1RQRA

Crystal structure and mechanism of a bacterial fluorinating enzyme, product complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-fluoro-5'-deoxyadenosine synthase
publication title Crystal structure and mechanism of a bacterial fluorinating enzyme
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 67
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2003-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 1rqrA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 1rqrA01
5FIUA 2CBXA 1RQPA 2V7XA 5LMZA 2C4UA 5B6IA 2Q6KA 2C5HA 2CW5A 2ZBVA 1WU8A 2Q6IA 2Q6OA 1RQRA 2V7WA 4CQJA 2Q6LA 2V7TA 2C4TA 2V7UA 2F4NA 2V7VA 2ZBUA 2CC2A 2WR8A 2C5BA 2C2WA
chains in the Genus database with same CATH superfamily
3DAYA 3ON5A 3RV4A 2OR3A 1FP6A 5IVIA 4K87A 3WLSA 1DAFA 3PNBA 2FPOA 2QKYA 1Z36A 1B8VA 4J0KA 4Z3DA 4JLBA 3SYRA 1ILWA 2V7EA 4LYFA 4XQCA 3M1AA 4B3SB 4D9EA 1S0UA 2HQSA 1TADA 2QYOA 3BCSA 5FYQA 4R6XA 2FQXA 2O8CA 2Q9AA 3GA0A 2GD0A 3ITKA 1OX6A 3LLSA 2WUFA 4U39A 1TJ4A 2G5CA 5E1BA 5C3UA 5JY6A 4WOCA 3VTZA 1SD5A 3HZOA 1E2KA 3S1LA 2I91A 3VMFA 5ENVA 3SZRA 1I3LA 4DWVA 2ZJ8A 5BQFA 1ZITA 4KFTA 5DYWA 3ZWKA 3T7JA 1JKIA 1IOVA 1X1QA 1X7DA 2M98A 2PQ2A 4ZRNA 2QRMA 1V3TA 1JQDA 4U9UA 4FI3C 2ACEA 1PO7A 3BGIA 2HJVA 1LK7A 1RCUA 4J7CA 3Q3IA 4R1NA 1A97A 1BYUA 1Y4UA 2GLXA 2PS9A 1Z13A 3C3BA 3RYIB 3W1WA 1GUDA 5T6BA 4OD0A 2XH8A 1FTQA 2AB0A 4HI0E 1EQAA 1JWAB 2V5UA 2YL2A 1W6UA 2GILA 2JGLA 3MK31 3RNLA 5K20A 1WCV1 4HJXA 4QASA 1NKSA 2HRZA 4PC1A 2BP7B 1XDDA 2Q1WA 4QEDA 3T6KA 4IDOA 1FZTA 2JBAB 1GZ5A 1MIOB 3BMCA 3GZJA 1XPJA 1E79A 3OZDA 4F5EA 3MTQA 1OB5A 2DWPA 2C7QA 4CLRB 3SBEA 3DT9A 1EWQA 1CUBA 1JIXA 2YOGA 2HI0A 4UMVA 5KNDH 3LBNA 5EE0A 3A4MA 4EJ2A 1EVEA 1BOFA 1GV1A 4IG4A 4PSVA 1LXCA 3ZHYA 3P97A 5HKAA 3W5BA 3FB1A 3OTQA 1M34B 2ZRLA 1INLA 4GP7A 4OU5A 4H18A 4F6LA 2QJRA 1PS8A 3ONWA 4PFJA 3OX1A 2HMTA 1F3LA 2BTQB 4QT0A 5DCLA 5D3MA 3AGPA 1M1YB 5DWQA 2NO4A 4LC0A 4IIHA 2QYHA 1PJ3A 4MWBA 5E38A 3UO8B 1A69A 3K7EA 4UTNA 5D87A 4Z54A 3DR3A 5JQGF 3ADBA 2NZ8A 2IEYA 2RHTA 3DOJA 3TTSA 2Q3EA 3E9ZA 4PXAA 4RH1A 3K05A 5E6SB 5F51A 4HDNB 3THXA 1T1SA 5KWVA 4PGOA 1KZ9A 2QVLA 2IEGA 5H02A 2VZ0A 5HRUA 4XR4A 4BATA 3UH0A 1TUIA 1ZISA 2IZZA 4FFPA 2V3CC 3VR3D 4Q3CA 3I5MA 4RKQA 5IXSA 2XKAA 1GZ3A 4L27A 4BBAA 4PX9A 3OU6A 4RYLA 4D9MA 4TWAA 3G5TA 1GRQA 2H1RA 3NO4A 1EVLA 1QP4A 1EXNA 1R6AA 2R8BA 5TB5A 5CDTA 3GOHA 3OTGA 4QGFA 5C8ZA 1CDDA 2NYAA 4IG9A 4C4AA 1I33A 3H13A 1OF1A 1XQ6A 1LTHR 1UT6A 2PKYX 3WGHA 4D92A 2ZSIA 3Q6QA 3A3YA 1XZEA 2LVBA 2XVMA 3AEUB 5G1NA 3QOWA 3KTAA 4V0QA 3JZMA 4V1CA 5HKLA 1PF7E 5E2BA 2D3TA 4QFMA 4GYJA 4ETWA 1KJNA 1SFRA 3L7LA 1CF4A 2WWFA 3K5PA 1SUFA 4B0PA 4DQ0A 1C3XA 5EJIA 3S0JA 5AI5A 4DK0A 1GXSA 3T51B 1KH2A 5JXGA 1N6RA 3IE1A 1TCCA 4UDOA 2CN1A 3EXAA 3KFVA 4HZIA 5TGZA 1N5JA 5DTMA 1D2CA 4EJSC 3JWIA 2CK3D 1UL1X 1Z6PA 3O94A 1B0PA 3WX0A 4JASB 2HLDA 1FMJA 2EYUA 4IS2A 1SKBA 1QR2A 1WMFA 1VXRA 3EULA 3KELA 3PL5A 4KMSA 3HCOA 4UVGA 1MO6A 4X8OA 4B81A 1UR5A 2F1KA 5CAEA 4BNFA 2BHRA 4KQGA 3ZI0A 5A1JA 4E2XA 1A1SA 3I4CA 1EJ6A 4QL3A 1KDYA 1TJ3A 2JLSA 2PA3A 3L18A 4MVJG 3UG6A 3C8MA 3CCCA 4P7BA 1PAUA 3ZVRA 4CE6A 1O0SA 2O8EA 1FU4A 4GS5A 2XWBF 1DI0A 2GFIA 4NU6A 5L6LB 2WIFA 3IQGX 1AKEA 1ND6A 2ZJZA 4OA5A 2NM0A 3ZHUA 5AYVA 4EITA 4HK4A 2XUAA 2BFMA 4QHSA 2G36A 3OZGA 1N2GA 4WZBB 1ECLA 1L5RA 3UKDA 3NYIA 3NVDA 4ZQBA 4OHPA 1RS0A 4IHJB 4WCFC 5F5NA 4U9IS 4QM7A 1YUBA 3RGWS 4TL6A 3S81A 4IXNA 4J4HA 4MUJA 5KNLA 3ISXA 3ZDAA 3A25A 1EIWA 4DY6A 4EFKA 1L5MA 3L7DA 2XSZA 4K5QA 3TQSA 4MRPA 1KIAA 3WNVA 1M8FA 5AW2A 2FKAA 3NU1A 2B8TA 2HWYA 3WFIA 3MWLA 5DCWA 3SMQA 3RAJA 4OI4A 3ZWPA 1Y1LA 1OFIA 3OFSA 4FGUA 5CGQB 4KPFC 2JGFA 4LJ5A 4KLZA 3U17A 3UAOA 4UOEA 3E1KA 1RLOA 2Q6IA 3ETCA 3UAYA 4MKIA 4TXMA 2VH5R 2ONZA 4H9GA 4M0MA 3UMJA 3CO0S 3TZHA 1UKCA 2FMHA 3EB9A 2QP9X 2YWRA 3FTNA 2G7MC 4Z7OB 1NR7A 4UBLA 3WL7A 1G5IA 2XUIA 2ZR8A 4CHGA 1F2TA 1E1CB 1N8TA 4P5EA 1E7YA 1MLDA 1K8ZB 2NO9A 2PUEA 3TL6A 1QHNA 4ZU1X 1B8NA 3IP3A 1DO2A 4ACAA 3QWIA 1T1GA 4BCBA 1DJOA 1CY7A 1KP2A 1L5HB 2B37A 2LRHA 2NZYA 1LDEA 4Q4JA 5H8WA 4KR3A 2GERA 2G3YA 3S28A 1I7PA 5ULLA 1HE4A 1U94A 2YNMC 3VBEA 5KDOA 3HXPA 2FRXA 2Q6KA 1KDTA 2EF0A 3WRXC 3IH5A 4DNOA 1W0CA 2AFRA 2AI1A 2VP6A 8AT1A 1HG1A 3SC2A 3ND8A 4AO6A 2P90A 2JBHA 3M4NA 4HX9A 4BMNA 4AS3A 3HJNA 2H06A 4KFUA 5LZ9A 3P2JA 5JDCC 3PE4A 2H31A 1LX6A 3WB1A 4IDGA 1ULAA 4X8IA 1NYLA 3N8IA 1FTWA 3PQ7A 4GZ3A 1NTOA 4J6EA 2Z2YA 5CVUA 5AK5A 3U1VA 2WR8A 1VL0A 3AM4A 3OVMA 3V3TA 3E48A 4JUFA 3GDGA 1MJNA 9LDTA 3E0QA 1PWXA 3HBFA 3V7FA 1WTHD 3NP9A 2ZRCA 1V39A 4MLCA 4N6OA 1TU0A 4UUQA 2Y99A 3CR3C 3JRNA 2OBLA 4ZWNA 5M29A 3LA8A 5H16A 1SIBE 4TYQA 1PQ4A 1RMYA 2WKQA 1R4AA 3TO5A 4BKPA 3K09A 1DKMA 3M49A 4RVSA 2VJCA 4X7BA 3M83A 3O91A 4RACA 1E4YA 1N4AA 1DRKA 1YRYE 2IYNA 3HB7A 2H92A 2IXEA 1MDBA 1KH3A 2AN4A 2H2HA 3MA0A 4PLWA 3MMNA 2V7PA 5AW9A 4B0OA 1K3UB 4WXHA 5K8LA 3R7FA 3GHHA 5JBQA 4YJ3F 3NCTA 2R85A 4NTZA 4EJ6A 1UP7A 3WNBA 2Z8YA 3CN9A 3GHYA 3HA3A 3K6SB 3CIFA 4C0QC 2YHIB 1E8DA 2ODAA 3E3OA 1VZ2A 4URZR 1E3MA 1WPGA 2IYUA 2WVGA 3RH0A 4I50B 2JIZD 4B43A 1J07A 2B5WA 1BEZA 1YASA 2C8KA 3DA8A 3G85A 1DFGA 3I1IA 3OOEA 2GD6A 1XPRA 5DNWA 4Y3UA 3RC2A 1MTZA 1SPBS 2OHGA 2WIAA 2VH2A 1QB7A 3QXCA 4ENVA 3OSUA 3IHTA 3AFGA 3D64A 4FYYA 4MZXA 3F8WA 1TAGA 2GTIA 3V2IA 3ODPA 1E96A 3TRIA 4L0DA 2IYWA 2NZVG 3P5BA 1XU7A 4P4UA 1P4SA 1NDHA 2CSUA 3RK4A 2VAXA 1G4UR 3KB2A 2P6UA 4Z7JA 1CR1A 2B35A 3NHYA 1VQKB 4P31A 4HNTA 2PL5A 3K0CA 3Q15C 1H8HA 3GN1A 1NP3A 2IUSA 5EINA 2WJPA 3K1TA 3JD0A 4MKRA 5TE9A 3CX7A 3ZNNA 4BE9A 5KS2A 4MWOA 3FOWA 2B6NA 5KREA 1K9SA 1AZTA 3Q7TA 4DDKA 2CFIA 1A9PA 3MIIA 1I36A 2XMDA 4C03A 4YV2A 1FDUA 3ZNOA 4DLKA 4UBKA 2B4YA 2AWOA 2K2WA 1KOLA 2PSEA 1M0EA 1RWKA 4E31A 1JLHA 2IEZA 3DHYA 4TL7A 4EJSB 3OX3A 1ZGZA 3K72B 3CNEA 3DOFA 1JEQA 5FOSA 4AW9A 4C1BA 2V0CA 1GKIA 1KYQA 3HUDA 4NS4A 5JO0A 3DOUA 1E5VA 4UKDA 4GZ5A 1MB9A 1RBYA 1V9CA 1P3JA 3NHPA 3IAHA 3EZGA 4A8TA 1IJFA 5KNBD 2IELA 1LK0A 1U3FA 3SJAA 3OT1A 4NI5A 3TFWA 4CMAA 3WGGA 1PZNA 1Z4MA 2WOJA 3II6X 3QX3A 2VOJA 1DJLA 3H6KA 1NXQA 4Z1MA 1SA0B 3ERCA 2BELA 1NFRA 1Z5NA 1OHHA 1D03A 1GAWA 4JU8A 4K9MA 5TQ0A 1GG2A 4BB0A 4D7AA 2QZSA 4BMPB 4C1NA 1ETHA 1RRMA 1TCVA 1T8WA 1IVYA 3GFSA 4WGFA 4BZPA 4E46A 2XBMA 2H4ZA 3IUPA 4Y2HA 1NULA 3LC7O 5BYBA 1VQOB 3MJDA 5AJYA 3OAAD 3TE6A 1Y8AA 3FWPA 1E2PA 4MWSA 4QU5A 4IDNA 2SKEA 3ZWDA 5CBKA 1QX4A 2GYWA 1DHRA 2JEYA 4G1BA 1E0KA 1ECPA 2XGGA 2O7SA 1J22A 4FGKA 4N7RA 4NMMA 3WLHA 3DJYA 4NBKA 2ZB2A 4WCFB 2O8FB 5EGNA 4KO4S 4WKPA 1JMYA 3FOFC 2O2ZA 2YCBA 3K2QA 4HDRB 1LJLA 3DDYA 4YP9A 3WGLA 1E2FA 2J3MA 3F9CA 2DHDA 2J8ZA 1NUUA 1MB2A 3ROPA 3VUEA 3ZX5A 1KI6B 1TKRA 3M9XA 2KHZA 2R5WA 2UYHA 4HZUB 1G19A 1KJQA 4RELA 4K8OA 1MX9A 2ZIFA 3BTUA 2DECA 3MSXA 4GNKA 4GKBA 2C3MA 4R9VA 4AYWA 5C5IA 5LIPA 4BP8A 1JQ3A 1X2EA 3KZ1E 4TT8A 4WK0B 3KKLA 4Q4HA 5ALWA 2QN9A 4MB6A 3T7RA 4PLYA 4I9HA 5FBZA 3FHJA 1VL8A 2FLWA 2I2WA 4RY8A 4A2PA 1FJHA 1EBBA 5IKMA 3H9CA 3U3RA 1XEXA 2HFKA 3E9CA 4C07A 1UD3A 3EXFB 2EKBA 1RZVA 1D09A 1T1EA 2VEDA 2VK4A 1DXQA 1K88A 1SC3A 2H08A 5GY7A 5C8YF 2IS4A 4CYMA 1DOZA 2RK6A 4NJOA 4IDEA 3EFOA 5FCDA 1RHQA 4Q5IA 4FQ8A 2A5YB 3IVMA 2O2DA 5DSZA 5DP1A 1RE1A 3FPAA 1PV4A 3Q0IA 1WL8A 3ICCA 2WUEA 4DRZA 1DIAA 1RWXA 1FYEA 4HE5A 1GZ4A 1TVKB 2GSDA 2VHZA 5EZYA 4D99A 4IM7A 3HGQA 3U7FB 5HE8A 4Y67A 4O6VA 1E94E 2R25B 5BUQA 5DGHA 1AHIA 4HTFA 5E9AA 4CMEC 4CLOA 3CXCB 4PHCA 3RARA 3THOA 5CM2Z 1TM7E 3IR5A 1D8AA 3SC4A 5FDFA 3OO0A 1W5FA 2G0TA 3JU3A 3RO7A 4B4VA 4D25A 1W48A 2OV3A 2J0EA 3DDHA 3ESRA 3LPLA 3VR2D 3Q7EA 2PXXA 4Z1OA 4CT4B 2RFLA 4H7DA 2E4WA 2AC2A 4PTZA 3FPJA 3F6CA 2E4VA 3AW9A 4HAYA 2CHUA 4WA7A 3A0RB 2BFEB 2HBZA 1LI7A 3DUFB 3NAZA 5EHNA 1V1RB 1B15A 4KXUA 2HSZA 1IHYA 3D3WB 2GF2A 1LZLA 1ZAKA 1CJUC 1UDBA 3B48A 3I2FA 3WQZA 4JQCA 2PLWA 4ZOEA 3JYOA 4JGBA 1X77A 4C7OA 4HQ0A 2OG1A 4K3UA 4A1OA 4AO7A 4AX8A 4ND6A 1F2UA 3REOA 1O6CA 4G0WA 1RACA 4UQOA 1B3BA 3ZK8A 4EG6A 3O8NA 1JHYA 2PMDA 5G0UA 3VYTB 4GM4A 1RJFA 1UF9A 4ZC8A 3TXAA 4LEIA 2GN6A 2PX8A 5G0TA 4QGBA 4AUMA 2HT1A 4BNVA 1HO3A 1YZQA 2AFHB 1H2HA 4G5XA 4LY0A 4NL4H 3AR4A 3L8GA 4TKZA 1NYTA 1JXMA 3ECAA 3I6YA 2V7BA 3IUEA 3QLTA 4ZYTA 5JDIA 5DHAA 1M2HA 1OWPA 5JNTA 3ORFA 4NBVA 4FJ0A 5K05A 4WBXC 3DE6X 1DWPA 3RFCA 3IXLA 4V03A 1OBVA 3N2IA 1EX6A 2C2YA 3PTAA 1EAMA 1CD5A 1G20B 1VIAA 3HDYA 4HNSA 5BV1A 1SVNA 3FMGA 4WZAE 3CS3A 1N1GA 2PUVA 3NBFA 2B8WA 3OIUA 5E6RB 4IKEA 1XYGA 3ZBTA 1HRKA 3K8QA 1A9TA 4C6TA 4G1MB 3E3LA 3TQFA 5IYRA 3L0ZA 1AHNA 2H8GA 5E6UA 2QNIA 3B2NA 3B7GA 2QX8A 4OJNA 4ENPA 2BKXA 2NV6A 3EHDA 1FVFA 5K8VA 1W5AA 1QX3A 1OROA 1YI0A 2BEWB 2IY7A 4EH1A 1EUCA 3FPGA 2EJUA 1UKVY 2W2TA 3QJ5A 4F21A 1P80A 4QG7A 1Q21A 4KIJA 2R86A 3WK4A 2C5HA 2REOA 3MC1A 1WCIA 4XPIB 2QM3A 2KPOA 2ORYA 1CRQA 3PRHA 1ZN7A 4P2NA 5CB4F 4MW4A 5I9MA 4BQPA 4WZZA 1LFAA 1XMPA 1QGDA 3D6MA 1LY1A 3VYUB 1KYIA 2C5AA 4WN9A 4YAIA 2B3DA 4LC1A 3Q6RA 1WORA 3WLOA 3DZHA 3S1AA 4F4DA 2GZAA 4WHMA 2DUUA 3HU1A 3G9UA 4M36A 2J3QA 3R4CA 4OB8A 3SZGA 3L6RA 2FK8A 2ZYSA 4PXYA 4S24A 4FHFA 3PUVA 5KAMA 3RVSA 5BN4A 3Q2OA 5ALTA 4BO2A 3HZHA 3M2PA 4HEQA 4YRIA 3A36A 2Y4NA 1MEJA 1TCBA 3C39A 3T7AA 1Z4OA 1KEPA 3A3GA 3D31A 1E79D 1CS0A 2B4RO 3NHRA 3PEUA 2PAAA 4UE2A 1T3LA 1XJCA 4NV0A 4M1MA 1CDZA 4KXYA 3UPTA 3MXTA 3UG7A 3BRWD 2RG1A 5I7UA 4YAJA 4HH1A 2V6FA 1USIA 1JEOA 1DBRA 2Z6VA 3GJ0A 1VJTA 1Q7YD 1XCOA 3STVA 1DPGA 4M0FA 1RPAA 1TECE 1K7EB 3ILYA 4F7WA 2ENUA 3CVYA 4GI7A 1M5TA 3EGIA 4TX1A 2C58A 1W34A 4M9ZA 2W43A 1VIMA 4OB6A 3MFQA 1SBHA 1V37A 1MN6A 2E6KA 3M5DA 1Z5VA 3NASA 2H17A 2L0XA 4L0CA 4EEXA 3E3MA 5HJ7A 4L2IB 4TTQA 4DPMA 7AT1A 1SU8A 4JUCA 3RRJA 3FSJX 2PFGA 3V8RA 2D0PB 5J1SB 3QWHA 1T6ZA 4WNAA 3LY5A 1HNNA 4HAWA 3UQYS 2PT5A 2EFEB 5T4BA 1VSUA 3VNVA 2H7CA 1WEHA 5A2QA 5CJJA 3HNPA 2X8JB 5U1PA 4RZUA 2IU6A 1XZKA 4YJGB 4DILA 3PHGA 3WC4A 2ZRKA 3PT5A 4BO8A 4E6EA 3RAPR 4PAQA 5JRJA 1SQ5A 4FILA 4MP6A 3TPFA 2WZPP 2OCLA 2PM8A 1B16A 3A58B 3IFSA 4GX1A 4KRXA 3R7DA 1WKCA 2R00A 1U5AA 4XDYA 2L17A 1AV7A 2MMCA 4KPUB 4DCNA 3WZLA 5AN9A 2JI8A 4KE6A 4MGZR 4TPKA 1AURA 1ZN9A 4YFYA 3ZBUA 2IRWA 2EBHX 1QHXA 4CIBA 1TYEB 2QIPA 4RDHA 1C80A 4F86A 1EQ2A 2PG3A 3ITDA 3KQQA 5CK5A 4E5YA 1QH8B 3RCBA 5ALVA 2NUAB 1VRWA 4LTDA 1Z4JA 3BMNA 4G89A 3IPXA 3RUCA 1HUQA 4C0KA 4UFOA 3WGTA 1T5IA 2PYDA 4U2DA 5A5DA 3ZXUB 3AETA 2ID4A 2EATA 1AKTA 2PT7A 4DPKA 3LQ6A 4MHOA 4RM0A 3NDIA 1KI7A 5EJGA 1AA9A 3WV4A 3NJ8A 3HYNA 2V1XA 4F11A 3HWWA 2XPCA 4RVNA 2D0OB 2R7KA 3CB2A 4OJTA 5EIXA 1Z38A 1K7XB 2ADFA 1WLSA 3AZQA 4YIKA 3DV0A 3BEDA 3R3SA 3LUKA 1JIJA 1VLMA 1IN4A 2J46A 5AI9A 3PITA 1PWYE 2V5VA 4S35A 5LP6C 3BAFA 2Y2VA 5CDFA 2ABWA 1OKKA 1JRLA 4PGAA 3FSRA 3AI2A 1KEUA 1CUJA 3ZD8A 3RU7A 2VRCD 2AOWA 2ZXHA 1C1XA 1Y1TA 3NW9A 1QGZA 1SZJG 3DZIA 2FQQA 3CONA 1W59A 3C1OA 5DGTA 3KYDA 4B2IA 1ZH2A 1RLMA 1TGYA 2HBRA 1ZDMA 1B6RA 2QQFA 2VT7A 3CISA 1USUA 3DFUA 3O8OB 4P32A 2G04A 5AK3A 4B6GA 3PEYA 3EBLA 3MYYA 2EZTA 2HF9A 4LNHA 2PVCA 3FWZA 2QD5A 4QDJA 2JFNA 3CYFA 4DJFC 1L7OA 4DDUA 3VH4A 4UPVA 2DT5A 2OUIA 1N9GA 2YV2A 3HCEA 2IYEA 3K4PA 1K5GA 3NHAA 3TRDA 4GWKA 2A84A 4JOCA 1VHJA 4NQZA 4EHHA 1N3YA 1PVDA 1N5IA 1P0QA 4M3NA 2XAAA 3AGQA 3CUTA 3TSOA 2V7TA 5EMLA 3HSYA 1USGA 5IJ0A 3P9PA 5G0WA 5BOSA 4DCJA 1SBQA 1RADA 3PUZA 2H2GA 3D5EA 1CB7A 1VL6A 1XZNA 2Q99A 2YIMA 3LYHA 3QPDA 2VP0A 5BWCA 2OYNA 1P18A 1DDGA 3IA7A 4KQ6A 4EKYA 1CYDA 4F1KA 1E3ZA 1LLUA 4AD8A 1NSYA 1NOKA 1H0KA 1P2VA 4UBNA 2P69A 1QIEA 1JIIA 2B8JA 3BWYA 4CLDA 4IBOA 4LRYA 1AV6A 5JJKA 2QP3A 2QRKA 3FPEA 1U7XA 1P0FA 4ENQA 1YI1A 2FWBA 2FZCA 3I6QA 2VI5A 4CQJA 2JB9A 4H4DA 2BEUA 2N42A 2ILTA 1AS3A 1YD7A 3B85A 3DYIA 3OPOA 1Z45A 1XT6A 4IAOA 1T43A 2Q0HA 4Y18A 2X0FA 1GKUB 2VDKB 3VHQA 2P40A 3FGNA 3LJKA 5KYYB 3JQQA 3EH2A 4EHNA 5ALGA 2I55A 1JIQA 2N47A 1IVSA 4DC1A 1XDZA 1YDHA 2CDBA 3UA3A 4P3KA 1U81A 1N07A 3E6AA 2IY9A 5FHRA 3RGGA 4XYEA 3BC9A 2B2CA 5CA0B 4CGYA 1GAXA 1TM5E 3PGVA 1R6TA 1T10A 2GPYA 3U4AA 4HPWA 4YPVA 2JN9A 3P9IA 3N6RA 2BEKA 4D6XA 5B6JA 1ODJA 1KJJA 1P45A 1G4HA 3QTLA 1WHSA 1CLEA 1LSUA 1DZIA 1PJ7A 3O1HB 2C31A 4TQAA 3LBFA 4MWTA 5BQPA 4F3NA 2RGAA 1BZYA 4TTIA 4G25A 2BMJA 2EW2A 1KK3A 3VTAA 1YTLA 3EG9A 2HIHA 3Q9SA 4IOKA 4XX0A 1L9XA 4OYHA 3W0LB 1ZH8A 3LCRA 4UHJA 3K0FB 2JFWA 5CB4A 4XVUA 1U3DA 2YC4C 1YL5A 1V95A 4HDSA 1JZQA 1NF2A 1O4WA 1Y7LA 1Q5PA 1X39A 2O1EA 3CT6A 1XZLA 2GN2A 3PJFA 2PMEA 1ST2A 4C4ZA 4REQA 2K2QB 3BIOA 3JQ8B 3KZVA 3WLMA 2W8BA 1DUSA 5AJUA 3SG0A 5HIAA 3HYTA 1YQGA 1DV1A 1P77A 1RQNA 1UDAA 3HMQA 4G5HA 3OOYA 3R1IA 3W2HA 2GSWA 4G8JA 4IQ4A 3X1YA 4C7BA 1Y48E 4BMZA 5FP0A 4D98A 1DXHA 3HVUA 1X15A 4DLBA 3HPRA 1Q1GA 4ZAWA 3UICA 5CDUA 4IDAA 3SLRA 5LQUA 1CS4C 5J2TA 1GSHA 3RLFA 3O31A 3CLSC 4UFPA 1E7SA 2ZTLA 1Y5MA 3F7TA 2ECQA 2IW3A 3B3QA 4DTIA 1JV2B 1N32B 4TZTA 3HMKA 4RD1A 2PX0A 2C2KA 2DF8A 3GVCA 1YWGO 4ZZ3A 4L8JA 1MX5A 1OZHA 1RI4A 2FSFA 3UK1A 1CE8B 3KKKA 1XTIA 5C7IO 3UJ8A 1Z6QA 1G8AA 1P8AA 2IK8A 3ENQA 3MWYW 1VBMA 3HXKA 2GI4A 3LXMA 4BTEA 3ZWBA 1M74A 1D2HA 1VI5A 3DE4X 3GLIB 1LBEA 2O3UA 3MCZA 3NC4A 1PKXA 3BC1A 5KNDA 1I2AA 1KAQA 1VQ6B 3CZ4A 1KH1A 5FORA 2R7LA 3AU8A 5B7NA 4D8UA 3ESQA 3R7NA 4G86A 1NF3A 4PZUA 2IXGA 2BKUA 2NSLA 4QVAA 1LFDB 4XM2A 4AAYA 1D07A 1H8HD 2BFOA 3TEMA 3IP7A 2L19A 1VHEA 3ZE8A 2ZETA 4WZEA 4I66A 1EP9A 4YIHA 2G9NA 7MDHA 5ALSA 1V7CA 3H8JA 4D97A 4PO3X 1JDBC 1JJIA 2OV4A 3HJGA 4KX3A 2XZTA 3BWBA 3T1TA 4OXQA 1XC7A 1NV8A 3WSVA 1Z2AA 3FX2A 2QZJA 5HTKA 1TJ5A 3N07A 2J9FA 1N6HA 4QO8A 2D9RA 2PS1A 1Y1KE 3GJXC 3H5OA 1V43A 3QU4A 4ACBA 3AESB 1Z7EA 4I1YA 4R2MA 4YK7A 4V1CI 3AFOA 4BKRA 3WGIA 3T1VA 2BGWA 1PZXA 4WOBA 2VR1A 2ECKA 2XUFA 2V54A 3AXSA 5LP6B 3V1YA 1QRUA 3G9TA 4L73A 1NHWA 1T0PA 3UHFA 4MV4A 4EW3A 4OJKA 1QSGA 2IGTA 1PNQA 4RA9A 3IVCA 5FBKA 3FCOA 4AJJA 4YUZA 2OGZA 1MQ8B 4D6YA 3THWA 1CNEA 4KLAA 3ZY6A 3C5HA 3WLQA 4Z1MD 1AKVA 5BNZA 2C8JA 5ITWA 3PFHA 5F73A 3FLMA 5DNEA 3P0JA 1IUOA 1TA4A 1WQ3A 2Y1XA 4PZZA 2A0UA 2MSWA 2C5SA 3GD7A 4IKOA 2I3BA 2G63A 1UZAA 3G82C 4R1UA 2RGNA 1YR9A 2YWCA 4FNAA 4TS9A 2H2AA 1FDVA 3O82A 3FCEA 2D3NA 3RE1A 4ALIA 3M70A 5H81A 2DJ5A 4JNCA 3TI9A 1ID1A 3C97A 2PLAA 3AEKB 5DM2A 2C57A 1EDOA 3SKXA 1IM2A 4RZ2A 3OX4A 5CJ2A 2IDKA 4LCBA 4U7WA 3IP9A 5A5GA 2V6MA 1TF7A 2J3KA 4TV9F 6GPBA 1VSQA 3FGOA 5BUCA 2ZSKA 1KGSA 2YFYA 5REQB 4AN1A 4R71A 2WVAA 4M0CA 1U2SA 1OYOA 3GNTA 4JLAA 4IRMA 4OK5A 3S2FA 3BSFA 3TSCA 3R2JA 2W2KB 1LBSA 3E84A 2O52A 4QNRA 3KR9A 4UHHA 5T3UA 1F60A 3U3MA 4KIGA 3S7ZA 4PBRA 1JKJB 1SBTA 2I2BA 3CMCO 4BO5A 1TLTA 2FSVC 4CQMA 1GOTA 2HMSA 2G17A 4HNHA 4Q66C 3QEMA 5AVVA 3SKBA 4S12A 2YXBA 5IYPA 3BWEA 2W0MA 5KYUA 3J81A 1C7JA 2ZSBA 3H0KA 4LQ4A 5DHSA 3THWB 1KFJB 4CU2A 2V7UA 2WZDA 1I4EB 5JMPA 1WPXA 1M6VA 2D3WA 2Q2VA 5UKDA 3U39A 3C6ZA 3L92A 1KQPA 3OJOA 5HIMA 4LTMA 4OKSA 4IIJF 5EP4A 5KSPA 5IRCD 1GUZA 2NV2B 3FM9A 5ITVA 1PJ5A 3EUEA 1HQCA 5J2UA 4IYRA 1ZM9A 1JDUA 1ZA2A 3A26A 4ARIA 2FPMA 1K66A 4WY8A 2FFHA 2O20A 2B4KA 5F12A 4YPOA 1DXOA 4TMFA 1OB2A 1SH7A 3UCFA 1TUBB 3VYRB 2BM8A 4R2HA 4XVQA 4N0QA 3TGLA 4ZIRA 1QGUA 2Z9DA 3EE6A 4ID3A 3WIVA 4D46A 1I94B 1QWOA 2PN1A 4MUKA 4XJSA 1I1NA 4M1EA 3DDNA 4RJKA 1CVLA 1I80A 3EOBI 1KBZA 4AJNA 3UBMA 1X8JA 4AWXA 4IIBA 1W4AA 3G17A 2O3QA 1RI3A 3QMWA 4LE1A 4OPVA 2PJDA 2QQ5A 4NCHA 1SRQA 4DMFA 4BTVA 2AEMA 1DFIA 1UZNA 4H3HB 4JEHA 5CEEA 3CNBA 1E1MA 1YB1A 2GCNA 1YU6A 2AKEA 2FPPB 5A89A 3RKSA 3TZ6A 2YV3A 3D7SA 3U5TA 3GLFB 3QVGB 1GHTA 4LYYA 2P0YA 5AJVB 1XNGA 3GFGA 1ZC3A 4NEGA 4AECA 3ASVA 4BNWA 1IMJA 5K7SA 5FPSA 1P9WA 2ZDQA 3TUJC 4CWAA 1SQSA 1R4NA 1TM1E 3SYTA 4NRDA 4GL4A 2H11A 3WIBA 5CB6A 2OTLB 1BGXT 1VE9A 2NU7A 3VH2A 3JASB 1PEDA 1V26A 2XKJE 3I2IA 2EAUA 3I2KA 3G5UA 2W2MA 1AZWA 3FHLA 4KEAA 3PD1A 3AJ8A 4I4IA 5K0LA 3V48A 4BBJA 5HP4A 3AVXA 2Q0QA 1OQAA 1PG5A 2QM7A 4DJEC 5HFNA 4NENA 1SBZA 1N5LA 1JSZA 3T34A 1GY8A 1L3BA 4HDQB 1U2DA 4DIDA 3I9KA 4RPCA 4CCYA 4LWQA 3ZZ0A 1VLYA 4JIMA 5F2KA 3ZOKA 1MFZA 2QU7A 3RHZA 4DT1B 3Q1KA 4I99A 4DV0B 3Q39A 3ZDBA 1II0A 1JAYA 3R3HA 4EHAA 4PAGA 2H54A 1IY1A 1QH1B 3CKYA 1KJIA 3F9IA 3A35A 2HY7A 3CPEA 3DG9A 1A7UA 1PS9A 3EC7A 1FUEA 1Y82A 2VJAA 1ZI9A 3R0IA 2BL4A 3DTNA 2ZAOA 1FA9A 3R5KA 4TMYA 5DT9A 4PG4A 3O9MA 3M8KA 3QBTA 2JAHA 2C29D 2GCEA 3IIIA 4GEKA 2PGAA 2FE1A 4BRSA 4RLZA 2OCAA 3MS4A 4RVFA 1U5BB 4Y2UA 5FYDA 3U4GA 5FX2A 3ETLA 1LDNA 4GZMA 4XDHA 4H6PA 2ECOA 3SEZA 5E4YA 3UUFA 5L3VA 1TRKA 4MRSA 5BO5A 1AXEA 3LKZA 4DSAA 2PWPA 1W0KA 2RI6A 3F6YA 3C1UA 1IH8A 4O4HF 4OLFA 4W7SA 5SY4A 5JW6A 1I6MA 3I39X 1QRTA 1LBTA 3EDYA 4FMCF 1DBVO 5FI1B 1HEUA 1YB5A 5LLSA 3BB1A 4QQ8A 2DWCA 4JL5A 2CWWA 2XCQA 2ZZEA 1KO8A 3A14A 5FNVB 3ZEIA 3B9RA 3LUBA 1QGED 1U9IA 2YDXA 3VZQA 5HR5A 3ZJUA 4II7A 2BD0A 2C4VA 1NP6A 4CMIA 2C04A 2I7VA 4WESA 4OM7A 3PHHA 1HI9A 4NV1A 2F4VB 3TB4A 2VJDA 2WJHA 2FB9A 2FSIA 2PUDA 4RESA 3QUQA 4TTPA 1CBUA 4R8LA 4V0OA 3EGVA 4QVJA 1JHVA 1V7ZA 3C98A 3OMLA 3QELB 4FGZA 3UHJA 2PMWB 3WLTA 3CCEB 1XJWA 2QENA 5EJ8A 4I4TA 3QPUA 1F2DA 3P1JA 4M1TA 5HOEA 1F12A 4OLHA 5TPZA 1TQ8A 4KJZA 3STYA 2GJKA 1H1LB 1O58A 4BKUA 4D4KA 3PS9A 1GGVA 4DCUA 2G9VA 5FWYA 4O4JB 4EUEA 2QI9C 3KHTA 1P1FA 1DKQA 4ZQHA 4YJ2A 4KFRA 1EGVB 2XQKA 1A96A 3N70A 5ADWA 3OY2A 2I4MA 3I9FA 1ULBA 1LEHA 2C7VA 4EVQA 4UTVA 5JPDA 2ZWOA 3U62A 4DSTA 4DV6B 4YUVA 1CY8A 2E49A 2GTHA 4P81A 1JR3D 2BZGA 5A4AA 1UZMA 1VSBA 3DBHB 5KYKA 2IEIA 1DQPA 5LQMA 4IIVA 5IS2A 2ZJAA 2PRJA 1QPZA 4DV7B 4A6XA 3KXDA 4RTNA 1V4BA 2DVMA 1U63A 1OI2A 3KU1A 3KWJA 2NXJA 3F90A 4LKRA 3GXOA 5AW5A 1CJKC 4UCXA 2OBFA 3WBBA 1HC7A 4GICA 3RRYA 4INJA 4R31A 1V1JA 1ADGA 2FW8A 4WWHA 2UUBB 3AC0A 1FIUA 1NQXA 4PZDA 1WZEA 3PWTA 1TCAA 3P71T 5F4ZA 2W11A 2XT9A 4YRSA 2NQTA 1X9HA 3N6VA 4P33A 3CZRA 4F3TA 1VI6A 3GJ5A 1LBQA 4ALNA 3H8VA 1U0HC 4M89A 2MYTA 4UXIA 4GF5A 3VSDA 2PLFA 1Y1SA 2AMLA 2WYHA 1IJBA 1OLXB 3IBFA 3PB3A 4GOND 4KITB 2ZCJA 3X44A 1A72A 3SR4A 2J7PA 3B7PA 3QV2A 1TK3A 2VJMB 4I19A 3RDPA 3I5XA 4QSHA 3R74A 4YT8A 1QC5B 1EDDA 1WXGA 4L1KA 5FTNA 2R60A 2F7SA 2AFIB 2H5LA 4B17A 3MJEA 4BCDA 4PYMA 4XE5A 1HDRA 1T13A 3TJZA 1CG6A 1I3OA 1AE1A 3IL2A 1DC4A 3EMKA 4GOMD 4REMA 2C8LA 1PLKA 3HNRA 4BX0A 2REXB 3AHJA 1QIMA 4BMOB 3NHZA 5BV8A 1IHUA 1VBNA 5BNIA 1QOQB 2BONA 1P2BA 1UD5A 2H7YA 1VOTA 4G0XA 4OBWA 1N3BA 1W7AA 3A32A 3W06A 2FPXA 1P81A 2NO0A 4QULA 1E3LA 1Z82A 2X8LA 4HUQB 4U2FA 3T5DA 2J09A 4JFRA 3RUHA 1TA9A 3VYSB 3QSGA 3W3AA 1EZ4A 1KQ3A 1WXFA 3TZQA 1SVSA 3X1JA 4HMQA 3RASA 1OLSB 3LZ6A 4V39A 3OZSA 1ECBA 2WT4A 3MWJA 1EFUA 2QQGA 3IOCA 4YONB 2HWXA 3V00A 4XONA 4AMYA 1DHTA 4DNRB 2SHKA 4TMKA 1ITZA 1OKKD 2RI0A 3QH4A 3QX8A 4XIGS 1KKUA 5GWXA 3ZI7A 4TKUB 4BLRA 1IHPA 2P5TB 3NT5A 3GRAA 2WW8A 5EYPB 2V6JA 2Y93A 3SIRA 3AKCA 4CMBA 1LD3A 4UAVA 3WO0A 1V71A 4IH1A 5FQNA 3KWFA 1EEHA 5FTMA 2NVBA 3LWBA 3HCWA 5L4SA 5EMJA 3A9SA 5A4MS 1FY2A 4KYIB 2X1LA 4A5OA 2P68A 4FYKA 3CPSA 1L7NA 3EEFA 1ACLA 2P2SA 4H7JA 3ADOA 2VCYA 4J0EA 4CKBB 3VUFA 4RCYA 3R6DA 2XHZA 5AW7A 3KFXA 4DUYB 4I1OA 1CUZA 1XTQA 4WEQA 4D0GA 5LVAA 3MHTA 3BERA 2OXCA 1LCIA 2ZB4A 1XLTA 2XNHA 1YQ9A 5AT1A 1JEYA 3ZIAA 1Q11A 2IYAA 3DTVD 1XR3A 1OH7A 3FDIA 1CERA 3PSHA 3E05A 1NBHA 1N1DA 4JLNA 3UUWA 2W6IA 1H05A 1NVVQ 4GOOD 3D9QX 2HMVA 4DLNA 5C18A 1ZGJA 1RCTE 3W6PA 3ZWYA 2H18A 3AYZB 1GPUA 1YBVA 4KFSA 1S3IA 2BFFA 2BC9A 1NRXA 4J1TC 4L5IA 3LF1A 4AX4A 3QFCA 1PBTA 1NB9A 5HS4A 5JSKA 4Z8YA 2CCJA 2ODQA 3EDMA 2NU8B 4DIFA 3PRYA 3T5PA 4XXHA 2P8JA 4G1CA 4QNNA 1T35A 1ZCJA 2EFJA 1H9AA 2FW9A 1E2EA 4FYWA 4BQQA 2NXEA 2HSGA 1A04A 4RY2A 3OKXA 4FWTA 1HVXA 2JC3A 1DCFA 4MVXA 3P9NA 2ZJ7A 4OQMA 1HSZA 5IVDA 3CZAA 5IJZA 4MGYR 3WLFA 4N3AA 5DF1A 5EIOA 3MF4A 3RC3A 2YFQA 1ETUA 4Q1AA 2XYPA 3TQTA 5D1HA 1T3ZA 2DU8A 1BLIA 3AU9A 1LLDA 3G8BA 4WXRA 1NXTA 5F7JA 4URHA 3V4PB 4C6HA 4D81A 2WB4A 4DZZA 3IAM1 1N0HA 3P2OA 5FLEX 2PKCA 3A1EA 1X1EA 2QLMA 3KPWA 4L6CA 4QTXA 3HWX1 2V6BA 2G6BA 1QXSA 5HZHA 5L3QB 1UBNA 3I6BA 4N0PA 4KOAA 1K4YA 3JYNA 3FAZA 3N87A 4FZ5A 1OV6A 3JQAD 4GI3A 2OSBA 3P26A 3QFSA 3FIJA 4H4CA 5HQJA 2JEOA 2O1XA 2ZYRA 4I1VA 4BBZA 1AKRA 1DJNA 1Z7GA 2EERA 1LVUA 1HETA 5ESXA 3ZCQA 5K3EA 4Y9UA 4F46A 4UEWA 1G8PA 1EAYA 2CMGA 3L1HA 4YMSA 4N5IX 3DKIA 4AJKA 2PT9A 4Z86A 4XCQA 4YBZA 1KOJA 4RJIA 3UJNA 1AK9A 1IQRA 3CW9A 1I4WA 1ZMTA 4EPWA 5T8KA 5C1IA 1LA2A 4Q1DA 1VMAA 3IV7A 3JD2A 3RS9A 1RYYA 5DM4A 5F3DA 4CMGA 2J0UB 1JEDA 3V7NA 4E4RA 2INGX 5HKKA 2NV4A 4EUHA 1HFJA 4GQAA 3HEMA 3M6WA 2WU0A 4BN5A 2ZBEA 4PHFA 3VAZA 4NF2A 3IE0A 1ORTA 1UM9B 2PFKA 4EHFA 3JALB 3HJUA 4DADA 3V4RA 5C1BA 1QVRA 1MJ5A 1JJVA 4F9FA 4UUAA 2VATA 1HDXA 4K9SA 3C7CB 5CNJA 1WVGA 1NVUQ 2P2LA 4HAOA 3TTVA 1WY7A 3JVUA 2P1RA 4DIOA 1U2EA 3AUAA 3KYJB 5IYZB 3VPDA 3CRW1 2J85A 1QE5A 4GXNA 1NNUA 3CC8A 4IQFA 4M8SA 4OXIA 2DXIA 3VVCA 3PNSA 3TIFA 2QB5A 4MPPA 1R50A 1G9XA 2ICAA 1UJNA 4TWJA 4R51A 2WYWA 1QNLA 1TJYA 1KP3A 1X7YA 1AO0A 1QK3A 4AF7A 1ZLYA 3LY9A 3A6LA 4FCWA 2JW5A 4FIDA 3TKLA 4AN4A 1MO4A 5BPFA 2VDVE 4XGIA 3V8PA 3FLAA 3UEOA 4BNUA 1V48A 2C4HA 4QUJA 4ZCLA 3GFFA 1JI0A 4U8HA 3X2EA 2PZLA 3BXGA 4MUIA 2NU8A 3ZWNA 2F00A 3KALA 4C87A 3R20A 2Z8XA 4OLJA 2NMVA 2CFTA 3EGEA 3TQOA 3G71B 1F4PA 3VM6A 4DRXA 5KNDD 1C7IA 2IA5A 2FR1A 4JBIA 2VQEB 3RIEA 4FOLA 1BFKA 1UD8A 2M9MA 2OCKA 1Y4DE 3EZ2A 3N28A 3ZWQA 3Q8LA 3JQ9C 2CJWB 4B3DA 4YRKA 5K03A 3A8TA 3U44A 4Y6PA 4QVKA 4TN1A 2IYTA 5LXTF 1AC5A 3B6KA 4FBGA 4BKOA 4BVHA 2J0SA 5IMSA 1N6KA 4BEJA 1LGYA 1MW9X 3I8SA 5EKDA 5CXQA 1P7CA 3C7KA 2PS3A 4B4KA 1M1YE 2HLPA 1IDN1 2QMYA 2W4IA 1NIJA 3DCNA 1WR8A 3TTTA 3IOYA 3EA0A 3R6TA 1R0RE 4NZOA 3WL6A 4ER6A 2VBUA 2QLLA 1U1EA 3BXHA 4L02A 4NE2A 1V11B 2PUGA 1R6DA 2FFRA 1O87A 1ONBA 2JJMA 4PHTA 2JARA 3K3PA 3PGXA 5K2OA 3GQBA 4UVDA 4L78A 4XFJA 1C3LA 3NTRA 2FSSA 3T1QA 1HE3A 2KBFA 1JBKA 2WNSA 3A06A 1ZOLA 2PHZA 2EFYA 2DZDA 1CJMA 3D8BA 3IJPA 3K6RA 4HGQA 5AR1A 4XUCA 2VHEA 3UA4A 1T8TA 4II3A 4HZGA 5BN5B 2OL4A 3ZYZA 3G0GA 3KKMA 3P0HA 3RBZA 2YJ3A 1UPTA 2AF4C 4NG4A 4F72A 2QRZA 2CE7A 5BORA 1BGVA 1Y8QA 2XA9A 1OAAA 5FJJA 2CXQA 4R9UC 1Q0TA 2QTCA 5FLXA 4Z9YA 4YACA 4KBFA 1GGFA 2DUWA 3I73A 2PE5A 4B2YA 5LQJA 5AXBA 1RIIA 1UOOA 2POQX 3WKAA 1LPNA 4CM8A 2JLUA 2WAOA 4IFIA 1LB1B 2Z6BD 4RCZA 1RIFA 1FQJA 2I2FA 2WF9A 5JAUA 2ZYIA 4W8HA 2COUA 4XGQA 5K3SA 1LU9A 1QH0A 4UTPA 4NFSA 3UH1A 1T4DA 2ASVA 2FTKE 3EIXA 1B1AA 1SHTX 2VHWA 3TXYA 4MYTA 1E2UA 3KYCB 3FUCA 1WZ2A 4H17A 2HUPA 2G09A 1JR6A 4OKIA 2YRXA 2I62A 3SSOA 4JJEA 1PWHA 3GEBA 1Q9SA 2VJIA 1C14A 1T8YA 3MWDA 1QO0A 2JK1A 4UUOA 1ZSNA 1SURA 1GUYA 4GAEA 5LQKA 5GZ1A 2ZYAA 2QUKA 1XYYA 1IZ8A 2FR8A 4CQMD 4PG5A 3QUBA 2ZU6A 2FQWA 4RSGA 3LC2O 1U9JA 1U0TA 2A3NA 2M5SA 1C3EA 2QRJA 1YUMA 2J41A 4Y9RA 2OVBA 1IG3A 2AKAB 4G65A 1N5KA 3OZRA 2WSMA 4QLOA 1CNFA 3LX5A 2X5XA 5TY0A 5KO2A 2JLVA 1FB5A 3AF1A 4MUEA 2WJGA 4DBLC 2RKWA 4N7BA 1HQKA 4FFBB 4DY4A 5BVHB 4ZYXA 5DI3B 3ZCPA 1YCFA 3SVZA 3NGLA 2AXEA 1YH3A 2OG2A 1I1OA 1UJ5A 4GRAA 2XKKA 1PNOA 4ZYUA 1L9KA 3ZYCA 4CUKA 4JI5B 4MKZA 3DE0X 1VE7A 1C8LA 3UMFA 4LJRA 1HYGA 4AL4A 1NN0A 1RYZA 4XWKA 4JSYA 1ELOA 1T2VA 1O77A 3G4SB 5IASA 1LX7A 3ZWMA 4XLEA 3H05A 4X45A 1RHKA 2WD7A 4QQNA 2YW2A 4L16A 4BFWA 3FMOB 4EDFA 3ZD7A 1A2KC 2IYZA 3CLUD 3OQBA 2YYSA 1GTVA 3GP3A 2YY6A 4JCOA 3F5QA 2QNRA 1NT2A 5TMBA 2VAMA 3T54A 5BR7A 2H7VA 4QXMA 2LP4Y 3WL3A 2P3OA 1Q1NA 1IN7A 1XVLA 1JFVA 2XDAA 5GJBA 3WLIA 5C4MA 3AUXA 2ZJ6A 3BKXA 4RTPA 3VNUA 1QVVA 3STHA 3UJ3X 2EP5A 3JQGA 1IBKB 1QU3A 2Y6VA 1DWOA 2ZJ4A 3IQHX 1A1VA 3SBOA 1OH8A 1TOAA 5J4HA 2IUYA 3ZV5A 2XOEA 4LOKA 5EIFA 1OR8A 4AMBA 5HA5A 3KR2A 3WADA 5GONB 2O7NA 4H7FA 2YOFA 3JXEA 3QYAA 3QVXA 5ER6A 4REOA 1M2OA 4NU0A 5U4XA 1C7RA 1PU2A 1VIVA 4P98A 1GPKA 3KVVA 3QOXA 2MWMA 4PINA 4RGBA 1L8OA 4P6YA 2GZMA 1MC4A 3F73A 2Y0BA 4HWOA 2AZ4A 4FGJA 3MMSA 3HDJA 3E2MA 3QKWA 2AOVA 1E4EB 1HDEA 3KLPX 1ZVQA 2VBVA 4ASUA 2G8LA 1P0IA 5D84A 5DGXA 3IMEA 2PR7A 2GN0A 4G4JA 2FGKA 1G291 5SY6A 1UBUS 3QF7A 4C7MA 2VTBA 4DG5A 3D5TA 2H29A 4P93A 2PUFA 4IWXA 2QNBA 4QYIB 4YLYA 5EHQA 1MNQA 2I6XA 4L3WA 1U1IA 1WUHS 2X4IA 3DEZA 2H4HA 5EQTA 1WU7A 1BDIA 2ZVDA 1QV9A 3ASZA 2Z3ZA 4BQEA 2SCUB 2P4HX 3WOHA 3UBTA 5D7NA 3JQ7A 4EF5A 2HNAA 2J31A 4CHTA 3ROFA 2MDTA 1QFYA 3CJTA 3F8TA 4KR0A 1Z0JA 4KYUA 2WTXA 1JTVA 2RDMA 3FAKA 4LVCA 3SEFA 3ZNPA 4EGJA 1ZJJA 3M5PA 1H42A 3CNQS 2B36A 3RFUA 2JZCA 5HZBA 1XMVA 2P9EA 3A1TA 5E8RA 4AU1A 1U7HA 2C9MA 4PRYA 3WGUA 5B30A 5AI0A 2ZTHA 1K73D 1NVBA 4N39A 2ZIXB 1SHUX 3BL5A 4YJKA 3REQB 3W5SA 1W0KD 2XKBA 4HWSA 4Z4ZA 1UMCA 4W5QA 3AEXA 1Y6ZA 3IUBA 1VECA 1Q7RA 2HIAA 3HCFA 3K1YA 4MRMA 4TTRA 2Q21A 4H1VA 1WPQA 3RANA 2WHXA 1I3MA 5CA1B 4CNBA 4OGKA 1N7HA 3VNAA 4DIEA 5KQLA 3BB3A 2W2OA 5DNYB 3SIPA 1D4OA 1CRLA 1EXWA 4LFCB 4TQ9A 4PLPA 3DAFA 2QZPA 2AUTA 5DXJA 2MYPA 1GPH1 3NAGA 2AJCA 3JSXA 2BW0A 4EUFA 2O3SA 5AK0A 3FKSD 2QGGA 2O57A 4OK3A 1FYDA 4HVLA 5C7YA 5FUXA 4RETA 4Y9DA 5KVVA 4KQIA 3WDMA 3QLJA 3P52A 1JLSA 5I7VA 3PEEA 1Q91A 1VC2A 1ZS9A 3L07A 2TMYA 1QPBA 3K71B 2VHUA 1P2UA 1VG0B 2YHUA 1T0IA 1GG5A 3LKBA 4OJYA 1MKYA 2BM0A 4B47A 4LZWA 2DBVO 2WYIA 1L4YA 4R1MA 2QN7A 3NYQA 3QY9A 4P35A 1NBIA 2GVDC 3F1KA 3LUAA 2WV7A 1SBCA 3VKHA 3QVWA 1E5QA 4Q0MA 1CQJB 3TSYA 1MBZA 2P11A 1D6JA 2ID9A 3GLTA 3KZKA 1E0SA 2WWTA 2P9GA 1L4NA 1B26A 3Q3VA 2NIPA 1YRHA 5DB4A 2AMJA 2ZT5A 4M8KA 2ZYTX 3JWEA 4W7IA 3PDWA 1R0YA 3TNFA 1JHDA 1H8ED 3IAFA 3IAS1 2RJ3A 2X6QA 2RHBA 2PZMA 3QW4B 2ORVA 4QJ5A 2VDQB 4X54A 3TM4A 3A2LA 2JGJA 4Y6SA 4C76A 5A3RA 1M2NA 2VCHA 2R62A 5HF9A 1W9XA 4WSOA 3TPCA 4YUYA 4G6IA 3OWOA 4AKIA 2NUPA 5J23A 5F9FA 4HWTA 2DRIA 1UBHS 3DQPA 2NAPA 4CLXA 4MULA 2GLTA 3KHUA 5JT1A 1JX6A 3H3JA 3ASPA 5BW5A 4KYTA 2ZI3A 3KSDO 3UWMA 3W2FA 1UBOS 2VYQA 1ZCBA 4J2OA 3RS8A 3U5ZB 3MGAA 3HYLA 2G7ZA 3HJHA 1QUFA 4WJLA 1B14A 3RHTA 4BJ5A 1KEEB 3Q5DA 5ITZA 4I5FA 1GCOA 5CHEA 2BTEA 2PMBA 4HVAA 4HS9A 3N8GA 4RKEA 4A16A 4F04A 1AMUA 4ENTA 1LJ8A 1L7DA 3DL7A 4O8ZA 4YASA 3H19A 1ZX1A 1ICIA 1KARA 3JD4A 1YV9A 4YAOA 4I46A 3OLXA 1RXIA 4PTLA 3W6OA 4AY3A 3NNSA 5CLIA 4DR1B 3K9WA 4EI7A 4WGGA 4ZK2A 5HRCA 3MELA 3MOSA 3K0AB 5IM4F 3H5TA 4QJIA 1NVXQ 1NDUA 2BIFA 2HRDA 2NYVA 4IDPA 5ICFA 5JMOA 3PD7A 4TS4A 5FIUA 1XWFA 2QTFA 4G8DA 2BFCB 3W8FA 1D7AA 1QG6A 4UUPA 1M0WA 4EA9A 4XRGA 1NBMA 5EUMA 4RTLA 4D02A 2ZRNA 2DPMA 1C1DA 2C97A 3M34A 1XN1A 4Z0TA 5BN1A 4RTQA 2YN0A 5HHTA 2RJNA 2QV7A 2DMRA 3LDFA 4PCAA 3GRPA 5EWJB 4ZCMA 1T5EA 2BDUA 3E3AA 1WOPA 1AK2A 1CUDA 3M3DA 2AT1A 3WMWA 3CT4A 2XLBA 5ICEA 1BVUA 1XQ9A 3EIQA 4V0NA 2CWDA 5GIOE 3ZH9B 3W3AD 3R3JA 4Y2TA 3AVOA 4R1PA 3GUUA 5DJ5A 3RAEC 5EMMA 2G28A 1DINA 2WABA 3TLGA 1Z5WA 3RFTA 1CEQA 1IBLB 3W5IA 5CAEB 4S05A 3HDHA 2NSYA 4TXJA 4JY7A 3C6YA 1QIDA 1RYMA 4JLWA 1FC0A 1BMFD 4MAMA 3ZE9A 3EVBA 1MV5A 3IRVA 1YA8A 1OY1A 4NBWA 3LD9A 3LVQE 4WNIA 4QOJA 1T0JB 2QPTA 1FEZA 3IR6A 4H7HA 3ZGXA 4M8IA 2OXTA 1J25A 2TRSB 4B3FX 1VQ5B 2OKGA 2XECA 3ANLA 5KHOC 1EFLA 4GOLD 5HQ3B 1ECJA 3EJ6A 1VKNA 4IV5A 1SCKA 3SM3A 4AY2A 2WWGA 3DMYA 1GLNA 1GCIA 3CCRB 2XEXA 1K7CA 2GAFA 2GBLA 3ZY4A 2RH4A 3O4RA 3LDHA 4JEIA 1C3JA 1NIPA 1U8AA 4YP0A 1EQUA 4FVTA 4ZAZA 2X5OA 5LBTA 3RJZA 4CIAA 5IYNA 4L07A 4DQUA 3TTUA 1XVIA 4ERXA 1VQLB 1NP7A 4IHJF 1RQ7A 2AOUB 4FR2A 4RULA 2Y1KA 1P1CA 2YXLA 3CURA 1GGJA 3KKEA 4Q3KA 5I47A 3KKPA 5FUYA 3E3NA 1JW9B 3GGCA 3HFSA 3OCVA 4BUZA 4CI9A 4Q37A 4C30A 1ZSYA 4L3VA 3PQFA 4X8LA 3PUIA 2BKAA 4EUKA 1RZ3A 1DT5A 3B52X 4YBRA 5JEDA 1NN3A 3G2KA 3Q7SA 2IYLD 1X8KA 1AQUA 3FF4A 3NYRA 4KMMA 2C2HA 1DSSG 3EZYA 2ZITA 1RCFA 5HBRA 4YX9A 5MN5A 1EESA 1SVMA 4YRRA 1ZHHA 1FX1A 5K0GA 4HBZA 2ZL5A 5KCMA 1OT3A 2E5WA 3SY8A 4OSPA 1ZKDA 3DLPX 4KNVA 5A03A 3DTTA 1E9CA 1OUMA 1FFDA 1NVFA 2ZT6A 5AI8A 3PFIA 2XF8A 1Q83A 3E61A 4YXWA 5F1OA 1XRRA 2G6TA 4FI3F 3L0YA 3B3JA 2WU8A 2O3RA 2K87A 4F2HA 4EVSA 2ZBVA 1YGYA 4BVKA 2EWMA 5C51B 2D6FA 1HE2A 2ZOSA 4RVUA 3OZIA 1E2HA 5FTKA 4GLLA 1Y8CA 2AFHE 3E4CA 1FYVA 5FL3A 1E69A 2NTEA 1B1CA 1E77A 1EGHA 1Y6QA 4R0MA 4GOXA 5MF6A 3OKAA 4JLPA 4RE5A 4E13A 3LQ1A 4A7PA 3ULKA 2WIKA 3QBVA 1YONA 2DEUA 3R3WA 3GBSA 3UT6A 3DZJA 5JWOA 2IIPA 4MR7A 4JQYA 4QPCA 3UWOA 3G0HA 3GWZA 4TXNA 1DAIA 1G6KA 4OG2A 1ZVKA 3A6EA 4IO1A 3CH7A 4H0FA 3E35A 3G0OA 3OJFA 4NH0A 4TUYB 5PNTA 4B6EA 1W0JD 1CXZA 2BSQA 3O2JA 3NE5B 3A6JA 1M9NA 1GQYA 2VBTA 1NQVA 2GNOA 3ANSA 3TG2A 4I6EA 1Z5ZA 5JNUA 4MP8A 4FNOA 4K6CA 5TXGA 2Z9CA 1MHTA 1ADCA 1UDXA 3RPEA 1HQYE 2WTMA 3LNCA 3GI1A 3O9VA 3EFBA 5KJ1A 3EH1A 5DIFA 3H11B 4LY6A 4U6NA 1NU8A 2BBWA 2X2EA 4N40A 1XLVA 5AVZA 3WZMA 1YKFA 2X58A 1FE8A 3E7DA 3EF1A 3KAJA 1DOAA 2J9ZB 1JJFA 1DG1G 1O08A 3BCRA 3I9V6 1H3FA 4OYRA 1ZL2A 1QLHA 2I65A 1G9SA 1KDPA 2IQIA 1QG4A 3GVLA 1UEIA 1UXGA 4RGVA 4Y1RB 4MJ7A 4YRCA 5AW6A 2VIIA 4JI8B 4DR4B 4Z4IA 1QYIA 4E94A 1FFGA 1IHXA 1Z4QA 1KKLA 2CLOB 2QIOA 1KMNA 3CR8A 1L7VC 3FZYA 1HY3A 4P82A 5LB4A 3WO1A 4I50F 5F78A 5LMZA 2FGJA 3B51X 1I7LA 1GARA 3DKKA 3R0QA 1XMSA 1UANA 1WD7A 4PO9A 4MIKA 1C9EA 2ODNA 1Q7TA 4I9NA 3FTCA 1NX9A 5HUQA 2RE8A 2H85A 4WK2B 4BEVA 2CD9A 2V0NA 3GT3A 2WYVA 3B12A 3BFPA 2D5IA 1UFVA 4UU1A 4QICA 2ZIEA 2QJFA 5BY2A 1KZHA 5FOTA 4JKYA 1GSIA 5FD8A 2UUPA 5HM8A 1UIMA 3USCS 4BAZA 3DNPA 4M46A 5ERYA 4WWVA 1SWWA 3NRJA 4ZI5A 2VDNB 1E2JA 1QGYA 4OIFA 4F5DA 3IDSA 3NC0C 1V5WA 3S99A 4B34A 3KDAA 1T15A 3STXA 4DNTB 2PV0A 2Z2ZA 3QLVA 4WTOA 2FW0A 5JRDS 5LQAA 2XGOA 3RBAA 5HZMA 2QT9A 5B2FA 2NU6B 3TD9A 4H3SA 3TMYA 3THSA 1XKQA 3ZHSA 1Q95A 4WA8A 4JJ6A 3KV3O 4NYIQ 1Y37A 3SI7A 1G7TA 1FSZA 1NE2A 4KSYA 1SXJD 1W4CA 3N0WA 3OCZA 1HLGA 2YBEA 4F8JA 4KAFA 2PWBA 3QENA 1FFSA 5DN6A 1REQB 5EWLB 3D3NA 5B55A 5KC9A 2FPGA 2VHVA 4J2TA 3CNNA 3WB0A 1DC6A 2FEPA 3OT1B 3PGLA 3OBBA 3TYXA 2ZAYA 2HMWA 4S0XA 1DIBA 2HO5A 1HE5A 2FOXA 2A35A 4JAVC 3FUXA 4YJFB 3GUHA 5AVJA 4CKXA 2YCLA 4XKJA 1NNLA 2WMOB 1S01A 4KV9A 4DEVA 4CV1A 4MJXA 2UYYA 2Z98A 5HCIA 3PUXA 4M6WA 2K4MA 4G24A 4HQLA 3T7KA 4LX0A 5AM1A 2R7NA 2KYRA 1CSEE 2WJVA 1KZYC 1GR1A 2XGJA 1YO6A 2VK8A 3C5WP 2PH3A 3CKMA 3G1UA 3PCTA 3T61A 2O9JA 4OPSA 3OQHA 1U1CA 1NQTA 1PX0A 4ZDWA 4FTWA 2VZEA 3DULA 3W6NA 4BASA 1YJNB 3LL7A 4W9NA 2VQDA 4E0FA 5BNFA 2Z3VA 1EP2B 3L1KA 1P4GA 3QVMA 3BMQB 1Z8HA 1ZLXA 2X76A 4LWOA 3SHWA 3H1TA 1KYWA 3HABA 4JJZA 3C15C 2XDQB 1CB0A 2I4RA 1QFJA 3O8LA 4HMPA 4X1YA 1JHAA 1LVGA 5K99A 3H9GA 1XP5A 4D3ZA 4MQ4A 1LPBB 1T24A 4YFVA 1DV2A 3NVMB 3BE6A 1BDJA 2CVZA 3JVEA 5DLPA 2O5RA 4GQBA 4ZEXA 3S2EA 3TQHA 2EU8A 2JASA 4LVUA 1I5RA 4C4SA 5D51S 3EY4A 3OE1A 1L7QA 3KM0A 4WDQA 2WB2A 1JHRA 1YB7A 2FWMX 1J5XA 4GR9A 3VTFA 3D4LA 4D9JA 4P25A 1DC7A 2WFLA 5BYAA 5T5QA 1R8SA 1PVVA 1R8JA 4BC0A 3DBVO 5AVSA 2PBZA 3CMAB 3GVIA 4GP6A 1ISPA 2ZXFA 4XUEA 2LV8A 5LDHA 2R00C 1D5CA 3NEYA 4RKWA 3N05A 1I0LA 1HH4A 2YQ4A 3JAWB 2YFKA 4HL6A 1H1DA 1JS1X 4IXMA 1UJMA 2O2IA 2AF3C 2G88A 5JI2E 3RVKA 1YS6A 4AURA 2QE7A 4ZODA 5A4KA 1W4ZA 1WA5A 2AXQA 2YOHA 3K9HA 1K08A 1G98A 3ASYA 4Y9SA 2XUGA 2F3TA 2ZUFA 4HTFB 3AJAA 2V9PA 1G7CA 2XDYA 1JFFB 3T4XA 1YBMA 1KL7A 4IHQA 5FF9A 1Z4IA 4ZV4A 4FGLA 3NHLA 3SKYA 4JL6A 2P6NA 1LDYA 2AG1A 1P5FA 3BXEA 3BD7A 3G8AA 3LKVA 4QUKA 3V4VB 5IYZA 3FOEC 1R7RA 3HG7A 5JV5A 2VDOB 5JSZB 4BQFA 5GOZA 3L7OA 1MUUA 5JSFA 1Z07A 4LXQA 1GGKA 3EF3A 3TSAA 5B6IA 3KYBA 4WY2A 4Z9XA 5K09A 1ESMA 3HE3A 3PPYA 3ONVA 1C4WA 1WXHA 3DMNA 4ZVVA 5I7SA 2CVOA 3OQPA 5IDWA 3G9QA 4PIVA 3VR4A 1KNXA 3Q40A 3VZPA 1KYYA 4W5WA 1M7GA 2ETVA 3OQOA 2VHQA 3LC1O 5BNTA 4LYGA 3U4MA 4BJHB 4QGAA 1I7QB 1CQIB 3KJHA 3MUEA 4BMYA 4URXR 4KN6A 5FUMA 4QTZA 3EPPA 1DTWA 1K2WA 2GXUA 4U7HA 1TRHA 5IN4A 5B7GA 2V8BA 3U9SA 4X6LA 3QTTA 3CE9A 1CEEA 2COKA 3LQFA 3JD3A 4PHHA 4F2PA 1U7UA 2BUBA 4CXMA 4Q15A 1ONOA 5BQOA 4Q3NA 1KMHB 1E92A 1SVKA 2YVQA 3EQ7A 2OK7A 5TSDA 3WISA 2OORA 3TQIA 3WYFA 4AJOA 4E11A 5LQCA 2HXSA 1QFSA 4H1UA 3RS0A 2XXAA 4GKKB 4ZZ1A 5FFMA 3SC6A 3OQNA 1G3QA 1R18A 4UC0A 2RC5A 5G1PA 4A5SA 5JTUA 3CVUA 1E3DA 4HXFB 2WVHA 3ABQB 2GPTA 3A9WA 4RL4A 4KI7A 1KO5A 3IEUA 4ASUD 5JADA 3P9QA 1MO5A 2XOKD 4BX3A 4UQLA 3ZQ6A 3F5FA 1BD3A 5AKJA 1A8IA 5L3ZA 2C3PA 1T1RA 4HNAA 1OYYA 1BGWA 2PZKA 1WCXA 4MI1A 4N7MA 4QVGA 2WQ7A 2OPHA 1M2JA 2ZULA 3ZV4A 4RU1A 1TW3A 1H4QA 4FZRA 4X6UA 1RPJA 4YLEA 4RA6A 3OJLA 4HAZA 1O94D 4KGVA 5LWHA 2EWVA 4P83A 4W99A 1UPFA 1EM6A 1ZMOA 1MABA 3BJZA 1C9JA 4RXMA 4Y6RA 1J8DA 7ABPA 3L8DA 5P21A 4TVBA 1YL6A 2HRQA 4A0FA 1OD6A 3T7DA 3AR7A 3Q3EA 4OHOA 1NVWQ 4U02A 2AJDA 3LVBA 3L82B 4BJ3A 1U0FA 2ONKA 4BX9A 4EI9A 4O2BB 3LT1A 1RJWA 4NCAA 1JLMA 3CUSA 2WIBA 4QPNA 3KPJA 5JZSA 2G5PA 4UBJA 2VP9A 4S0ZA 1SUAA 1AMOA 2GEJA 2P4QA 3GX1A 4YJ3A 3R4VA 1BRTA 4O08A 1ZHOA 4RLHA 2DQKA 5DYYA 3LQQA 1M90D 5TC4A 4E5VA 1QUEA 1TZMA 4Y2QA 1E3QA 3INNA 3KXKA 4B3GA 2WJ4A 3E5RA 3G68A 5G41A 2AE2A 2FI1A 4XQ9A 1A9QA 2VDPB 3BZBA 3U60B 1LF0A 1SD1A 4ZD6A 1N8SA 2V6GA 1I6LA 3DW3X 1XTTA 2HF7A 2ILVA 3R8FA 1DEXA 4H77A 2UZ1B 2ZXUA 3V8QA 4BRWA 4Y6QA 2QLJA 2K5UA 1P17A 4WX2B 1FP1D 3ESYA 4Q9AA 1RI5A 1U7DA 1Z73A 2A0XA 3IVRA 1UXJA 1AX9A 2VYCA 3EVCA 3I2GA 3OPYA 3AJRA 2H0RA 5FOUA 3GLIE 1XNQB 3UYKA 1G5QA 2WM9B 1PG2A 3KEWA 3O8QA 1FUYB 2F17A 5L51A 4H60A 3WSTA 3P20A 3K94A 3G5LA 3CNOA 3USZA 5TLSA 2KBEA 4ZVOA 1TQ4A 3ZQJA 4X3PA 4MQ5A 4OUKX 4RS4A 1GVNB 1HYHA 1KR2A 5SY9A 3AIKA 4EYSA 1DDOA 4M55A 4Q02A 5KKCA 4D9KA 4LV6A 4RHYA 3SOZA 2X42A 1VF7A 3NIBA 4E5NA 4F9GA 3IIMA 3ORHA 4FGWA 4B80A 1N6IA 2HDNB 4D1YA 2ROQA 1N3LA 1NJID 1SRRA 2WTEA 5AOVA 3PDIB 3ND6A 2L69A 4IVQA 5JNLA 2VDUE 2IL1A 2A30A 2TMKA 5A05A 3V1MA 4AVYA 2I8CA 4ZJUA 1T6NA 5ICSA 4RF5A 2E0IA 4CKCB 3FYCA 3H2HA 4XJXA 4CF7A 4R9NA 1CUFA 3PUHA 3NNNA 4XGKA 3OWXA 3LOPA 5FOXA 3C7TA 3R41A 4J0CA 5YASA 3RTBA 4RTKA 3EHEA 4Q47A 4Q12A 1VPEA 2R8EA 4OAPA 1RDFA 5LU9A 2ISSD 5KMGB 1MMFB 3ER9A 2BMDA 3NTUA 4NJMB 4P58A 5D5HA 1JG2A 4NPCA 2F48A 3F97A 3U3JA 4ZVTA 3IR7A 5JASA 2C54A 4JR0A 2PAFA 2AQ8A 5LQSA 4FR0A 1F9EA 4K9LA 5DEIA 3UFXA 3IP1A 4KXVA 2ZQYA 3OHSX 2B20A 1L8LA 4XLHA 2MSKA 2Q1XA 3TTXA 5HGXA 4X9XA 1RKXA 1YZKA 2WA2A 1NC3A 3EEIA 1P3DA 4L9AA 1ZPDA 1NBMD 3BCFA 1PL8A 3EVTA 2GZRA 3KSZO 1J7KA 3K30A 1LV7A 3F6BX 2OAP1 3W5CA 2XQVA 3FKJA 3OUZA 5JIBA 3UPUA 2VOEA 1ONPA 3ZTTA 3R5JA 4WBNB 5JANA 4W9MC 4KKXB 4HGOA 5LLDA 3QEAZ 2PKXA 3DBIA 3PLAE 1FS6A 1ZGGA 4QBFA 4EY4A 4EKEA 5ADHA 1OSNA 3FJOA 2BMVA 4X8MA 3UC9A 3HDVA 4I4NA 1DTSA 1RWVA 2WICA 4OMCA 3ETDA 2DPLA 2JNWA 1D1TA 2I3AA 4FKBA 3IXQA 3HY3A 4HNRA 5A0FA 2PWAA 3GRUA 5MN6A 1FSPA 1A3CA 2VHTA 4MPTA 5C8YA 5T67A 1TZ2A 5C1PA 1UC5B 1BN7A 1B73A 2G82A 2QBYB 3FB4A 3LZCA 3UKJA 2GM4A 1OX4A 2F8MA 2Y0DA 3DTVB 5I7WA 1X1DA 4JVMA 4EK9A 1HE1C 4NFHA 2GXSA 5KOJA 3SLGA 2A1UA 5F4MA 2QV0A 1VJ5A 3UOWA 2HDOA 3C3EA 3EZXA 4ZU6X 1E1YA 5BOSB 5IJ9A 2EIHA 3AVWA 1X0XA 3ZXSA 2EZUA 2VJKA 3L6OO 3D6NB 3TW0A 4ALLA 1D2MA 1W5BA 3DMPA 2BHSA 2CL5A 2HWWA 3P0IA 1DBWA 5D3ZA 5D6OA 3AFNA 4HADA 1J39A 4A2CA 4ZHQB 5K8CA 1GNRA 3FRIA 3QFFA 4NE9A 1NBOA 3UAVA 1JQAA 1CC1S 2VEOA 5B1IA 5DW0A 2VTDA 2V8OA 4AZ3A 1JSRA 1H85A 3H8WA 3GF4A 1N57A 4DZTA 3KZMA 3DE1X 2BZ0A 2C42A 4P0PB 1FLAA 4DIBA 2HLHA 3M6VA 3LSTA 1DEAA 2GYYA 4ABYA 5F21A 1RXCA 3TI7A 2I6UA 3WLRA 3OJEA 3UVEA 5IJXA 3RVPA 1M5RA 3M5CA 5SYMA 1KU6A 1Z56C 3C14C 3LTEA 4NHOA 1OWOA 5JSUA 5LUAA 3O38A 3PHCA 1G6Q1 2ZJ2A 1WV1A 1Q20A 4FFRA 4GMDA 2HCBA 3ESZA 5FNZA 2H4YA 2CC2A 1YITB 2ALJA 5B2EA 4NFLA 3GLFE 4DMRA 5DFAA 3NIDB 4K6FA 1KHHA 3GDOA 5I5EA 1A9YA 4AKEA 4GKJB 2GPAA 5CA0F 5CTAA 2OGSA 3JQAB 1H2FA 1OWLA 2V31A 1P6XA 2EC5A 2WU4A 2ZL7A 2CXUA 2BT4A 2DHCA 13PKA 1A8UA 1TTPB 2QUIA 1TMOA 1E0DA 4LYAA 3UY4A 4KUEA 2BKVA 1V47A 3R5TA 3JZDA 1BTOA 4QUZA 4V38A 4BZWA 3JWJA 5DOVA 3VOSA 4ND8A 3OMXA 3EQ8A 1WIWA 4TMTA 1AUQA 4LXHA 5ICCA 2HMAA 4I0WB 2RGEA 5G4KA 2PVSA 5BWLA 1P0MA 2AR7A 3KJIA 3A1CA 5AMXA 4MDYA 5I9TA 5TF4A 1AA6A 2ZPTX 3F74A 3VISA 5HIIA 4J0IA 1P2GA 2WIDA 4MLDA 2QW0X 4OL0A 3WGZA 4FWBA 1JA1A 3AP2A 2R47A 2JS7A 1N7JA 1MC8A 1OZ0A 3SIWA 3C4QA 5AKLA 3K9QO 5H83A 4A27A 1JKMA 3AHDA 2OZLB 3GZNA 3QLUA 4LDJA 5AKHA 4ZAXA 5HJ5A 3B13B 5CYPA 3KYIB 3A6KA 3LAWA 4J9UE 4EG4A 1L4UA 4ZFNA 2ZUEA 1GCGA 2Q46A 2ZYGA 1XX6A 1P91A 1PBNA 3UCXA 2ZJ1A 4FFLA 4JD5A 2KWIA 1TMYA 1Y3FE 2PRKA 3G13A 1U6KA 1TMKA 1VMEA 1M6HA 2W2QA 2WJAA 3F67A 4KQCA 3DD1A 3TUIC 4UM9D 3THYB 3L05A 4YTEA 2ZI6A 3VGPA 1R5OA 1RLIA 3WP0A 4DG9A 4H6WA 2GN4A 3CZQA 4ZT6A 3CPWB 4KN9S 4PYOA 1B0AA 2P30A 1V6AA 3KP1A 2C7RA 3IB3A 5AM3A 1FVOA 3NV7A 3PVDA 4PPNA 4QPJC 3LVFO 4XM0A 5FKJA 4R1SA 1G42A 5G3YA 1R6UA 2P2YA 3GPBA 1KC3A 2JGNA 4DEYA 4P0QB 3UMVA 2CF5A 1G6OA 1Y3HA 2ZAIA 3NT4A 5GM2A 1IXYA 2NTYC 1H6DA 1ZCFA 1SKMA 1ZMBA 1MA3A 5T6MA 1SCJA 4HGYA 3NRBA 4EX7A 1A8HA 1NQ5A 2J6IA 2P78A 3D6AA 1EVJA 4JVLA 3FZGA 3VSCA 4IEIA 1CUVA 3LY7A 1U0NA 1IHOA 4JVNA 4L4RA 4O4LB 4BLVA 4HBGA 2P9FA 2BFDA 1DC5A 1FDTA 4Q3BA 3HLYA 4YROA 3HZRA 3PLNA 4KHPB 2G9RA 5EJEA 2NVOA 1XZJA 1MT3A 3OM1A 5AUQA 1IWOA 1I3NA 4XQGA 4RF2A 1ZMRA 2BFAA 3BSYA 2Z08A 3WGNA 4WZKA 1PFQA 1UT8A 2Q3JA 4P34A 5JZBA 1IQUA 2VPXA 1Q7CA 3H7IA 1NKTA 4PM4A 2BLLA 3EK2A 3QMPA 4WW0A 3UJ9A 2W2PA 2HQRA 1OIVA 3ACDA 1ZGBA 1S9DA 5B3KA 2AOTA 4IFTA 1ODSA 3KAQA 2H4FA 3C5CA 4IMPA 1KVRA 2WINI 3ROEA 3PUMA 2GCGA 1YI2B 4E5UA 3LWNA 2X53S 4MV1A 3RFFA 5EJ5A 3C3AA 3DAPA 1RJGA 5LP6F 3S2GA 4UHEA 1YJAA 2H5IA 3PPWA 1C9YA 5CVDA 4EYOA 3NC1C 4FDUA 3A8IA 3L79A 2BHLA 5ESWA 3I0ZA 1JTFA 4XQEA 3QG5A 1SXGA 5ESDA 3I1JA 3L84A 1KPIA 2O7VA 5E2AA 3RTEA 2AKYA 3IPYA 1CUGA 3L77A 4HHEA 3W8RA 4DANA 1JG6A 4JR2A 2UVDA 1E9AA 4G5RA 2C7PA 2HCFA 1HK7A 1VB3A 3LBIA 4Q4AA 1N05A 1CU1A 2FZLA 2ZR0A 3NFRA 3FNGA 5FRDA 5KVAA 4CLHA 3U0VA 3G7UA 3GAFA 4X1KA 3K73O 1KZLA 1Y5NA 3HLKA 1NN1A 1WMSA 4L8WB 1XMIA 1XZFA 4G81A 5DX0A 2OAQ1 2IKQA 2AFIE 2IYFA 4RPLA 3RIXA 2ZQ5A 1FMFA 4JDPA 3LWZA 2Y27A 3LQRA 4GR4A 1HORA 3IILA 4CF3A 4D26A 3CNLA 1GPJA 1WXIA 2O2YA 4S1OA 5JRZA 1K6IA 3B9PA 1BX0A 2G9ZA 2C5LA 1NI3A 1T6XA 5ALPA 4AYTA 2G40A 1I2DA 3TW4A 3U56A 5J4YA 1XHLA 4L50A 3OFNA 4QPDA 5FAKA 1H4SA 1G60A 1JYSA 1KJ8A 3VXKA 2OSVA 3DDUA 4OYYA 4QATA 4ND2A 1O03A 5KWSA 2I9PA 4YECA 1NY6A 4AP9A 5DM70 4F60A 3PP8A 4ES6A 1HKHA 1ZEJA 3OA2A 3Q6NA 3A2MA 3UJ7A 2QAIA 4LJAA 3B70A 1SIUA 2AN5A 4MVYA 2NVUA 1KXZA 1LQUA 4KUHA 4AF8A 4EG7A 3TX6A 4LTNA 4HDMB 1W2HA 2ZRJA 2X5JO 1YMUA 3BS4A 3IQIX 4JC5A 1XRLA 4H15A 4NAHA 3DO6A 3ENNA 1OXMA 2A1TS 2X9GA 3ROGA 5L4LA 3OZTA 4WUTA 4YCDA 1ZJYA 4I8IA 2GEVA 3W2GA 1VQ7B 3O74A 3PA8A 4KQWA 4QQFA 1RLJA 2XTZA 5AKXA 2DOKA 4EHJA 3FDZA 2DCMA 4ZQEA 3PNVA 1ZUWA 2OQRA 1Z4NA 3ZPNA 2V03A 2HCRA 4ZAYA 3SPXA 3INTA 5SZHB 2MTBA 1YQXA 4RPKA 4CKWB 5A04A 4ABTA 4P4NA 2OBXA 3L8EA 1PFWA 3PFKA 4RKRA 4W6QA 1A95A 4BN0A 3HFRA 5IKOA 1XN4A 5L53A 1JHUA 2YWHA 1OYVA 4R16A 3QVSA 1JEEA 2ZYWX 4BPRA 1XVTA 4F2GA 4GQIA 1ZAYA 2RK4A 3MUOA 5GV8A 3MQ2A 4FSXA 1V6CA 2DG2A 3BRQA 4QYMA 1ZD9A 3K16A 3GUVA 4TYMA 3IRUA 4MTCA 2B5OA 2I8LA 1ZCAA 2IHUA 1M0SA 2GRUA 3Q87B 4EB8A 1WV0A 3I9MA 4HDAA 3ZHZA 1EP3B 3CUYA 1KHTA 2ZUBA 4WFKA 3PPXA 1P75A 2QA5A 2X19A 2PNJA 4DMUB 1X1SA 5EJAA 3U3KA 4ROTA 4UXHA 4KUGA 3R3UA 3MYRA 4BVLA 4G5GA 1X92A 1WJGA 2XYRA 4GP9A 4PGFA 5E7JA 3GVJA 3L1UA 1ZQ9A 3LHFA 2E89A 2NU7B 1FF9A 4TWZA 3ZWOA 4UJ5A 5A7HA 1JHOA 1IN8A 2VSXA 1NW5A 2V5AA 3PFFA 4QQKA 2EZ9A 1NURA 4CG0A 3EVEA 4XN0A 1P9NA 4MVJF 4ARZA 5BMVB 3IKVA 3AL2A 4MW9A 4YT5A 5K3FA 6CHYA 1DRUA 4RMHA 3ZCXA 1CZKA 1XTPA 1N33B 4IDQA 4KXFB 3P2YA 2Q9BA 1BIFA 7REQA 1IB6A 2CW5A 1Z3IX 4D9NA 3GJ7A 5A0TA 3EXEA 2D8AA 1YR7A 3DXYA 3D6TB 4WZAA 1KI9A 3Q3JB 4IV0A 1HT1E 4EZEA 1NJ1A 2HA6A 1O95A 4J1SA 1PW5A 2EHJA 4HATA 1W30A 3EW9A 5A3VA 4KRGA 3PXDA 1FYFA 2P75A 5JVDB 5TMPA 3H17A 3ZWVA 5E1MA 2XNJA 1VHWA 1Q16A 2NZ2A 3G1TA 3H0CA 1I2CA 3HADA 1CF2O 1YSCA 4HLDA 4B79A 1E66A 3EWAA 5B1DA 3C48A 3PGA1 5IYQA 3GT0A 5EIBD 4C2BA 1W2WB 2ZB7A 1JTEA 4UBMA 5HJEA 4V0LA 1MW8X 2P9JA 1ZXBA 5JCJA 3SEAA 2WEKA 4PANA 4DVGA 4YMLA 2BGUA 1FJ2A 1IN1A 1GPWB 3FVRA 3C1AA 4C2TA 1MJHA 2HNKA 4XFKA 4XRRA 5FPPA 4BN4A 3ETJA 4EAQA 4WESB 3MHPA 5AXDA 4KR2A 3QPVA 3R6JA 2GGSA 1KTIA 1IAVA 1U9YA 3KKZA 2O3JA 3UTCA 3WNCA 4X91A 4EW1A 4B3HA 4YDQA 3RT9A 3KOYA 1XHEA 5JXWA 3GB9A 4N03A 3TW6A 5IUJC 5FOVA 3WK8A 2C98A 1LVHA 2H63A 3F3YA 3PZRA 4G0NA 4QLAA 3RLIA 1FJXA 4LY9A 5I8WA 1IEXA 3R3VA 4OGWA 4TT3D 2HW8A 4YCSA 3HP7A 3VZRA 4IILA 1I7NA 4EB0A 2V4ZA 5P8WA 2OAGA 3UV3A 1SUIA 2VDJA 4TMXA 3AB8A 2HK8A 3DWGA 2B6HA 3JZAA 4UMDA 1E9SA 1DGQA 1I14A 1P5JA 2XE4A 4BP3A 4NNPA 4FE4A 2ZSDA 3WHKA 2PSFA 3KQMA 4DVJA 4RJTA 4LYDA 5JISA 5KZMB 5T8KC 3EWIA 3B2EA 1GG9A 4O4JF 4JB3A 4NZ9A 3KCNA 1DJPA 4OATA 5ER9A 1BXGB 5ECDA 3PEFA 1SMKA 4ZVPA 3VV3A 4ENSA 2HKIA 5A6SA 4KQEA 1A5SB 3NFYA 3RWOA 2ID8A 4OMUA 4UULA 2MSDB 3QXXA 4H0NA 5JWHA 1BCRA 1DU4A 4XB6B 2I29A 1ZD2P 5EPUA 1IY8A 3PUNA 1OH5A 4AI6A 3W8EA 1XKLA 2GRJA 4M37A 2ZBDA 4RF3A 2F90A 3CH6A 4HXGA 1MB3A 1YIAA 2QDKA 2RJOA 4XYBA 1B8OA 2AK3A 3LHKA 3NHUA 2CXRA 1C29B 4BDSA 2HMUA 3HBLA 4X24A 1YNOA 2BVNA 2AX4A 2FRDA 2IOYA 2VYNA 2GAIA 3D3JA 3L46A 1MO3A 2ZBPA 3PQ5A 2D1SA 3PIRA 3HSSA 5FPHA 3B53X 2QUBA 5JYEA 1H3NA 4DIKA 4RANA 3TLZA 1VQ4B 9GPBA 3KUCA 1JJ2B 1KK0A 2W2LD 2X9QA 4E6PA 3ICWA 3QKRA 3H4VA 3IEKA 2IPXA 3HZZA 5CDHA 5A88A 1M2VA 3LQYA 4B7XA 3H86A 4PG7A 1KYXA 1LRJA 2VHXA 2XXJA 3P2EA 2VTEA 1M0TA 2VG8A 3NIWA 3D4IA 5L40A 4E08A 1RXWA 4D4JA 1V96A 3DGFC 5I7AA 1A8QA 5L7TA 1HEIA 3E7XA 3QGMA 4I6GA 4RMGA 3DFZA 3TR5A 5BNWA 2R1TA 3W3AH 5CYFA 1ABBA 1W88B 4DUZB 1FFAA 4L6AA 2NYUA 3HWRA 5AXAA 2JHAA 1SCIA 1EWYA 1ZHFA 1T2DA 4M1ZA 4J94A 1DKLA 1M6YA 1KDVA 3HLTA 3F47A 2IUTA 2Q2QA 1SXJC 3DKPA 4GBMA 1BOOA 1QS0B 1UOPA 1GEEA 4QFCA 3WA6A 1QQTA 2PO5A 4TV9A 5BSMA 2ZP1A 5I7OA 2DWUA 2VDWA 2Z4SA 1IBRA 2H5EA 2QMHA 1DKUA 1T2FA 2DC1A 3AV3A 3KQKA 1VLLA 2IBTA 1SC4A 2QS9A 3FHOA 3F71A 5AK4A 3FLEA 4XM3A 4GZ6A 4L85A 4EY7A 3I9V1