1RQRA

Crystal structure and mechanism of a bacterial fluorinating enzyme, product complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-fluoro-5'-deoxyadenosine synthase
publication title Crystal structure and mechanism of a bacterial fluorinating enzyme
pubmed doi rcsb
source organism Streptomyces cattleya
total genus 67
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 1rqrA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 1rqrA01
2C2WA 2Q6LA 2V7WA 2ZBVA 1RQPA 2Q6IA 2V7VA 2WR8A 2V7UA 2C4TA 5FIUA 2CC2A 2Q6OA 2F4NA 5LMZA 2C5BA 2CW5A 1RQRA 2V7XA 2C5HA 4CQJA 2V7TA 1WU8A 2ZBUA 2CBXA 2Q6KA 2C4UA 5B6IA
chains in the Genus database with same CATH superfamily
4AXBA 1NLFA 5I7FA 5ALJA 3KQPA 3R2JA 5B2EA 1X8JA 3GPDG 4UNQA 3V7AA 3GVHA 4KQJA 4CG0A 3OFSA 1HT3A 2CXOA 2YASA 5E2AA 4GWKA 4AG6A 3OKFA 1T9KA 2IV7A 3NC0C 1UMDB 1GFZA 2OBNA 1XNGA 5AI4A 4ZOLA 1DRUA 1FB5A 4JASB 3VA7A 1DX6A 2C8VA 2C95A 3UYLA 3SLRA 1MO6A 1DFIA 3FPAA 1M1ZA 1D4ZA 3G68A 5GZ3A 3CQ9A 1Z6YA 2BEKA 4D8WA 1PJAA 2N1BA 2PXCA 3G6WA 4R5MA 1QUEA 1T25A 3E3NA 3EWNA 5CJ2A 3VPHA 2P3MA 1KGSA 4CNBA 4I99A 4BN0A 3V80A 3C6YA 4ZOEA 1ZK3A 4F4IA 4O2BA 3CN9A 1EGHA 1QHFA 1PFWA 1MJFA 1YE8A 4HVAA 3U3RA 2RB4A 4N5MA 2VAXA 1F06A 4PBSA 4R1LA 5DT9A 2W11A 2DTDA 3QFFA 1Q82D 3GPLA 2M1ZA 3ZE9A 1MEEA 4IUCS 5BUZA 3ICOA 2IOFK 1IY2A 3ABQB 3ZZMA 1E1QA 4OAQA 1QAOA 2XVXA 4B2IA 2OT3B 4JR1A 2QZJA 2FZGA 4OB8A 3WDSA 4CT5A 1N5LA 4OKSA 8ADHA 2VJOA 2O0JA 3RUDA 5D85A 4PFQA 3R0JA 2IE8A 4G5HA 4UZFA 1V71A 3TQHA 1Z56C 3IKMB 4CQMA 1ATIA 5G0SA 2BLLA 2GF0A 1ZBDA 4HQLA 4QC2A 3A8IA 1FS4A 4RA9A 4Y7CA 2D3NA 4HJXA 3BD6A 4HGYA 4BNFA 3O38A 1G8MA 2P5YA 3OSUA 3AVXA 3NT2A 3E3MA 4LF5B 1NG9A 1MO3A 3ZDAA 2OC9A 2FB9A 4AQ7A 4Y1EA 1EXDA 1M6WA 3KCQA 5G3YA 3PENA 3RFCA 2PBFA 2YYZA 3K0CC 2I2FA 1ZW6A 1MH1A 3PRHA 2QRNA 4RQBA 3PTZA 3TUZC 4CLRA 1L4EA 1D2NA 1EFLA 1Z4MA 4XR9A 1KU6A 3GARA 4RZ2A 2IRWA 1EUCA 1E89A 3FRHA 5DM60 3L0ZA 4M87A 4IDCA 2WDPA 2YZGA 1NDQA 1UEXC 3OJFA 1KJJA 3KQLA 1Y89A 1QVFB 4MVYA 5IYZB 4R9RA 1JJIA 4BEJA 2Q6IA 1ADJA 3G4SB 2AXEA 2J87A 1Z0DA 4HDNA 4RWEA 2PWYA 1WDTA 2C7BA 3N76A 3RUIA 3V7UA 1O77A 1AKQA 2ZB7A 3E18A 3ENQA 1PT8A 2VWQA 5FAXA 5U1PA 4YCSA 4ZOBA 4KQHA 3MFQA 2Q50A 4ZQEA 1EFHA 2WUWE 5BOSB 3TOXA 2E4ZA 2GBFA 4ED9A 3OZVA 2GNOA 4QULA 5T4BA 3VKWA 4EX7A 1ORVA 4RTNA 4IIXA 2VUTA 5D3MA 3OTIA 1SC1A 2X3FA 4OQQA 4V0SA 4UCXA 3ERCA 1SBTA 4U2BA 2FETA 1Z0UA 1WY5A 4QELA 2E4XA 2O06A 2G5GX 1DKUA 2GJAA 1IPHA 1YR2A 2IIBA 2OFOA 2B1GA 2A5YB 3G9TA 1H5NA 2C31A 1OR8A 4MUIA 3RVMA 1YV9A 4BLTA 2G67A 4LQ4A 3M5CA 4BE9A 5JNRA 2B1QA 4ACAA 2PG3A 3D5EA 3O93A 3RYHB 5LQAA 5LQRA 3R3WA 2CB9A 1XEWY 3PUNA 1G64A 2YZNA 4HLUC 3HVIA 2FW1A 2M2IA 5JD6A 2A3NA 5KBYA 5JZBA 4DCVA 4QJ3A 3QEAZ 1I4OA 3DB1A 2HT6A 4HL6A 1GLVA 3IIJA 3ZDRA 2AJBA 1JHAA 2I8LA 1ZH6A 2B3TA 2IUSA 2E7ZA 3LXMA 5A8AA 2NLOA 3EVFA 5F2EA 2JG3A 9MHTA 1JXAA 1TYCA 1W8DA 2JK1A 2FWBA 2WQZA 5BP7A 2J4CA 1PR6A 4Z4ZA 2FUG1 2AFIB 3K4PA 4FYHA 5CP8A 1VMIA 3M7IA 1KQGA 2W2OA 3IUNA 3MWDA 4E4RA 3FNIA 3CN7A 4HGZA 5CRIA 2X9QA 2XECA 2C7QA 3SOPA 1BEZA 3AUJB 3PNKA 4BFLA 1TEHA 2O7SA 3Q15C 4Y6SA 3TNLA 1TYAE 1Z4IA 2P9QA 3HSKA 2AH5A 3O83A 4TMYA 1VJTA 5IVDA 1CIJA 4URVR 5JUWA 3ES9A 4Y2XA 5DBHX 1OLOA 3UG6A 1EE1A 3AERB 2ZRAA 3AR5A 4B3GA 2W6ZA 4WKOA 4U2FA 3T7AA 4Q9DA 5DNEA 5KOHA 3EF1A 1Y82A 3AEXA 1M74A 5EKSA 1BMDA 4G0YA 2HO4A 1JG6A 1NJSA 1T4DA 2I67A 2W4MA 1E1YA 4S2UA 1H6CA 4Y2GA 3TRHA 1VQNB 3GH1A 4OV6B 1L7PA 1CG6A 4FT2A 5A0FA 2X0JA 4YDQA 3OPYA 2LIPA 1LW6E 3CUEF 3R0VA 4HDCA 4PZLA 1UZLA 2AOVA 1BJRE 3I6YA 3KEGA 1ZUNB 4FFNA 1KC3A 3T6KA 2E4UA 4LSZA 4C6TB 5IYPA 2ZUUA 1Z06A 3DOFA 3F5FA 4RV9A 4N9WA 3BPSA 3H2YA 2ZTHA 4WN9B 1FEZA 3ZHXA 4BV3A 2WR8A 1HKHA 2P0EA 2Z58A 5G4KA 3V76A 1B26A 4QQRA 4J9VA 3EAFA 3QUBA 3ESYA 3QYPA 1UADA 2A9FA 1VKHA 3UK6A 4Q24A 1Q12A 1G16A 3WGTA 4TYWA 1YAJA 3D4BA 3G17A 1U65A 5JG7A 5F5NA 3M70A 4FYVA 4HSGA 4P7KA 3GA5A 3WR5A 3DMTC 1M6YA 4YBZA 3M4NA 2JGFA 3IE0A 2ZYTX 4AUMA 5SZKB 5K09A 3DTVD 4OIFA 1W5BA 3WLAA 2Y1EA 1WW8A 5GV8A 3I01A 6NULA 4DV0B 5BSXA 1E8MA 2GPNA 3P32A 3TIIA 1O5OA 1Y3AA 1EBUA 3NXSA 3VHXB 4OQMA 4CMAA 5BSKA 3RYIA 2I99A 5HNKA 4MQ5A 2I6QA 2JLVA 3VYWA 1DIGA 1N2JA 2GCOA 1R4AA 3K6JA 2JLZA 1JZSA 4M55A 1THMA 1FBNA 1QYWA 2B9VA 2ANBA 5JC8A 2V7UA 2JCBA 3J7TA 1IJEA 4OAPA 5F51A 1NR7A 2PH5A 2PN1A 4CMJA 3BGWA 3IT2A 1YL6A 3JW8A 3NO4A 1JEYB 1A82A 4IEFB 1VE6A 1S2IA 3DEFA 4RS3A 1QIJA 1KY5A 4UAJA 4LJAA 4GT1A 2FUKA 3Q7PA 4HDRA 5C7IO 4OREX 2DWCA 4RFSA 5JPCA 1BU5A 1KVTA 5FNVF 5EYPA 3ZWMA 1RS0A 4LJ7A 1DHTA 4MDHA 4KR6A 5LA6B 2VNJA 2Y1FA 3ZZTA 4NMWA 2JH3A 5EHNA 1AGYA 1BFDA 4CR6A 4WL0A 3FM9A 3O2SB 3THXA 3CG0A 1RT9A 5L3VA 3HL0A 4XQ9A 4MA0A 4HAWA 2CDCA 4BRSA 4E7OA 4RULA 4D9MA 1E5QA 5F3DA 1G7CA 5MN6A 3SMVA 3WDLA 4Z4WA 1MQ9A 2B7LA 2GPSA 2RGWA 2G06A 5ENZA 3QHPA 4RABA 3SHTA 1JFSA 5AOCA 4FUQA 3DFUA 3E9YA 5ALZA 1P33A 1HKUA 3O74A 3D02A 3UV7A 1O6GA 5C7YA 1SOMA 4O1HA 1SIOA 2QTAA 4MDEA 4K86A 3B6JA 2C4WA 1B16A 4O4HA 3A6ZA 2WWWA 4EI7A 1G42A 3I04M 2JD2A 3C5EA 2C29D 1XHEA 3I2YX 3IIIA 3LBHA 4QOJA 3WE7A 4DQDA 2J6IA 2VSFA 3M5WA 2B2NA 1MA0A 3G2JA 4NOLA 4GDFA 4HN4B 1OH7A 1ZCBA 2JRLA 3BJIC 2ZTGA 2HQ1A 2RGGA 4TTAA 4P4NA 5E8RA 2OCIA 4PICA 3I34X 2REQA 5DWQA 1DLJA 3TL2A 4B85A 5JSFA 3PGKA 4FTWA 4EHFA 4X20A 4PYQA 2QM0A 3V6MA 1U3CA 5M7EA 4CM5A 4DWVA 4R2HA 4YJ3A 4P8RA 4MRMA 5AVVA 4X1KA 3U7RA 1XVVA 1U8FO 1SC6A 1JQLB 3CCRB 1U0EA 1UMCA 2GGSA 4WMLA 4Y2TA 4CV3A 4DLPA 1VCHA 1E6EA 1UBSB 1SIBE 3ASTA 1D0SA 4EYOA 1RWQA 2C2HA 3PF9A 2NIPA 2YW2A 1IHOA 3O73A 5JCOC 2O3TA 2DLDA 3GU3A 4P3PA 3ZY6A 2I5PO 1TK2A 5AW2A 2XNDA 2PJZA 4FXOA 3I3OA 3IRVA 3HXMA 2GASA 1UD3A 4MQFA 4OQYA 1SUBA 1Y80A 2LE0A 4J29A 1ZISA 4WASA 2MINA 4UULA 2YZ2A 2IHNA 1EM8A 2XGGA 3NLLA 1L4YA 4XX0A 5D51S 3H84A 2WYOA 3V42A 1YNSA 1PE0A 3LQYA 5CA0A 1VJGA 2PTGA 1AMOA 2C1EA 2F3UA 3BGVA 4QDJA 2O2GA 4WCFA 4PAMA 5J1TB 1D6MA 4BB9A 3IDOA 4LECA 4WHMA 1V16B 2X13A 3BWDD 4DZRA 5KSPA 2WG1A 2YWBA 2ZREA 4C0WA 4DJFC 1J7KA 2VUHB 1P8JA 1DXHA 2XTAA 2IL1A 1A4RA 4FVTA 5G02A 3L1JA 5KHAA 4D9FA 5BRAA 3UWSA 3HE3A 2M32A 2X19A 4U8HA 1ZH4A 1SUPA 4IIJB 1AKTA 1DIRA 1XMIA 1Y9AA 2VYVD 4YDRA 4RM3A 3CLSC 4AYTA 1K89A 1P7YA 3QWAA 4KRGA 4Q3BA 5KYXB 1TRHA 4DR7B 1DT3A 1WXDA 2K4MA 1QIGA 3H1EA 1PHPA 4ILEA 4A92A 2I78A 1Z62A 3FFBA 4L57A 1QLJA 5IUKC 1H85A 3ND7A 1DMRA 4QYSA 4JMLA 4KPYA 3GAAA 3FD8A 1DEKA 3T51B 2AK2A 4I1YA 3D54D 4OI4A 5KOJA 1GD1O 2XE8A 4OJKA 3IPXA 3PDIA 3UWDA 4G86A 1NLYA 4QBTA 3U1TA 1VGVA 4ZCTA 5L7TA 2B20A 4R2KA 2NPFA 4HWSA 3UKOA 2VJCA 4J7CA 3WNZA 3OZCA 2PGXA 2QQFA 4AAYA 3F9CA 4B17A 1Q1ZA 2WM9B 5A9SB 1GFSA 4ZRNA 3AEUB 1DFHA 1KU0A 1ZCAA 2FV8A 1Y63A 5M34A 2A1TS 1PP4A 2H4HA 3PC2A 3JU3A 4JLMA 1H69A 2P9GA 1GUZA 5CB6A 3LCJA 2PWAA 4LBVA 2J4FA 1HK7A 1PFKA 2A57A 2HJGA 5B3JC 2EZ8A 3T34A 7ABPA 4CWAA 3HP1A 1RYYA 3EAQA 3M5DA 3ZQKA 1FU7A 3EQ2A 4D8XA 4FCVA 1LLFA 1M2VA 3GL9A 2JZOA 4OOXA 4C1NA 1P73A 3QYFA 1NLUA 3NYIA 1I7LA 3WGLA 3AUSA 4JCCA 1RYFA 3FR7A 3KZCA 2C04A 3RSCA 2A0WA 2P65A 1PSZA 5ICEA 3T3EA 1UDCA 4BV2A 1WB4A 4ALMA 3NBZC 2XD9A 2BY4A 3LCUA 1PV1A 2X42A 3ZWCA 2CV0A 1V26A 1EG2A 1XZLA 2X6QA 3DLPX 1PWZA 3LY9A 1J1ZA 1MMFB 1TL7C 2IOYA 4MB6A 2WSMA 5DBIA 3ZVNA 2BUCA 4V2UA 2QD2A 4W1RA 1Z5VA 4O4IB 4P3NA 3V8RA 2YY7A 3A28A 1CU1A 1KJQA 3GGCA 5REQA 3S1AA 4BO7A 2CSXA 2GA9A 3DDHA 2BHSA 1Z12A 4UXHA 3TNDA 1LVUA 3X0DA 2YOFA 3PI6A 4BRUA 1UK8A 5HUJA 1OB5A 2QJWA 1ZL0A 3GT4A 4P81A 1E5XA 4TKZA 1VE3A 1FIUA 2G76A 1Y5MA 1MX3A 4BBPA 2VP4A 4FFPA 1T1JA 4DILA 5HQ3B 5EUBA 3IE1A 3ZDYB 4IV8A 4JOCA 3TNFA 1QAQA 1WMBA 3QVOA 3SZ3A 5AMXA 2YMQA 1WP6A 1ISMA 3AR8A 4JJ8A 3HYLA 4NYMR 3NOVA 4M0DA 3HVRA 3I42A 3ER9A 1T24A 1AC5A 2XUKA 2VO1A 4JLSA 4UATA 1WQ4A 2HBYA 5FBWB 5C8XA 2E1RA 2FSSA 1A50B 2PHZA 1PK8A 3L4BA 3OMWA 4WFIA 3KPUA 1IH8A 2JHAA 3PVCA 1KVSA 5CURA 3SM3A 4F1KA 4JUBA 2JGAA 1H2FA 2J45A 4YRBA 4RENA 4NCIA 3I8XA 1X8LA 3PUWA 1PWEA 1A88A 1Q74A 1QIMA 3DFKA 3TQIA 4CLHA 4LHYA 4P3KA 1DMSA 1G63A 2BONA 2HWUA 3CCVB 1PU2A 4NJEB 5JD4A 1UFQA 3EPKA 5BSWA 2PLRA 1X3LA 2Q8NA 2WNSA 3OM1A 4JXKA 2AGVA 5KOYA 1TADA 1Q7CA 3USCS 3SIPA 2G63A 1XG5A 3C0KA 1GAWA 2XMPA 3M1LA 3G59A 1VFNA 3HK2A 4NZOA 3BDIA 4PXAA 4XUEA 4XSHA 2UDPA 4OL9A 2ODWA 3VR3D 2MYNA 3BQ9A 3P0JA 5JW6A 2FOXA 1S7GA 3BXXA 4FYMA 3SZLA 2GCPA 2Z5LA 4QDTA 1CUSA 3IALA 2L82A 1H2XA 4M1MA 1WUJS 2G6BA 2VRCA 3NWBA 4MHTA 2VUIB 1FRZA 2AVNA 5DSZA 2W6IA 4RDCA 1VMDA 2B0CA 3GHYA 1DOZA 3KYIB 1M5TA 1E8DA 4MZDA 1Z73A 1RXEA 4PPNA 3UMFA 3A3PA 4GSLA 4RZXA 1XPOA 1S96A 4YALA 1EXNA 5AHWA 1PZMA 2ZI3A 1CUUA 4H9GA 1OSNA 1SZCA 4L7VA 1EX1A 1BMFD 3ORHA 1FCJA 3UJ9A 2P6RA 3JQ8B 3CONA 2PRKA 2ZKIA 1EVIA 4QEDA 2IZ1A 3Q5EA 3I2GA 4ID3A 3RODA 3WMFA 3FMIA 4KV9A 3NDRA 3IT3A 1LC3A 3FPBA 1N6NA 3GT7A 2ECFA 1U0GA 4ZQBA 1VF7A 2Z9BA 1UXKA 4YMTA 3P71T 3DDCA 4OMUA 3VOAA 1L9KA 1RXCA 4I1VA 2D06A 3EIXA 1QMGA 2B8JA 3MWKA 3G0HA 1SBZA 2QAJA 1D1NA 4PPGA 1ZNZA 3EFOA 5LQCA 3C15C 2AMVA 4BMOB 5A4DA 5JJKA 3PUJA 3LUBA 4Z4HA 2A5LA 1NZFA 2R3SA 1U3DA 5K0BA 1XZHA 3T1OA 1E9CA 3V4PB 3UV3A 3KEOA 2PCJA 2BE9A 1YS6A 3CRQA 2UXCB 4NAUA 2ZXUA 1L7RA 3M4JA 3B8EA 1U9YA 4MYHA 4BX2A 4WNAB 1ID1A 1RKVA 5K3FB 5LQDA 4NOJA 5AR1A 3THYB 2DPHA 5FFMA 5A3SA 1CFJA 4LRTB 1G2PA 2Y6UA 5FBKA 3Q7TA 2XQGA 4WINA 4Y9RA 3PJFA 3ZLTA 3ZC3A 5EP2A 1MN6A 2W2LD 4NOMA 3UWMA 5FOWA 4PN7A 5BMVF 1GNLA 2HQRA 3PUYA 3F4BA 2A14A 1W6UA 3OCUA 4NFLA 3RUCA 4C0BA 2GZHA 2BKXA 1W87A 1L8AA 2RSLA 4D0GA 5K2OA 1E2MA 2CXPA 4I1RA 5BR8B 3AVWA 5HIIA 1TCVA 2X3UA 1II8A 2FA9A 1C30B 1H1LA 4ZCIA 2HX1A 4GO1A 4GP9A 3H19A 4IFEA 4C5BA 4C88A 2IPMA 2ONJA 2HHAA 5FBVB 1O08A 3ANMA 1QNFA 2Q1WA 3QVGB 5ES4B 3AZOA 4OYLA 4HNGA 4DW8A 5GTDA 3OLYA 5JCJD 4OP3A 1NVUQ 3H3FA 1L5MA 2MYTA 2W6NA 2X7XA 2ASEA 4FYPA 1NYTA 4KUGA 4S1WA 1B2RA 3GOHA 3KVOA 5FR2A 5GGXA 4EIWA 3F90A 3I64A 1Y9DA 2PCLA 3ZUGA 1E5VA 1TYZA 2QVGA 2XOXA 2GOYA 1U1FA 1L8QA 2IELA 2PD6A 3KTDA 5EQJB 3M6VA 1A9PA 3BK2A 1E1MA 4L5AA 1A27A 1U2RA 4FSDA 4I3HA 3MWEB 2VNHA 4L3OA 1SGWA 2AC7A 1KY4A 4BNYA 2CHEA 3E9ZA 3DFIA 4MARA 5EG5A 2H63A 1MG0A 4V0QA 5DM4A 2VDRB 1K8XB 5H4GA 1CUHA 2A59A 2NUAB 3U6KA 4B47A 5IMSA 5JO0A 1KYXA 1HQCA 5AOAA 4ZVOA 2UZ4A 1XLWA 3C1TA 5HKBA 1F2DA 1P2GA 4FIZA 4MUYA 5K6AA 1XLVA 3K5WA 4Q3DA 4UMDA 1D2AA 5KQPA 1PT5A 4HH0A 3F3MA 1K7SN 5TVKA 3T5TA 1NR5A 2O0MA 5KJEA 3Q7IA 5EHQA 2BMAA 4MPJA 2G4CA 8LDHA 3VR5H 3DSRA 3DD1A 3NASA 3NC1C 2DIEA 1YIOA 1BCSB 1JAHA 1CUWA 1RYHA 1HDZA 2XDQB 1MJGA 3DLTA 1LBHA 1R3DA 2AZ4A 4DOMA 3ROZA 3UG7A 1F6BA 1WSBA 2E1PA 5CD9A 5CB8A 1IULA 1B6TA 2GRJA 2XYVA 1JR3D 1LJLA 2BGIA 1VIYA 1OFUX 5F4OA 1H1DA 2BEJA 1MABB 2BSXA 4OHPA 4TN5A 3VDQA 4QSMA 3SQWA 1NBME 2FRXA 4JT2A 5P21A 4BLVA 2BFEB 4ZYTA 3LDUA 2W48A 3RJ9A 1Q16A 3S29A 3H1TA 4RKEA 2X0DA 5E9WA 4GX5A 2NU9A 5KYWA 1H9BA 3ZW8A 1IAVA 4RLFA 1DE0A 4I5DA 2IQIA 2GPTA 5DYTA 4AWXA 1PR0A 3PIRA 2ZZNA 1JPVA 4LRQA 2ZUEA 2JIPA 4PBTA 4LXGA 4DNPA 2GO7A 3L05A 5IT9A 3UOWA 2X0NA 4I55B 3LCMA 4J16A 4L5CA 4GKKB 1G4AE 3GUUA 4TS1A 4ARAA 5BV8A 4Z0HO 4DDUA 1D4FA 3LLSA 1U8UA 4UC0A 4DLVA 1L5KA 4TWBA 2CCGA 2HAEA 1OTHA 1NY6A 1ZOLA 1T9BA 4FFBA 4ISBA 4TMFA 4U7JA 2C5AA 3KU1A 2F7SA 1KQNA 1N4AA 4Q4CA 4G1EB 5ADUS 3UMMA 2OESA 4NCAA 4WJZA 2Q4RA 2IYQA 3MTEA 1N7IA 2BZ0A 1M6VA 2VTVA 2WILA 1VJ1A 2WTEA 2ZR7A 2WJIA 1NUTA 3HA7A 4LCJA 5LXTF 5ILOA 3SWWA 2GN4A 3U3KA 2FQWA 2E82A 3FYUB 1ACLA 1PJ3A 2AT1A 3X2FA 2PNJA 4F4FA 3C6MA 2Z9DA 1R0BA 3OBIA 2R6ZA 4YCLA 1R66A 4DIKA 2JCGA 3GGJA 5EWLA 1ZM4A 5LBTA 2Z56A 3KWMA 3BJMA 2PMFA 4GZ5A 3LLMA 1XB2A 4UCFA 4XYBA 2RE8A 3OTWA 4K6HA 4K8RB 4Q9LA 3B3JA 3GAFA 4K46A 1LTHR 4MLPA 3D1VA 4GM4A 4UVIA 3JQ7B 3TZQA 1L4KA 4J8PA 2C0CA 2E5WA 2VQ6A 3CO5A 5AHRA 1BMQA 5AHOA 4ZGWA 5JJCA 3K0FA 3TMKA 1PHRA 3VU3A 2Z98A 4X71A 4LHSA 1ESMA 4AQDA 3C7AA 1U3GA 2OE2A 3KT3A 1PJRA 2HUNA 4P7BA 4CV0A 3OWOA 4HLQB 4F4HA 5I47A 4L4SA 2HF7A 1RZVA 4P4SA 1BMTA 5CYFA 1JJ2B 5E6SB 1X1SA 4FGLA 1CW2B 2R1VB 2PT6A 3C8ZA 3Q9LA 2DB3A 3WL6A 4KAAA 1DBRA 3LVRE 3R7SA 3AG6A 2FRDC 1JJBA 4E4YA 2JJ8A 1G3MA 4EITA 4C30A 5CFQA 1UWVA 2NSDA 3X43A 1XALA 1LI5A 1IB6A 1M2HA 2EEPA 1YK0A 3M6AA 4I9FA 4YJGA 2Y3IA 2UYOA 5AI9A 1K7EB 4S24A 4BMYA 4U7WA 2NVUA 3HFGA 2PGNA 5CLQA 2W6OA 1ZINA 2QN6A 3ZKWA 3ZV7A 2BGRA 1NVEA 5JSYA 1HE3A 4BOYA 4Q19A 2VTEA 2WPNA 5D7NA 3SSNA 1E6CA 5B6PA 3K1JA 1W9XA 3PDWA 4N03A 5F52A 1C3VA 1Y8QA 2ZWMA 2WJ4A 3CXUA 4UM8B 3D5TA 4WFKA 2XMDA 2DT5A 1A3CA 2IZZA 1T5DX 4HGQA 1PFGA 4S1VA 2QZ9A 3DEJA 3I9V6 1P7WA 2MYUA 1UKBA 3IP9A 2QMOA 3OU6A 1TQ2A 2QVLA 3MCUA 2ZAYA 1ZM2A 2JD0A 1RQPA 1FFWA 3KHUA 4MPPA 3Q2KA 5J4HA 3EVGA 4GXTA 4N6OA 3UAGA 5LWHA 3I73A 4U7DA 1GOTA 1CUEA 1P5RA 3SKXA 3FKSD 1RSZA 2FPSA 4LQLA 2D7DA 5J5VA 3JWPA 1YZQA 4UFPA 1XPUA 1BKSB 1Q92A 1ZIPA 3N28A 5FUXA 3EBOA 2JA1A 1XK6A 4RADA 1BDMA 4DCGA 3N5KA 2D62A 5FTKA 3BGSA 5A3VA 3ILYA 4HQRA 1CY6A 1JWBB 3RTEA 1PYDA 5EIEA 1G0OA 4HDSA 5F5LA 4FB5A 3P8ZA 1OFGA 1T2DA 1BWRA 1P7VA 3UQYS 1KH2A 3GLGE 2RHLA 3BY1A 1T1IA 3LLCA 4N47A 4NS1A 1TTQB 5A7HA 1M2FA 4UTXA 3MG9A 2NU7A 5T57A 5A5EA 5IKEA 1YO6A 1N9GA 2E48A 1UBKS 4UAUA 4XFDA 5FYDA 3KQKA 2OWEA 1QRAA 5I4CA 3B6IA 3PEFA 1A1VA 2OV2A 3BH6A 4P38A 3RUPA 5A0VA 2ZP1A 3O92A 2V6JA 3U4GA 1KOGA 1P4JA 4M99A 5H16A 5CDGA 3CPWB 1NBHA 3NOXA 4MVJH 2NZYA 4WT7A 3T3HA 2AFHB 4CHTA 1YBAA 3H8JA 4AG5A 4KU4A 3ER8A 2E18A 1I1HA 2XT6A 4G9EA 2F55A 1CQPA 2BAGA 3OQ1A 2AMFA 3G2NA 3W3AH 5J2UF 2C7PA 5JO9A 2WTXA 1NXXA 3TLGA 4UHHA 5ALEA 3UHOA 1ECPA 2AUMA 2QTBA 4UEWA 5EAIA 5CAEB 4B82A 1QK5A 1U80A 2YJNA 2Q4BA 4MGZR 3CD6B 3N87A 2FHPA 4U7PB 4HPWA 3ZU6A 3VV3A 3OZDA 4Q7JB 2JFNA 2W2XA 3I12A 4TKLA 5FXMA 1OKKA 2OORA 1USKA 3EVNA 4HMOA 4Y6GB 1NKTA 3V9PA 2FSIA 3UC5A 4E03A 4GZMA 5BSYA 1YZGA 2CCKA 1IK6A 1GZDA 1NNI1 1KA9H 3PS9A 5KINB 1WHTB 4RAOA 4E22A 1I1QB 2YHUA 1X1TA 1S3FA 2CJYA 3GGDA 3GRVA 3KQVA 3KKOA 4Z0PA 2HA5A 1ZRSA 3NIWA 4FFLA 1CD5A 4RIGA 2MSEB 3W5SA 3Q6QA 2PZKA 3O4IA 1OOEA 2BTQB 2RGRA 1XSEA 3OE7D 3D2BA 1VHJA 3H9BA 2BI8A 1ZAYA 2DKOA 1S02A 2VLIA 3QX7A 4MS3B 2ISCA 3TLAA 3UOGA 1C3OB 4KDFA 3WOVA 2ODQA 3WLHA 1K1EA 1XVUA 4DCTA 3CLSD 3NU1A 1A95A 2I7TA 2VAWA 4ETMA 1I2MA 4IKPA 3RBAA 5A1JA 1CR1A 2VHVA 3NOQA 1F7VA 4XW2A 3ROTA 4CIXA 2Y66A 1KOLA 3LW8A 4AKTA 4AJHA 4F6CA 1E79D 1HQDA 3L4EA 5ALDA 3X1MA 4HRYA 1DBVO 2BEUB 3MD9A 3IEMA 1EA7A 3LW7A 2WT4A 3P97A 3IUEA 3VZSA 1Y5RA 3HC7A 4OGGA 5J43A 4IF4A 3HO6A 1Y3IA 1NVXQ 4MOWA 1N2CB 4U2GA 3AKDA 4ZQHA 5H3HA 3VSEA 4MIYA 5AM4A 1K4KA 1SA0A 3QMMA 5JY6A 2G83A 4X8IA 5E4TA 5M2QA 5CB0A 3ZZ0A 1ZM3A 1G5RA 2AFRA 4JFAA 3VOBA 1EGMB 2RCNA 2O2CA 1XHLA 2WVGA 3P9NA 1E7WA 4ZT6A 4ZVSA 1IC6A 3PRKE 3V8BA 1HC7A 1T9HA 4TWJA 5HXAA 3U56A 5FD8A 2IZ5A 1I0ZA 4AFNA 1GNVA 1UBCA 1M1UA 2RH8A 2QUJA 3LOUA 3MJHA 4YK7A 2FW6A 1CY0A 2M9MA 5LL6P 4BYMA 5BOSA 1YDWA 4D44A 3N53A 3ZIUA 4HAVA 1Q0HA 2HRCA 4XB2A 3EAGA 5I48A 3M81A 4P5DA 5DRYA 3BF7A 2PZJA 3C16C 1B0UA 1K6IA 2VDNB 1UD6A 1JUDA 5BSFA 3RM3A 2VIIA 2WYVA 1Z26A 4QG7A 4P6YA 3QNMA 1L5QA 3GLHB 3ND6A 3O75A 4FKZA 4OF4A 2DBRA 3RYHA 3MGBA 1SHKA 1SCKA 3HLTA 1RM3A 2ZANA 4TLLB 5CNMA 5DJ5A 3KKLA 1BWSA 1E5DA 4A91A 5EJFA 5BV0A 1ZD2P 2JLWA 4XVUA 4UFNA 3JTMA 1WVGA 2ZRPA 4LV8B 4U0JA 4K26A 4YXFA 2GBLC 3Q39A 3QY0A 2VDJA 3HMKA 4I9HA 4J76A 1R5OA 2FZKA 2CXQA 3PQ7A 1YOBA 4QXAA 2ZSHA 3ZCQA 1QBGA 3P9PA 3CNEA 2WWXA 4F92B 4UTNA 5IXSA 3QITA 4Z4GA 3SQXA 1K97A 5F1YA 5ALYA 3H5IA 2GSDA 3QNWA 3WA6A 1P1JA 2QGNA 1SPBS 5MN4A 1FBTA 4J75A 1YC5A 4XE5A 3RAFC 1M2OB 3Q38A 3B9BA 3ETEA 3FMPB 4OI2A 4Z4QA 4LJ6A 1GZHB 3GFGA 1ZN8A 3W05A 2HJ9A 5EQDA 2R6AA 1EFCA 1LW7A 3LLUA 3GEEA 3A9UA 1DUIA 1T4BA 3ELUA 4R1OA 1XK7A 1T1GA 1ZNWA 3PTAA 4AT1A 4M53A 1P4AA 2E85A 3BWXA 3OZFA 3KUCA 2V1UA 2WU3A 3O8LA 1Q81D 1ZN9A 4E94A 3GJ4A 1TMGE 3TGPA 3LA8A 2O8DA 1R8YA 3IAEA 1G41A 3CVYA 4BNDB 3JZFA 2Q2NA 3E58A 3KKEA 1SBYA 3RLFA 1N0WA 4QTTB 4RZIA 2CYCA 3SFVA 4Q9AA 3OOHA 2C9ZA 3CMCO 3PJDA 4FFSA 5KX5B 2VHUA 5LQKA 2JDID 4Y1RA 4RTKA 4MW7A 5AP9A 3I9JA 4DDKA 4ERNA 1H8HD 2VZ8A 4CMKA 1XQBA 2V8OA 2WOOA 1U28C 4QVAA 3BEDA 3AB7A 3GROA 4KI0A 3BT7A 1NJ1A 4C6TA 4D25A 3A9CA 1GL9B 1I2DA 3R41A 4ACBA 2YOGA 3N2LA 1S1MA 2WIFA 5IVIA 3DT8A 1V95A 1JH8A 1YDFA 4YVFA 3RU3A 1LDYA 1Z2PX 2OD9A 1GCGA 1H23A 4BFSA 1CFZA 2FPUA 4MV7A 2XQIA 3SN6A 1CRLA 3UAOA 1VG9B 5T67A 1CEQA 1PBNA 2L17A 4EHDA 2C1ZA 1WZ2A 1Y98A 1NVVQ 3I2FA 4CKXA 3MD0A 2UXDB 4YMGA 1Z2CA 2FUG6 4Y9SA 1USWA 1FTSA 4NNPA 5DSTA 3CPJB 3VR5D 1P6UA 3D6NB 2HR1A 3R3ZA 3HL4A 2WJGA 2QUAA 2ZU0C 1QP7A 5ALNA 2J9FB 3M4ZA 1UKCA 1LK0A 3QBTA 1Q0UA 3GEDA 3GWGA 3D9QX 3BHJA 3OQIB 2BFFB 2I6FA 4N41A 3D26A 5CVUA 3LVQE 1G5TA 1FW6A 2P3LA 4Z9AA 1EFUA 3GYBA 2D2XA 3QLJA 5GZ6A 2P4EA 1VSBA 4E6EA 4MVJF 4ZMRA 2JLYA 3HYCA 1ZZGA 4MGIR 5JD3A 3SICE 1R6AA 2M1XA 4DNFA 3GELA 4BNXA 2GZRA 4DIEA 4JYAB 4LTMA 4PQGA 1UPUA 3CYFA 4DHEA 3ZDBA 4O59O 4B9EA 2H08A 3IC5A 3H1BA 1QHHB 4L3VA 1NB9A 2ZXEA 5FYQA 5IBRA 3OUUA 4Q1DA 1J8FA 1BHSA 1G8KA 1ULHA 3KRTA 2PS9A 3OFVA 4JB2A 4QDXA 4CEHB 1KO5A 3JASB 4F91B 5GP1A 3DAOA 3SZUA 4TWIA 4C4RA 2EL9A 1K3FA 3KLOA 4Z49A 4Z3DA 1G6KA 3NI2A 4HMQA 3O8NA 2WU8A 2D1FA 2JGDA 4ZAWA 5LA6A 1M83A 4M1SA 3IDAA 1Z8FA 3LJKA 4U7TB 5K0NA 5EIXA 1FTGA 4BUZA 2GVNA 3GZNB 3CVWA 3K5IA 1T5LA 3DBLA 2JFYA 3FNFA 5G3ZA 3GW8A 4FMDF 3WKBA 4N3AA 1KNXA 1XD2A 2NW6A 2HFJA 3H1FA 4LY3A 2IV3A 2I0FA 3PWTA 3S68A 1KAEA 4CM6A 3HB9A 3LLVA 3RS8A 3SIRA 3SYLA 3WX0A 4B5KA 4OUKX 1TUEA 1NZDA 1X86B 1SUIA 1W4ZA 1ZGHA 3QF4A 2Q28A 1QGZA 3PNPA 4XWTA 4YREA 2RHDA 2JHPA 3EWSA 4BJ6A 4TUYF 4ID9A 2DCMA 1R6XA 4KXUA 1PKEA 3NHLA 3MBOA 4K88A 1QZXA 4IQGA 1I36A 4R01A 4BHTA 4TTPA 1OXMA 1ESNA 2BGNA 4U5QA 3DTVB 4BKOA 3C5VA 1E1CB 4JXZA 5HOEA 2VJYA 2XOKD 1IHDA 4E7PA 1FSGA 2OUIA 3B5IA 5KNLA 5G0UA 5IW8A 4PYOA 4XVQA 5NULA 3BH0A 3EA4A 5BWLA 2NO6A 1V3QE 1VQPB 4JYBA 4FR2A 3KHSA 5FA6A 3RGWS 4RFLA 1G3UA 1WW3A 3L8CA 1JIXA 5LLTA 3PXEA 1KDVA 3UAYA 4ZJZA 1CR6A 1GADO 4YRRA 2GLUA 1CHNA 3MFYA 3AUFA 5MN5A 3WNDA 1KYYA 4AD8A 3RD5A 4K0RA 4KKVA 1JDZA 1OLUB 4C04A 3MQFA 5LM3A 2IYUA 4IDDA 3JQFA 1J7JA 4RKFA 2FPIB 3NBYC 3YASA 1QCCA 1NVFA 4X00A 3ZLBA 3A8KA 2QS9A 1G8PA 3NR2A 3C1OA 5DXFA 4Q9KA 3RSLA 3IPYA 3SS9X 2ZTSA 1N75A 1HDGO 3TLJA 4MR8B 1WHSA 2AMJA 4DNRB 1ZU4A 2JJ2D 1SR8A 3JYHA 2QW8A 1HR0B 3WC4A 2XCTB 3KP1A 2Q8QA 2RARA 5KVCA 2C2XA 3M6XA 3GVXA 2GAJA 1A7JA 5E1DA 3HFRA 1G6HA 2ZIZA 3A58B 3VHRA 1P3JA 1AM4D 3HBMA 3ADKA 3FCYA 4YLEA 4BC0A 5KNBA 1OW3B 2OPHA 1VL5A 3AQIA 4RELA 5IAJA 4ZYWA 1CEEA 3BGDA 4CEJB 4N48A 3OT4A 3ZXSA 3LKDA 4BLRA 4L5IA 3SX2A 3B52X 3VAAA 2BJVA 2H4YA 2Q3LA 4BVFA 3Q0IA 1P1IA 1OZ0A 1FUIA 3MTBA 3CTAA 4YAKA 1IVSA 1V16A 3LUPA 3QZUA 3TX6A 1YXMA 2CLFB 2CLEB 1F12A 4H3SA 2CNDA 3ZWNA 2C58A 3V7WA 3VJKA 3EGDA 5F7ZA 1RXIA 4PABA 1PNOA 3T0GA 5AQ1A 2FZVA 4NS4A 1P1HA 1IOZA 1KI2A 1PUIA 3NTUA 4LJLA 4Z0NA 1N8TA 1FDUA 1TAHA 2PAFA 3A6DA 4B0OA 4LNUA 3RSGA 3BN3A 2AQKA 2ODNA 3IPAA 3E81A 1KZ6A 3LT5A 2QPOA 1MENA 1NYLA 4RTLA 5KAMA 2BFPA 3RU9A 4EUSA 2QL5A 4RHUA 3DE3X 4LYGA 4TKMA 5KOIA 4IGIA 1AKYA 4YP1A 3COSA 3L0SA 5TPZD 3HY6A 3NBMA 4E2YA 1NQ5A 4RK0A 4YC7A 2W0SA 3MJ4A 1Z39A 1CRZA 2C2KA 3R6WA 3TLBA 4ZOCA 4JI4B 3BORA 3DE1X 3KKQA 3P2EA 2RHRA 4GLJA 4DNXA 4KPEC 1T6YA 2VNKA 4LSGA 4B48A 2YNMD 4ESOA 5J1SB 1E7YA 2VHZA 2I22A 4ZU6X 1J06A 3EQZA 3ZCUA 1D2EA 1P2VA 1TKBA 3A9WA 5CBPA 1JBKA 2PH3A 4M1KA 1P45A 1KK2A 1B74A 4M0UA 4C78A 4DKXA 1P19A 2G04A 4EJ6A 1C0EA 4D79A 1IHXA 3ELYA 5BVGA 5AXBA 2FUCA 2QXUA 2ZJOA 2WF9A 1JFRA 2K2QB 1E94E 4MVJD 2K87A 5FF9A 3UBTA 2NTJA 4I1SA 3HCCA 4JNKA 3LG2A 2EHJA 1RQ7A 2IX9A 3COWA 4RK6A 1RKUA 1OB2A 5E3JA 1G17A 1NNEA 1SG9A 2B99A 1RPAA 1L3BA 5ERXA 4NYJQ 4KKTA 3W3AD 1OCEA 3OIUA 4LKRA 1TW2A 4BRZA 4LPSA 3VGPA 3FCCA 3L6CA 1KYWA 4D80A 4RLZA 1KEVA 3IKVA 1KMIY 2OV3A 1ZS9A 4HB4A 3BG5A 2EWMA 1WDWB 4MGKR 1SPXA 2P5SA 4L8LA 4JI2B 2NQ8A 2ZXFA 4MAAA 4XQFA 3A6JA 4FEGA 2VAPA 2EFCB 4WBNF 2QZZA 3UH1A 4YONB 3W34A 5LOVF 2PLNA 1GPJA 4DLYA 2BGGA 3DL0A 1IATA 1UANA 4F5WA 2GCEA 3AL2A 1RYNA 2NV0A 1SUSA 4A2QA 1E92A 1XTUA 2XQJA 3EZFA 4KXMA 4YCDA 1GA4A 2BUBA 3SEAA 4A03A 4AJNA 4EFKA 5JFTA 1RIIA 2W6PA 2IOQA 2C4VA 1KEEB 2RBEA 2V98A 2H1OA 1EE2A 3A32A 4UPDA 3ZWKA 4GOOD 4DRXB 3ZDCA 4FWTA 4TKUA 4LCBA 1Z68A 1V8OA 5MDHA 2WAYA 3MOGA 2V45A 2ZIUB 3KL2A 4EY3A 4BWFB 3HR7A 5BSEA 2AA3A 1TECE 2HA3A 4URYR 4HGNA 1L4FA 1W30A 1S8AA 1OVGA 3HLKA 2WSIA 3I09A 3R5FA 4R6WA 4ZQGA 1XVTA 1G6Q1 1QIEA 4WESB 5HTOA 1T2UA 1HDCA 4OHFA 4DCPA 3KAPA 3TN7A 4BU0A 6YASA 1S2MA 4F9FA 2V58A 1NQWA 2G77B 4NFYA 4FFWA 3DAYA 4RW0A 4C7VA 2RJOA 2NAPA 3AI2A 3GLIB 3T1NA 2FJ0A 2VDKB 2ZETA 3AJ8A 3OZXA 4TSFD 4ON9A 2C9CA 4NJEA 4CZ2A 4PVCA 1NF8A 2AMLA 3HU5A 4XLZA 3T7EA 4RHEA 2AXQA 2ONKA 4UMEA 4KCGA 1WCXA 3TZ6A 1K8ZB 3IQIX 1S3IA 5T8KA 3V7YA 3WK4A 5ELMA 3H5VA 1A7AA 2H85A 4NEGA 4RK5A 3AGPA 5FNVB 4ARUA 2AJ8A 1P9NA 3KR9A 3WHIA 1KAHA 1AK9A 2A30A 4D0NA 2GD0A 4Y98A 5BNWA 1V0EA 1EXVA 2CB0A 5I7AA 3IVCA 4QXQA 1T3SA 3WGKA 3EJWA 4BWVA 5KTPA 1TM2A 4IDOA 3UFXA 4Z4IA 1WZEA 4ZPJA 4H1VA 1X7ZB 1Z74A 5K1ZA 3TTVA 3RHFA 3FX2A 1U2DA 2H54A 4MQMA 1BVHA 5IMBA 1I2AA 3CNQS 1GRVA 4WDRA 3WBJA 5K0CA 2VP9A 3D81A 1E7MA 5EVJA 1F8UA 7MHTA 4NBVA 3KETA 5C52B 4M1QA 4Z99A 4NZZA 5C46F 4G89A 1XEFA 4UEKA 4B6QA 2FW8A 4MB0A 2ZZGA 5DNUA 4INZA 1JSZA 1JTVA 4D46A 3RC1A 2SKDA 4G0NA 2D5AA 4XWGA 3LQ6A 2A1UB 4RSHA 3OQPA 3W9SA 4NBSA 1YJNB 2Z2YA 1VFPA 2PJUA 2ZJ0A 4CKEA 3LCCA 4UU8A 3PVDA 1INLA 1QDLB 5EUMA 5JSKA 3V97A 4WRRA 4KSBA 2COUA 4G26A 2QTCA 2V6BA 5FWNA 5IC6A 3ZNOA 2I91A 3C4QA 4WZAB 1J49A 3MUEA 5HFJA 4LVOA 1C7QA 4LYDA 4M1WA 3HWX1 3D0RA 4WNAA 4QYIA 3AIKA 1SURA 2QZ4A 2YWCA 3VYVA 1LPSA 1R8JA 2F90A 2HV9A 1GGVA 1DC4A 3LC7O 3TQCA 1R00A 2PYDA 4Q9HA 4Z1MA 3KYDB 3TD2A 2F43A 1YWGO 2WMOB 3TB6A 2QRVB 3DNMA 4JVOA 3TXAA 3VUEA 4BO2A 5L4NA 1AVTA 2C59A 1REQA 4M89A 1ZJWA 3QMPA 3ZGYA 1AN9A 5LMZA 4DCOA 3LK6A 2XUDA 1DZIA 1C1XB 2I2BA 1YQ9A 1TF5A 3KYCB 4GXNA 4U4AA 4GLFA 1H93A 3OC0A 4BFVA 2BN4A 1NFFA 5KTNA 1C30A 5HEKA 4S3MA 1RKQA 2GYYA 1IY8A 3UWKA 3W2TA 3OX3A 3QGMA 3FDIA 3QVGA 2FP4B 3IJEB 3V1YA 3H5WA 2G1PA 2R7MA 3E82A 4UE3S 1IBLB 2WLTA 2CXNA 1VE7A 4FS3A 1RLIA 3V4VB 4JQCA 3RJTA 4KUEA 4XLFA 1OXUA 3F5DA 2XBMA 3P9CA 3R3VA 4A6EA 3JALB 4CDMA 2R68A 3F4LA 2NXEA 2H4FA 2ZE6A 3SBOA 2C83A 3CJQA 3TBFA 4ZJPA 1UWKA 4RNDB 3R3HA 1X19A 2B4AA 2EX4A 4UEQA 2NP6A 4N0MA 4UOQA 4AP9A 3IKTA 4UM9D 3BSWA 4X06A 4QPZA 1KYTA 5JEDA 1YU6A 4D8TA 3AW9A 2XLCA 2A67A 3NHPA 4QDKA 3AP2A 4P31A 4TROA 3NRCA 1IPFA 5K3BA 2WT9A 1QX3A 1BX0A 5B7NA 1DCTA 1ECFA 3TJZA 4BJ3A 4YRIA 3IJRA 1JDPA 4IIGA 1UD5A 5AVOA 3DZDA 2G1KA 5BY2A 5I7SA 3EGIA 3NB0A 2VKTA 3SJZA 1TW3A 5AM2A 2FFRA 5CJPA 3C3KA 3D6MA 3GUHA 3MJCA 2GNAA 4LJYA 4JGIA 5L3ZA 3Q41A 5D1NA 3MJSA 3LP5A 4QUBA 4IX1A 2MYPA 3MINB 4TPKA 4EH1A 5LQNA 3ROGA 5EJEA 2OGTA 2XE4A 3D6VA 4TYPA 4BJ5A 1FYDA 3VPGA 3L8ZA 2GLTA 4H7KA 3SFZA 3K73O 4PO8A 2DOGA 1PJZA 2H2IA 1CS0B 2HRZA 4PQYA 3ZV5A 4RAQA 2XNJA 3KX2A 2ENWA 3L6OO 4LPKA 1QF6A 4CIVA 3A4IA 3OE5A 4ZGBA 1WWKA 5DTMA 2BFEA 2R44A 1QYDA 2EBFX 3HJCA 4PCVA 4QOHA 1P18A 5IAKA 2IIQA 5LPNA 3T5MA 4CIDA 2O3RA 2W71A 3MJTA 3R5HA 4P58A 3HV0A 5EJ2A 2R2GA 4ZDWA 4JUDX 3MC1A 1F48A 2IODA 4MEAA 5ALXA 5A6SA 1A7UA 4JC0A 2DPXA 4HBZA 2ZBFA 3DBHB 4OK5A 2J7KA 2EDAA 1R18A 2G70A 3KJZA 4F5YA 2BFOA 5I51A 3LA6A 1WB9A 4S04A 3COPA 5EY5B 1PGJA 3FF4A 5E6RB 2WIJA 2HNKA 3IA7A 2CZCA 5CXXA 2WJJA 3L7IA 2ZJ6A 5JWRA 2NZUG 1LSOA 2Q6LA 4RPKA 1BOFA 1CJMA 3IPLA 3TDMA 3UHFA 2J9GA 1IPEA 3G89A 1NKVA 5C4IA 1CQXA 2C4HA 3GFSA 4DLKA 4BO1A 3JQGB 4MDFA 1NMQA 2VHQA 1TGYA 2ZUCA 3RY8A 4J90A 2ZKLA 1H65A 3VC7A 1RD4A 4N7MA 2JF0A 4LXHA 5SY4A 4B3IA 4D1YA 1DG9A 3MSXA 4TTVA 2WIAA 3FYUA 1UJ2A 2ACWA 5C8VA 2YDYA 4XSGA 1ECCA 4PCUA 4CG2A 3A4NA 2FMUA 1VJSA 3IVAA 1DLIA 1XZMA 3FZNA 4WX2B 5KQRA 1PL6A 1MTZA 2GEFA 2G4LA 3RTCA 1H5UA 1KHHA 4EYGA 2F1MA 3K3PA 5INTA 2WYUA 5KYUB 1L5HB 4M1EA 4OB6A 3ZLUA 3T9CA 4LX0A 3A2LA 3P7MA 3WRYA 1U7UA 2BISA 3ESBA 3HDHA 2CBGA 3HB1A 4GEKA 1QR6A 1R15A 4MUGA 5CGZA 5HZBA 3H2ZA 3CO0S 5IX8A 1N6LA 3HN2A 2BR3A 3ZYZA 4XL9A 5SZIA 1QH8A 5H80A 1L1FA 2GA8A 3TTTA 1FTWA 1BQ4A 1C1DB 4QE3A 5F1OA 4BMSA 5LMUB 4CKCA 1OH8A 2R751 1XXLA 3EXAA 3K30A 3VFDA 1V8ZA 3DXYA 4MPDA 3SDBA 1FXSA 1Q2XA 1U5AA 3O3CA 1M73E 5DLQC 3MUOA 4EY8A 1U2QA 1G21B 3BB3A 2R7NA 1NFRA 3CEJA 3W2HA 1A8UA 4DTIA 5AIBA 3AL0C 3MWGA 1BA3A 3GZ4A 4FFDA 4KFUA 1RAHA 1A9YA 5E3HA 5ITZB 2M6SA 1ID8A 1ZOPA 1Q0SA 1PSWA 2WUGA 3HCFA 1XMJA 2W2MA 1NIJA 1I7QB 1ZEMA 4FNMA 3E22A 3IV9A 4IO0A 4ZCSA 4Z4CA 3CRZA 3HU2A 4MA5A 5AVSA 1EFVA 1RHMA 1YS4A 5HIMA 4RD4A 1NVTA 1PZGA 1STOA 4UHEA 4N5HX 4IPTA 5CM8B 3U40A 2IU4A 1B23P 3T5BA 1KDRA 1J2RA 3IUQA 2ZS8A 5HWSA 2GPWA 2OBXA 2UUBB 5E0KB 2V0CA 1P7ZA 1NWHA 3PRYA 4OPSA 4D4LA 5I01A 4A7PA 1TA4A 1OTXA 2NAFA 1DWUA 3AF5A 4HQFA 3GJ7A 4XJSA 3ZYCA 4ZAVA 1FRFS 1OI4A 2OAGA 4O8ZA 4EENA 4DCUA 1XT6A 2HCJB 4N76A 4NG4A 1YDMA 3PE6A 1XKTA 3KVVA 2ZJBA 3ONDA 5B2FA 1IEVA 2DVMA 4TZKA 2FX2A 1T3LA 4D9IA 3DM9B 2J67A 2V9CA 2ZZKA 1V4NA 3LDGA 4BX9A 3DOOA 2FSUA 4OJYA 3SXJA 3OLZA 1TZMA 2WHPB 5DGTA 4CTMA 2PSFA 4RZHA 1KDZA 3CLUC 4KTVE 2R9VA 1MNQA 5H9WA 3SOZA 4H4CA 3FPLA 4U2KA 2PMDA 3UB4A 4DYDA 2RD2A 1DWOA 1MDBA 3BC9A 2PRYA 4R3NA 4D8VA 4HNUA 1O9GA 2D6FA 4GBMA 1E0KA 2F1KA 2WTAA 4EG8A 3H9GA 3F98A 4A2CA 3O90A 2BJHA 3HRIA 2W2VA 2OOKA 2UXBB 3GA7A 4GXRA 1CUJA 1UEIA 1E1RD 4N5IX 4MQ4A 1E1KA 1DP4A 2O50A 2VYND 3P0FA 1UFOA 1XCLA 4OHKA 1ZVVA 4WCFC 5DHQA 4MYSA 5TLSA 1NW5A 4WEOA 4GKAA 4BFTA 1PZXA 1E4YA 4DBVO 4DV3B 3QG1A 1LTQA 2XXJA 4H7PA 2EG5A 4AXXA 1XDDA 4FGZA 3ZY4A 4KLNA 5BWNA 4G37A 3WXMA 4IMJB 2FWNA 1P31A 3RIMA 1LPAB 4DV6B 1HORA 2I2AA 1P7PA 4HDMA 2PL3A 1G3RA 3ZQ4A 2AFHA 4CLOB 3D7NA 1KY2A 3H99A 3SLGA 3QE3A 3B3GA 1CULC 2QB5A 5EZ6B 3VH3A 1G5PA 4PTZA 5BN4A 4CIYA 5MGNA 4X24A 4KVFA 4O2BF 3OX1A 2YZ7A 1B93A 2FUNB 2D2FA 4Q4JB 3I9KA 1HE4A 2LWIA 1RADA 1T1RA 3GIRA 4D74A 1QVRA 3HI6A 4NMHA 3W4IA 1SK9A 1COWD 3V2IA 3UK7A 1QYCA 5CB4A 1Y5LA 3QEJA 4KLCA 2W4IA 4RHYA 3S1LA 3IT0A 2VR1A 3R4CA 5EMNA 3ONWA 4EQ6A 4ZICA 1F0KA 2C4MA 3O21A 5JDCA 2QL7A 2LCFA 1WHTA 1I18A 2ZSIA 2QY6A 3L4SO 5JHGB 3AVPA 4Y9UA 4PEVA 2HK7A 3JU4A 2VYFA 3RQSA 2F3RA 2X2OA 3AEZA 1BNCA 3D7LA 3FWYA 4H2DA 4B6GA 1KIMA 1DOAA 1AQNA 4C43A 1D2RA 1IQ0A 4MV6A 1O94A 4TMZA 3DUFA 4NVRA 5E8JA 4MS3A 1MD9A 5J2TA 1OXXK 3NJ4A 5AW4A 1Z37A 2Q5HA 5AUQA 3T1VA 2B4KA 1P9OA 5TIIA 3FBTA 3CBQA 1BVUA 2IH2A 2VEDA 1YL7A 1YONA 4EO9A 2DC1A 2GZ3A 5JNLA 1PEDA 3LBFA 3QE9Y 1LA2A 5EJ5A 1GP2A 1Q17A 2JFWA 3NALA 3IKJA 4PO3X 5DISB 4S1NA 2WYHA 2EOAA 2BEUA 3U0VA 5ITWA 1X7XB 4HAZA 4ZYYA 3SKVA 2FU5C 4EW6A 2GD2A 2PD3A 3BD9A 3JQCA 1UPBA 3LDHA 1MP0A 3H0EA 4B71A 4M37A 5EERA 1WTAA 4UZUA 1HUQA 1NC3A 1ULSA 2GM5A 4NBTA 4BZXA 2A84A 4AN4A 1RXYA 1SBHA 4EKEA 3AL3A 3D6JA 1HFKA 3WQSB 4WGFA 1MORA 2MSLA 3THOA 1NVDA 3VDRA 3GRYA 1LBIA 1HNNA 2VT6A 4ZI5A 2J3HA 3IR6A 3TEJA 1XTSA 1H2RS 2AOUA 1YU9A 3ANXA 1T35A 4MEBA 5FPSA 4YRAA 2IYRA 2VHCA 3UGKA 4B35A 1QG2A 3V2UA 3U9SA 2G7MC 2PIDA 4WVFA 4XYGA 1O1YA 2AVDA 2H6EA 4V0RA 2NQTA 1G7RA 3QPWA 4R83A 4JLUA 4XFKA 1BYUA 4DDTA 2D2VA 1H1TA 4JCOA 4KBYA 1TM1E 5KCZA 4U9UA 4HNSA 4J0CA 2IYYA 3ECCA 1H42A 2YS7A 3VKGA 1B0ZA 3RYTC 4J1SA 1K6JA 5CFZA 4AC9A 4DQVA 3TOSA 4CM8A 2EFEB 2OFWA 1VDMA 2XXAB 2YHSA 3QKIA 4I4IA 4LEIA 3W1EA 3A10A 1EAYA 4DPMA 3GUZA 4QSHA 4TQGA 2X8AA 1LLCA 5IC5A 2I4MA 5FX2A 3EIHA 1LPPA 4K03A 1VQ6B 3DL4A 3C48A 4E08A 2FQ1A 2QYOA 2ZOSA 4UBKA 4P93A 3CPSA 5DCYA 3CX4A 3EXIB 1N2XA 5AJWA 1QQ5A 4BWGA 2ANCA 5FP0A 4HX9A 2JFXA 3M3PA 4A4DA 2EFHB 1ZMXA 2IZOA 4JSTA 5JAZA 1JDVA 1Y6GA 3PJGA 2ZE5A 4FE3A 2VJQA 3R20A 4MLDA 3T7RA 5JRZA 2HPZA 5KB3A 3B1WA 1C14A 4JKOA 2XVZA 4TRRA 5LBIA 1YZFA 2PVSA 1YVUA 1MVLA 2ZDGA 4IOKA 3R7AA 2QOEA 3GIWA 3FVQA 3NV7A 3OETA 3OHSX 4L9WA 3SJPA 4G5YA 4K9MA 2H1FA 2VZ0A 5JYEA 2QAGC 3PUHA 4F0JA 4OBWA 3JPYA 4EVSA 1I3NA 1M8JA 2G36A 4BNDA 1PW5A 1RPZA 2XCRB 2AG1A 4ZEVA 5KKCA 3BK1A 1EDDA 4RF3A 3TLCA 3A0RB 3LKVA 3WBBA 4HWPA 1OT3A 2JHCA 2BKVA 1J33A 3D8TA 4HDAA 3AY3A 3ZK7A 1Z25A 5B64A 3EN0A 1V8DA 3DPIA 1BD4A 3PYXA 1XV5A 3T41A 1K4YA 2GN9A 2O2IA 1IXRC 1CJKC 2QQ5A 2FPPB 1KH3A 3PCXA 4QM7A 3LK7A 2VUSA 2OP1A 2P4QA 4HYTA 4B75A 2D1QA 2AE1A 2EGUA 2BGWA 1VE9A 4R2WA 2Y92A 2AQHA 4WK2B 1C3LA 4CYMA 4F5DA 1DQNA 3A4MA 5EI5A 3U81A 4DQUA 3QWHA 1P5ZB 5IF9A 3LHDA 3NWOA 2QGZA 3DMPA 3RUEA 3OMLA 5I7OA 4RS4A 2QP9X 5TDHA 2OGUA 5SY9A 2AUTA 3T9FA 1H4VB 5H0IA 4ZT3A 2LTAA 4PTYA 2X2FA 4X6XA 1KBQA 1S9HA 2I9PA 1X2EA 4D3XA 4CVNA 5L45A 3T7DA 6ADHA 3RYCB 1KJWA 1QORA 1RWOA 1MQ8B 2NADA 1R9MA 2NTNA 3G9ZA 4RY8A 4Y30A 2INGX 4R1TA 3G3EA 2AR0A 4DGSA 4KNYA 3ZJVA 4TQUS 1CY7A 1HE5A 5C8YF 1HXHA 3T7KA 3JPWA 2ECQA 5HOQA 3N2KA 4M0EA 4G5RA 1GJRA 2PL9A 3GJ0A 4V39A 3RSHA 4P3IA 2CL6X 4OIMA 2NZWA 2GD6A 2XVYA 4WKCA 5J63A 4K81B 3G0IA 4A0SA 1C4KA 4KE8A 5DMHA 2PA3A 1L4NA 1B6RA 1K2VN 2VBIA 2OP0A 3OTGA 2NV4A 1OXSC 2PGOA 4IMRA 1S2GA 5K8TA 4JXXA 1E2BA 1MH9A 4MS1B 4LDQA 4YR9A 3K1AA 1NT2A 3AEKA 2Q0XA 1V39A 3BS4A 3ECAA 4AZ3A 4HLDA 4FN5A 5FWYA 5JALA 3GHHA 3C5HA 4MCIA 2YJGA 4MYUA 4EEKA 4IIBA 5E4YA 4QD3A 1UOEA 4YFVA 1C1YA 4IH4A 4M1TA 4P53A 1AKVA 1ZLXA 3B7PA 4DADA 4W4TA 1FLVA 3ENNA 2PTHA 5AKHA 2W70A 1W44A 4F84A 3U4MA 4IDGA 3F74A 4Q48A 3R8XA 3QWBA 1HNXB 1QQTA 5JNVA 5SZHB 2R7LA 1TUBB 4UOZA 2WG2A 1Z18A 1BHQ1 3N7UA 3OC6A 2L18A 4NYIR 5CVTA 5KJFA 2AC2A 2H1IA 1TVKA 3PDHA 4NAHA 1XEAA 3TR6A 2QXYA 3GP5A 1QV6A 2FKNA 3WWOA 2W6JD 4Z54A 4XN3A 4H0FA 4K6OA 4C87A 3ICQB 5J2UB 4J9UE 4KN8A 4PYLA 1J09A 2VDVE 3SFTA 3DTVA 4L2IB 2R60A 1E1CA 3UB3A 4OXIA 2NU8B 1JKFA 5DX8A 3U4QB 1T3ZA 3S2SA 1T5TA 1VZ3A 4HWKA 1KGDA 4JYMA 2TMGA 4KR0A 1L1RA 2G8NA 4LRSB 2Q2QA 1P2SA 5HIJA 5K6AC 1F0YA 1BW9B 3LIPA 4BLUA 1Q0PA 5EE5B 1X3SA 2H1RA 2OV4A 1ML4A 1ABFA 4DWOA 3BL8A 4UUNA 1R4MB 4MKHA 3PA6A 1TRKA 1W35A 4J91A 4CBVA 1W2BB 3MOIA 3EIFA 4LQCA 4Q4AB 4C08A 1JDBC 3H87A 3ZHUA 2ECPA 1MW8X 3EGWA 5FBZA 3DAGA 4HN2A 4YRKA 3GB9A 4F96A 1DQZA 4UUMA 4GOJA 1QVVA 3A2NA 4YAGA 1JPJA 2EP7A 4QPJC 3W04A 2B78A 2CHFA 3T3DA 2HH9A 1OBOA 2ILVA 3I9NA 3RC2A 4E5UA 1ISIA 5A9TA 5L4SA 1HBJA 2IJGX 1AQJA 2OHFA 5DB4A 1CJTC 2Q9CA 1P72A 4BQNA 2ZWPA 5K0FA 2XMGA 1Z4OA 1DEXA 4EG7A 5IABA 4PWZA 4W9RA 3OZSA 1V8BA 1TGVA 2WFZA 1JQBA 1RRFA 4REQB 5JFGA 13PKA 2Z1NA 2NXNA 5EXDA 3URMA 4QZVA 3DEHA 5HCIA 4QNMA 5AVYA 1H2AS 4QUGA 2NUBA 4DMKA 1T9GS 3OJXA 3BMXA 5EP3A 1JDJA 1PQUA 3SZRA 1R5NA 1KMQA 4J16C 3ZWAA 1ZR4A 1NF2A 2FVGA 3O47A 4FX5A 2ZCJA 3IXMA 3JQBA 2ZR8A 5AK5A 1MNAA 2B2CA 3JAWA 4AZTA 2BHRA 3LBNA 1SEVA 1LNSA 2YJ5A 4YP0A 2DUNA 2B7CA 4DC1A 3AUKA 2WJPA 5FJJA 2ZIGA 1DKQA 3I9MA 4C4AA 3FLAA 4O4LB 1FSFA 1QDEA 2P9HA 4URZR 4OHOA 5CLFA 4KJZA 3CP2A 2CF6A 2WG0A 5J5AA 1KJZA 5BQFA 5HCNA 5LN1A 1JAYA 1FXWF 2X6YA 1OGYA 1Q0QA 1Z5OA 2FW0A 3DZGA 4PQFA 3ZE1B 2V0NA 3KBBA 5AUPB 5IYNA 3F47A 3KTOA 5EC8A 1LNQA 3B9PA 1J20A 3EY4A 1HRKA 3ZVRA 1Z4LA 4PC1A 2QN2A 1IYZA 4OTZA 5I4IA 1AZSC 4AN0A 3UT0A 4LGVA 2IIPA 4A0HA 3R3SA 4LK3A 4COKA 4NCKA 5J59A 5C53B 2UYHA 3HJGA 3BTSA 2RGAA 2V7XA 1E2HA 3KAKA 3E5MA 3GLRA 2BGKA 4AUKA 2B92A 3DOIA 1BDHA 1FFEA 1WM1A 5KVSA 3T7CA 3PQ4A 1CY4A 1XVAA 2AF3C 3ETLA 4JJFA 4KWEA 3ABOB 2PRJA 1AZTA 5L3QA 2P9ZA 2Z1MA 4LOLA 3FNGA 1Q95A 3VPDA 1IONA 3ZHQA 4DIBA 2ZPAA 1KQPA 2WWHA 1W52X 2H4WA 3D59A 2P78A 3CM0A 4BLPA 4DUYB 1WA5A 3K9HA 2YKGA 2YR0A 2OXTA 1EHYA 2XDWA 1MDFA 4KX3A 2HKIA 1JLLA 1QR2A 4YP6A 4O3FA 1KPIA 1HEYA 2WJZB 1BYIA 2MR6A 3R0XA 3DV0A 2ZR9A 1YMQA 2QSZA 1DIBA 2VYVA 1PR2A 2Z4SA 1B0AA 1OFIA 1OV4A 4HX5A 4E21A 5I4BA 3KZMA 4J3JA 1KDPA 4M8KA 1KBZA 3ASZA 4NF2A 4X94A 3VC1A 1WMDA 3C98A 3OKPA 5FT9A 1UC8A 3IR5A 3P2MA 2C3OA 4YY3B 3ADCA 4P12A 5ICCA 3GLQA 1XCPA 1H5QA 3DDZX 4MHOA 3V7FA 1S9DA 4XDHA 5FPHA 1P3Y1 1O03A 1SCAA 4FOSA 2QA4B 1O5IA 4G1CA 1PNVA 3INGA 1X1AA 3A6FA 1JTEA 2DUMA 5BUSA 1N5RA 3AI3A 3G8AA 3PC8A 4ETNA 2XBLA 1XUOA 1O0SA 2HU2A 2X1LA 4JJKA 4X84A 3A9VA 3TRDA 5KTOA 2CFIA 4EA7A 5L51A 3LOQA 1S3GA 3HJAA 4QOGA 4Q15A 4MWEA 1LUAA 4D45A 1URPA 2W2KB 4KL8S 4CM3A 1FFGA 2CLHB 2PKQO 4OJMX 5FADA 2YHIB 3SE7A 3FB1A 1JZTA 4IJUA 1THTA 3F1KA 2XGMA 1ICEA 1SUEA 2D4HA 3EIWA 4JIMA 1CYDA 1NMYA 4PX9A 1AKMA 4Q7MB 1VC2A 1V0JA 4LV5B 1U2ZA 2H59A 4WESA 3AT1A 5KYYA 1UFVA 5GZ1A 3EPRA 4GMHA 1WSWA 2CD9A 3WK7A 4KMSA 1AO0A 5E95A 3HJHA 5LFAA 4PCAA 3TSWA 3N86A 3N05A 3VR0A 4C0JA 3A1TA 4JJZA 3GLIA 1VSQA 4MMYB 2DETA 2AI3A 3JWHA 1GZ7A 2O59A 3ONFA 5IN5A 4B3MB 1GZ6A 3R76A 3BCSA 5A06A 2XA2A 1ZN2A 3LWZA 2HCFA 2PZLA 3I4FA 4JS0A 4LHEA 5ALUA 1DG3A 3FOCA 4DSZA 2AKYA 4N4AA 4KQCA 3TZEA 1XEXB 5TY0A 5FTWA 2XNKA 3HJNA 3BSFA 3QXCA 1R50A 2IXBA 3C1UA 3T5DA 5JCZA 2WSLA 4CG1A 2P4UA 2XYGA 2YN2A 2EJWA 1A5AB 3FTNA 1UAGA 2GTPA 2GYVA 3QRWA 4KO2S 3AFHA 2EYQA 4Q4DA 5DYNA 1A04A 5LCXA 4ND4A 5AJXA 1CJVC 3S70A 1L7AA 2B4YA 3LGAA 3ZHZA 2O8CB 2XUGA 3HPRA 4DJJA 4J4TA 4U7GA 4JI5B 2FCAA 5AK6A 3I76A 2XNDD 4B34A 1SEPA 1Y3BE 3QFCA 3NBAA 4LI0A 4NULA 1QVWA 3UAXA 2EFYA 3SC2A 5D2CA 3TWOA 4F3KA 1NHWA 3LWNA 2YWRA 1QFXA 4E33A 4H7HA 4KLZA 1YZLA 3NHAA 3ZLJA 2OORC 4L6AA 2XE7A 3UOAB 4EUKA 4RPGA 3SQDA 4D0LB 5IJ0B 5B55A 3EYWA 4C76A 3TQSA 3X1KA 1QQBA 3W9UA 1LZKA 5TRDA 2X22A 1OBFO 1KS9A 4WZBA 4C4TA 1BS9A 3VI3B 4BMDA 3AWDA 4TV8A 4TT3A 2A33A 2G5CA 3C6QA 3DCYA 4JXJA 3NETA 5BSUA 3I45A 5FWXB 4KW7A 1BXKA 3EXG2 3WKCA 3WZ2A 5KTSA 4RLHA 1EJ6A 2YJZA 5A71A 3UTDA 3ZJUA 2GAAA 4V0ME 1IZ8A 3KB2A 4TS4A 4CKWB 4HLCA 1ZD5A 1UM9B 2HM7A 4KHZA 2FI1A 3HS3A 1JE1A 1Q5PA 3LXRA 5TS3A 3FGOA 2MCFA 4Y2VA 2C92A 2O2YA 1X9HA 1F9EA 1UBHS 1XZAA 3SQMA 3E7WA 2FPXA 2RGYA 3GXBA 5AH0A 2IUUA 4KXNA 3H11B 4BUCA 5AW6A 1JIIA 3MWJA 1C7IA 4GG1A 4R31A 2D2EA 4O5AA 5HF5A 3CZ5A 4WQMA 2ORYA 2BHNA 2QRKA 1Z22A 3JX9A 3VR3A 1J2EA 1NATA 4GE0A 4OY3A 1OIXA 1U2SA 3UMGA 3TH5A 3KYDA 2EQBA 1EUYA 3TPZA 2QRVA 3BCRA 2W42A 4B3SB 4CF5A 2Z6UA 2QN8A 4TLEA 4EB3A 1U02A 1G21E 1E3QA 3OOWA 1BN7A 2H11A 2X86A 5DBEX 2ZQYA 1C1XA 2B3DA 3GCDA 3VKVA 1NW6A 5JS7A 2HJHA 2REXB 3K94A 4PX5A 4D6YA 3DPUA 5EJ9A 1VLHA 3FN4A 3EULA 1USIA 3N8KA 1BMFA 4OFWA 1ZVJA 3TD9A 4B6OA 1ACJA 2IYWA 2ZB3A 3C8UA 2V7EA 1WF3A 4I6GA 3RV4A 1VXOA 1FMTA 3H5AA 3ZZUA 5GJCA 1ONBA 3PE4A 4GOXA 3GD7A 3H9CA 2JFBA 4ZU1X 4EA8A 1I01A 1RE1A 4O29A 3TKLA 5JS2A 4OFXA 5DS0A 3FVVA 3HUEA 3JQDA 3LU1A 3NIBA 4BVBA 3ZQUA 4CCWA 5F3WB 3JALA 3VKHA 1TK9A 3JYOA 3KXDA 3DLIA 1QLHA 2PS0A 4BKMA 5KWIA 1KWKA 1Z3CA 4ECAA 4FILA 4HNAB 4YQZA 4OHUA 4EHNA 3SHOA 2JFZA 1GPYA 1YBFA 3ZDDA 1C7JA 1RZRD 4MVJM 2WKSA 3MT8A 1G2OA 4L27A 5THQA 3TK1A 1U9JA 4Z8XA 3L18A 1G291 2C9DA 3MF4A 5T64A 3Q6NA 2X9VA 4TRMA 2OO5A 4PV7A 3S27A 2X76A 4G0OA 1TQ8A 3TB4A 1DHRA 3EG5A 4PRZA 3A8TA 3BIFA 3QPVA 5H3CA 4DYHA 3C4VA 4F2GA 2W2TA 3JWJA 2D4AA 5BR1A 1JJ7A 2NTVA 4JSYA 4H6XA 5E6UA 5HRAA 1DO2A 1M0EA 3PDJA 1MJNA 3BWCA 4RDLA 1L3IA 1YI0A 2P6NA 3DBOB 4ND2A 5M04A 1VQMB 1HQYE 4EVRA 3A9RA 1E4EB 3FWHA 3ZE2B 4AKIA 2R8XA 4UVGA 2V7BA 2IPNA 3DKIA 4WK6A 1CS0A 1GN9A 1BDBA 1WS6A 4G23A 5L53A 5L4LA 1UWLA 2OK7A 2XQFA 3AR3A 4FZ3A 1TVCA 2XBUA 5FPYA 4XWWA 2O2HA 3H5OA 3NS7A 1IXYA 3TQTA 3D4IA 1F3OA 4HUQA 1SN7A 1NW8A 1QVZA 3JSAA 1JIUA 2XA9A 2XRZA 3L43A 2R7AA 4Q37A 5EUQB 1RVV1 2CXXA 3UUFA 3HPQA 2OCLA 1Q0TA 4D3SA 3LC0A 2C4TA 3PLRA 4BWYA 1QZTA 3PFGA 3KEFA 1LEHA 2J31A 3QFSA 3T3OA 1JG7A 4UM9B 4LZWA 1SO8A 1UKAA 1OXKB 1OMOA 2ODAA 4TLDA 2DKNA 2F1JA 4E0FA 1P4HA 3CNBA 4GPEA 5AKYA 1IZYA 3DE6X 3FSEA 2FPGA 5GJBA 4EPXA 3PZRA 4WBNB 5K03A 5K6TA 5LOVB 2QG4A 1BE1A 3F3KA 3FLEA 3BWBA 3SYKA 3KZKA 4DRYA 3ADBA 2W6ID 4Y2YA 2YJ3A 3I6MA 3KJXA 1TXGA 4YAEA 4EHLA 1UUFA 1JR2A 1CE8B 2I3AA 4IXDA 5AJVB 4MQUA 1MBZA 5DGXA 3FIUA 1GAJA 3MYRA 3TRIA 3AI1A 1U63A 3MS4A 1GIAA 4YAOA 3L7NA 4QODA 4JEIA 1T2EA 2YQZA 3KV1A 1VBMA 3O8QA 4IIYA 1Y5NA 2NV6A 1EAMA 4GR5A 3CUUA 1NVGA 3NHSA 4AMUA 4X97A 4CNQA 1YC2A 3SXPA 3IP5A 1I6KA 1JR3A 1I51A 2VDUE 1GCIA 1WDLA 2IQ5A 1L5HA 1IWPB 1YJ9B 4HEJA 4CQLA 1GDHA 4F8YA 2A5DA 2RGNC 2O8BA 2AS0A 5D8DA 4FCTA 4Z51A 4Y18A 3F6PA 1C1DA 7MDHA 3GK3A 4G24A 1Q83A 2NWQA 1RR6A 2F1LA 2L2QA 2WAXA 3INYA 4H59A 4J0DA 4XX1A 1HTTA 1CIPA 1GUYA 1R1DA 2WAMA 3T7IA 3TLKA 4P32A 3EPPA 2QUZA 4E2FA 1GKIA 1GNSA 3WWCA 3ZD9A 4XJXA 4ADSG 3ZTTA 1UC4B 1CWUA 1IUKA 4K40A 4C2BA 2AWNA 3GV0A 5IDVA 2X2PA 3A1DA 3BNWA 2GJ8A 5E9JA 2XEXA 2PT9A 3L40A 4X7RA 4RY9A 1JU3A 4L72A 3L5OA 3OOSA 4X63A 4RV4A 4XGQA 2OYCA 3UTCA 2F3PA 1J56A 1MRNA 2DSTA 3MLEA 3KFLA 1AK1A 3ORRA 3R4VA 4FDMA 1R8XA 5TNXA 1SKMA 1Z2DA 2W7TA 3P19A 2P9TA 1D07A 3IHWA 4EWLA 2I4IA 2H4XA 1DRJA 2VRWA 2YWJA 3CF6R 3CC7B 1PDOA 4I4CA 2CNWD 4R6XA 3L3BA 3RIGA 2FSFA 1U3FA 3KR0A 1F0NA 2H48A 5IZ4A 2XJ9A 1L7VC 3DDYA 4IHKA 3B78A 1CUGA 2WKPA 1WCV1 1Y1SA 2JJYA 3MTDA 3RRYA 4UU7A 3AM1A 3OAAA 2GBCA 3QU5A 2WVJA 1US8A 5CEEA 3TIGA 3U49A 3B12A 3JQFC 2HB6A 3HQ4O 4EB6B 2IDZA 3WQHA 3V46A 4MI1A 2ZL6A 2CBXA 1GPMA 2CVQA 2XCQA 5AKEA 2QYTA 4ZZ1A 1QGUA 3ETCA 2JEOA 2HA2A 3MRTA 4UE6A 2UZ3A 4BO4A 3LHFA 3UXYA 3HSYA 4O4JF 3EPLA 1QHGA 5IAGA 1HV8A 2PS3A 5T4EA 1MAWA 2PVPA 3B70A 3S2ZA 1NM5A 3HA2A 3TQOA 1NF3A 1GPUA 4KC0A 2IITA 3KDPA 4JYPA 3HLYA 2IXGA 4NNOA 4X1OA 4M7RA 3UUEA 2X7JA 4YNBA 3PDCA 3NVAA 3O91A 4YTEA 1QU2A 5A88A 1EVYA 1T91A 3MUNA 2EQ5A 4UU0A 3RBZA 3MIIA 1OWLA 5KTKA 1YAHA 3PB3A 4KN6A 4ZGQB 2EARA 1KP3A 2HQBA 1N8SA 3B2QA 3GBPA 1NULA 2I9KA 4OQXA 5EE3A 3A2KA 1BROA 1RXSA 2QN7A 2TS1A 4IXMA 1COZA 2XKBA 3IP3A 2OBRA 4Z86A 3RADC 1XQ1A 4JZYA 2OCYC 4YA6A 5I9LA 1OU0A 3ZXYA 3PC7A 5BMVA 1P60A 2VP2A 1JQAA 2Z57A 2ZSEA 5KI6A 1EQ2A 3W6PA 4C07A 3Q11A 1QZZA 3H9QA 2BMWA 4WECA 1QAMA 4RVOA 3V6LA 2LDXA 2XT0A 5DHSA 2ID9A 1UM8A 4RDXA 2E49A 2ONYA 3KPVA 4TLCA 4IV0A 3WMEA 1H0RA 2NSLA 4B79A 1PZEA 1AXGA 1PD1A 1ZWLA 2OECA 4CLOA 2Z6VA 2PX6A 3UHPA 4AQYB 4CMIA 4HH4A 2GR9A 3T7SA 3IERA 4B76A 3NHZA 5JS6A 3ZGLA 1KEPA 2JATA 4PC7A 3GFFA 2O54A 3WIEA 2JCXA 4CQJA 4Q4JA 3VGJA 5DTQA 1THGA 4Q3OA 4HS9A 1U7OA 2HHJA 4NPAA 4EJSC 4P0QB 5JJLA 1YR9A 2DT8A 1BXGB 4BVLA 1KZ7B 2BBTA 3PGA1 4G9BA 4HFMA 4MA4A 3I9FA 1QRRA 2C3YA 4RCZA 3PYLA 1HDOA 2D8AA 1YR6A 4LWZA 2EIHA 4UUPA 5C34B 3RV3A 2RHMA 4JITA 3BMOA 2Q6VA 3DBVO 4ZYZA 1E9AA 3DOUA 1LFAA 4FC7A 3ZY2A 3DC7A 2POCA 3DLBA 5IWCA 3CF0A 2J9XB 1M8FA 1WF6A 4NCJA 1OTYA 1ESZA 4E11A 1OA0A 5LSAA 5FV7A 1WP9A 2CFCA 2BFWA 1LQ2A 2DULA 3VDNB 1W49A 1I5OA 2B35A 1M1YE 2ZWIA 2Y1CA 3DXFA 4TKVB 1QKJA 2X58A 3Q2OA 5D6NA 4NABA 1W25A 3RVDA 4Q7KA 5HMLA 2XODA 2GD1O 1QZUA 1OLSB 2IXDA 3KD2A 1A8IA 1AKRA 3MCTA 1T2VA 3MELA 4MK4A 2Y0PA 4KK3A 5ALFA 3TECE 3PXUA 1O58A 4DSOA 9ATCA 3EGOA 4ER6A 2QAIA 3PZBA 1ZVMA 4F9EA 1K0FA 1XRQA 4EY5A 3AF0A 1T8TA 1D1QA 2DJIA 4JLVA 1AUOA 4PLWA 2O4CA 3MJVA 4KB5A 1FDVA 4UTOA 4ML3A 3EIOA 1L5WA 1X7XA 2QL9A 4MZXA 2VJMA 5SY6A 2ZM6B 1DIOB 3H2GA 4LOKA 2JIOA 1CR0A 3CZ4A 3TINA 1MRZA 2BI7A 2F6RA 2OGZA 3BXEA 4K3UA 4PSKA 1IXSB 1SBQA 4BNZA 1V8PA 1D09A 4XKWA 3WGOA 3A1UA 2LIVA 3BMCA 3TXXA 4IWXA 1VPWA 1Y9ZA 4TVBA 4D82A 1QH0A 1KP9A 2RG7A 3IFSA 4TTQA 2GHTA 2PVCA 3I6BA 4P4LA 3CH7A 2CNNA 3CSSA 3W4KA 4OX9Y 5EA2A 4ICIA 3W90A 2QRPA 3AHEA 4QU8A 3ZHBA 1V5FA 1VBNA 4PHGA 3LI2A 4U1RA 3E0XA 2BEWA 4JL5A 1MV5A 3BILA 5FBRB 3CB2A 2QQEA 1MLDA 4MJ7A 1F7UA 1KO4A 3UA4A 1HYHA 3KT0A 4KMMA 3GGOA 2AG8A 2FEAA 2IHJA 3E23A 4WY8A 1RRCA 3FAZA 2OBMA 1KI9A 3R6TA 4FUTA 1OUMA 3F97A 4NOKA 5JSZA 4JBIA 3RT9A 1F8YA 3WHPA 3S2YA 3ADDA 1XTRA 4N7JA 1AO3A 5KNBH 3OE7A 1E6MA 2Y1DA 4UD2A 1YUBA 3LS2A 1R6BX 1T6BY 3L8DA 4INPA 3JZIA 1W48A 4FCWA 4U3JB 4Y2SA 3D8BA 2CLKB 4QARA 2XXAA 2GTHA 3U80A 4N40A 5EP1A 1R0RE 5LXTA 5DNVA 3IBGA 4G1MB 1TAQA 1W581 2QGFA 5J35A 1R7RA 3BUSA 2ZQ5A 3NAQA 2P35A 1Y48E 1X70A 3AR4A 2O1SA 1XL1A 2D1TA 1E79A 4K3VA 3TZHA 2QX8A 3MMXA 4RTPA 2QP3A 2OCDA 3IVMA 4E2ZA 3T3GA 2VQFB 1IUOA 3D3NA 4C0SA 1ENZA 2XD4A 1YTLA 3EIQA 1Y0RA 4MGEA 3KOZA 2BBWA 2QJFA 2IDMA 4R16A 4UTZA 2OAQ1 4BKQA 3LV8A 4YRJA 3CCQB 1G5HA 1JVBA 4J0FA 3HUTA 4FEYA 2X4IA 5FKJA 4DK1A 1KNQA 4MSUA 5T8KC 3ZOKA 2A8YA 1Z34A 3FHJA 1HTBA 4I1UA 4OD0A 1NUQA 1R0XA 4E15A 1IUNA 1AD2A 2EJBA 3KJIA 1WAMA 3LVFO 1Y4AE 2IYTA 3Q8XB 3W79A 5KYYB 1T1EA 1POXA 3M2TA 2IBTA 1TU4A 4G25A 1YB1A 3GR6A 3WJ1A 4JBNA 2X1HA 2GREA 1TM5E 1DBQA 3MMNA 5K99A 3KALA 5DFAA 2C0QA 3K0HA 3TEFA 1JN0A 1QO7A 3A25A 4LJRA 1D4AA 2RH5A 2WV9A 3WMXA 1P0FA 4I9GA 1X9IA 1TO2E 2FFAA 3TAUA 5FB3A 3AVUA 1Q1AA 8AT1A 1IY1A 2FTKE 4ZGNB 2VKQA 3IQGX 1U2DC 3TCKA 3WG9A 1UJCA 1DKLA 3RRJA 3OUTA 5ADVA 2R97A 2DFPA 4RTQA 4OPVA 1JPUA 3TI7A 3MSCA 4YPVA 4LJ9A 1VRWA 3U62A 4K2AA 4JQOA 1NN1A 2QN9A 3T52A 1QIHA 4NCHA 5ESXA 2PQ2A 4N49A 5A4JA 4OPMA 2FPPA 1IHUA 1NBEA 3ZHYA 4JI8B 4RMIA 4J03A 5LKRA 2X5KO 3H2JA 2XUJA 2V6GA 2HXYA 3BWYA 3R77A 1WW2A 4UHCA 1U31A 1YA4A 4XI9A 3FHTA 1PJ7A 5EIBC 3EG9B 3BAZA 1QANA 3CIFA 4TZTA 2YH2A 5CLGA 2OYSA 2WWVD 2WY2D 1CEYA 2DHQA 4CV2A 2HC9A 3CRW1 4MUFA 4BZZA 4XKVA 1G7SA 1U1EA 4NYMQ 2MJLA 1WG8A 4C29A 5TJHA 1PWHA 4I5FA 5FLYA 2ZTNA 5TVGA 2WZNA 4JJ6A 2AOTA 3L7MA 1IN1A 4XIIA 3QE2A 1AB5A 1H9AA 1XMXA 3ENVA 4NJMB 4BP3A 3WGVA 5BV7A 2EJVA 2EV9A 5L8VA 3C14C 1EVEA 2J5KA 4BB6A 2WEKA 3ELWA 1N0HA 3IEXA 1OKKD 4EGCB 1FQJA 3C85A 1NU6A 3ZDFA 3V1MA 3E3AA 1E0JA 1Y8RB 1BHJA 3IPCA 4I4NA 2JIZD 4U39A 3TUJC 5F98A 1M10A 3WKEA 1TVEA 3PA1A 1YHQB 5AW0A 1OWMA 1LFDB 3COYA 2J5RA 2QQ0A 4WN3A 3WLMA 3DQZA 3IXQA 1WZUA 1BQ3A 3I9OA 2X53S 3LT4A 3GJ5A 1I3LA 4JB0A 4P1ZA 2CYBA 4RZSA 4YN3A 3ABSB 5B2ZA 3ZWOA 1EVJA 2PKQP 1PJTA 2XY4A 3A04A 1CP3A 4K9RA 4MS1A 5B4UA 5EMKA 2UAGA 4OQDA 3B6KA 1LWNA 1H8HA 2XZTA 5FOTA 4WA8A 4RZ3A 4L15A 1LKZA 2MR5A 2R8ZA 4JVNA 4ZOLB 5EKDA 4CMHA 5HK9A 2X15A 1FJGB 2AXNA 2B7BA 5KSWB 3K2BA 1ZCZA 5KC9A 3O2QB 4OSOA 4GBJA 4MUHA 3O3NB 4ROSA 1HL3A 2NO7A