA 4J56E 3GURA 3IE3A 1GSFA 3UL3A 2LRNA 3GH9A 4Q5FA 4YAPA 4NPBA 5CAXA 4GCIA 1UC7A 4J57E 4V2MA 5INYA 2B3SA 4YKFA 2GTUA 1M3IA 2K8VA 4I2UA 1IYHA 1G6WA 2L4CA 1PN9A 3HY2A 2R2JA 2H70A 5D9TA 1WIKA 2CAQA 4HOJA 4KUNA 5DCHA 2GSSA 3IC8A 4ZBDA 2IMDA 3MWHA 2R3XA 3BOAA 5DBQA 1PL1A 1NW2A 2DLXA 4BL7B 1YJ6A 3GL3A 5A5KA 2H8LA 1ST9A 5ECPB 4NHZA 4XS4B 1TI3A 4OO4A 4A5PA 1AXDA 1O8WA 4IQAA 5LNKe 4FYBA 1ERUA 1JZRA 3IBHA 6GSTA 3TKSC 1M2DA 5ECMB 5D8IA 4TXOB 1Z7RA 1TOFA 1QUWA 3HJOA 4PQIA 2DIYA 5G1LA 4DSRA 1W89A 2A4HA 3RDWA 3VPQA 4IBPA 1ERVA 4G19A 4KA0A 2VCVA 4FH8A 1X5CA 22GSA 4ACSA 2WJUA 3ZITA 4YQMA 4NMUA 3VWXA 4GSTA 2EIOA 4K9ZA 4K7IA 4OCEA 1RW1A 4GF0A 1XOBA 4KX4A 3LYPA 1TK5B 1AQVA 1THOA 2H1DA 6GSVA 3KTLA 2LEGA 4KAEA 4HZ4A 2L6CA 2DMMA 3NZNA 4JR4A 3CSIA 2G0FA 2DJ3A 4IJ3A 1A8LA 3GV1A 3F4TA 3BCIA 4E8EA 4Z2TA 2P5RA 4N10A 4ML1A 4HQSA 5H5SA 4X0XA 2E0QA 1XWGA 5ELAA 2QGVA 3A3TA 3WGXA 2GZZA 1B9XC 3EMXA 5IO0A 4CY6A 5HFIA 3GSTA 1HYUA 2AUVA 1SKRB 2WS2A 3F0IA 4HI7A 1PD21 4RQXA 1PL2A 1Z6MA 4N0VA 4EVMA 3GTUA 2YWNA 1V40A 3VWWA 1XWKA 2D2ZA 5CRGA 1LBKA 2VCXA 3VI5A 2C8UA 4X43A 2C3QA 5D9VA 5FT3A 1JZDA 1S3RA 2K9FA 2PN8A 2C0GA 1MDIA 3VWUA 4KNDA 3HZ4A 2B5YA 3I69A 3P90A 1ZOFA 1ACVA 3CTFA 3LWAA 3QDNA 3Q18A 5ECSA 2P31A 1PFOA 3SBCA 4DEJA 8GSSA 1Q4JA 2V2GA 2EIRA 2KLXA 3CMIA 1WP0A 4ZB9A 3KZQA 3PR8A 4JBBA 4WR4A 2VCQA 5IMCA 3CSHA 3KH9A 1XZOA 5D9WA 4EDYA 2H0IA 2JL4A 1GLPA 1AAZA 3JCML 1T1VA 1K3LA 3DWVA 5DAKA 3TKPA 4D73A 1GSYA 3MDKA 3NIVA 5KEJA 1WOUA 3CSJA 1A2MA 5IPGA 2RLIA 3ZMKA 5CO3A 3H8QA 3I43A 2LUSA 4XS1A 2VUPA 5B6MA 2NPBA 3ED3A 3WT1A 5IIZA 2CVKA 5B6NA 4LLRA 5JCUA 2DJ2A 3FZ5A 4TRXA 4OFNA 2H1BA 2JADA 4ID0A 4YKGA 3A2VA 2HZFA 4BWSA 4JR6A 5DDLA 3GN3A 2V41A 1BQ7A 2VCWA 1XFLA 3LQ7A 3E0UA 4FYCA 2V6KA 4TXVA 1HD2A 1U88A 2OADA 1AIUA 3GKNA 2PWJA 1GL8A 2VD0A 1JLVA 4ECIA 2A2SA 2NBSA 3GUSA 5E59A 1BX9A 1AQWA 5GSSA 2PGTA 4K1FA 2CV4A 1ERWA 6GSWA 3LFLA 2CA8A 4XS6A 2VLVA 1YZXA 1K3OA 3HJPA 5HR1A 1TU7A 1EV9A 2YN1A 3F4SA 1X5EA 4F2IA 1S3DA 4O7HA 5GZZB 3C8EA 1NSWA 4KH7A 4IGJA 1SU9A 2LRTA 20GSA 1WWJA 4DSSA 3GL5A 3EINA 4PX1A 1N2AA 2L6DA 3HVXA 4OCFA 3KD0A 2IMKA 1EZKA 4V2LA 4G2EA 2F8AA 1O8XA 2B1KA 2HYXA 1EWXA 3GNJA 4PNGA 2REMA 1QFNA 3UBLA 16GSA 5JWOB 2F8FA 4IQ1A 5D73A 4BVYA 2N5AA 2GZPA 2MZCA 4PGTA 3ME8A 4L0WA 4NV5A 6GSYA 2H6ZA 2DC5A 3HHVA 3RPPA 4TVEA 2QA2A 3CBUA 3D21A 4Z2RA 4WEYA 4N0ZA 2AAWA 3L9UA 4N11A 2ZNMA 4HJ2A 4G9HA 5KN1A 2HRNA 2C3NA 1O81A 1YKCA 2X64A 4PQHA 4LMWA 4KF9A 1K0DA 2FLSA 1R5PA 1XBSA 3DRNA 3FK8A 2ZCTA 3TKSE 3CTGA 4ZL8A 4WKWA 1G7EA 3GKKA 1Y6EA 4NXIA 4MK3A 3KXOA 1BAYA 4O5RA 5BMUA 1U87A 3J7Yb 5ID2A 2FNOA 2LNSA 1WMJA 4JE1A 2I4AA 2GGTA 3ERGA 2L57A 5G2ZA 4POBA 1MTCA 5G5FA 1K0NA 4OFMA 4MJCA 4IKHA 2ON7A 3ZL5A 1JLWA 3ME7A 5CRWA 3EE2A 3I6AA 2TRCP 2WRTA 3HVVA 2WCIA 1ERTA 3CRTA 1X9SB 2H76A 1GRXA 2PVQA 4OO5A 1BYEA 1PKWA 4F82A 1XW6A 3ZLPA 2O8VB 4K7OA 1EGRA 2V1MA 4MJAA 4MJBA 1NHYA 2VL3A 3ZIJA 4K6XA 1B4PA 1GTUA 4TR1A 4Z2UA 3GA4A 2WGRA 5G1KA 2WFCA 4KE3A 2HRAA 2YZHA 2B5XA 4EC0A 1U3AA 5HR0A 1KTEA 3RBTA 13GSA 1XWAA 2HXKA 3UARA 2CAIA 5ELGA 2B1LA 2ALBA 5IMAA 5IOXA 1F3BA 2H1GA 1FW1A 1MDKA 3DKSA 2R5GA 3TDGA 1PX7A 4PQ1A 5IMZA 3DGQA 2VCTA 3LXZA 2LJAA 3DXBA 3EU4A 3O3TA 2KHPA 3EPTA 4EKZA 3ZTLA 2AB6A 2CX3A 3FZ4A 3KTBA 3C73A 2RM6A 4ULXA 4E8HA 1USBA 4PUFC 5FWGA 3FR3A 3EURA 3HA9A 3L9SA 4Q5RA 2VO4A 2LQOA 1A0FA 4CDOA 3IRAA 4MPFA 2IMIA 2P0GA 4ZILA 4Z7XA 4P3YB 4ZBAA 2V6OA 1OKDA 3GTUB 2FWHA 4KDYA 1LJRA 1OC9A 4NWYA 10GSA 1V58A 3QAVA 1SJIA 3LXTA 1ABAA 3G7IA 4BA7A 1K3YA 2GZYA 4JU5A 1EP7A 2I81A 5J3RA 4ZBBA 3U6VA 2VL2A 2JZSA 3ZRDA 1T8EB 3WT2A 3VWVA 1U3IA 19GSA 2LJKA 5DVBA 3G9BA 1B9YC 2CT6A 3GYKA 4ECBA 5CYYA 5L71A 1TDIA 2L4QA 1K0MA 2JZRA 3QAGA 1XG8A 1N8JA 4F9ZA 4BVXA 4XRDA 1BJXA 5KOXA 3UIWA 5KN2A 2IPAA 2QA1A 2OJLA 1SK0A 4D73B 2A4VA 3A5WA 4BIKA 4KDXA 1O7UA 5F07A 2KOKA 3EYTA 1UN2A 1QXHA 3A5IA 1K0CA 2CX4A 4QL9A 3ERWA 3M9KA 4BWQA 1GULA 2YWOA 2HE3A 1TRWA 4MABA 3IR4A 2Z9SA 2FUG2 4MF7A 2C80A 1A23A 4POKA 1FHEA 9GSSA 2JACA 1FAAA 1XWCA 1ON4A 2V32A 3HXSA 4FIWA 5AN1A 5DALA 2GQKA 4WR5A 2X49A 1JHBA 2F9SA 2XC2A 3TKQA 1AQXA 5IOWA 3D4TA 4K7NA 3CRUA 4HUAA 3C7MA 1GNEA 2H73A 1T3BA 3ZMLA 1XW9A 3HYPA 1ZYQB 1JFUA 3M3MA 3VURA 2QSIA 5F06A 4YH2A 4IP6A 2HRFA 3US3A 5ECKB 2X8CA 3EWLA 1TRSA 3UVTA 2VLUA 2HRKA 2PERA 3D0ZA 4XCSA 2VAFA 1T4ZA 1GUHA 2DIZA 1FB0A 3GH6A 2JSYA 3DEXA 2VM2A 4EDZA 2HZEA 2YOIA 4DSSB 5ECLB 3R2QA 3VK9A 3KGKA 1YDKA 2C1YA 2FGXA 3MIXA 1A8YA 3HVNA 4HU7A 1YF1A 1SD8A 3HCZA 3TOUA 1VF3A 4G0KA 4MJEA 3F63A 1TRVA 2H0HA 4ZL7A 3IAS2 1MD3A 1TW9A 4BVYB 1B48A 1GP1A 3TRQA 2M72A 3IOSA 2R37A 2L5LA 1R7HA 3IDVA 3FZ9A 3F8UA 2IIYA 1RK4A 4HU9A 4IHUA 1GSQA 4HZ2A 4ILFA 3QPMA 4PTSA 2RIIA 5GSTA 2MBSA 4XS4A 5F8BA 2R0CA 4YAVA 3WGDA 1DE2A 3OR5A 2MMZA 2OE1A 3DIEA 3DVXA 2VIMA 3UJ1A 4GXZA 4TXOA 3DMLA 2O87A 2B6MA 1XVQA 5ECRB 4AGSA 4MA9A 1M2AA 4IELA 2C4JA 5AISA 4L8EA 3P7XA 3A2XA 3LGCA 3RHBA 5ID2B 2FA4A 3ISOA 3CQFA 1ZZYA 2QKEA 4F0BA 3FKFA 3C1SA 2DKHA 2K18A 1FVJA 4K2XA 2JSZA 3WD6A 2CQ9A 3WGEA 2CZ3A 2I3YA 4ZXGA 2GT5A 6GSXA 1QK8A 1HQOA 2DMLA 5KOWA 1M3JA 4ISDA 1ZGNA 4PNFA 2HFDA 2GSTA 4ML6A 1V98A 4YQVA 5HFGA 1GSEA 3TB2A 2E7PA 2CVDA 4MZCA 2YJHA 3IHGA 4TKYA 4WF5A 3D6IA 4LL4B 4ZB8A 17GSA 2G2QA 4RI7A 1OC8A 3KP8A 2VL9A 5DQYA 1KNGA 5ECHB 4N30A 12GSA 1EV4A 4TR1B 4TR3A 3KJYA 1TJDA 2R6KA 5G31A 1IYIA 4NHWA 1CQGA 2NTOA 1V57A 2F51A 1PQNA 1YEPA 3WYWA 5F0GA 3KCMA 2R4VA 4FYUA 1O6JA 5HFKA 4HDEA 3UOMA 1F37A 1SENA 5AIXA 1SYXA 3KIJA 2FY6A 3UEMA 1GUKA 1JZWA 3Q74A 4L0UA 1T00A 1S3AA 2E2MA 4TR4A 2VCZA 1M2BA 1YY7A 2R0PA 5DCGA 2YANA 4KCEA 3QD9A 5IM9A 1XCCA 3CXGA 1J0FA 3UMAA 3VFIA 2H1AA 4BPYA 4HSCX 4MLYA 1K0BA 2VL2C 1U6TA 1W4VA 2X8GA 4QQ7A 5ECIB 3QCPA 4MDCA 2WB9A 5CNWA 1FOHA 4F03A 4TW5A 3RAZA 4ZIJA 4GTUA 1XWBA 1UA5A 1H75A 1PA3A 2IMFA 1XVWA 1R26A 3HZ8A 4MCUA 4EF0A 5A4UA 2YP6A 2K8SA 3UAPA 2H19A 4H86A 3F9UA 4PURA 1TP9A 3FR9A 1NM3A 2E2GA 1V2AA 4DVCA 1BEDA 3H93A 1THXA 1OE7A 2B7KA 1TK8B 1XXUA 1VF2A 4ICYA 3L4NA 3P2AA 2B7JA 3LYKA 2FWEA 2IJYA 4J2FA 1EOHA 4EIQA 4HS1A 5HR3A 2IFQA 3PH9A 1OVNA 4BVXB 1HNCA 3H1NA 4CY8A 2GLRA 2XBIA 4GQFA 2A2PA 3TJKA 4EE0A 1XW5A 2KP2A 2FHEA 4GRFA 3TJFA 1Z5YE 3E9JB 2OKAA 4K2DA 2HNLA 1ZYEA 4IP1A 5B8AA 5EPFA 4RQRA 1A2LA 2FCHA 1GUMA 1R4WA 5H5RA 3QFBC 4I97A 2DSAA 4WF4A 5GAND 3IK7A 3V1WA 3DVWA 2C0DA 1X5DA 3C1RA 2F3MA 5J9CA 2MBTA 5E4WA 4TR0A 5ECNB 1FG4A 3TOTA 2J23A 5DALB 2R0GA 3MAKA 3FMWA 1A0RP 3FZAA 4L5LA 1MEKA 1DSBA 5EL8A 3HJMA 3DYRA 1Z7PA 2GS3A 1KBNA 2GSQA 2MMOA 2YNXA 3IK9A 1QGVA 3FY7A 1Z6NA 1TKDB 4GSSA 4G0LA 1WJKA 1R5AA 3C71A 4V1Ap 2L5OA 2UZ8A 3HKRA 5HQPA 2LTKA 2OA7A 4EIPA 1B4QA 3IV4A 3QMXA 3IAM2 2O7KA 5ECOB 5LD0A 3TJGA 1X9WB 2VM1A 3KP9A 1JZOA 5IMVA 3M9JA 5JWRB 4MH2A 1SD9A 4MZWA 4KSMA 3F4RA 4ECCA 3ZZXA 2ZUPA 3H4KA 4EO3A 1PMTA 2RM5A 5ENUA 2AJQB 2ON5A 1AC1A 1SK2A 1VF4A 2HZEB 5CRHA 3GRXA 4WBRD 4AJ8A 3I9V2 5BRTA 2LKUA 5J9BA 3TCOA 2LQQA 4GWRA 2OBIA 4OMVA 2BTOT 5CREA 3ZVJD 1K0OA 4AJ6A 4WETA 3FW2A 5C04A 1WRYA 1ZYNA 3A2WA 2N5FA 4KDUA 1VF1A 4OWYA 5J41A 1AUCA 4AJ7A 5DQSA 3W6GA 2NVLA 4EUYA 3R3EA 4QL7A 3H79A 3QFAC 2EC4A 1BG5A 3ZIVA 5GAPD 2H71A 5EVOA 4OD7A 3HDCA 1XOAA 5DAKB 2VLTA 3ZVJA
chains in the Genus database with same CATH topology
1PRXA 4RUVA 1GSDA 3APSA 1SL0B 3VI7A 3LEFA 2PMTA 5JCWA 4JRRA 5F05A 3CYNA 4JZQA 3BBYA 4YQUA 1NHOA 3ZREA 1E6BA 1O73A 1A2JA 3RHCA 5B8BA 1K0AA 3KM6A 3O76A 2ES7A 3MSZA 1PKZA 3FRCA 1HNBA 2BMXA 3G7YA 3LORA 1OE8A 4X1UA 1M7TA 3APQA 3MYDA 1TI1A 2PU9C 2PUKC 4MPGA 4AF2A 4ZB6A 2VD1A 2RUFA 1URMA 3GKMA 3IPZA 2TRXA 3TJBA 4PUAA 5J4UA 11GSA 1A24A 1SKWB 1Q98A 18GSA 2OE0A 2XBQA 3E3EA 2WDUA 4EXJA 3P8WA 5H5QA 2DBCA 1GNWA 2PPTA 1FB6A 1X0RA 3G7JA 2H75A 1GH2A 1B8XA 2JZTA 4GQCA 4CW9A 1FVKA 1I5GA 3D4MA 2XPEA 1UVZA 2X4AA 5HR2A 3KMNA 1VRSD 1TXXA 2MMNA 2J9HA 1EP8A 2DJ1A 3L78A 4KGIA 4HJMA 1T4YA 3D5JA 4G0IA 2AYTA 3VLNA 2M80A 4WBJA 1RQMA 1TRUA 5D96A 5IMDA 3DD3A 2VOCA 1GSUA 3F3QA 2P5QA 5CRDA 3BCKA 1HNAA 4K0NA 4ZL9A 1QMVA 2DKIA 4Q5NA 1CQHA 3KH7A 4K8MA 3EU3A 1SKSB 2YWMA 4NAXA 4Q5QA 1VGLA 2EIQA 3ZYWA 5DJMA 1SL1B 4K5RA 3TKRA 2IMEA 1EEJA 4FQUA 3KMOA 3HD5A 4GSNA 3W8JA 5AGYA 3GX8A 1G7OA 1ZYPA 3F6DA 1DE1A 1EGOA 4MF5A 3F3RA 2OACA 4O32A 4BL7A 3AY8A 1GTBA 3ZFBA 2H01A 2RUEA 3KEBA 4I8BA 4TN8A 2HSMA 3TJJA 1J9BA 1WPIA 4HEA2 4DSQA 2CVBA 3FHKA 2HSYA 1E2YA 6GSUA 3ZFLA 2LS5A 1X9MB 1ZMAA 3GIXA 1WE0A 2GQMA 1OAZA 2A2RA 2JU5A 4IW9A 4MF6A 1AW9A 3Q19A 3UVHA 1EOGA 2K6VA 1XPVA 3VPTA 1PX6A 2GDRA 2FA8A 2DJKA 5IPHA 2FWFA 2YPMA 4MZBA 2LSTA 4MNNA 4O5QA 3TRPA 2IFQB 1KEBA 4POLA 2C3TA 1SK1A 2H6YA 3TKSA 3EMPA 4O5UA 1F9MA 2X99A 1GTAA 1M0UA 1SJ6A 3PGTA 5AIVA 2IL3A 1EEMA 5C00A 4LMVA 1OYJA 3RPNA 4MH3A 3S9FA 1YQ1A 1H4OA 1J08A 1QQ2A 1YF0A 2WZ9A 1DUGA 3IA1A 2FD3A 3U5RE 1GTIA 3L9VA 3QR6A 3UBKA 5G30A 2YV7A 1Y25A 2GVPA 3IC4A 2TIRA 2IWTA 4RI6A 4XRAA 4IS0A 2PVOC 1ZL9A 2KUCA 2L59A 7GSSA 3M0FA 4XTSA 4L5OA 5FHIA 3M1GA 4KSOA 1I9DA 2H66A 3IHQA 3FR6A 2GT6A 3LJRA 4IJIA 1O85A 4KW6A 1S3CA 2O89A 5KN0A 1TU8A 1MD4A 2LRCA 2C0EA 5DJLA 2WULA 3FYGA 1GWCA 3LG6A 2HI7A 1XIYA 3PPUA 4O92A 2I9HA 5IMFA 1SJZA 2HSHA 2LJRA 2H74A 1G0TA 4USSA 3K8NA 3W8SA 1YEXA 2H6XA 1FO5A 4WXTA 3LSZA 4G10A 1FOVA 1OC9B 2YV9A 1F3AA 1M99A 4MMMA 4OFTA 1MDJA 1ILOA 4V1Ag 5IO2A 1M9AA 1M9BA 1TK0B 2AHEA 4LL1B 5G5EA 5J5NA 3BD2A 2LNTA 4MP4A 1GLQA 4V2NA 2M46A 2C0FA 3HVSA 3NOFA 2LV3A 2FWGA 5JCGA 3GFKA 3L0HA 1V9WA 2H0GA 2AV4A 2XPDA 3BJ5A 2OE3A 2HLSA 4HQZA 1PSQA 2HT9A 2QC7A 5JWQB 3M8NA 4IN0A 4NV2A 2PBJA 1F6MC 2MYGA 3GMFA 4X4JA 3MNGA 1SYRA 3FEUA 2I1UA 2DJJA 4TOPA 1OKTA 5A4VA 3LW9A 2OBKA 3Q6OA 14GSA 1Z9HA 1DBYA 1F2EA 2YCDA 4XHMA 5A4WA 5ECQB 1ZCPA 3SWLA 3GKXA 6GSSA 1PN0A 2BJXA 4KCAA 3EC3A 4F0CA 3TRXA 2O85A 3TGZA 4XIHA 1YKAA 5CP1A 1T7PB 4GLTA 2GQLA 2IN3A 1ML6A 4FO5A 5COHA 1Z3EA 4EL1A 4POMA 3PINA 4CHSA 4LA1A 1LU4A 2GSRA 3J7Yk 3ERFA 1OC3A 2KP1A 2X8HA 3GX0A 2XHFA 3TUEA 1G6YA 2N5BA 4I5QA 2H30A 2DJ0A 4I2TA 4I6XA 4K5SA 5IQYA 4ECJA 4JEDA 3GSSA 2H72A 4KB3A 3QOUA 5EY6A 4PXOA 2NDOA 3N5OA 3F6FA 2CZ2A 3QAWA 1SL2B 2YZUA 1GSSA 4K0GA 2MMAA 3O6TA 2YJ7A 5D9XA 5KN3A 1TTZA 2YWIA 3APOA 2B5EA 5ABRA 5LCZA 3N9JA 5B7CA 3D22A 3GHAA 1C72A 1PGTA 4IVFA 5D93A 3IXRA 3EVIA 4J56E 3GURA 3IE3A 1GSFA 3UL3A 2LRNA 3GH9A 4Q5FA 4YAPA 4NPBA 5CAXA 4GCIA 1UC7A 4J57E 4V2MA 5INYA 2B3SA 4YKFA 2GTUA 2K8VA 4I2UA 1IYHA 1G6WA 2L4CA 1PN9A 3HY2A 2R2JA 2H70A 5D9TA 1WIKA 2CAQA 4HOJA 4KUNA 5DCHA 2GSSA 3IC8A 4ZBDA 2IMDA 3MWHA 2R3XA 3BOAA 5DBQA 1PL1A 1NW2A 2DLXA 4BL7B 1YJ6A 3GL3A 5A5KA 2H8LA 1ST9A 5ECPB 4NHZA 4XS4B 1TI3A 4OO4A 4A5PA 1AXDA 1O8WA 4IQAA 5LNKe 4FYBA 1ERUA 1JZRA 3IBHA 6GSTA 3TKSC 1M2DA 5ECMB 5D8IA 4TXOB 1Z7RA 1TOFA 1QUWA 3HJOA 4PQIA 2DIYA 5G1LA 4DSRA 1W89A 2A4HA 3RDWA 3VPQA 4IBPA 1ERVA 4G19A 4KA0A 2VCVA 4FH8A 1X5CA 22GSA 4ACSA 2WJUA 3ZITA 4YQMA 4NMUA 3VWXA 4GSTA 2EIOA 4K9ZA 4K7IA 4OCEA 1RW1A 4GF0A 1XOBA 4KX4A 3LYPA 1TK5B 1AQVA 1THOA 2H1DA 6GSVA 3KTLA 2LEGA 4KAEA 4HZ4A 2L6CA 2DMMA 3NZNA 4JR4A 3CSIA 2G0FA 2DJ3A 4IJ3A 1A8LA 3GV1A 3F4TA 3BCIA 4E8EA 4Z2TA 2P5RA 4N10A 4ML1A 4HQSA 5H5SA 4X0XA 2E0QA 1XWGA 5ELAA 2QGVA 3A3TA 3WGXA 2GZZA 1B9XC 3EMXA 5IO0A 4CY6A 5HFIA 3GSTA 1HYUA 2AUVA 1SKRB 2WS2A 3F0IA 4HI7A 1PD21 4RQXA 1PL2A 1Z6MA 4N0VA 4EVMA 3GTUA 2YWNA 1V40A 3VWWA 1XWKA 2D2ZA 5CRGA 1LBKA 2VCXA 3VI5A 2C8UA 4X43A 2C3QA 5D9VA 5FT3A 1JZDA 2K9FA 2PN8A 2C0GA 1MDIA 3VWUA 4KNDA 3HZ4A 2B5YA 3I69A 3P90A 1ZOFA 1ACVA 3CTFA 3LWAA 3QDNA 3Q18A 5ECSA 2P31A 3SBCA 4DEJA 8GSSA 1Q4JA 2V2GA 2EIRA 2KLXA 3CMIA 1WP0A 4ZB9A 3KZQA 3PR8A 4JBBA 4WR4A 2VCQA 5IMCA 3CSHA 3KH9A 1XZOA 5D9WA 4EDYA 2H0IA 2JL4A 1GLPA 1AAZA 3JCML 1T1VA 1K3LA 3DWVA 5DAKA 3TKPA 4D73A 1GSYA 3MDKA 3NIVA 5KEJA 1WOUA 3CSJA 1A2MA 5IPGA 2RLIA 3ZMKA 5CO3A 3H8QA 3I43A 2LUSA 4XS1A 2VUPA 5B6MA 2NPBA 3ED3A 3WT1A 5IIZA 2CVKA 5B6NA 4LLRA 5JCUA 2DJ2A 3FZ5A 4TRXA 4OFNA 2H1BA 2JADA 4ID0A 4YKGA 3A2VA 2HZFA 4BWSA 4JR6A 5DDLA 3GN3A 2V41A 1BQ7A 2VCWA 1XFLA 3LQ7A 3E0UA 4FYCA 2V6KA 4TXVA 1HD2A 1U88A 2OADA 1AIUA 3GKNA 2PWJA 1GL8A 2VD0A 1JLVA 4ECIA 2A2SA 2NBSA 3GUSA 5E59A 1BX9A 1AQWA 5GSSA 2PGTA 4K1FA 2CV4A 1ERWA 6GSWA 3LFLA 2CA8A 4XS6A 2VLVA 1YZXA 1K3OA 3HJPA 5HR1A 1TU7A 1EV9A 2YN1A 3F4SA 1X5EA 4F2IA 1S3DA 4O7HA 5GZZB 3C8EA 1NSWA 4KH7A 4IGJA 1SU9A 2LRTA 20GSA 1WWJA 4DSSA 3GL5A 3EINA 4PX1A 1N2AA 2L6DA 3HVXA 4OCFA 3KD0A 2IMKA 1EZKA 4V2LA 4G2EA 2F8AA 1O8XA 2B1KA 2HYXA 1EWXA 3GNJA 4PNGA 2REMA 1QFNA 3UBLA 16GSA 5JWOB 2F8FA 4IQ1A 5D73A 4BVYA 2N5AA 2GZPA 2MZCA 4PGTA 3ME8A 4L0WA 4NV5A 6GSYA 2H6ZA 2DC5A 3HHVA 3RPPA 4TVEA 2QA2A 3CBUA 3D21A 4Z2RA 4WEYA 4N0ZA 2AAWA 3L9UA 4N11A 2ZNMA 4HJ2A 4G9HA 5KN1A 2HRNA 2C3NA 1O81A 1YKCA 2X64A 4PQHA 4LMWA 4KF9A 1K0DA 2FLSA 1R5PA 1XBSA 3DRNA 3FK8A 2ZCTA 3TKSE 3CTGA 4ZL8A 4WKWA 1G7EA 3GKKA 1Y6EA 4NXIA 4MK3A 3KXOA 1BAYA 4O5RA 5BMUA 1U87A 3J7Yb 5ID2A 2FNOA 2LNSA 1WMJA 4JE1A 2I4AA 2GGTA 3ERGA 2L57A 5G2ZA 4POBA 1MTCA 5G5FA 1K0NA 4OFMA 4MJCA 4IKHA 2ON7A 3ZL5A 1JLWA 3ME7A 5CRWA 3EE2A 3I6AA 2TRCP 2WRTA 3HVVA 2WCIA 1ERTA 3CRTA 1X9SB 2H76A 1GRXA 2PVQA 4OO5A 1BYEA 1PKWA 4F82A 1XW6A 3ZLPA 2O8VB 4K7OA 1EGRA 2V1MA 4MJAA 4MJBA 1NHYA 2VL3A 3ZIJA 4K6XA 1B4PA 1GTUA 4TR1A 4Z2UA 3GA4A 2WGRA 5G1KA 2WFCA 4KE3A 2HRAA 2YZHA 2B5XA 4EC0A 1U3AA 5HR0A 1KTEA 3RBTA 13GSA 1XWAA 2HXKA 3UARA 2CAIA 5ELGA 2B1LA 2ALBA 5IMAA 5IOXA 1F3BA 2H1GA 1FW1A 1MDKA 3DKSA 2R5GA 3TDGA 1PX7A 4PQ1A 5IMZA 3DGQA 2VCTA 3LXZA 2LJAA 3DXBA 3EU4A 3O3TA 2KHPA 3EPTA 4EKZA 3ZTLA 2AB6A 2CX3A 3FZ4A 3KTBA 3C73A 2RM6A 4ULXA 4E8HA 1USBA 4PUFC 5FWGA 3FR3A 3EURA 3HA9A 3L9SA 4Q5RA 2VO4A 2LQOA 1A0FA 4CDOA 3IRAA 4MPFA 2IMIA 2P0GA 4ZILA 4Z7XA 4P3YB 4ZBAA 2V6OA 1OKDA 3GTUB 2FWHA 4KDYA 1LJRA 1OC9A 4NWYA 10GSA 1V58A 3QAVA 1SJIA 3LXTA 1ABAA 3G7IA 4BA7A 1K3YA 2GZYA 4JU5A 1EP7A 2I81A 5J3RA 4ZBBA 3U6VA 2VL2A 2JZSA 3ZRDA 1T8EB 3WT2A 3VWVA 1U3IA 19GSA 2LJKA 5DVBA 3G9BA 1B9YC 2CT6A 3GYKA 4ECBA 5CYYA 5L71A 1TDIA 2L4QA 1K0MA 2JZRA 3QAGA 1N8JA 4F9ZA 4BVXA 4XRDA 1BJXA 5KOXA 3UIWA 5KN2A 2IPAA 2QA1A 2OJLA 1SK0A 4D73B 2A4VA 3A5WA 4KDXA 1O7UA 5F07A 2KOKA 3EYTA 1UN2A 1QXHA 3A5IA 1K0CA 2CX4A 4QL9A 3ERWA 3M9KA 4BWQA 1GULA 2YWOA 2HE3A 1TRWA 4MABA 3IR4A 2Z9SA 2FUG2 4MF7A 2C80A 1A23A 4POKA 1FHEA 9GSSA 2JACA 1FAAA 1XWCA 1ON4A 2V32A 3HXSA 4FIWA 5AN1A 5DALA 2GQKA 4WR5A 2X49A 1JHBA 2F9SA 2XC2A 3TKQA 1AQXA 5IOWA 3D4TA 4K7NA 3CRUA 4HUAA 3C7MA 1GNEA 2H73A 1T3BA 3ZMLA 1XW9A 3HYPA 1ZYQB 1JFUA 3M3MA 3VURA 2QSIA 5F06A 4YH2A 4IP6A 2HRFA 3US3A 5ECKB 2X8CA 3EWLA 1TRSA 3UVTA 2VLUA 2HRKA 2PERA 3D0ZA 4XCSA 2VAFA 1T4ZA 1GUHA 2DIZA 1FB0A 3GH6A 2JSYA 3DEXA 2VM2A 4EDZA 2HZEA 2YOIA 4DSSB 5ECLB 3R2QA 3VK9A 3KGKA 1YDKA 2C1YA 2FGXA 3MIXA 1A8YA 4HU7A 1YF1A 1SD8A 3HCZA 3TOUA 1VF3A 4G0KA 4MJEA 3F63A 1TRVA 2H0HA 4ZL7A 3IAS2 1MD3A 1TW9A 4BVYB 1B48A 1GP1A 3TRQA 2M72A 3IOSA 2R37A 2L5LA 1R7HA 3IDVA 3FZ9A 3F8UA 2IIYA 1RK4A 4HU9A 4IHUA 1GSQA 4HZ2A 4ILFA 3QPMA 4PTSA 2RIIA 5GSTA 2MBSA 4XS4A 5F8BA 2R0CA 4YAVA 3WGDA 1DE2A 3OR5A 2MMZA 2OE1A 3DIEA 3DVXA 2VIMA 3UJ1A 4GXZA 4TXOA 3DMLA 2O87A 2B6MA 1XVQA 5ECRB 4AGSA 4MA9A 1M2AA 4IELA 2C4JA 5AISA 4L8EA 3P7XA 3A2XA 3LGCA 3RHBA 5ID2B 2FA4A 3ISOA 1ZZYA 2QKEA 4F0BA 3FKFA 3C1SA 2DKHA 2K18A 1FVJA 4K2XA 2JSZA 3WD6A 2CQ9A 3WGEA 2CZ3A 2I3YA 4ZXGA 2GT5A 6GSXA 1QK8A 1HQOA 2DMLA 5KOWA 4ISDA 1ZGNA 4PNFA 2HFDA 2GSTA 4ML6A 1V98A 4YQVA 5HFGA 1GSEA 3TB2A 2E7PA 2CVDA 4MZCA 2YJHA 3IHGA 4TKYA 4WF5A 3D6IA 4LL4B 4ZB8A 17GSA 2G2QA 4RI7A 1OC8A 3KP8A 2VL9A 5DQYA 1KNGA 5ECHB 4N30A 12GSA 1EV4A 4TR1B 4TR3A 3KJYA 1TJDA 2R6KA 5G31A 1IYIA 4NHWA 1CQGA 2NTOA 1V57A 2F51A 1PQNA 1YEPA 3WYWA 5F0GA 3KCMA 2R4VA 4FYUA 1O6JA 5HFKA 4HDEA 3UOMA 1F37A 1SENA 5AIXA 1SYXA 3KIJA 2FY6A 3UEMA 1GUKA 1JZWA 3Q74A 4L0UA 1T00A 1S3AA 2E2MA 4TR4A 2VCZA 1M2BA 1YY7A 2R0PA 5DCGA 2YANA 4KCEA 3QD9A 5IM9A 1XCCA 3CXGA 1J0FA 3UMAA 3VFIA 2H1AA 4BPYA 4MLYA 1K0BA 2VL2C 1U6TA 1W4VA 2X8GA 4QQ7A 5ECIB 3QCPA 4MDCA 2WB9A 5CNWA 1FOHA 4F03A 4TW5A 3RAZA 4ZIJA 4GTUA 1XWBA 1UA5A 1H75A 1PA3A 2IMFA 1XVWA 1R26A 3HZ8A 4MCUA 4EF0A 5A4UA 2YP6A 2K8SA 3UAPA 2H19A 4H86A 3F9UA 4PURA 1TP9A 3FR9A 1NM3A 2E2GA 1V2AA 4DVCA 1BEDA 3H93A 1THXA 1OE7A 2B7KA 1TK8B 1XXUA 1VF2A 4ICYA 3L4NA 3P2AA 2B7JA 3LYKA 2FWEA 2IJYA 4J2FA 1EOHA 4EIQA 4HS1A 5HR3A 2IFQA 3PH9A 1OVNA 4BVXB 1HNCA 3H1NA 4CY8A 2GLRA 2XBIA 4GQFA 2A2PA 3TJKA 4EE0A 1XW5A 2KP2A 2FHEA 4GRFA 3TJFA 1Z5YE 3E9JB 2OKAA 4K2DA 2HNLA 1ZYEA 4IP1A 5B8AA 5EPFA 4RQRA 1A2LA 2FCHA 1GUMA 1R4WA 5H5RA 3QFBC 4I97A 2DSAA 4WF4A 5GAND 3IK7A 3V1WA 3DVWA 2C0DA 1X5DA 3C1RA 2F3MA 5J9CA 2MBTA 5E4WA 4TR0A 5ECNB 1FG4A 3TOTA 2J23A 5DALB 2R0GA 3MAKA 3FMWA 1A0RP 3FZAA 4L5LA 1MEKA 1DSBA 5EL8A 3HJMA 3DYRA 1Z7PA 2GS3A 1KBNA 2GSQA 2MMOA 2YNXA 3IK9A 1QGVA 3FY7A 1Z6NA 1TKDB 4GSSA 4G0LA 1WJKA 1R5AA 3C71A 4V1Ap 2L5OA 2UZ8A 3HKRA 5HQPA 2LTKA 2OA7A 4EIPA 1B4QA 3IV4A 3QMXA 3IAM2 2O7KA 5ECOB 5LD0A 3TJGA 1X9WB 2VM1A 3KP9A 1JZOA 5IMVA 3M9JA 5JWRB 4MH2A 1SD9A 4MZWA 4KSMA 3F4RA 4ECCA 3ZZXA 2ZUPA 3H4KA 4EO3A 1PMTA 2RM5A 5ENUA 2AJQB 2ON5A 1AC1A 1SK2A 1VF4A 2HZEB 5CRHA 3GRXA 4WBRD 4AJ8A 3I9V2 5BRTA 2LKUA 5J9BA 3TCOA 2LQQA 4GWRA 2OBIA 4OMVA 2BTOT 5CREA 3ZVJD 1K0OA 4AJ6A 4WETA 3FW2A 5C04A 1WRYA 1ZYNA 3A2WA 2N5FA 4KDUA 1VF1A 4OWYA 5J41A 1AUCA 4AJ7A 5DQSA 3W6GA 2NVLA 4EUYA 3R3EA 4QL7A 3H79A 3QFAC 2EC4A 1BG5A 3ZIVA 5GAPD 2H71A 5EVOA 4OD7A 3HDCA 1XOAA 5DAKB 2VLTA 3ZVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRX A;  4RUV A;  1GSD A;  3APS A;  1SL0 B;  3VI7 A;  3LEF A;  2PMT A;  5JCW A;  4JRR A;  5F05 A;  3CYN A;  4JZQ A;  3BBY A;  4YQU A;  1NHO A;  3ZRE A;  1E6B A;  1O73 A;  1A2J A;  3RHC A;  5B8B A;  1K0A A;  3KM6 A;  3O76 A;  2ES7 A;  3MSZ A;  1PKZ A;  3FRC A;  1HNB A;  2BMX A;  3G7Y A;  3LOR A;  1OE8 A;  4X1U A;  1M7T A;  3APQ A;  1TI1 A;  2PU9 C;  2PUK C;  4MPG A;  4AF2 A;  4ZB6 A;  2VD1 A;  2RUF A;  1URM A;  3GKM A;  3IPZ A;  2TRX A;  3TJB A;  4PUA A;  5J4U A;  11GS A;  1A24 A;  1SKW B;  1Q98 A;  18GS A;  2OE0 A;  2XBQ A;  3E3E A;  2WDU A;  4EXJ A;  3P8W A;  5H5Q A;  2DBC A;  1GNW A;  2PPT A;  1FB6 A;  1X0R A;  3G7J A;  2H75 A;  1GH2 A;  1B8X A;  2JZT A;  4GQC A;  4CW9 A;  1FVK A;  1I5G A;  3D4M A;  2XPE A;  1UVZ A;  5HR2 A;  3KMN A;  1VRS D;  1TXX A;  2MMN A;  2J9H A;  1EP8 A;  2DJ1 A;  3L78 A;  4KGI A;  4HJM A;  1T4Y A;  3D5J A;  2AYT A;  3VLN A;  2M80 A;  4WBJ A;  1RQM A;  1TRU A;  5D96 A;  5IMD A;  3DD3 A;  2VOC A;  1GSU A;  3F3Q A;  2P5Q A;  5CRD A;  3BCK A;  1HNA A;  4K0N A;  4ZL9 A;  1QMV A;  4Q5N A;  1CQH A;  3KH7 A;  4K8M A;  3EU3 A;  1SKS B;  2YWM A;  4NAX A;  4Q5Q A;  1VGL A;  2EIQ A;  3ZYW A;  5DJM A;  1SL1 B;  3TKR A;  2IME A;  1EEJ A;  3KMO A;  3HD5 A;  4GSN A;  3W8J A;  5AGY A;  3GX8 A;  1G7O A;  3F6D A;  1DE1 A;  1EGO A;  4MF5 A;  3F3R A;  2OAC A;  4O32 A;  4BL7 A;  3AY8 A;  1GTB A;  3ZFB A;  2H01 A;  2RUE A;  3KEB A;  4I8B A;  4TN8 A;  3TJJ A;  1J9B A;  1WPI A;  4HEA 2;  4DSQ A;  2CVB A;  3FHK A;  2HSY A;  1E2Y A;  6GSU A;  3ZFL A;  2LS5 A;  1X9M B;  1ZMA A;  3GIX A;  1WE0 A;  2GQM A;  1OAZ A;  2A2R A;  2JU5 A;  4IW9 A;  4MF6 A;  1AW9 A;  3Q19 A;  3UVH A;  1EOG A;  2K6V A;  1XPV A;  3VPT A;  1PX6 A;  2GDR A;  2FA8 A;  2DJK A;  5IPH A;  2FWF A;  2YPM A;  4MZB A;  2LST A;  3TRP A;  2IFQ B;  1KEB A;  4POL A;  2C3T A;  1SK1 A;  2H6Y A;  3TKS A;  3EMP A;  1F9M A;  2X99 A;  1GTA A;  1M0U A;  1SJ6 A;  3PGT A;  5AIV A;  2IL3 A;  1EEM A;  5C00 A;  4LMV A;  1OYJ A;  3RPN A;  4MH3 A;  3S9F A;  1YQ1 A;  1H4O A;  1J08 A;  1QQ2 A;  1YF0 A;  2WZ9 A;  1DUG A;  3IA1 A;  2FD3 A;  3U5R E;  1GTI A;  3L9V A;  3QR6 A;  3UBK A;  5G30 A;  2YV7 A;  1Y25 A;  2GVP A;  3IC4 A;  2TIR A;  2IWT A;  4RI6 A;  4XRA A;  4IS0 A;  2PVO C;  1ZL9 A;  2KUC A;  2L59 A;  7GSS A;  3M0F A;  4XTS A;  4L5O A;  5FHI A;  3M1G A;  4KSO A;  1I9D A;  2H66 A;  3IHQ A;  3FR6 A;  2GT6 A;  3LJR A;  4IJI A;  1O85 A;  4KW6 A;  1S3C A;  2O89 A;  5KN0 A;  1TU8 A;  1MD4 A;  2LRC A;  2C0E A;  5DJL A;  2WUL A;  3FYG A;  1GWC A;  3LG6 A;  2HI7 A;  1XIY A;  4O92 A;  2I9H A;  5IMF A;  1SJZ A;  2HSH A;  2LJR A;  2H74 A;  1G0T A;  3K8N A;  3W8S A;  1YEX A;  2H6X A;  1FO5 A;  4WXT A;  3LSZ A;  4G10 A;  1FOV A;  1OC9 B;  2YV9 A;  1F3A A;  1M99 A;  4MMM A;  4OFT A;  1MDJ A;  1ILO A;  4V1A g;  5IO2 A;  1M9A A;  1M9B A;  1TK0 B;  2AHE A;  4LL1 B;  5G5E A;  5J5N A;  3BD2 A;  2LNT A;  4MP4 A;  1GLQ A;  4V2N A;  2M46 A;  2C0F A;  3HVS A;  3NOF A;  2LV3 A;  2FWG A;  5JCG A;  3GFK A;  3L0H A;  1V9W A;  2H0G A;  2AV4 A;  2XPD A;  3BJ5 A;  2OE3 A;  2HLS A;  4HQZ A;  1PSQ A;  2HT9 A;  2QC7 A;  5JWQ B;  3M8N A;  4IN0 A;  4NV2 A;  2PBJ A;  1F6M C;  2MYG A;  3GMF A;  3MNG A;  1SYR A;  3FEU A;  2I1U A;  2DJJ A;  4TOP A;  1OKT A;  5A4V A;  2OBK A;  3Q6O A;  14GS A;  1Z9H A;  1DBY A;  1F2E A;  2YCD A;  4XHM A;  5A4W A;  5ECQ B;  1ZCP A;  3SWL A;  3GKX A;  6GSS A;  2BJX A;  4KCA A;  3EC3 A;  4F0C A;  3TRX A;  2O85 A;  3TGZ A;  4XIH A;  1YKA A;  5CP1 A;  1T7P B;  4GLT A;  2GQL A;  2IN3 A;  1ML6 A;  4FO5 A;  5COH A;  1Z3E A;  4EL1 A;  4POM A;  3PIN A;  4CHS A;  4LA1 A;  1LU4 A;  2GSR A;  3J7Y k;  3ERF A;  1OC3 A;  2KP1 A;  2X8H A;  3GX0 A;  2XHF A;  3TUE A;  1G6Y A;  2N5B A;  4I5Q A;  2H30 A;  2DJ0 A;  4I2T A;  4I6X A;  5IQY A;  4ECJ A;  4JED A;  3GSS A;  2H72 A;  4KB3 A;  3QOU A;  5EY6 A;  4PXO A;  2NDO A;  3N5O A;  3F6F A;  2CZ2 A;  3QAW A;  1SL2 B;  2YZU A;  1GSS A;  4K0G A;  2MMA A;  3O6T A;  2YJ7 A;  5D9X A;  5KN3 A;  1TTZ A;  2YWI A;  3APO A;  2B5E A;  5ABR A;  5LCZ A;  3N9J A;  5B7C A;  3D22 A;  3GHA A;  1C72 A;  1PGT A;  4IVF A;  5D93 A;  3IXR A;  3EVI A;  4J56 E;  3GUR A;  3IE3 A;  1GSF A;  3UL3 A;  2LRN A;  3GH9 A;  4Q5F A;  4YAP A;  4NPB A;  5CAX A;  4GCI A;  1UC7 A;  4J57 E;  4V2M A;  5INY A;  2B3S A;  2GTU A;  2K8V A;  4I2U A;  1IYH A;  1G6W A;  2L4C A;  1PN9 A;  3HY2 A;  2R2J A;  2H70 A;  5D9T A;  1WIK A;  2CAQ A;  4HOJ A;  4KUN A;  5DCH A;  2GSS A;  4ZBD A;  2IMD A;  3MWH A;  2R3X A;  3BOA A;  5DBQ A;  1PL1 A;  1NW2 A;  2DLX A;  1YJ6 A;  3GL3 A;  5A5K A;  2H8L A;  1ST9 A;  5ECP B;  4NHZ A;  4XS4 B;  1TI3 A;  4OO4 A;  1AXD A;  1O8W A;  4IQA A;  5LNK e;  4FYB A;  1ERU A;  1JZR A;  3IBH A;  6GST A;  3TKS C;  1M2D A;  5ECM B;  5D8I A;  4TXO B;  1Z7R A;  1TOF A;  1QUW A;  3HJO A;  4PQI A;  2DIY A;  5G1L A;  4DSR A;  1W89 A;  3RDW A;  3VPQ A;  4IBP A;  1ERV A;  4G19 A;  4KA0 A;  2VCV A;  4FH8 A;  1X5C A;  22GS A;  4ACS A;  2WJU A;  3ZIT A;  4YQM A;  4NMU A;  3VWX A;  4GST A;  2EIO A;  4K9Z A;  4K7I A;  4OCE A;  1RW1 A;  4GF0 A;  1XOB A;  4KX4 A;  3LYP A;  1TK5 B;  1AQV A;  1THO A;  2H1D A;  6GSV A;  3KTL A;  2LEG A;  4KAE A;  4HZ4 A;  2L6C A;  2DMM A;  3NZN A;  4JR4 A;  3CSI A;  2G0F A;  2DJ3 A;  4IJ3 A;  1A8L A;  3GV1 A;  3F4T A;  3BCI A;  4E8E A;  2P5R A;  4N10 A;  4ML1 A;  4HQS A;  5H5S A;  4X0X A;  2E0Q A;  1XWG A;  5ELA A;  2QGV A;  3A3T A;  3WGX A;  2GZZ A;  1B9X C;  3EMX A;  5IO0 A;  5HFI A;  3GST A;  1HYU A;  2AUV A;  1SKR B;  2WS2 A;  3F0I A;  4HI7 A;  1PD2 1;  4RQX A;  1PL2 A;  1Z6M A;  4N0V A;  4EVM A;  3GTU A;  2YWN A;  1V40 A;  3VWW A;  1XWK A;  2D2Z A;  5CRG A;  1LBK A;  2VCX A;  3VI5 A;  2C8U A;  4X43 A;  2C3Q A;  5D9V A;  5FT3 A;  1JZD A;  2K9F A;  2PN8 A;  2C0G A;  1MDI A;  3VWU A;  4KND A;  3HZ4 A;  2B5Y A;  3I69 A;  3P90 A;  1ZOF A;  1ACV A;  3CTF A;  3LWA A;  3QDN A;  3Q18 A;  5ECS A;  2P31 A;  3SBC A;  4DEJ A;  8GSS A;  1Q4J A;  2V2G A;  2EIR A;  2KLX A;  3CMI A;  1WP0 A;  4ZB9 A;  3KZQ A;  3PR8 A;  4JBB A;  4WR4 A;  2VCQ A;  5IMC A;  3CSH A;  3KH9 A;  1XZO A;  5D9W A;  4EDY A;  2H0I A;  2JL4 A;  1GLP A;  1AAZ A;  3JCM L;  1T1V A;  1K3L A;  3DWV A;  5DAK A;  3TKP A;  4D73 A;  1GSY A;  3MDK A;  3NIV A;  5KEJ A;  1WOU A;  3CSJ A;  1A2M A;  5IPG A;  2RLI A;  3ZMK A;  5CO3 A;  3H8Q A;  3I43 A;  2LUS A;  4XS1 A;  2VUP A;  5B6M A;  2NPB A;  3ED3 A;  3WT1 A;  5IIZ A;  2CVK A;  5B6N A;  4LLR A;  5JCU A;  2DJ2 A;  3FZ5 A;  4TRX A;  4OFN A;  2H1B A;  2JAD A;  4ID0 A;  3A2V A;  2HZF A;  4BWS A;  4JR6 A;  5DDL A;  3GN3 A;  2V41 A;  1BQ7 A;  2VCW A;  1XFL A;  3LQ7 A;  3E0U A;  4FYC A;  2V6K A;  4TXV A;  1HD2 A;  1U88 A;  2OAD A;  1AIU A;  3GKN A;  2PWJ A;  1GL8 A;  2VD0 A;  1JLV A;  4ECI A;  2A2S A;  2NBS A;  3GUS A;  5E59 A;  1BX9 A;  1AQW A;  5GSS A;  2PGT A;  4K1F A;  2CV4 A;  1ERW A;  6GSW A;  3LFL A;  2CA8 A;  4XS6 A;  2VLV A;  1YZX A;  1K3O A;  3HJP A;  5HR1 A;  1TU7 A;  1EV9 A;  2YN1 A;  3F4S A;  1X5E A;  4F2I A;  1S3D A;  4O7H A;  5GZZ B;  3C8E A;  1NSW A;  4KH7 A;  4IGJ A;  1SU9 A;  2LRT A;  20GS A;  1WWJ A;  4DSS A;  3GL5 A;  3EIN A;  4PX1 A;  1N2A A;  2L6D A;  3HVX A;  4OCF A;  3KD0 A;  2IMK A;  1EZK A;  4V2L A;  4G2E A;  2F8A A;  1O8X A;  2B1K A;  2HYX A;  1EWX A;  3GNJ A;  4PNG A;  2REM A;  1QFN A;  3UBL A;  16GS A;  5JWO B;  2F8F A;  4IQ1 A;  5D73 A;  4BVY A;  2N5A A;  2GZP A;  2MZC A;  4PGT A;  3ME8 A;  4L0W A;  4NV5 A;  6GSY A;  2H6Z A;  2DC5 A;  3HHV A;  3RPP A;  4TVE A;  3CBU A;  3D21 A;  4WEY A;  4N0Z A;  2AAW A;  3L9U A;  4N11 A;  2ZNM A;  4HJ2 A;  4G9H A;  5KN1 A;  2HRN A;  2C3N A;  1O81 A;  1YKC A;  2X64 A;  4PQH A;  4LMW A;  1K0D A;  2FLS A;  1R5P A;  1XBS A;  3DRN A;  3FK8 A;  2ZCT A;  3TKS E;  3CTG A;  4ZL8 A;  4WKW A;  1G7E A;  3GKK A;  1Y6E A;  4NXI A;  4MK3 A;  3KXO A;  1BAY A;  4O5R A;  1U87 A;  3J7Y b;  5ID2 A;  2FNO A;  2LNS A;  1WMJ A;  4JE1 A;  2I4A A;  2GGT A;  3ERG A;  2L57 A;  5G2Z A;  4POB A;  1MTC A;  5G5F A;  1K0N A;  4OFM A;  4MJC A;  4IKH A;  2ON7 A;  3ZL5 A;  1JLW A;  3ME7 A;  5CRW A;  3EE2 A;  3I6A A;  2TRC P;  2WRT A;  3HVV A;  2WCI A;  1ERT A;  3CRT A;  1X9S B;  2H76 A;  1GRX A;  2PVQ A;  4OO5 A;  1BYE A;  1PKW A;  4F82 A;  1XW6 A;  3ZLP A;  2O8V B;  4K7O A;  1EGR A;  2V1M A;  4MJA A;  4MJB A;  1NHY A;  2VL3 A;  3ZIJ A;  4K6X A;  1B4P A;  1GTU A;  4TR1 A;  3GA4 A;  2WGR A;  5G1K A;  2WFC A;  4KE3 A;  2YZH A;  2B5X A;  4EC0 A;  1U3A A;  5HR0 A;  1KTE A;  3RBT A;  13GS A;  1XWA A;  2HXK A;  3UAR A;  2CAI A;  5ELG A;  2B1L A;  2ALB A;  5IMA A;  5IOX A;  1F3B A;  2H1G A;  1FW1 A;  1MDK A;  3DKS A;  2R5G A;  3TDG A;  1PX7 A;  4PQ1 A;  5IMZ A;  3DGQ A;  2VCT A;  3LXZ A;  2LJA A;  3DXB A;  3EU4 A;  3O3T A;  2KHP A;  4EKZ A;  3ZTL A;  2AB6 A;  2CX3 A;  3FZ4 A;  3KTB A;  3C73 A;  2RM6 A;  4ULX A;  4E8H A;  1USB A;  4PUF C;  5FWG A;  3FR3 A;  3EUR A;  3HA9 A;  3L9S A;  4Q5R A;  2VO4 A;  2LQO A;  1A0F A;  4CDO A;  3IRA A;  4MPF A;  2IMI A;  2P0G A;  4ZIL A;  4Z7X A;  4P3Y B;  4ZBA A;  2V6O A;  1OKD A;  3GTU B;  2FWH A;  4KDY A;  1LJR A;  1OC9 A;  4NWY A;  10GS A;  1V58 A;  3QAV A;  1SJI A;  3LXT A;  1ABA A;  3G7I A;  4BA7 A;  1K3Y A;  2GZY A;  4JU5 A;  1EP7 A;  2I81 A;  5J3R A;  4ZBB A;  3U6V A;  2VL2 A;  2JZS A;  3ZRD A;  1T8E B;  3WT2 A;  3VWV A;  1U3I A;  19GS A;  2LJK A;  5DVB A;  3G9B A;  1B9Y C;  2CT6 A;  3GYK A;  4ECB A;  5CYY A;  5L71 A;  1TDI A;  2L4Q A;  1K0M A;  2JZR A;  3QAG A;  1N8J A;  4F9Z A;  4BVX A;  4XRD A;  1BJX A;  3UIW A;  5KN2 A;  2IPA A;  2OJL A;  1SK0 A;  4D73 B;  2A4V A;  3A5W A;  4KDX A;  1O7U A;  5F07 A;  2KOK A;  3EYT A;  1UN2 A;  1QXH A;  1K0C A;  2CX4 A;  4QL9 A;  3ERW A;  3M9K A;  4BWQ A;  1GUL A;  2YWO A;  2HE3 A;  1TRW A;  4MAB A;  3IR4 A;  2Z9S A;  2FUG 2;  4MF7 A;  2C80 A;  1A23 A;  4POK A;  1FHE A;  9GSS A;  2JAC A;  1FAA A;  1XWC A;  1ON4 A;  2V32 A;  3HXS A;  4FIW A;  5AN1 A;  5DAL A;  2GQK A;  4WR5 A;  1JHB A;  2F9S A;  2XC2 A;  3TKQ A;  1AQX A;  5IOW A;  3D4T A;  4K7N A;  3CRU A;  4HUA A;  3C7M A;  1GNE A;  2H73 A;  1T3B A;  3ZML A;  1XW9 A;  3HYP A;  1ZYQ B;  1JFU A;  3M3M A;  3VUR A;  2QSI A;  5F06 A;  4YH2 A;  4IP6 A;  2HRF A;  3US3 A;  5ECK B;  2X8C A;  3EWL A;  1TRS A;  3UVT A;  2VLU A;  2PER A;  3D0Z A;  4XCS A;  2VAF A;  1T4Z A;  1GUH A;  2DIZ A;  1FB0 A;  3GH6 A;  2JSY A;  3DEX A;  2VM2 A;  4EDZ A;  2HZE A;  2YOI A;  4DSS B;  5ECL B;  3R2Q A;  3VK9 A;  3KGK A;  1YDK A;  2C1Y A;  2FGX A;  1A8Y A;  4HU7 A;  1YF1 A;  1SD8 A;  3HCZ A;  3TOU A;  1VF3 A;  4MJE A;  3F63 A;  1TRV A;  2H0H A;  4ZL7 A;  3IAS 2;  1MD3 A;  1TW9 A;  1B48 A;  1GP1 A;  3TRQ A;  2M72 A;  3IOS A;  2R37 A;  2L5L A;  1R7H A;  3IDV A;  3FZ9 A;  3F8U A;  2IIY A;  1RK4 A;  4HU9 A;  4IHU A;  1GSQ A;  4HZ2 A;  4ILF A;  3QPM A;  2RII A;  5GST A;  2MBS A;  4XS4 A;  5F8B A;  4YAV A;  3WGD A;  1DE2 A;  3OR5 A;  2MMZ A;  2OE1 A;  3DIE A;  3DVX A;  2VIM A;  3UJ1 A;  4GXZ A;  4TXO A;  3DML A;  2O87 A;  2B6M A;  1XVQ A;  5ECR B;  4AGS A;  4MA9 A;  1M2A A;  4IEL A;  2C4J A;  5AIS A;  4L8E A;  3P7X A;  3A2X A;  3LGC A;  3RHB A;  5ID2 B;  2FA4 A;  3ISO A;  1ZZY A;  2QKE A;  4F0B A;  3FKF A;  3C1S A;  2K18 A;  1FVJ A;  3WD6 A;  2JSZ A;  2CQ9 A;  3WGE A;  2CZ3 A;  2I3Y A;  4ZXG A;  2GT5 A;  6GSX A;  1QK8 A;  1HQO A;  2DML A;  4ISD A;  1ZGN A;  4PNF A;  2HFD A;  2GST A;  4ML6 A;  1V98 A;  4YQV A;  5HFG A;  1GSE A;  3TB2 A;  2E7P A;  2CVD A;  4MZC A;  2YJH A;  4TKY A;  4WF5 A;  3D6I A;  4LL4 B;  4ZB8 A;  17GS A;  2G2Q A;  4RI7 A;  1OC8 A;  3KP8 A;  2VL9 A;  5DQY A;  1KNG A;  5ECH B;  4N30 A;  12GS A;  1EV4 A;  4TR1 B;  4TR3 A;  3KJY A;  1TJD A;  2R6K A;  5G31 A;  1IYI A;  4NHW A;  1CQG A;  2NTO A;  1V57 A;  2F51 A;  1PQN A;  1YEP A;  3WYW A;  5F0G A;  3KCM A;  2R4V A;  4FYU A;  1O6J A;  5HFK A;  4HDE A;  3UOM A;  1F37 A;  1SEN A;  5AIX A;  1SYX A;  3KIJ A;  2FY6 A;  3UEM A;  1GUK A;  1JZW A;  3Q74 A;  4L0U A;  1T00 A;  1S3A A;  2E2M A;  4TR4 A;  2VCZ A;  1M2B A;  1YY7 A;  5DCG A;  2YAN A;  4KCE A;  3QD9 A;  5IM9 A;  1XCC A;  3CXG A;  1J0F A;  3UMA A;  3VFI A;  2H1A A;  4BPY A;  4MLY A;  1K0B A;  2VL2 C;  1U6T A;  1W4V A;  2X8G A;  4QQ7 A;  5ECI B;  3QCP A;  4MDC A;  2WB9 A;  5CNW A;  4F03 A;  4TW5 A;  3RAZ A;  4ZIJ A;  4GTU A;  1XWB A;  1UA5 A;  1H75 A;  1PA3 A;  2IMF A;  1XVW A;  1R26 A;  3HZ8 A;  4MCU A;  4EF0 A;  5A4U A;  2YP6 A;  2K8S A;  3UAP A;  2H19 A;  4H86 A;  3F9U A;  4PUR A;  1TP9 A;  3FR9 A;  1NM3 A;  2E2G A;  1V2A A;  4DVC A;  1BED A;  3H93 A;  1THX A;  1OE7 A;  2B7K A;  1TK8 B;  1XXU A;  1VF2 A;  3L4N A;  3P2A A;  2B7J A;  3LYK A;  2FWE A;  2IJY A;  4J2F A;  1EOH A;  4HS1 A;  5HR3 A;  2IFQ A;  3PH9 A;  1OVN A;  1HNC A;  3H1N A;  2GLR A;  2XBI A;  4GQF A;  3TJK A;  4EE0 A;  1XW5 A;  2KP2 A;  2FHE A;  4GRF A;  3TJF A;  1Z5Y E;  3E9J B;  2OKA A;  4K2D A;  2HNL A;  1ZYE A;  4IP1 A;  5B8A A;  5EPF A;  4RQR A;  1A2L A;  2FCH A;  1GUM A;  1R4W A;  5H5R A;  3QFB C;  4I97 A;  2DSA A;  4WF4 A;  5GAN D;  3IK7 A;  3V1W A;  3DVW A;  2C0D A;  1X5D A;  3C1R A;  2F3M A;  5J9C A;  2MBT A;  5E4W A;  4TR0 A;  5ECN B;  1FG4 A;  3TOT A;  2J23 A;  5DAL B;  3MAK A;  1A0R P;  3FZA A;  4L5L A;  1MEK A;  1DSB A;  5EL8 A;  3HJM A;  3DYR A;  1Z7P A;  2GS3 A;  1KBN A;  2GSQ A;  2MMO A;  2YNX A;  3IK9 A;  1QGV A;  3FY7 A;  1Z6N A;  1TKD B;  4GSS A;  1WJK A;  1R5A A;  3C71 A;  4V1A p;  2L5O A;  3HKR A;  5HQP A;  2LTK A;  2OA7 A;  1B4Q A;  3IV4 A;  3QMX A;  3IAM 2;  2O7K A;  5ECO B;  5LD0 A;  3TJG A;  1X9W B;  2VM1 A;  3KP9 A;  1JZO A;  5IMV A;  3M9J A;  5JWR B;  4MH2 A;  1SD9 A;  4MZW A;  4KSM A;  3F4R A;  4ECC A;  3ZZX A;  2ZUP A;  3H4K A;  4EO3 A;  1PMT A;  2RM5 A;  5ENU A;  2AJQ B;  2ON5 A;  1AC1 A;  1SK2 A;  1VF4 A;  2HZE B;  5CRH A;  3GRX A;  4WBR D;  4AJ8 A;  3I9V 2;  2LKU A;  5J9B A;  3TCO A;  2LQQ A;  4GWR A;  2OBI A;  4OMV A;  2BTO T;  5CRE A;  3ZVJ D;  1K0O A;  4AJ6 A;  4WET A;  3FW2 A;  5C04 A;  1WRY A;  3A2W A;  2N5F A;  4KDU A;  1VF1 A;  4OWY A;  5J41 A;  1AUC A;  4AJ7 A;  5DQS A;  3W6G A;  2NVL A;  4EUY A;  4QL7 A;  3H79 A;  3QFA C;  2EC4 A;  1BG5 A;  3ZIV A;  5GAP D;  2H71 A;  5EVO A;  4OD7 A;  3HDC A;  1XOA A;  5DAK B;  2VLT A;  3ZVJ A; 
#chains in the Genus database with same CATH topology
 1PRX A;  4RUV A;  1GSD A;  3APS A;  1SL0 B;  3VI7 A;  3LEF A;  2PMT A;  5JCW A;  4JRR A;  5F05 A;  3CYN A;  4JZQ A;  3BBY A;  4YQU A;  1NHO A;  3ZRE A;  1E6B A;  1O73 A;  1A2J A;  3RHC A;  5B8B A;  1K0A A;  3KM6 A;  3O76 A;  2ES7 A;  3MSZ A;  1PKZ A;  3FRC A;  1HNB A;  2BMX A;  3G7Y A;  3LOR A;  1OE8 A;  4X1U A;  1M7T A;  3APQ A;  3MYD A;  1TI1 A;  2PU9 C;  2PUK C;  4MPG A;  4AF2 A;  4ZB6 A;  2VD1 A;  2RUF A;  1URM A;  3GKM A;  3IPZ A;  2TRX A;  3TJB A;  4PUA A;  5J4U A;  11GS A;  1A24 A;  1SKW B;  1Q98 A;  18GS A;  2OE0 A;  2XBQ A;  3E3E A;  2WDU A;  4EXJ A;  3P8W A;  5H5Q A;  2DBC A;  1GNW A;  2PPT A;  1FB6 A;  1X0R A;  3G7J A;  2H75 A;  1GH2 A;  1B8X A;  2JZT A;  4GQC A;  4CW9 A;  1FVK A;  1I5G A;  3D4M A;  2XPE A;  1UVZ A;  2X4A A;  5HR2 A;  3KMN A;  1VRS D;  1TXX A;  2MMN A;  2J9H A;  1EP8 A;  2DJ1 A;  3L78 A;  4KGI A;  4HJM A;  1T4Y A;  3D5J A;  4G0I A;  2AYT A;  3VLN A;  2M80 A;  4WBJ A;  1RQM A;  1TRU A;  5D96 A;  5IMD A;  3DD3 A;  2VOC A;  1GSU A;  3F3Q A;  2P5Q A;  5CRD A;  3BCK A;  1HNA A;  4K0N A;  4ZL9 A;  1QMV A;  2DKI A;  4Q5N A;  1CQH A;  3KH7 A;  4K8M A;  3EU3 A;  1SKS B;  2YWM A;  4NAX A;  4Q5Q A;  1VGL A;  2EIQ A;  3ZYW A;  5DJM A;  1SL1 B;  4K5R A;  3TKR A;  2IME A;  1EEJ A;  4FQU A;  3KMO A;  3HD5 A;  4GSN A;  3W8J A;  5AGY A;  3GX8 A;  1G7O A;  1ZYP A;  3F6D A;  1DE1 A;  1EGO A;  4MF5 A;  3F3R A;  2OAC A;  4O32 A;  4BL7 A;  3AY8 A;  1GTB A;  3ZFB A;  2H01 A;  2RUE A;  3KEB A;  4I8B A;  4TN8 A;  2HSM A;  3TJJ A;  1J9B A;  1WPI A;  4HEA 2;  4DSQ A;  2CVB A;  3FHK A;  2HSY A;  1E2Y A;  6GSU A;  3ZFL A;  2LS5 A;  1X9M B;  1ZMA A;  3GIX A;  1WE0 A;  2GQM A;  1OAZ A;  2A2R A;  2JU5 A;  4IW9 A;  4MF6 A;  1AW9 A;  3Q19 A;  3UVH A;  1EOG A;  2K6V A;  1XPV A;  3VPT A;  1PX6 A;  2GDR A;  2FA8 A;  2DJK A;  5IPH A;  2FWF A;  2YPM A;  4MZB A;  2LST A;  4MNN A;  4O5Q A;  3TRP A;  2IFQ B;  1KEB A;  4POL A;  2C3T A;  1SK1 A;  2H6Y A;  3TKS A;  3EMP A;  4O5U A;  1F9M A;  2X99 A;  1GTA A;  1M0U A;  1SJ6 A;  3PGT A;  5AIV A;  2IL3 A;  1EEM A;  5C00 A;  4LMV A;  1OYJ A;  3RPN A;  4MH3 A;  3S9F A;  1YQ1 A;  1H4O A;  1J08 A;  1QQ2 A;  1YF0 A;  2WZ9 A;  1DUG A;  3IA1 A;  2FD3 A;  3U5R E;  1GTI A;  3L9V A;  3QR6 A;  3UBK A;  5G30 A;  2YV7 A;  1Y25 A;  2GVP A;  3IC4 A;  2TIR A;  2IWT A;  4RI6 A;  4XRA A;  4IS0 A;  2PVO C;  1ZL9 A;  2KUC A;  2L59 A;  7GSS A;  3M0F A;  4XTS A;  4L5O A;  5FHI A;  3M1G A;  4KSO A;  1I9D A;  2H66 A;  3IHQ A;  3FR6 A;  2GT6 A;  3LJR A;  4IJI A;  1O85 A;  4KW6 A;  1S3C A;  2O89 A;  5KN0 A;  1TU8 A;  1MD4 A;  2LRC A;  2C0E A;  5DJL A;  2WUL A;  3FYG A;  1GWC A;  3LG6 A;  2HI7 A;  1XIY A;  3PPU A;  4O92 A;  2I9H A;  5IMF A;  1SJZ A;  2HSH A;  2LJR A;  2H74 A;  1G0T A;  4USS A;  3K8N A;  3W8S A;  1YEX A;  2H6X A;  1FO5 A;  4WXT A;  3LSZ A;  4G10 A;  1FOV A;  1OC9 B;  2YV9 A;  1F3A A;  1M99 A;  4MMM A;  4OFT A;  1MDJ A;  1ILO A;  4V1A g;  5IO2 A;  1M9A A;  1M9B A;  1TK0 B;  2AHE A;  4LL1 B;  5G5E A;  5J5N A;  3BD2 A;  2LNT A;  4MP4 A;  1GLQ A;  4V2N A;  2M46 A;  2C0F A;  3HVS A;  3NOF A;  2LV3 A;  2FWG A;  5JCG A;  3GFK A;  3L0H A;  1V9W A;  2H0G A;  2AV4 A;  2XPD A;  3BJ5 A;  2OE3 A;  2HLS A;  4HQZ A;  1PSQ A;  2HT9 A;  2QC7 A;  5JWQ B;  3M8N A;  4IN0 A;  4NV2 A;  2PBJ A;  1F6M C;  2MYG A;  3GMF A;  4X4J A;  3MNG A;  1SYR A;  3FEU A;  2I1U A;  2DJJ A;  4TOP A;  1OKT A;  5A4V A;  3LW9 A;  2OBK A;  3Q6O A;  14GS A;  1Z9H A;  1DBY A;  1F2E A;  2YCD A;  4XHM A;  5A4W A;  5ECQ B;  1ZCP A;  3SWL A;  3GKX A;  6GSS A;  1PN0 A;  2BJX A;  4KCA A;  3EC3 A;  4F0C A;  3TRX A;  2O85 A;  3TGZ A;  4XIH A;  1YKA A;  5CP1 A;  1T7P B;  4GLT A;  2GQL A;  2IN3 A;  1ML6 A;  4FO5 A;  5COH A;  1Z3E A;  4EL1 A;  4POM A;  3PIN A;  4CHS A;  4LA1 A;  1LU4 A;  2GSR A;  3J7Y k;  3ERF A;  1OC3 A;  2KP1 A;  2X8H A;  3GX0 A;  2XHF A;  3TUE A;  1G6Y A;  2N5B A;  4I5Q A;  2H30 A;  2DJ0 A;  4I2T A;  4I6X A;  4K5S A;  5IQY A;  4ECJ A;  4JED A;  3GSS A;  2H72 A;  4KB3 A;  3QOU A;  5EY6 A;  4PXO A;  2NDO A;  3N5O A;  3F6F A;  2CZ2 A;  3QAW A;  1SL2 B;  2YZU A;  1GSS A;  4K0G A;  2MMA A;  3O6T A;  2YJ7 A;  5D9X A;  5KN3 A;  1TTZ A;  2YWI A;  3APO A;  2B5E A;  5ABR A;  5LCZ A;  3N9J A;  5B7C A;  3D22 A;  3GHA A;  1C72 A;  1PGT A;  4IVF A;  5D93 A;  3IXR A;  3EVI A;  4J56 E;  3GUR A;  3IE3 A;  1GSF A;  3UL3 A;  2LRN A;  3GH9 A;  4Q5F A;  4YAP A;  4NPB A;  5CAX A;  4GCI A;  1UC7 A;  4J57 E;  4V2M A;  5INY A;  2B3S A;  4YKF A;  2GTU A;  1M3I A;  2K8V A;  4I2U A;  1IYH A;  1G6W A;  2L4C A;  1PN9 A;  3HY2 A;  2R2J A;  2H70 A;  5D9T A;  1WIK A;  2CAQ A;  4HOJ A;  4KUN A;  5DCH A;  2GSS A;  3IC8 A;  4ZBD A;  2IMD A;  3MWH A;  2R3X A;  3BOA A;  5DBQ A;  1PL1 A;  1NW2 A;  2DLX A;  4BL7 B;  1YJ6 A;  3GL3 A;  5A5K A;  2H8L A;  1ST9 A;  5ECP B;  4NHZ A;  4XS4 B;  1TI3 A;  4OO4 A;  4A5P A;  1AXD A;  1O8W A;  4IQA A;  5LNK e;  4FYB A;  1ERU A;  1JZR A;  3IBH A;  6GST A;  3TKS C;  1M2D A;  5ECM B;  5D8I A;  4TXO B;  1Z7R A;  1TOF A;  1QUW A;  3HJO A;  4PQI A;  2DIY A;  5G1L A;  4DSR A;  1W89 A;  2A4H A;  3RDW A;  3VPQ A;  4IBP A;  1ERV A;  4G19 A;  4KA0 A;  2VCV A;  4FH8 A;  1X5C A;  22GS A;  4ACS A;  2WJU A;  3ZIT A;  4YQM A;  4NMU A;  3VWX A;  4GST A;  2EIO A;  4K9Z A;  4K7I A;  4OCE A;  1RW1 A;  4GF0 A;  1XOB A;  4KX4 A;  3LYP A;  1TK5 B;  1AQV A;  1THO A;  2H1D A;  6GSV A;  3KTL A;  2LEG A;  4KAE A;  4HZ4 A;  2L6C A;  2DMM A;  3NZN A;  4JR4 A;  3CSI A;  2G0F A;  2DJ3 A;  4IJ3 A;  1A8L A;  3GV1 A;  3F4T A;  3BCI A;  4E8E A;  4Z2T A;  2P5R A;  4N10 A;  4ML1 A;  4HQS A;  5H5S A;  4X0X A;  2E0Q A;  1XWG A;  5ELA A;  2QGV A;  3A3T A;  3WGX A;  2GZZ A;  1B9X C;  3EMX A;  5IO0 A;  4CY6 A;  5HFI A;  3GST A;  1HYU A;  2AUV A;  1SKR B;  2WS2 A;  3F0I A;  4HI7 A;  1PD2 1;  4RQX A;  1PL2 A;  1Z6M A;  4N0V A;  4EVM A;  3GTU A;  2YWN A;  1V40 A;  3VWW A;  1XWK A;  2D2Z A;  5CRG A;  1LBK A;  2VCX A;  3VI5 A;  2C8U A;  4X43 A;  2C3Q A;  5D9V A;  5FT3 A;  1JZD A;  1S3R A;  2K9F A;  2PN8 A;  2C0G A;  1MDI A;  3VWU A;  4KND A;  3HZ4 A;  2B5Y A;  3I69 A;  3P90 A;  1ZOF A;  1ACV A;  3CTF A;  3LWA A;  3QDN A;  3Q18 A;  5ECS A;  2P31 A;  1PFO A;  3SBC A;  4DEJ A;  8GSS A;  1Q4J A;  2V2G A;  2EIR A;  2KLX A;  3CMI A;  1WP0 A;  4ZB9 A;  3KZQ A;  3PR8 A;  4JBB A;  4WR4 A;  2VCQ A;  5IMC A;  3CSH A;  3KH9 A;  1XZO A;  5D9W A;  4EDY A;  2H0I A;  2JL4 A;  1GLP A;  1AAZ A;  3JCM L;  1T1V A;  1K3L A;  3DWV A;  5DAK A;  3TKP A;  4D73 A;  1GSY A;  3MDK A;  3NIV A;  5KEJ A;  1WOU A;  3CSJ A;  1A2M A;  5IPG A;  2RLI A;  3ZMK A;  5CO3 A;  3H8Q A;  3I43 A;  2LUS A;  4XS1 A;  2VUP A;  5B6M A;  2NPB A;  3ED3 A;  3WT1 A;  5IIZ A;  2CVK A;  5B6N A;  4LLR A;  5JCU A;  2DJ2 A;  3FZ5 A;  4TRX A;  4OFN A;  2H1B A;  2JAD A;  4ID0 A;  4YKG A;  3A2V A;  2HZF A;  4BWS A;  4JR6 A;  5DDL A;  3GN3 A;  2V41 A;  1BQ7 A;  2VCW A;  1XFL A;  3LQ7 A;  3E0U A;  4FYC A;  2V6K A;  4TXV A;  1HD2 A;  1U88 A;  2OAD A;  1AIU A;  3GKN A;  2PWJ A;  1GL8 A;  2VD0 A;  1JLV A;  4ECI A;  2A2S A;  2NBS A;  3GUS A;  5E59 A;  1BX9 A;  1AQW A;  5GSS A;  2PGT A;  4K1F A;  2CV4 A;  1ERW A;  6GSW A;  3LFL A;  2CA8 A;  4XS6 A;  2VLV A;  1YZX A;  1K3O A;  3HJP A;  5HR1 A;  1TU7 A;  1EV9 A;  2YN1 A;  3F4S A;  1X5E A;  4F2I A;  1S3D A;  4O7H A;  5GZZ B;  3C8E A;  1NSW A;  4KH7 A;  4IGJ A;  1SU9 A;  2LRT A;  20GS A;  1WWJ A;  4DSS A;  3GL5 A;  3EIN A;  4PX1 A;  1N2A A;  2L6D A;  3HVX A;  4OCF A;  3KD0 A;  2IMK A;  1EZK A;  4V2L A;  4G2E A;  2F8A A;  1O8X A;  2B1K A;  2HYX A;  1EWX A;  3GNJ A;  4PNG A;  2REM A;  1QFN A;  3UBL A;  16GS A;  5JWO B;  2F8F A;  4IQ1 A;  5D73 A;  4BVY A;  2N5A A;  2GZP A;  2MZC A;  4PGT A;  3ME8 A;  4L0W A;  4NV5 A;  6GSY A;  2H6Z A;  2DC5 A;  3HHV A;  3RPP A;  4TVE A;  2QA2 A;  3CBU A;  3D21 A;  4Z2R A;  4WEY A;  4N0Z A;  2AAW A;  3L9U A;  4N11 A;  2ZNM A;  4HJ2 A;  4G9H A;  5KN1 A;  2HRN A;  2C3N A;  1O81 A;  1YKC A;  2X64 A;  4PQH A;  4LMW A;  4KF9 A;  1K0D A;  2FLS A;  1R5P A;  1XBS A;  3DRN A;  3FK8 A;  2ZCT A;  3TKS E;  3CTG A;  4ZL8 A;  4WKW A;  1G7E A;  3GKK A;  1Y6E A;  4NXI A;  4MK3 A;  3KXO A;  1BAY A;  4O5R A;  5BMU A;  1U87 A;  3J7Y b;  5ID2 A;  2FNO A;  2LNS A;  1WMJ A;  4JE1 A;  2I4A A;  2GGT A;  3ERG A;  2L57 A;  5G2Z A;  4POB A;  1MTC A;  5G5F A;  1K0N A;  4OFM A;  4MJC A;  4IKH A;  2ON7 A;  3ZL5 A;  1JLW A;  3ME7 A;  5CRW A;  3EE2 A;  3I6A A;  2TRC P;  2WRT A;  3HVV A;  2WCI A;  1ERT A;  3CRT A;  1X9S B;  2H76 A;  1GRX A;  2PVQ A;  4OO5 A;  1BYE A;  1PKW A;  4F82 A;  1XW6 A;  3ZLP A;  2O8V B;  4K7O A;  1EGR A;  2V1M A;  4MJA A;  4MJB A;  1NHY A;  2VL3 A;  3ZIJ A;  4K6X A;  1B4P A;  1GTU A;  4TR1 A;  4Z2U A;  3GA4 A;  2WGR A;  5G1K A;  2WFC A;  4KE3 A;  2HRA A;  2YZH A;  2B5X A;  4EC0 A;  1U3A A;  5HR0 A;  1KTE A;  3RBT A;  13GS A;  1XWA A;  2HXK A;  3UAR A;  2CAI A;  5ELG A;  2B1L A;  2ALB A;  5IMA A;  5IOX A;  1F3B A;  2H1G A;  1FW1 A;  1MDK A;  3DKS A;  2R5G A;  3TDG A;  1PX7 A;  4PQ1 A;  5IMZ A;  3DGQ A;  2VCT A;  3LXZ A;  2LJA A;  3DXB A;  3EU4 A;  3O3T A;  2KHP A;  3EPT A;  4EKZ A;  3ZTL A;  2AB6 A;  2CX3 A;  3FZ4 A;  3KTB A;  3C73 A;  2RM6 A;  4ULX A;  4E8H A;  1USB A;  4PUF C;  5FWG A;  3FR3 A;  3EUR A;  3HA9 A;  3L9S A;  4Q5R A;  2VO4 A;  2LQO A;  1A0F A;  4CDO A;  3IRA A;  4MPF A;  2IMI A;  2P0G A;  4ZIL A;  4Z7X A;  4P3Y B;  4ZBA A;  2V6O A;  1OKD A;  3GTU B;  2FWH A;  4KDY A;  1LJR A;  1OC9 A;  4NWY A;  10GS A;  1V58 A;  3QAV A;  1SJI A;  3LXT A;  1ABA A;  3G7I A;  4BA7 A;  1K3Y A;  2GZY A;  4JU5 A;  1EP7 A;  2I81 A;  5J3R A;  4ZBB A;  3U6V A;  2VL2 A;  2JZS A;  3ZRD A;  1T8E B;  3WT2 A;  3VWV A;  1U3I A;  19GS A;  2LJK A;  5DVB A;  3G9B A;  1B9Y C;  2CT6 A;  3GYK A;  4ECB A;  5CYY A;  5L71 A;  1TDI A;  2L4Q A;  1K0M A;  2JZR A;  3QAG A;  1XG8 A;  1N8J A;  4F9Z A;  4BVX A;  4XRD A;  1BJX A;  5KOX A;  3UIW A;  5KN2 A;  2IPA A;  2QA1 A;  2OJL A;  1SK0 A;  4D73 B;  2A4V A;  3A5W A;  4BIK A;  4KDX A;  1O7U A;  5F07 A;  2KOK A;  3EYT A;  1UN2 A;  1QXH A;  3A5I A;  1K0C A;  2CX4 A;  4QL9 A;  3ERW A;  3M9K A;  4BWQ A;  1GUL A;  2YWO A;  2HE3 A;  1TRW A;  4MAB A;  3IR4 A;  2Z9S A;  2FUG 2;  4MF7 A;  2C80 A;  1A23 A;  4POK A;  1FHE A;  9GSS A;  2JAC A;  1FAA A;  1XWC A;  1ON4 A;  2V32 A;  3HXS A;  4FIW A;  5AN1 A;  5DAL A;  2GQK A;  4WR5 A;  2X49 A;  1JHB A;  2F9S A;  2XC2 A;  3TKQ A;  1AQX A;  5IOW A;  3D4T A;  4K7N A;  3CRU A;  4HUA A;  3C7M A;  1GNE A;  2H73 A;  1T3B A;  3ZML A;  1XW9 A;  3HYP A;  1ZYQ B;  1JFU A;  3M3M A;  3VUR A;  2QSI A;  5F06 A;  4YH2 A;  4IP6 A;  2HRF A;  3US3 A;  5ECK B;  2X8C A;  3EWL A;  1TRS A;  3UVT A;  2VLU A;  2HRK A;  2PER A;  3D0Z A;  4XCS A;  2VAF A;  1T4Z A;  1GUH A;  2DIZ A;  1FB0 A;  3GH6 A;  2JSY A;  3DEX A;  2VM2 A;  4EDZ A;  2HZE A;  2YOI A;  4DSS B;  5ECL B;  3R2Q A;  3VK9 A;  3KGK A;  1YDK A;  2C1Y A;  2FGX A;  3MIX A;  1A8Y A;  3HVN A;  4HU7 A;  1YF1 A;  1SD8 A;  3HCZ A;  3TOU A;  1VF3 A;  4G0K A;  4MJE A;  3F63 A;  1TRV A;  2H0H A;  4ZL7 A;  3IAS 2;  1MD3 A;  1TW9 A;  4BVY B;  1B48 A;  1GP1 A;  3TRQ A;  2M72 A;  3IOS A;  2R37 A;  2L5L A;  1R7H A;  3IDV A;  3FZ9 A;  3F8U A;  2IIY A;  1RK4 A;  4HU9 A;  4IHU A;  1GSQ A;  4HZ2 A;  4ILF A;  3QPM A;  4PTS A;  2RII A;  5GST A;  2MBS A;  4XS4 A;  5F8B A;  2R0C A;  4YAV A;  3WGD A;  1DE2 A;  3OR5 A;  2MMZ A;  2OE1 A;  3DIE A;  3DVX A;  2VIM A;  3UJ1 A;  4GXZ A;  4TXO A;  3DML A;  2O87 A;  2B6M A;  1XVQ A;  5ECR B;  4AGS A;  4MA9 A;  1M2A A;  4IEL A;  2C4J A;  5AIS A;  4L8E A;  3P7X A;  3A2X A;  3LGC A;  3RHB A;  5ID2 B;  2FA4 A;  3ISO A;  3CQF A;  1ZZY A;  2QKE A;  4F0B A;  3FKF A;  3C1S A;  2DKH A;  2K18 A;  1FVJ A;  4K2X A;  2JSZ A;  3WD6 A;  2CQ9 A;  3WGE A;  2CZ3 A;  2I3Y A;  4ZXG A;  2GT5 A;  6GSX A;  1QK8 A;  1HQO A;  2DML A;  5KOW A;  1M3J A;  4ISD A;  1ZGN A;  4PNF A;  2HFD A;  2GST A;  4ML6 A;  1V98 A;  4YQV A;  5HFG A;  1GSE A;  3TB2 A;  2E7P A;  2CVD A;  4MZC A;  2YJH A;  3IHG A;  4TKY A;  4WF5 A;  3D6I A;  4LL4 B;  4ZB8 A;  17GS A;  2G2Q A;  4RI7 A;  1OC8 A;  3KP8 A;  2VL9 A;  5DQY A;  1KNG A;  5ECH B;  4N30 A;  12GS A;  1EV4 A;  4TR1 B;  4TR3 A;  3KJY A;  1TJD A;  2R6K A;  5G31 A;  1IYI A;  4NHW A;  1CQG A;  2NTO A;  1V57 A;  2F51 A;  1PQN A;  1YEP A;  3WYW A;  5F0G A;  3KCM A;  2R4V A;  4FYU A;  1O6J A;  5HFK A;  4HDE A;  3UOM A;  1F37 A;  1SEN A;  5AIX A;  1SYX A;  3KIJ A;  2FY6 A;  3UEM A;  1GUK A;  1JZW A;  3Q74 A;  4L0U A;  1T00 A;  1S3A A;  2E2M A;  4TR4 A;  2VCZ A;  1M2B A;  1YY7 A;  2R0P A;  5DCG A;  2YAN A;  4KCE A;  3QD9 A;  5IM9 A;  1XCC A;  3CXG A;  1J0F A;  3UMA A;  3VFI A;  2H1A A;  4BPY A;  4HSC X;  4MLY A;  1K0B A;  2VL2 C;  1U6T A;  1W4V A;  2X8G A;  4QQ7 A;  5ECI B;  3QCP A;  4MDC A;  2WB9 A;  5CNW A;  1FOH A;  4F03 A;  4TW5 A;  3RAZ A;  4ZIJ A;  4GTU A;  1XWB A;  1UA5 A;  1H75 A;  1PA3 A;  2IMF A;  1XVW A;  1R26 A;  3HZ8 A;  4MCU A;  4EF0 A;  5A4U A;  2YP6 A;  2K8S A;  3UAP A;  2H19 A;  4H86 A;  3F9U A;  4PUR A;  1TP9 A;  3FR9 A;  1NM3 A;  2E2G A;  1V2A A;  4DVC A;  1BED A;  3H93 A;  1THX A;  1OE7 A;  2B7K A;  1TK8 B;  1XXU A;  1VF2 A;  4ICY A;  3L4N A;  3P2A A;  2B7J A;  3LYK A;  2FWE A;  2IJY A;  4J2F A;  1EOH A;  4EIQ A;  4HS1 A;  5HR3 A;  2IFQ A;  3PH9 A;  1OVN A;  4BVX B;  1HNC A;  3H1N A;  4CY8 A;  2GLR A;  2XBI A;  4GQF A;  2A2P A;  3TJK A;  4EE0 A;  1XW5 A;  2KP2 A;  2FHE A;  4GRF A;  3TJF A;  1Z5Y E;  3E9J B;  2OKA A;  4K2D A;  2HNL A;  1ZYE A;  4IP1 A;  5B8A A;  5EPF A;  4RQR A;  1A2L A;  2FCH A;  1GUM A;  1R4W A;  5H5R A;  3QFB C;  4I97 A;  2DSA A;  4WF4 A;  5GAN D;  3IK7 A;  3V1W A;  3DVW A;  2C0D A;  1X5D A;  3C1R A;  2F3M A;  5J9C A;  2MBT A;  5E4W A;  4TR0 A;  5ECN B;  1FG4 A;  3TOT A;  2J23 A;  5DAL B;  2R0G A;  3MAK A;  3FMW A;  1A0R P;  3FZA A;  4L5L A;  1MEK A;  1DSB A;  5EL8 A;  3HJM A;  3DYR A;  1Z7P A;  2GS3 A;  1KBN A;  2GSQ A;  2MMO A;  2YNX A;  3IK9 A;  1QGV A;  3FY7 A;  1Z6N A;  1TKD B;  4GSS A;  4G0L A;  1WJK A;  1R5A A;  3C71 A;  4V1A p;  2L5O A;  2UZ8 A;  3HKR A;  5HQP A;  2LTK A;  2OA7 A;  4EIP A;  1B4Q A;  3IV4 A;  3QMX A;  3IAM 2;  2O7K A;  5ECO B;  5LD0 A;  3TJG A;  1X9W B;  2VM1 A;  3KP9 A;  1JZO A;  5IMV A;  3M9J A;  5JWR B;  4MH2 A;  1SD9 A;  4MZW A;  4KSM A;  3F4R A;  4ECC A;  3ZZX A;  2ZUP A;  3H4K A;  4EO3 A;  1PMT A;  2RM5 A;  5ENU A;  2AJQ B;  2ON5 A;  1AC1 A;  1SK2 A;  1VF4 A;  2HZE B;  5CRH A;  3GRX A;  4WBR D;  4AJ8 A;  3I9V 2;  5BRT A;  2LKU A;  5J9B A;  3TCO A;  2LQQ A;  4GWR A;  2OBI A;  4OMV A;  2BTO T;  5CRE A;  3ZVJ D;  1K0O A;  4AJ6 A;  4WET A;  3FW2 A;  5C04 A;  1WRY A;  1ZYN A;  3A2W A;  2N5F A;  4KDU A;  1VF1 A;  4OWY A;  5J41 A;  1AUC A;  4AJ7 A;  5DQS A;  3W6G A;  2NVL A;  4EUY A;  3R3E A;  4QL7 A;  3H79 A;  3QFA C;  2EC4 A;  1BG5 A;  3ZIV A;  5GAP D;  2H71 A;  5EVO A;  4OD7 A;  3HDC A;  1XOA A;  5DAK B;  2VLT A;  3ZVJ A; 
#chains in the Genus database with same CATH homology
 1PRX A;  4RUV A;  1GSD A;  3APS A;  1SL0 B;  3VI7 A;  3LEF A;  2PMT A;  5JCW A;  4JRR A;  5F05 A;  3CYN A;  4JZQ A;  3BBY A;  4YQU A;  1NHO A;  3ZRE A;  1E6B A;  1O73 A;  1A2J A;  3RHC A;  5B8B A;  1K0A A;  3KM6 A;  3O76 A;  2ES7 A;  3MSZ A;  1PKZ A;  3FRC A;  1HNB A;  2BMX A;  3G7Y A;  3LOR A;  1OE8 A;  4X1U A;  1M7T A;  3APQ A;  3MYD A;  1TI1 A;  2PU9 C;  2PUK C;  4MPG A;  4AF2 A;  4ZB6 A;  2VD1 A;  2RUF A;  1URM A;  3GKM A;  3IPZ A;  2TRX A;  3TJB A;  4PUA A;  5J4U A;  11GS A;  1A24 A;  1SKW B;  1Q98 A;  18GS A;  2OE0 A;  2XBQ A;  3E3E A;  2WDU A;  4EXJ A;  3P8W A;  5H5Q A;  2DBC A;  1GNW A;  2PPT A;  1FB6 A;  1X0R A;  3G7J A;  2H75 A;  1GH2 A;  1B8X A;  2JZT A;  4GQC A;  4CW9 A;  1FVK A;  1I5G A;  3D4M A;  2XPE A;  1UVZ A;  2X4A A;  5HR2 A;  3KMN A;  1VRS D;  1TXX A;  2MMN A;  2J9H A;  1EP8 A;  2DJ1 A;  3L78 A;  4KGI A;  4HJM A;  1T4Y A;  3D5J A;  4G0I A;  2AYT A;  3VLN A;  2M80 A;  4WBJ A;  1RQM A;  1TRU A;  5D96 A;  5IMD A;  3DD3 A;  2VOC A;  1GSU A;  3F3Q A;  2P5Q A;  5CRD A;  3BCK A;  1HNA A;  4K0N A;  4ZL9 A;  1QMV A;  2DKI A;  4Q5N A;  1CQH A;  3KH7 A;  4K8M A;  3EU3 A;  1SKS B;  2YWM A;  4NAX A;  4Q5Q A;  1VGL A;  2EIQ A;  3ZYW A;  5DJM A;  1SL1 B;  4K5R A;  3TKR A;  2IME A;  1EEJ A;  4FQU A;  3KMO A;  3HD5 A;  4GSN A;  3W8J A;  5AGY A;  3GX8 A;  1G7O A;  1ZYP A;  3F6D A;  1DE1 A;  1EGO A;  4MF5 A;  3F3R A;  2OAC A;  4O32 A;  4BL7 A;  3AY8 A;  1GTB A;  3ZFB A;  2H01 A;  2RUE A;  3KEB A;  4I8B A;  4TN8 A;  2HSM A;  3TJJ A;  1J9B A;  1WPI A;  4HEA 2;  4DSQ A;  2CVB A;  3FHK A;  2HSY A;  1E2Y A;  6GSU A;  3ZFL A;  2LS5 A;  1X9M B;  1ZMA A;  3GIX A;  1WE0 A;  2GQM A;  1OAZ A;  2A2R A;  2JU5 A;  4IW9 A;  4MF6 A;  1AW9 A;  3Q19 A;  3UVH A;  1EOG A;  2K6V A;  1XPV A;  3VPT A;  1PX6 A;  2GDR A;  2FA8 A;  2DJK A;  5IPH A;  2FWF A;  2YPM A;  4MZB A;  2LST A;  4MNN A;  4O5Q A;  3TRP A;  2IFQ B;  1KEB A;  4POL A;  2C3T A;  1SK1 A;  2H6Y A;  3TKS A;  3EMP A;  4O5U A;  1F9M A;  2X99 A;  1GTA A;  1M0U A;  1SJ6 A;  3PGT A;  5AIV A;  2IL3 A;  1EEM A;  5C00 A;  4LMV A;  1OYJ A;  3RPN A;  4MH3 A;  3S9F A;  1YQ1 A;  1H4O A;  1J08 A;  1QQ2 A;  1YF0 A;  2WZ9 A;  1DUG A;  3IA1 A;  2FD3 A;  3U5R E;  1GTI A;  3L9V A;  3QR6 A;  3UBK A;  5G30 A;  2YV7 A;  1Y25 A;  2GVP A;  3IC4 A;  2TIR A;  2IWT A;  4RI6 A;  4XRA A;  4IS0 A;  2PVO C;  1ZL9 A;  2KUC A;  2L59 A;  7GSS A;  3M0F A;  4XTS A;  4L5O A;  5FHI A;  3M1G A;  4KSO A;  1I9D A;  2H66 A;  3IHQ A;  3FR6 A;  2GT6 A;  3LJR A;  4IJI A;  1O85 A;  4KW6 A;  1S3C A;  2O89 A;  5KN0 A;  1TU8 A;  1MD4 A;  2LRC A;  2C0E A;  5DJL A;  2WUL A;  3FYG A;  1GWC A;  3LG6 A;  2HI7 A;  1XIY A;  3PPU A;  4O92 A;  2I9H A;  5IMF A;  1SJZ A;  2HSH A;  2LJR A;  2H74 A;  1G0T A;  4USS A;  3K8N A;  3W8S A;  1YEX A;  2H6X A;  1FO5 A;  4WXT A;  3LSZ A;  4G10 A;  1FOV A;  1OC9 B;  2YV9 A;  1F3A A;  1M99 A;  4MMM A;  4OFT A;  1MDJ A;  1ILO A;  4V1A g;  5IO2 A;  1M9A A;  1M9B A;  1TK0 B;  2AHE A;  4LL1 B;  5G5E A;  5J5N A;  3BD2 A;  2LNT A;  4MP4 A;  1GLQ A;  4V2N A;  2M46 A;  2C0F A;  3HVS A;  3NOF A;  2LV3 A;  2FWG A;  5JCG A;  3GFK A;  3L0H A;  1V9W A;  2H0G A;  2AV4 A;  2XPD A;  3BJ5 A;  2OE3 A;  2HLS A;  4HQZ A;  1PSQ A;  2HT9 A;  2QC7 A;  5JWQ B;  3M8N A;  4IN0 A;  4NV2 A;  2PBJ A;  1F6M C;  2MYG A;  3GMF A;  4X4J A;  3MNG A;  1SYR A;  3FEU A;  2I1U A;  2DJJ A;  4TOP A;  1OKT A;  5A4V A;  3LW9 A;  2OBK A;  3Q6O A;  14GS A;  1Z9H A;  1DBY A;  1F2E A;  2YCD A;  4XHM A;  5A4W A;  5ECQ B;  1ZCP A;  3SWL A;  3GKX A;  6GSS A;  1PN0 A;  2BJX A;  4KCA A;  3EC3 A;  4F0C A;  3TRX A;  2O85 A;  3TGZ A;  4XIH A;  1YKA A;  5CP1 A;  1T7P B;  4GLT A;  2GQL A;  2IN3 A;  1ML6 A;  4FO5 A;  5COH A;  1Z3E A;  4EL1 A;  4POM A;  3PIN A;  4CHS A;  4LA1 A;  1LU4 A;  2GSR A;  3J7Y k;  3ERF A;  1OC3 A;  2KP1 A;  2X8H A;  3GX0 A;  2XHF A;  3TUE A;  1G6Y A;  2N5B A;  4I5Q A;  2H30 A;  2DJ0 A;  4I2T A;  4I6X A;  4K5S A;  5IQY A;  4ECJ A;  4JED A;  3GSS A;  2H72 A;  4KB3 A;  3QOU A;  5EY6 A;  4PXO A;  2NDO A;  3N5O A;  3F6F A;  2CZ2 A;  3QAW A;  1SL2 B;  2YZU A;  1GSS A;  4K0G A;  2MMA A;  3O6T A;  2YJ7 A;  5D9X A;  5KN3 A;  1TTZ A;  2YWI A;  3APO A;  2B5E A;  5ABR A;  5LCZ A;  3N9J A;  5B7C A;  3D22 A;  3GHA A;  1C72 A;  1PGT A;  4IVF A;  5D93 A;  3IXR A;  3EVI A;  4J56 E;  3GUR A;  3IE3 A;  1GSF A;  3UL3 A;  2LRN A;  3GH9 A;  4Q5F A;  4YAP A;  4NPB A;  5CAX A;  4GCI A;  1UC7 A;  4J57 E;  4V2M A;  5INY A;  2B3S A;  4YKF A;  2GTU A;  2K8V A;  4I2U A;  1IYH A;  1G6W A;  2L4C A;  1PN9 A;  3HY2 A;  2R2J A;  2H70 A;  5D9T A;  1WIK A;  2CAQ A;  4HOJ A;  4KUN A;  5DCH A;  2GSS A;  3IC8 A;  4ZBD A;  2IMD A;  3MWH A;  2R3X A;  3BOA A;  5DBQ A;  1PL1 A;  1NW2 A;  2DLX A;  4BL7 B;  1YJ6 A;  3GL3 A;  5A5K A;  2H8L A;  1ST9 A;  5ECP B;  4NHZ A;  4XS4 B;  1TI3 A;  4OO4 A;  4A5P A;  1AXD A;  1O8W A;  4IQA A;  5LNK e;  4FYB A;  1ERU A;  1JZR A;  3IBH A;  6GST A;  3TKS C;  1M2D A;  5ECM B;  5D8I A;  4TXO B;  1Z7R A;  1TOF A;  1QUW A;  3HJO A;  4PQI A;  2DIY A;  5G1L A;  4DSR A;  1W89 A;  2A4H A;  3RDW A;  3VPQ A;  4IBP A;  1ERV A;  4G19 A;  4KA0 A;  2VCV A;  4FH8 A;  1X5C A;  22GS A;  4ACS A;  2WJU A;  3ZIT A;  4YQM A;  4NMU A;  3VWX A;  4GST A;  2EIO A;  4K9Z A;  4K7I A;  4OCE A;  1RW1 A;  4GF0 A;  1XOB A;  4KX4 A;  3LYP A;  1TK5 B;  1AQV A;  1THO A;  2H1D A;  6GSV A;  3KTL A;  2LEG A;  4KAE A;  4HZ4 A;  2L6C A;  2DMM A;  3NZN A;  4JR4 A;  3CSI A;  2G0F A;  2DJ3 A;  4IJ3 A;  1A8L A;  3GV1 A;  3F4T A;  3BCI A;  4E8E A;  4Z2T A;  2P5R A;  4N10 A;  4ML1 A;  4HQS A;  5H5S A;  4X0X A;  2E0Q A;  1XWG A;  5ELA A;  2QGV A;  3A3T A;  3WGX A;  2GZZ A;  1B9X C;  3EMX A;  5IO0 A;  4CY6 A;  5HFI A;  3GST A;  1HYU A;  2AUV A;  1SKR B;  2WS2 A;  3F0I A;  4HI7 A;  1PD2 1;  4RQX A;  1PL2 A;  1Z6M A;  4N0V A;  4EVM A;  3GTU A;  2YWN A;  1V40 A;  3VWW A;  1XWK A;  2D2Z A;  5CRG A;  1LBK A;  2VCX A;  3VI5 A;  2C8U A;  4X43 A;  2C3Q A;  5D9V A;  5FT3 A;  1JZD A;  2K9F A;  2PN8 A;  2C0G A;  1MDI A;  3VWU A;  4KND A;  3HZ4 A;  2B5Y A;  3I69 A;  3P90 A;  1ZOF A;  1ACV A;  3CTF A;  3LWA A;  3QDN A;  3Q18 A;  5ECS A;  2P31 A;  3SBC A;  4DEJ A;  8GSS A;  1Q4J A;  2V2G A;  2EIR A;  2KLX A;  3CMI A;  1WP0 A;  4ZB9 A;  3KZQ A;  3PR8 A;  4JBB A;  4WR4 A;  2VCQ A;  5IMC A;  3CSH A;  3KH9 A;  1XZO A;  5D9W A;  4EDY A;  2H0I A;  2JL4 A;  1GLP A;  1AAZ A;  3JCM L;  1T1V A;  1K3L A;  3DWV A;  5DAK A;  3TKP A;  4D73 A;  1GSY A;  3MDK A;  3NIV A;  5KEJ A;  1WOU A;  3CSJ A;  1A2M A;  5IPG A;  2RLI A;  3ZMK A;  5CO3 A;  3H8Q A;  3I43 A;  2LUS A;  4XS1 A;  2VUP A;  5B6M A;  2NPB A;  3ED3 A;  3WT1 A;  5IIZ A;  2CVK A;  5B6N A;  4LLR A;  5JCU A;  2DJ2 A;  3FZ5 A;  4TRX A;  4OFN A;  2H1B A;  2JAD A;  4ID0 A;  4YKG A;  3A2V A;  2HZF A;  4BWS A;  4JR6 A;  5DDL A;  3GN3 A;  2V41 A;  1BQ7 A;  2VCW A;  1XFL A;  3LQ7 A;  3E0U A;  4FYC A;  2V6K A;  4TXV A;  1HD2 A;  1U88 A;  2OAD A;  1AIU A;  3GKN A;  2PWJ A;  1GL8 A;  2VD0 A;  1JLV A;  4ECI A;  2A2S A;  2NBS A;  3GUS A;  5E59 A;  1BX9 A;  1AQW A;  5GSS A;  2PGT A;  4K1F A;  2CV4 A;  1ERW A;  6GSW A;  3LFL A;  2CA8 A;  4XS6 A;  2VLV A;  1YZX A;  1K3O A;  3HJP A;  5HR1 A;  1TU7 A;  1EV9 A;  2YN1 A;  3F4S A;  1X5E A;  4F2I A;  1S3D A;  4O7H A;  5GZZ B;  3C8E A;  1NSW A;  4KH7 A;  4IGJ A;  1SU9 A;  2LRT A;  20GS A;  1WWJ A;  4DSS A;  3GL5 A;  3EIN A;  4PX1 A;  1N2A A;  2L6D A;  3HVX A;  4OCF A;  3KD0 A;  2IMK A;  1EZK A;  4V2L A;  4G2E A;  2F8A A;  1O8X A;  2B1K A;  2HYX A;  1EWX A;  3GNJ A;  4PNG A;  2REM A;  1QFN A;  3UBL A;  16GS A;  5JWO B;  2F8F A;  4IQ1 A;  5D73 A;  4BVY A;  2N5A A;  2GZP A;  2MZC A;  4PGT A;  3ME8 A;  4L0W A;  4NV5 A;  6GSY A;  2H6Z A;  2DC5 A;  3HHV A;  3RPP A;  4TVE A;  2QA2 A;  3CBU A;  3D21 A;  4Z2R A;  4WEY A;  4N0Z A;  2AAW A;  3L9U A;  4N11 A;  2ZNM A;  4HJ2 A;  4G9H A;  5KN1 A;  2HRN A;  2C3N A;  1O81 A;  1YKC A;  2X64 A;  4PQH A;  4LMW A;  4KF9 A;  1K0D A;  2FLS A;  1R5P A;  1XBS A;  3DRN A;  3FK8 A;  2ZCT A;  3TKS E;  3CTG A;  4ZL8 A;  4WKW A;  1G7E A;  3GKK A;  1Y6E A;  4NXI A;  4MK3 A;  3KXO A;  1BAY A;  4O5R A;  5BMU A;  1U87 A;  3J7Y b;  5ID2 A;  2FNO A;  2LNS A;  1WMJ A;  4JE1 A;  2I4A A;  2GGT A;  3ERG A;  2L57 A;  5G2Z A;  4POB A;  1MTC A;  5G5F A;  1K0N A;  4OFM A;  4MJC A;  4IKH A;  2ON7 A;  3ZL5 A;  1JLW A;  3ME7 A;  5CRW A;  3EE2 A;  3I6A A;  2TRC P;  2WRT A;  3HVV A;  2WCI A;  1ERT A;  3CRT A;  1X9S B;  2H76 A;  1GRX A;  2PVQ A;  4OO5 A;  1BYE A;  1PKW A;  4F82 A;  1XW6 A;  3ZLP A;  2O8V B;  4K7O A;  1EGR A;  2V1M A;  4MJA A;  4MJB A;  1NHY A;  2VL3 A;  3ZIJ A;  4K6X A;  1B4P A;  1GTU A;  4TR1 A;  4Z2U A;  3GA4 A;  2WGR A;  5G1K A;  2WFC A;  4KE3 A;  2HRA A;  2YZH A;  2B5X A;  4EC0 A;  1U3A A;  5HR0 A;  1KTE A;  3RBT A;  13GS A;  1XWA A;  2HXK A;  3UAR A;  2CAI A;  5ELG A;  2B1L A;  2ALB A;  5IMA A;  5IOX A;  1F3B A;  2H1G A;  1FW1 A;  1MDK A;  3DKS A;  2R5G A;  3TDG A;  1PX7 A;  4PQ1 A;  5IMZ A;  3DGQ A;  2VCT A;  3LXZ A;  2LJA A;  3DXB A;  3EU4 A;  3O3T A;  2KHP A;  3EPT A;  4EKZ A;  3ZTL A;  2AB6 A;  2CX3 A;  3FZ4 A;  3KTB A;  3C73 A;  2RM6 A;  4ULX A;  4E8H A;  1USB A;  4PUF C;  5FWG A;  3FR3 A;  3EUR A;  3HA9 A;  3L9S A;  4Q5R A;  2VO4 A;  2LQO A;  1A0F A;  4CDO A;  3IRA A;  4MPF A;  2IMI A;  2P0G A;  4ZIL A;  4Z7X A;  4P3Y B;  4ZBA A;  2V6O A;  1OKD A;  3GTU B;  2FWH A;  4KDY A;  1LJR A;  1OC9 A;  4NWY A;  10GS A;  1V58 A;  3QAV A;  1SJI A;  3LXT A;  1ABA A;  3G7I A;  4BA7 A;  1K3Y A;  2GZY A;  4JU5 A;  1EP7 A;  2I81 A;  5J3R A;  4ZBB A;  3U6V A;  2VL2 A;  2JZS A;  3ZRD A;  1T8E B;  3WT2 A;  3VWV A;  1U3I A;  19GS A;  2LJK A;  5DVB A;  3G9B A;  1B9Y C;  2CT6 A;  3GYK A;  4ECB A;  5CYY A;  5L71 A;  1TDI A;  2L4Q A;  1K0M A;  2JZR A;  3QAG A;  1N8J A;  4F9Z A;  4BVX A;  4XRD A;  1BJX A;  5KOX A;  3UIW A;  5KN2 A;  2IPA A;  2QA1 A;  2OJL A;  1SK0 A;  4D73 B;  2A4V A;  3A5W A;  4KDX A;  1O7U A;  5F07 A;  2KOK A;  3EYT A;  1UN2 A;  1QXH A;  3A5I A;  1K0C A;  2CX4 A;  4QL9 A;  3ERW A;  3M9K A;  4BWQ A;  1GUL A;  2YWO A;  2HE3 A;  1TRW A;  4MAB A;  3IR4 A;  2Z9S A;  2FUG 2;  4MF7 A;  2C80 A;  1A23 A;  4POK A;  1FHE A;  9GSS A;  2JAC A;  1FAA A;  1XWC A;  1ON4 A;  2V32 A;  3HXS A;  4FIW A;  5AN1 A;  5DAL A;  2GQK A;  4WR5 A;  2X49 A;  1JHB A;  2F9S A;  2XC2 A;  3TKQ A;  1AQX A;  5IOW A;  3D4T A;  4K7N A;  3CRU A;  4HUA A;  3C7M A;  1GNE A;  2H73 A;  1T3B A;  3ZML A;  1XW9 A;  3HYP A;  1ZYQ B;  1JFU A;  3M3M A;  3VUR A;  2QSI A;  5F06 A;  4YH2 A;  4IP6 A;  2HRF A;  3US3 A;  5ECK B;  2X8C A;  3EWL A;  1TRS A;  3UVT A;  2VLU A;  2HRK A;  2PER A;  3D0Z A;  4XCS A;  2VAF A;  1T4Z A;  1GUH A;  2DIZ A;  1FB0 A;  3GH6 A;  2JSY A;  3DEX A;  2VM2 A;  4EDZ A;  2HZE A;  2YOI A;  4DSS B;  5ECL B;  3R2Q A;  3VK9 A;  3KGK A;  1YDK A;  2C1Y A;  2FGX A;  3MIX A;  1A8Y A;  4HU7 A;  1YF1 A;  1SD8 A;  3HCZ A;  3TOU A;  1VF3 A;  4G0K A;  4MJE A;  3F63 A;  1TRV A;  2H0H A;  4ZL7 A;  3IAS 2;  1MD3 A;  1TW9 A;  4BVY B;  1B48 A;  1GP1 A;  3TRQ A;  2M72 A;  3IOS A;  2R37 A;  2L5L A;  1R7H A;  3IDV A;  3FZ9 A;  3F8U A;  2IIY A;  1RK4 A;  4HU9 A;  4IHU A;  1GSQ A;  4HZ2 A;  4ILF A;  3QPM A;  4PTS A;  2RII A;  5GST A;  2MBS A;  4XS4 A;  5F8B A;  2R0C A;  4YAV A;  3WGD A;  1DE2 A;  3OR5 A;  2MMZ A;  2OE1 A;  3DIE A;  3DVX A;  2VIM A;  3UJ1 A;  4GXZ A;  4TXO A;  3DML A;  2O87 A;  2B6M A;  1XVQ A;  5ECR B;  4AGS A;  4MA9 A;  1M2A A;  4IEL A;  2C4J A;  5AIS A;  4L8E A;  3P7X A;  3A2X A;  3LGC A;  3RHB A;  5ID2 B;  2FA4 A;  3ISO A;  1ZZY A;  2QKE A;  4F0B A;  3FKF A;  3C1S A;  2DKH A;  2K18 A;  1FVJ A;  4K2X A;  2JSZ A;  3WD6 A;  2CQ9 A;  3WGE A;  2CZ3 A;  2I3Y A;  4ZXG A;  2GT5 A;  6GSX A;  1QK8 A;  1HQO A;  2DML A;  5KOW A;  4ISD A;  1ZGN A;  4PNF A;  2HFD A;  2GST A;  4ML6 A;  1V98 A;  4YQV A;  5HFG A;  1GSE A;  3TB2 A;  2E7P A;  2CVD A;  4MZC A;  2YJH A;  3IHG A;  4TKY A;  4WF5 A;  3D6I A;  4LL4 B;  4ZB8 A;  17GS A;  2G2Q A;  4RI7 A;  1OC8 A;  3KP8 A;  2VL9 A;  5DQY A;  1KNG A;  5ECH B;  4N30 A;  12GS A;  1EV4 A;  4TR1 B;  4TR3 A;  3KJY A;  1TJD A;  2R6K A;  5G31 A;  1IYI A;  4NHW A;  1CQG A;  2NTO A;  1V57 A;  2F51 A;  1PQN A;  1YEP A;  3WYW A;  5F0G A;  3KCM A;  2R4V A;  4FYU A;  1O6J A;  5HFK A;  4HDE A;  3UOM A;  1F37 A;  1SEN A;  5AIX A;  1SYX A;  3KIJ A;  2FY6 A;  3UEM A;  1GUK A;  1JZW A;  3Q74 A;  4L0U A;  1T00 A;  1S3A A;  2E2M A;  4TR4 A;  2VCZ A;  1M2B A;  1YY7 A;  2R0P A;  5DCG A;  2YAN A;  4KCE A;  3QD9 A;  5IM9 A;  1XCC A;  3CXG A;  1J0F A;  3UMA A;  3VFI A;  2H1A A;  4BPY A;  4MLY A;  1K0B A;  2VL2 C;  1U6T A;  1W4V A;  2X8G A;  4QQ7 A;  5ECI B;  3QCP A;  4MDC A;  2WB9 A;  5CNW A;  1FOH A;  4F03 A;  4TW5 A;  3RAZ A;  4ZIJ A;  4GTU A;  1XWB A;  1UA5 A;  1H75 A;  1PA3 A;  2IMF A;  1XVW A;  1R26 A;  3HZ8 A;  4MCU A;  4EF0 A;  5A4U A;  2YP6 A;  2K8S A;  3UAP A;  2H19 A;  4H86 A;  3F9U A;  4PUR A;  1TP9 A;  3FR9 A;  1NM3 A;  2E2G A;  1V2A A;  4DVC A;  1BED A;  3H93 A;  1THX A;  1OE7 A;  2B7K A;  1TK8 B;  1XXU A;  1VF2 A;  4ICY A;  3L4N A;  3P2A A;  2B7J A;  3LYK A;  2FWE A;  2IJY A;  4J2F A;  1EOH A;  4EIQ A;  4HS1 A;  5HR3 A;  2IFQ A;  3PH9 A;  1OVN A;  4BVX B;  1HNC A;  3H1N A;  4CY8 A;  2GLR A;  2XBI A;  4GQF A;  2A2P A;  3TJK A;  4EE0 A;  1XW5 A;  2KP2 A;  2FHE A;  4GRF A;  3TJF A;  1Z5Y E;  3E9J B;  2OKA A;  4K2D A;  2HNL A;  1ZYE A;  4IP1 A;  5B8A A;  5EPF A;  4RQR A;  1A2L A;  2FCH A;  1GUM A;  1R4W A;  5H5R A;  3QFB C;  4I97 A;  2DSA A;  4WF4 A;  5GAN D;  3IK7 A;  3V1W A;  3DVW A;  2C0D A;  1X5D A;  3C1R A;  2F3M A;  5J9C A;  2MBT A;  5E4W A;  4TR0 A;  5ECN B;  1FG4 A;  3TOT A;  2J23 A;  5DAL B;  2R0G A;  3MAK A;  3FMW A;  1A0R P;  3FZA A;  4L5L A;  1MEK A;  1DSB A;  5EL8 A;  3HJM A;  3DYR A;  1Z7P A;  2GS3 A;  1KBN A;  2GSQ A;  2MMO A;  2YNX A;  3IK9 A;  1QGV A;  3FY7 A;  1Z6N A;  1TKD B;  4GSS A;  4G0L A;  1WJK A;  1R5A A;  3C71 A;  4V1A p;  2L5O A;  2UZ8 A;  3HKR A;  5HQP A;  2LTK A;  2OA7 A;  4EIP A;  1B4Q A;  3IV4 A;  3QMX A;  3IAM 2;  2O7K A;  5ECO B;  5LD0 A;  3TJG A;  1X9W B;  2VM1 A;  3KP9 A;  1JZO A;  5IMV A;  3M9J A;  5JWR B;  4MH2 A;  1SD9 A;  4MZW A;  4KSM A;  3F4R A;  4ECC A;  3ZZX A;  2ZUP A;  3H4K A;  4EO3 A;  1PMT A;  2RM5 A;  5ENU A;  2AJQ B;  2ON5 A;  1AC1 A;  1SK2 A;  1VF4 A;  2HZE B;  5CRH A;  3GRX A;  4WBR D;  4AJ8 A;  3I9V 2;  5BRT A;  2LKU A;  5J9B A;  3TCO A;  2LQQ A;  4GWR A;  2OBI A;  4OMV A;  2BTO T;  5CRE A;  3ZVJ D;  1K0O A;  4AJ6 A;  4WET A;  3FW2 A;  5C04 A;  1WRY A;  1ZYN A;  3A2W A;  2N5F A;  4KDU A;  1VF1 A;  4OWY A;  5J41 A;  1AUC A;  4AJ7 A;  5DQS A;  3W6G A;  2NVL A;  4EUY A;  3R3E A;  4QL7 A;  3H79 A;  3QFA C;  2EC4 A;  1BG5 A;  3ZIV A;  5GAP D;  2H71 A;  5EVO A;  4OD7 A;  3HDC A;  1XOA A;  5DAK B;  2VLT A;  3ZVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...