1RRCA

T4 polynucleotide kinase bound to 5'-gtc-3' ssdna
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
288
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*C)-3'
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
total genus 94
structure length 288
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrcA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rrcA02
1GILA 3IKJA 1P2SA 1QVRA 1G9XA 2Y8EA 4GBMA 5JEDA 2RGNC 1VJ5A 2JASA 3FHOA 1MV5A 1N0WA 2ZIAA 1G291 2ZYUX 5ALXA 2JEOA 2QP4A 4O2RA 3U7HB 2EWWA 3OEHD 1FMLA 3KJGA 3DOEA 5EP1A 3THYB 1EESA 3LWNA 2YWEA 1VHTA 4GL2A 1IAQA 2JJ2D 3HPQA 4XOUA 4BEWA 3MD0A 4XIGS 5JWHA 2HO4A 1WF3A 2ZS7A 1R2QA 5AJZA 1YS9A 5AKGA 1KTVA 4ITRC 3FMOB 4B3GA 4QM6A 3VX4A 3N2EA 1N5KA 4QNMA 1PZNA 3LRPA 3L0BA 3WP0A 2IXGA 2R6CA 1HQYE 5CK4A 3GFOA 4DT1B 1FPMA 1ZRHA 3MMZA 3L0YA 2PJZA 3WYGA 1KI4A 1KI3A 2RGGA 3T06B 4EEKA 5JECA 3I1FA 1GZSA 4LHVA 4NPHA 1RDFA 2XTZA 3VR3A 5AW6A 1L6RA 2BEKA 2GAOA 3BFXA 4Q9JA 2GJSA 5JHHB 4LY6A 1SXJB 3AVTA 3GLFA 4XD7D 2O8CA 3BIFA 1Z0JA 4BASA 1Z5GA 1YR6A 4MGIR 2ZJBA 1OKKA 3I4LA 2GNOA 3GCGA 1E1QD 2FSFA 4KYIB 3TLXA 2VP6A 2P69A 4YDSA 1OV4A 1QHNA 3Q85A 1S2OA 5CITA 2MMGA 3NIBA 2ZU0C 4LHYA 5ALSA 1LF0A 3CNLA 2C8VA 5AKZA 1L7PA 1HURA 1C9KA 4B47A 2QMOA 5KNDA 4IDQA 1DG3A 4UMDA 5AICA 4PTLA 2NOAA 5FTJA 3L1UA 3PXGA 2KSQA 1G3MA 2DCUA 1JR3E 3JZMA 3EARA 3F3YA 4KFSA 4RD3A 1NVXQ 4LI0A 2ANBA 4A0FA 1ZM7A 2MSDB 3WHLA 2OM6A 3KL4A 5ALDA 5L3SB 4D0NA 5DSZA 3ZW7A 2FEOA 1AJEA 1NMZA 4EX6A 5B2ZA 2WSSD 4LGMA 4KJZA 2VYFA 2JCSA 3KB2A 3TR0A 4LWZA 1ZVQA 3KQHA 2Q9CA 1E2FA 4M1WA 3IBGA 4HDOB 3K0AA 4LRWA 3QF7A 4RD4A 1E9RA 2FE4A 1DAEA 3QXJA 4E5UA 2YFYA 2AGVA 3BERA 4JSYA 5TVKA 4FYPA 5KSYA 1N5LA 3OAAA 4H9GA 2PKEA 5ALGA 3C15C 2P2LA 1RLTA 4FW9A 1ETUA 4BQSA 1CLUA 3WNCA 3FB4A 4ZCMA 3THYA 3SDZA 1GNQA 1EWQA 3ND8A 3ZZ0A 2LCFA 1DOAA 1RRCA 2OO7A 3SFZA 3E81A 3RRMA 5AW1A 3AGPA 3FPAA 4TZ6A 1WPGA 5DHAA 2QSYA 4G5SA 2K5UA 3RVBA 4DXAA 4JBXA 4DJTA 1AKYA 3E58A 3I76A 1X1SA 3B6EA 4LBZA 1X8KA 2DQSA 1QDEA 1W0JD 4PX9A 1IBRA 5AW9A 2GVZC 3FMPB 3A3YA 3I8XA 4Y2SA 4DT1A 4TTRA 3L0PA 3DMNA 2FEMA 1Z4KA 4IG4A 1FZQA 5AKYA 3A1WA 4XWAA 4Y0VA 4LPKA 3QUTA 4JLOA 1FX0B 2CHQA 4PO9A 3W5IA 1SXJA 2J7PA 2ODEA 1P2VA 4DLUA 4ZKDA 4AY2A 3THWB 2GF0A 1D6JA 1FP6A 1KZGB 4TYPA 2G1AA 2DWOA 1H8ED 2WMOB 2VP9A 4LJAA 1KJWA 3QUQA 3LBIA 2RARA 3WKCA 1E4VA 1K6MA 4DDVA 3B9RA 2Z43A 5AVZA 1RFLA 1DS6A 4ESVA 1R6BX 3AP1A 4XTRA 3TQCA 4KSCA 4ZDIA 2C8LA 1VJRA 3NEYA 1E32A 2CCKA 1EWRA 2ATVA 2YN4A 1NP6A 4MGYR 2B8WA 4Q21A 4W9MC 2PH1A 4YMVA 3SHFA 1T3LA 4B44A 3GFPA 1JQJC 2BM0A 1E98A 5CK5A 2G0NA 1OJLA 3SC3A 5K8UA 1F48A 3THXB 3WK4A 4V0KA 4ESHA 5L3SA 1XTKA 2GRJA 2JJ1D 3ADBA 2C78A 1XFAA 2IS1A 3NUQA 1KNQA 5FOXA 1ZD5A 5AKEA 5GADl 1N6RA 4DUGD 2GEVA 1T5IA 3X1YA 5JRZA 1XCPA 2FZ4A 3OE7D 2Q3FA 3C41J 1FNMA 1KI6B 2F6RA 3TAHA 2J3EA 3VTKA 4XVUA 1ZOLA 2QGZA 3QEJA 1OLOA 1Q21A 2G83A 2JDIA 4F4JA 4KYUA 3OCYA 4YMTA 4FINA 4TYNA 1SKQA 2RBKA 1T5SA 4TMTA 1TL7C 4OHYA 1YMQA 2GJ8A 2FPMA 2VO1A 4KV9A 1X1RA 4V0OA 4A9AA 2I7DA 2W4MA 2ZOSA 1OYWA 1E2JA 3B9QA 4LOAA 3HDTA 2BJWA 4JS0A 4GDFA 3K1ZA 1E2MA 1NLYA 3W5BA 2QQEA 1KAOA 5FPSA 2IYXA 3VHLB 1W4CA 1UBEA 5HZHA 3QKTA 2AR7A 5C4MA 2YC2C 4AURA 1UKEA 2J0VA 1LTQA 3VR1A 4R71A 4O2LA 4PQRA 3CRVA 2WHXA 1NBMA 3SYKA 2ZAOA 3FGOA 1N2CE 3QIAA 4TT3A 2BM1A 3T1QA 1FX0A 3KBBA 1AM4D 1OF1A 5GVSA 2J1LA 3VMFA 1TJ5A 3THWA 2QYHA 3B78A 4QNRA 3L0SA 5EP3A 2RH5A 4NHOA 1XTJA 2IEZA 4EFLA 2E9SA 4AWXA 3V9PA 1COWA 3NG1A 4O8CA 2EFCB 3UANA 3NBYC 1QG2A 3L8FA 4I99A 4D2IA 4D4MA 3VQTA 1OIVA 4MGKR 4Q4HB 3VKHA 3A1CA 1KY3A 3SJBA 6Q21A 5FTLA 1ZJJA 4RKFA 5E0OA 4HYTA 3H0KA 1TE2A 5CB8A 2P6UA 2ZRPA 2D3WA 3KQLA 4D0LB 2RGAA 2BMEA 2IL1A 3THXA 4NU0A 5CM9C 4LBWA 4BEBA 2NO4A 2ZVQX 1ZM4A 3DEFA 2WAXA 1JUDA 1OXXK 3F9RA 4N0DA 4UXHA 4U7DA 3K0EA 2ZU6A 2ZEJA 2XNDD 3CH5A 2IOFA 3QBTA 1H8HD 4D82A 2HF9A 2NO5A 5FTNA 1SWVA 2OCYC 4G3XA 3DZDA 1KI6A 3H84A 4KX3A 4NMMA 3NALA 4J2TA 3GEIA 3U7FB 2IHYA 3KDPA 3U3RA 4BECA 2AHOA 3B5JA 1NLFA 2RGEA 4KX5A 1OIWA 3V00A 2J5XA 4B3CA 3FVVA 4UAVA 5ALFA 4DRZA 2WWWA 4JLDA 4Q03A 4QGAA 2PZEA 5FOSA 4NYIQ 3MG9A 4HB2A 4URUR 4V0LA 3WHKA 2JGAA 4BZPA 3HPRA 4EKDA 4AG5A 2CHVA 1E94E 2GTPA 3RLFA 2CEAA 4R2HA 4WVFA 4EPXA 1F5SA 4M53A 2YBDA 2FF7A 3HU1A 4RCYA 3KDSE 1OKKD 2BBTA 2YMPA 3LX8A 5AJVB 3TAUA 3EIEA 2C77A 4HAUA 4CEHB 2P27A 5L3QB 3R8FA 1A5TA 4EFMA 1GITA 3BS4A 4OQXA 3MWYW 1NY6A 4TLDA 4TYYA 5AI8A 3TQFA 1YVDA 2QPTA 4GZMA 3EPJA 4KYTA 1EFHA 4CW7A 2G0AA 2HLDD 4L15A 4PPFA 4QHSA 4RCZA 4BFSA 4ZDKA 4DW8A 4RKEA 2GDJA 3KC2A 3CPJB 2C9OA 1P4SA 4QHTA 1EX6A 4CF5A 3BA6A 3PIRA 2O2XA 2CCGA 2CE7A 3P96A 2B8TA 2PT7A 4H1WA 2J41A 1K5GA 4EFNA 4RVCA 2WZQA 2QTFA 4TMXA 3T1OA 4J0QA 2ZJ2A 4MUAA 3I3SR 5LB2A 4UNRA 2GXAA 3UPUA 5FFMA 2A78A 4C2UA 4Q4HA 3AVQA 4BX0A 1NMYA 4TMKA 2AXNA 4D4KA 1G8GA 2NO6A 4YMWA 2QAGB 1X86B 1L7VC 3KZ1E 3L82B 4HUQB 3NDPA 1E1RA 1DAMA 2YWGA 3B2EA 4MKGA 3IUYA 2I55A 2JIZD 1I4TD 3HJNA 5JSZB 1Z0KA 4OKSA 3VFDA 2XGJA 1XD2B 4BUJA 4HAXA 2Z6VA 2R6GA 2B30A 2ECKA 3I62A 3CB4A 1JJVA 2FFQA 3IIMA 2R6AA 3N70A 4MKHA 2CLSA 3ZIAA 2OBBA 3NAMA 3ZD7A 3H1TA 3WKAA 1RW4A 4XWOA 1V43A 4B71A 3OF5A 3TW8B 1N9KA 1G8YA 2Z4SA 1WBDA 4C2TA 4OQFA 2CE2X 3WK7A 2ZJZA 5DLQC 1E0SA 1GL7A 1AKEA 2QP9X 3LX5A 2FGKA 4XH9B 4KU4A 3U3KA 3AQ4A 1QH9A 4N1AA 2HI0A 4G5QA 1G6HA 1R7RA 1HV8A 5C4GB 1W48A 1CP2A 3EG5A 3K9GA 1Q0UA 3PEUA 3W90A 3C8UA 4CEIB 4Y2QA 3AUYA 1OHHD 5FH9A 3MN1A 5LBIA 2BEJA 2OFOA 3Q8XB 4HGOA 4QBIA 3KKOA 3F0TA 1J7KA 4A8JC 3WKDA 3BH7A 4Y2JA 1NJFA 2W83A 3T1TA 1NKSA 2J7PD 5FBWB 1YQTA 5JLJA 4OK6A 4JB3A 2Q9BA 2ZYVX 2A5GA 3N2IA 5GJVC 4I1SA 3TNFA 2W11A 3HLTA 4Z51A 2YJTD 2R44A 3QQ5A 1KK0A 4IOJA 2IX3A 4WOPA 5L3QA 4CEHA 2GBLC 4UKDA 5ALTA 5AM5A 2WJVA 1XMIA 3GJ3A 4RETA 4TLCA 4EQ6B 4NCNA 3OIVA 1UKZA 1EK1A 3OCZA 3OPXA 2WJGA 2OFXA 3OEHA 1KYIA 3A4MA 1Z5ZA 4YH1A 3U7GA 5ALZA 4F38A 2IEYA 1OH6A 1QQ5A 1XPJA 2Z0MA 3WGUA 4AKEA 2JJ2A 3QEOA 4RD6A 4PPQA 1IHUA 2BC9A 4ZEXA 1KGDA 4KFRA 1P62B 4URXR 1VCMA 5FUYA 1HY3A 2QG6A 4B2LA 4MRNA 4F4CA 4PHHA 5AKHA 3TW4A 3GFTA 3L5KA 4ZI2A 4AS3A 3BB3A 4Q9IA 1U9IC 2FUCA 1AGRA 1O08A 5LDDC 3H2YA 1XPUA 3ONWA 1JALA 2GXUA 2A7QA 3GLHB 3WMEA 4KO8A 5ALUA 4P4UA 3W8RA 3LD9A 4EELA 2HCBA 5J4KA 4R7ZA 2PMKA 3UKDA 5LPNA 1F2TA 4XD7A 1PUJA 4IOLA 5B57C 5IS2A 1UM8A 2QAGA 1FP7A 4S2EA 5H1YA 1G1MA 1E0JA 3AR5A 3RANA 4HUQA 3ZS8A 4U00A 1SGWA 4HAVA 3A1DA 2W0MA 4M2LA 4PFSA 3AB3A 1F3OA 3RS3A 5JSZA 3GLIB 4Q1BA 1GP2A 1XD2A 1Q20A 2H5EA 2PJRA 1XU4A 2ZR0A 1GDDA 4B74A 1TF2A 4ABYA 1CIPA 4Y2PA 4DLSA 3U26A 4E07A 2CLDX 2UVQA 3NXSA 3F5FA 4Q9LA 3AR8A 1P7CA 2TMKA 5BYKA 1DELA 1LW7A 5E7MA 1VTKA 3VR5A 1GIAA 2PLFA 5SZIA 1II8B 3QX7A 4W7SA 5EE3A 2ZRBA 2FPSA 3CX8A 4FN5A 4TMWA 2ZSBA 2VQSA 3V4RA 2EFEB 4UM5A 3AM1A 2GJ9A 3P32A 4JMPA 4L9SA 4CEIA 3MWKA 2WSSA 5ALIA 5ALVA 1S96A 4B2PA 3DZ8A 2EYQA 3O47A 4ZEWA 4M9QA 3CZQA 3VAAA 2G88A 3OCUA 2JAUA 3C16C 3EZ6A 5AUQA 1AZTA 1JEDA 1U8AA 2NZ8A 3CW2A 1WB9A 1T4GA 1ZD3A 4TTPA 3LH5A 4LSGA 1G8FA 3QY0A 5GJBA 1COWD 3P1JA 3MSXA 1RRFA 2PX0A 4NDZA 4EQ6A 4NYMQ 5JCPA 2IYUA 1L4UA 1AZSC 4Z54A 3NRJA 4HZUB 1Q3HA 4I4LA 1RPZA 4OI2A 5KNCA 2FFHA 3X1DA 4LHZA 4UMFA 1VIYA 4YMUA 1CF4A 1ZRMA 4LC1A 1SULA 3KJHA 3WRXC 5AJYA 4KITB 4XOIA 3QKRB 4DWOA 3FTQA 4E88A 4JKYA 4JVSB 2JLWA 1DG1G 5GVRA 5F9FA 1PUIA 3NDBB 2I54A 1TF5A 3QENA 3GLHA 1F60A 1TUIA 4JLMA 4QRHA 3A1TA 4LYJA 4OHVA 1YNSA 1NN0A 3N8GA 4D6PA 1XMJA 4JLBA 3K8YA 2VEDA 4L4UA 1HQCA 5FTKA 2EFGA 4QM7A 2CFTA 5D3QA 5AUOB 3KOOA 3LXRA 4Q1FA 2J45A 2HYDA 1Z6TA 4ARZB 1RKQA 1H8EA 2C04A 3MAAC 3MFYA 1K8RA 2VSOA 1BO6A 2O5VA 2HCFA 2ZI6A 3W5DA 4OI4A 1A2KC 2CXXA 5AW3A 3GLIA 2WF6A 1G16A 1G64A 5FR1A 1JR3D 2XXAB 3KUDA 1Q57A 1A7JA 3NTUA 5EQTA 1VIAA 3ICEA 4FE3A 2Z83A 3GJ4A 4HDQB 1N8NA 1MRNA 2GK7A 4OD0A 1S9HA 4Y2UA 1U2RA 3ZYCA 4LC0A 1II8A 4IXMA 3RS7A 4HZIA 3RC8A 2V1XA 4NYJQ 2QN6A 2GEUA 1AIPA 2HF8A 1KHTA 4HEJA 3I28A 1VYTA 1XJCA 4G01B 5AW5A 1SKYE 3LW7A 2NO7A 5K8TA 2B0CA 4H1UA 1KNXA 3CUEF 3ZS9A 4DUGA 2SHKA 5B64A 1GNRA 1OW3B 1QHSA 3BD9A 3K9LA 3LBNA 2ZJOA 1RLOA 1G19A 2OLKA 3OE7A 3A36A 1CJMA 4TMZA 3OZXA 4QJ5A 1E2DA 2PLRA 4HB3A 4BLSA 2FFAA 4LPSA 3REGA 1ZINA 2WOJA 5J40A 3DNPA 1GRNA 4M9SA 5ALRA 2GESA 4CT5A 4AKGA 4Q4JB 2GETA 2FUEA 3EZ2A 4CZ2A 1RMQA 5KDDA 1FNNA 1DTSA 2R2AA 4PHTA 4NV0A 5FOTA 2MSCB 1XWIA 1W4BA 3R9KA 3SMVA 3AF3A 1CR0A 1M6NA 1E6CA 1R0XA 4V0MA 3SJZA 4BZXA 1RMTA 2A5YB 1Z4QA 1N0UA 2B82A 2IC5A 4C7OB 3TSWA 1D2EA 4KHZA 2ZPTX 3VR6A 2DPXA 3DKVA 4Q4LA 3QKRA 4CEJB 1D8TA 4US1R 1XJ0A 3E84A 1E4YA 1ZBDA 1Z6AA 2VIIA 4LK2A 1E2QA 4NH0A 4PC1A 3EAQA 1AQ6A 3K09C 1ESMA 1TQ2A 4JL5A 2IXFA 1KK2A 3CR8A 2NQ2C 1G4UR 3ZUPA 1R0ZA 4DKXA 2BDUA 1EK0A 4PO8A 5KHOC 2ZI5A 2RGDA 2JLXA 3L8HA 3DVLA 2HT6A 1PW5A 1KO4A 3O8BA 1GOTA 3EA5A 4M21A 4ARZA 3BBPA 4O25A 1QVAA 5E95A 1XVIA 3I6BA 4RD1A 4C4RA 3GJXC 2ZITA 5KU1A 3KKQA 1OSNA 5KSZA 5KDOA 2XXAA 2OBLA 2RGNA 1A4RA 1E2LA 1R4AA 4Q9HA 5K8LA 3QSYA 3ICQB 3K9HA 1TX4B 3A58B 2O8EB 4HGRA 4M1SA 3NH9A 2Q0HA 2QM8A 4MYCA 1U8YA 3R4CA 2ATXA 4EX7A 1QHHB 2VL7A 5JJIA 3QU4A 4BPBA 5EZ5A 1UF9A 2JLRA 4GOXA 3ZTWA 1IN8A 2I4IA 1GL6A 4TL9A 2AWOA 3HU3A 1US8B 2BCJQ 2OUKA 2C9CA 4JSTA 4ZPXA 1QF9A 4PR0A 2D06A 4DSUA 2XJ9A 4F4IA 5EUMA 1NJGA 1GKYA 2FGJA 1A82A 2MMCA 3DM9B 4JVNA 1E2GA 2R8ZA 2QM7A 5FUVA 3B1VA 3NVAA 4A2WA 5AVVA 3ZI4A 4KSBA 2XNDA 1Z4IA 1H8HA 1XDBA 1KO8A 5EXTA 5SZJA 4EDHA 3CZPA 1Z6GA 1YZGA 2VPPA 5DE3A 2FSIA 4D0GA 1JB1A 3IJ5A 5DNYB 1W2GA 3BORA 4OL0A 4B6EA 2G08A 3A1EA 3QBVA 1HEIA 1NIPA 3OCVA 1S1CA 1OXUA 1WE2A 2Q4RA 4Q4JA 3OCWA 2G09A 3MUFA 5AUNB 2V54A 5HPYB 4B3BA 2F1JA 4WZ6A 1KY2A 3SHWA 1G18A 2ZVPX 3NKVA 2KI5A 4LBYA 4R2IA 4YONB 3K70B 1SKYB 2CJWB 3FHTA 3AF1A 4M4SA 2P6RA 1Z6YA 4MRVA 4C7OA 1NSFA 2C96A 4FWIB 2WAYA 4KVGA 1IY0A 4YQFA 4CEJA 4GPTA 4XPZA 2R8XA 1ZNYA 3ET4A 2R6DA 4TQAA 4PQFA 4UU0A 4Q00A 1SHKA 3CZ4A 2QU8A 2AX4A 5ALPA 1Y3AA 1TPZA 4M22A 3R09A 1M1YE 1U94A 1KIMA 1CR1A 3QNUA 3EIQA 3MRSA 2FPKA 2HLDA 2X1VA 2ZSDA 4OK5A 5DI3B 2V1UA 4Q18A 3AVUA 421PA 4LJ5A 5AIBA 4A92A 2FPWA 3WBJA 3MC1A 4BLRA 4WW0A 2R6FA 2XITA 4B6FA 3TGPA 1DADA 3BE4A 4IKEA 4DIEA 3ZQ6A 4KN8A 1X3SA 4QXAA 3LXXA 4BFZA 4JDPA 3NH6A 1S4QA 3PGVA 2XZOA 4TL8A 4KFTA 3EW9A 1CR2A 4C3ZA 1NIJA 1V5WA 1G41A 2WBLC 4B35A 3U60B 2O8EA 3VKGA 3G0HA 1ZD8A 2IYQA 4IFBA 3LY5A 4Q7MB 4B34A 5AVXA 3LFUA 1D9XA 4II7A 3U19A 5BXQC 3SEAA 1US8A 2OAP1 2WWGA 2R8RA 1W0KD 1T0JB 1YV9A 2FA9A 2JIZA 3FGNA 5DISB 4DCSA 2O8BB 5EZ6B 1CBUA 1OE0A 1WP9A 1N5JA 2V6IA 3MCAA 1UEJA 2OEPA 1N25A 5A3SA 1ZU5A 4NP6A 2B1RA 3QYPA 3PVSA 2XB2A 3PUXA 4FMDB 1RLMA 2ZUCA 3I32A 5DO9A 3QXGA 2DFLA 1XNJA 2P5TB 2WPDA 3TUIC 3KXLA 1N5IA 4UNSA 3TVDA 3WMGA 2OCAA 3VHXA 1Z47A 3I5YA 1T5TA 5TY0A 3I73A 1Z4JA 2ZUBA 4YMSA 3EA0A 5AM1A 3SKYA 1Q1QA 5CM8B 1U0HC 2NIPA 3GJ5A 3K0FB 4FMBB 3B1YA 5JBQA 3ESQA 4UXJA 5FPKA 4JT4A 3B1XA 1DAGA 2BIFA 1Z07A 4PZYA 5AHXA 1OHHA 3E1SA 2AD5A 3BH6A 5JWOA 1SZPA 1AQYA 3IHWA 3U44B 1U7OA 2ZSAA 5F9HA 2IYLD 2ZETA 1U81A 2CJWA 3B7GA 1VCIA 4LJ6A 4Q1DA 1KSGA 2R8EA 1WA5A 3KTAB 4HAIA 1I2DA 3P4XA 1ZU4A 2WICA 3D6TB 4IFEA 4XSGA 4A6PA 4GMDA 3WK5A 2KB0A 3EF0A 2FV8A 2BVNA 3ZQJA 2VP5A 1P72A 4HUTA 4TYWA 4UMVA 4KCGA 1TA0A 2ZM5A 4NBSA 1IN5A 3LDAA 4B43A 3CPEA 4LX0A 5KPJA 4DCNA 1J2JA 2QNRA 3QNMA 1DEKA 1KMHB 4GNKA 3UMFA 3K70C 5DI3A 1M34E 4B2IA 4BGDA 2B1QA 1JBKA 2F3TA 1OFIA 3AVWA 4I9GA 4NFLA 1RVDA 3DDCA 1JEEA 1Q1EA 1KKLA 3JVUA 3GLGE 3MJHA 3QXXA 4ZCLA 3UATA 2D2EA 1PLJA 5EE1A 4KFUA 2OCPA 5AUPB 4DLRA 1VFPA 4PAQA 2F7SA 2ZREA 2H1LA 2IYZA 1XXHE 2B8EA 2QEQA 4PXAA 4G9BA 2V9PA 3QUSA 5CB6A 4CE6A 3I8SA 1OFUX 3C4JA 4MKFA 1QQ6A 5AW2A 3BRWD 2QPOA 2O0HA 3PFIA 3BK7A 2IHBA 4WIAA 1HT2E 2DFNA 1HT1E 2PEZA 2VHJA 4UNQA 5IHPA 1Y8AA 2FDRA 1UJ2A 3QE0A 2ORVA 2B92A 2YJ5A 2W6JD 4GIBA 4MUBA 1QG4A 2CNWD 3EWSA 3IEUA 4R98A 1SVIA 1W2HA 2QT0A 3E2IA 1SVWA 2Q21A 4FI3C 1XTRA 1E9AA 3WYAA 4R9UC 2O8BA 2BY4A 4LV5B 2AKYA 2ZE6A 4NCJA 1ZUNB 4GI7A 1XBTA 5KNBA 4WA7A 4C0HA 1HH4A 1LFDB 2A2ZA 3NHBA 3PEVA 4RFSB 2HEIA 1D2MA 3IBYA 4JZKA 3SYLA 1E2PA 5DIFA 1ZIPA 4MDEA 4CF4A 4E03A 1S3GA 2IOFK 3IQWA 3NBZC 3RNLA 1FUKA 4AP9A 2A5DA 1II9A 2V7QD 2YOFA 4M9ZA 4TL6A 3HR8A 2G07A 4C0BA 5JMTA 2VP2A 3K0FA 3RWOA 3QPVA 2QE7D 3PCRB 2CFSA 2BMDA 3CH4B 3U44A 3VR4A 3FFAA 2P6NA 3PJRA 5TV2A 2P0EA 2QBYB 2R8YA 2GCPA 4Q48A 4EPTA 3UK6A 2YC4C 4GT1A 3WKBA 121PA 2OV2A 3KTAA 1TF7A 4XTCS 3ETLA 3UWOA 4IRUB 2ZRJA 4KODA 5AWFC 3EPKA 2Q5EA 5HZKA 4FCVA 3BFKA 1UPTA 4PAMA 2OXCA 5AR1A 4Y2YA 5BN4A 4PO1A 5IK2A 5G53C 2XSZD 2GHQA 1ZC3A 5IT5A 4TLEA 4TMVA 3KKMA 2V6JA 5AJXA 3FM9A 3CNOA 1E3MA 3QVUA 4GFDA 4PZZA 3CRW1 4V03A 5KDLA 2D7DA 2YJ4A 1XEWY 1KMHA 1KOFA 3LA6A 1IXSB 1XTQA 2G1KA 4WZAE 5L8VA 4KLNA 2EWVA 3B8EA 2N46A 1NVVQ 2EW1A 2JAQA 5A3RA 3EWAA 1R5BA 3X2SA 3M1IA 1XP5A 3SF0A 2P5SA 2REXB 5H70A 1MO5A 2D4HA 3K1JA 1AN0A 1DBSA 2WIAA 2BCGY 4JYBA 4TQ9A 4Q02A 3K0SA 1JPJA 4IVPA 4Q47A 4HLDA 4B73A 4BWYA 2GHTA 1SWWA 2FPUA 5AKKA 3T61A 3TBKA 3TUJC 2IS2A 5DN6A 3X1XA 4UM7A 3TIFA 3R20A 4AD8A 3T1VA 1NN3A 1RYHA 5BWMA 4Q7LA 2G06A 5FBVB 4A8JB 4NYIR 3ESRA 1RJ9B 2QGNA 5AVYA 1Z29A 1TU4A 2WMNB 3QG5A 2W6IA 3T35A 3BOSA 1XZPA 1E99A 2C95A 4OI0A 3WNDA 4JIMA 1N6NA 3I92A 1JR3A 2QROA 4QOSA 5F98A 1J99A 2RMKA 3NIWA 2VP4A 2C9YA 3KQUA 2IWRA 4QGHA 3QVVA 4RFSA 1C4OA 4EPYA 3LVRE 5JS7A 1XXHB 4BFUA 2IF2A 2YMLA 2XAUA 1IWOA 1IOZA 3L8ZA 4F71A 4WXPA 1XPOA 3BB4A 2XZPA 3MWJA 5KTYA 1FL9A 1KAGA 4QBGB 1WXQA 3ZX5A 1CU1A 5J4YA 4C0LA 4YXWD 1NMXA 2ZROA 3ZVNA 3AR3A 5AW8A 1AK2A 1JAIA 3ECCA 3U2QA 5KUTA 1UEIA 4PC2A 2ZG6A 1NF3A 5L3RA 4JLNA 2QBYA 2XB4A 2OILA 1KK1A 5AVRA 3UMRA 1RKUA 1Z2AA 3CX6A 4UQOA 3GQBA 1Z3IX 5CDFE 2FWRA 2J87A 4Q9KA 1RC8A 1RQLA 4NONA 2GAAA 4DLXA 1KDPA 2G1JA 4JKIA 4F93B 2OA0A 4YIHA 3A1UA 2IS4A 3NANA 4C4SA 3W5AA 3KKNA 4LJ4A 3ZZTA 1NRJB 4Q1CA 3LVQE 2WIBA 4QKQA 2E1RA 1E2NA 4LDJA 4YDHB 2Q3MA 1K5DA 2ZRGA 1TJ3A 2R65A 2WWFA 5LD2C 3KZXA 3B9PA 1RIFA 3LW8A 3BB1A 1HE1C 2JARA 4F92B 2CBZA 4L8GA 3MWLA 4Q5IA 2EATA 4L57A 5ALHA 2F43B 3QXCA 1PJRA 2WKPA 1HE8B 1T8UA 1DAFA 2NYVA 4GP7A 4XE5A 2QMUA 2RHMA 1I4LD 2RCNA 2GCOB 3L1VA 1L7MA 2RGXA 3AVYA 1UFQA 2GEDA 2WPDD 3BC1A 2GA8A 5GJCA 1RJ9A 4A8JA 2ZRMA 4DLYA 5CIQA 1AQUA 1XD8A 2ZXUA 4BLQA 4BRWA 4O0MA 1IJEA 1W47A 4EJSC 4DDWA 3EWIA 3QU7A 4FCTA 4EPRA 2CN1A 4LV8B 4UNPA 4MYUA 1O3YA 1B0UA 2JLZA 2EFHB 3RRYA 2GBLA 3NBXX 4ZEVA 3U61B 3L2OB 2IK8A 1WZCA 1RZ3A 2NO9A 2GXSA 2HJGA 1XXHA 2HXYA 1GFIA 3C14C 3O8RA 3K70D 4TN1A 3MPOA 1T9HA 4JLPA 2PZGA 4POAA 4ASUD 2ZR7A 4DLVA 2WHEA 3LAWA 1EFUA 3EC2A 2HX1A 2WF8A 2D7CA 3L7YA 4C0JA 3FKSD 5AW0A 5KPDA 1GM5A 3UMGA 3DM5A 1L8QA 821PA 1NN1A 2XZLA 1GTVA 2VF8A 2ZRHA 4K81B 3IHLA 4AI6A 1FQJA 1FUUA 1U0LA 2VKQA 3L8GA 2AD1A 5AVQA 2HHLA 1U9IA 2F3RA 3CBQA 4MQBA 4IDNA 4IEIA 4D26A 1S8OA 2XX3A 4DB2A 4EIWA 3J81k 2FFBA 3AF0A 4KNWA 5AI9A 2C03A 1CEEA 1IY1A 2QAJA 2ZQ5A 1IJFA 5G3ZA 1ODFA 1LF5A 1TQ6A 1M7BA 1EGAA 3Q5EA 3DAOA 2REBA 2W2VA 2X19A 1Z4OA 4CRWB 1W49A 1S9DA 3RABA 4JVLA 5EE5B 3KXKA 2BV3A 4OQMA 2OG2A 4IOMA 4A0GA 2EARA 2ZUDA 3RS4A 3N5CA 2XEXA 4E22A 1AS0A 1NVUQ 1D5CA 3OFND 3PR1A 4FMDF 3U3MA 2EAUA 3S6JA 4L16A 3FDIA 2P9JA 2ZBFA 3WP1B 1DAHA 4BFWA 1L7OA 2WJHA 8OHMA 1OIXA 4EAQA 3EZFA 4LUCA 1E9SA 1G4AE 4DCVA 5JCZA 1WR8A 4M1MA 3IRUA 4BFXA 2FSHA 5ALWA 2QA5A 2ZI4A 3L0IB 2IYRA 2WVJA 1XD9A 3ASYA 3W3ZB 2FPRA 1P75A 4B48A 1CJKC 2ZR9A 1KI8A 1DARA 2C8KA 2YMMA 1A2BA 1VPLA 2ODAA 2N42A 3TK1A 4P4TA 3U6BA 4RJLA 3OIUA 2GCOA 2XOKA 3QKSB 1R0WA 5DGXA 3ZLJA 1RRGA 1GAJA 1XMSA 4JJZA 1XTSA 2N1BA 3EXAA 1LS6A 2QY9A 1KO7A 4PHFA 2B7BA 3BJIC 3OEED 4P3YA 3SBDA 2AXPA 4ZIRB 4MDFA 2ZTSA 2WM9B 1E2IA 4DZZA 5JJKA 1CR6A 2FPLA 1SQ5A 1ZW6A 3X1WA 4CNQA 2ZSEA 3QF4B 2YHSA 2ZRCA 1NLZA 2RHDA 2HXSA 4NYMR 3W6NA 3QKUA 3LLUA 3MJRA 1S0UA 1N3BA 3DKPA 1DVRA 5L3VA 3P20A 4D81A 3LV8A 5KYKA 2F1RA 5DI9A 3M1YA 2BBOA 1W0KA 4IOKA 3H86A 2NTYC 3AP2A 1E9DA 2PQ0A 2EYUA 4TYQA 1YRAA 1N6HA 1G17A 4LHXA 1Z8FA 5IK2D 3QPUA 3U13A 2QP3A 3IB6A 5JFGA 4PHGA 5E4FA 3Q9LA 5AI6A 1P3JA 1YJ5A 1N6PA 2YYZA 2ZRLA 4RZUA 5C1BA 1S3SA 2VTKA 3GLFE 3ZJYA 1Q44A 1IN4A 3SU8A 5IDVA 2JAWA 5UKDA 3HYCA 1XCGB 1CJUC 2IUSA 2JGNA 1Z4LA 1XF9A 3I5XA 4XVQA 4XSHA 2FU5C 2JLYA 1UADA 3SZRA 4PPNA 3ZU6A 5ALJA 4D25A 1EXMA 4QJBA 5DHFA 2J46A 1YZNA 2L0XA 2B8JA 4RZ3A 5DN6D 2CCJA 1WDTA 2A3RA 2W43A 3MLEA 3DV9A 4LJ7A 5BW8A 2PX3A 3CF0A 4QC2A 4XJXA 2ZRFA 1OXVA 2F1IA 3NBFA 4HI0E 2BDEA 2IUTA 3PENA 2ZBDA 2GHIA 2QZ4A 2W6ID 5D3MB 4WBSA 2YV5A 4TQUS 1T3HA 1VDZA 3KKPA 4NYJR 4X8LA 5ALYA 5HE9A 2R9VA 4ON9A 3U5ZB 1L8LA 2ODBA 5ALNA 1JXMA 2IS6A 1KO5A 4PPGA 1HTWA 2O0JA 1N6LA 3RC3A 1QHGA 2QI9C 3A1SA 3QKSA 2AL7A 1G5TA 3ZWKA 4G1UC 1M7HA 1VYUA 1GRRA 1Z0IA 2RKOA 4P0TA 4AG6A 1MOZA 4BX3A 1U2TA 2P67A 1LV7A 3DO6A 3OESA 1N0VC 1UBGA 2JATA 4A0HA 3TVTA 4BNDB 2GZAA 5ALEA 3CWZA 4GP6A 5J5CA 4ZIRA 4I1OA 2OSBA 2BBSA 5AK3A 2W2TA 1KI7A 4NKRA 4OYHA 3THOA 4B75A 1Z83A 5JRJA 3WKEA 3QXHA 4B33A 3QF4A 1VG9B 1ANKA 1WQ1R 4LYAA 1O03A 3ONNA 1E9FA 2YZ2A 5J4HA 1UAAA 1E0AA 2H8KA 4DSTA 1CQZA 2W6JA 3SFVA 4Q4AB 2CNWA 1Q92A 5BN3A 5FBRB 1M7GA 1BS1A 1YZQA 1E2KA 2W00A 3P26A 3EZ7A 2CMKA 4ILEA 1BIFA 3AF4A 4IDPA 4Q1AA 4NAVA 3CPHA 3K09A 5AJWA 5AI5A 5BN5A 1M8PA 4GRAA 1G3QA 5DYGA 3DL0A 3CNHA 4YCNA 3IO5A 3GMTA 4HZUA 1AS2A 2WJIA 3W34A 2D62A 1M74A 1SXJE 3W8NA 4BFTA 3AR7A 1JNYA 1QYIA 3CRRA 1FOEB 4UJ3A 3AR6A 1AGPA 1TEVA 3TSZA 2XNSA 2ODNA 2V7QA 4NTZA 2HV8A 3FOZA 4D80A 4ZDWA 4KI0A 2H16A 2AN9A 1R5OA 4DSOA 3AH8A 2QE7A 2ODWA 1NRWA 4HLQB 1NNEA 2BDTA 5FI0B 1RE0A 2IBMA 4FWTA 3A1VA 2BKUA 2AKAB 2OESA 3UIEA 3DPUA 2GO7A 3TE6A 3QPWA 3CONA 1KSJA 1LY1A 2WWIA 1C1YA 4FMCB 4HGNA 2NPIA 2J59A 5FBLB 1XCMA 5B58C 3FPBA 4PSKA 4JLKA 2G80A 1G7RA 3TSOA 1MR3F 1X8JA 2GZDA 2WWXA 4G5OA 4DEYA 5D3MA 2XSZA 5A4JA 3QG1A 1U99A 2ZE7A 3M4YA 3SKXA 4DWJA 4L5BA 1FQKA 1Y63A 5FP0A 4P31A 3DMDA 2IOHA 3T15A 2FOLA 2YOGA 3WRYC 1FMJA 4WAUA 1PLLA 1OH7A 4OFZA 3B60A 1EG7A 5A0FA 4A4DA 5AM0A 3C7KA 1TQDA 4HGPA 5AW7A 3GJ0A 1L4YA 3IIJA 5E7IA 1G3UA 2EFDB 4NL4H 4DIDA 5E3HA 1Z22A 4BNDA 2DFKB 1XP8A 1ZC4A 1IM2A 1E2HA 3GJ8A 4JYCA 2GMWA 3KFVA 4MGZR 2ZBGA 3KQKA 2CL0X 3PUZA 2VLIA 2VA8A 1Q1BA 2V3CC 3NC1C 4QBFA 2DFTA 4JBWA 2V4ZA 5FL7A 2GJKA 3KUCA 2BMFA 1JR6A 2GFHA 3E8MA 1R8SA 2ERXA 4IEEA 1ZAKA 1ZD4A 2QUZA 4L6AA 2D2FA 1ZMXA 2FSGA 1G6OA 2ORIA 2PCJA 2ONJA 1Z63A 4YLGA 3VNVA 1IXRC 1CKEA 4CT4B 2AFHE 1G20E 4QGGA 2CVHA 4Q4AA 3GEHA 4DHEA 4PQYA 4EPVA 1G5PA 4DBLC 1Z0FA 1Z88A 2RAPA 4A15A 5EXPA 1W46A 3QU5A 3CLVA 2CL6X 2OHFA 3DDHA 2WSMA 2AH5A 4HLCA 1P9RA 1NBME 1ZD2P 2XTMA 2IT1A 1CRPA 4C30A 1BOFA 3SD7A 1XEFA 1OFHA 4U02A 1CXZA 1UKVY 1YZUA 3OIWA 4EENA 3HP1A 3FYHA 2FEAA 2YJ3A 4F91B 1ZM2A 1G3RA 3B13B 1P6XA 4MRRA 4CVNA 4BFVA 2IA5A 2QRNA 2QLTA 2WWYA 5FTMA 1O87A 2WV9A 3RS2A 1N6IA 3CIOA 4YXWA 5F2EA 3TRFA 3ET5A 4CIDA 4Y2RA 3BWVA 4A0RA 3B1ZA 1EFRA 5FI1B 3R9IA 2JLQA 1R0YA 5AKXA 2QL6A 3QUBA 1E79D 2HDOA 2ZE5A 3D8BA 3JZAA 4RD2A 1MABB 3E5HA 4V02A 5HCNA 1CJTC 4C4PA 5EJEA 2XOKD 2FMXA 4YGYA 3C5HA 1MO3A 5IT0A 4IDOA 1MH1A 2WKRA 4L9WA 3L0OA 1Q3TA 4AC9A 4O3MA 2FPXA 4IJMA 4FFDA 3A8TA 4NE2A 4LYFA 3B85A 4NABA 1E2EA 5EP4A 4MKIA 3ZD6A 3W9YA 3OCXA 4ACAA 4FIDA 4PAOA 1QRAA 4GZLA 5C18A 4DFDA 1F2UB 1J70A 2FG5A 4P32A 4A36A 2PEYA 3AKEA 4OK3A 1QHHA 4UJ5A 1VYVA 5JI3E 5AW4A 1E0KA 4A6XA 5SZKB 5K8IA 4PZLA 3SE0A 3R9WA 4YIKA 1DE0A 3B8HA 1G8HA 4JT2A 4US0R 4B3XA 3SI7A 2FJUA 5EE9A 5AVUA 1T6NA 1KI2A 4CYMA 2QMEA 1II0A 4RESA 2RAVA 1KJYA 3PUVA 1T0HB 1ZUIA 3KJEA 1Q1ZA 3W6PA 4DSNA 2IYEA 4C0AC 4ZV4A 2E87A 5TXGA 4JLVA 5GJWC 2HUPA 3TMKA 3RWMB 1CS4C 1GUAA 2C99A 3RF6A 3T12A 3A37A 2X8AA 3L43A 1N6OA 4UW9A 1RQNA 4C0SA 2GWHA 2RGCA 5BQ5A 4K8OA 2IW3A 5KO2A 5CJ2A 3SHQA 1LVGA 3S1AB 1QHIA 1ZNWA 5JJBA 1ZUHA 2NMVA 4B32A 4RD0A 1KKMA 1HA3A 3GJ7A 3SJAA 3LQRA 3Q72A 3AVOA 221PA 2I33A 1ZJ6A 4RFVA 2DWPA 1G8PA 2JJ8A 4ASUA 2OFWA 3HR7A 2DY1A 2ZRDA 4KVAA 3SN6A 2QENA 3BH0A 3KJIA 2ZJ8A 3K9NA 4URYR 1TTTA 3FKSA 4BX2A 4HAYA 3Q5DA 3FHCB 3ZGXA 2J9RA 4FXPA 2VHCA 1VCOA 4DDTA 1JAHA 3M0EA 5ALOA 2HT1A 1VKJA 1CR4A 1JQLB 5FPYA 3UWKA 1KI1A 4W5JA 2PR7A 1T91A 3REFA 3GD7A 1AS3A 3QLEA 2ZI3A 2VF7A 4I81A 2ZYWX 1P73A 1MABA 1Z08A 2YY6A 5ELXA 2WKQA 5E7JA 5AKJA 5JJLA 2ZE8A 3KB1A 1NG1A 1XEXB 3N07A 4DLWA 2GF9A 4CGZA 5F3WB 2ZI7A 4EUNA 5AI0A 3PGLA 2DBYA 3CF6R 2ZXEA 3NWJA 1HUQA 1KSFX 4M1TA 1UKYA 5FOWA 2LKDA 4CF7A 1P2UA 2C2HA 2ANCA 4OJKA 2J0QA 1TJ4A 3OFNA 3ZDQA 2WTUA 2WF9A 5JHGB 2QPAA 5ANRB 1F2UA 5AVSA 2AFIE 2X77A 3CM0A 1MT0A 1J90A 2NZJA 3PCTA 3RFUA 1TAGA 2I3BA 1X6VA 5JS8A 1VMAA 2Q3HA 1IY2A 1MRSA 3PITA 2O9JA 1SXJC 3HYRA 3W5CA 2J0UB 4J03A 4HATA 3GP8A 4G5RA 1U0JA 3IDQA 5CYPA 5P21A 4UATA 2OLJA 2CL7X 2ZYTX 3TH5A 3GPLA 4GOKA 3VU9B 2IYWA 2HEGA 3W6OA 3MGCA 1LS1A 4TWZA 4IW3B 3WK8A 3ASZA 4I1VA 2O8DB 3X1ZA 3ADKA 3AR9A 1MO6A 2LKCA 4MA4A 1ZM3A 1SHZA 1LB1B 4BE7B 2FNAA 4QFMA 2I1QA 3N28A 4TSFD 1R5NA 4B6JA 3QI2A 1VG1A 4KNVA 4Y2XA 3ZVLA 4JJKA 2VP0A 3OEEA 1OH8A 2HF7A 1KDTA 3S1AA 2V55B 2WF7A 3LQQA 1PLKA 4RY2A 1Z28A 2QTVB 2REOA 3HYTA 1OXSC 1DO0A 3OIYA 4AYTA 1QQ7A 4M1YA 2BHRA 3RRNA 4BLOA 1QHXA 3U3OA 5FOUA 2P11A 2Q4TA 5AKLA 3PUYA 1G7TA 3IPYA 1J8YF 1XRJA 3QGMA 3QUCA 1L2TA 3A4NA 4HLUA 5TDHA 4UXIA 2A9KA 5BYJA 1OXTA 4ZI3A 4KXFB 4AS2A 1BMFA 2EVWX 4OQNA 3I72A 1NVVR 2C5LA 4FCWA 4LV6A 2CVFA 5LD2B 1GNPA 4JVMA 5IRCD 2QMHA 3Q7PA 4OHFA 5HE8A 2PMDA 2Z4RA 1XX6A 3DHWC 3SOPA 2JLVA 4OBEA 5A3QA 1QHYA 2ZS9A 2MSEB 2ZSFA 4HLUC 1CULC 3UG7A 2C4NA 1Z5UA 1XEXA 5FUWA 3SQWA 4IDHA 4I9FA 1FTNA 2GVDC 2HCJB 5EE0A 3GYGA 4HAWA 4LBVA 1R8QA 2IYVA 4N3NA 4PSVA 5SZHB 3Q3JB 1XZQA 4AYXA 1E9EA 4B76A 3TUZC 1Z4NA 2B7CA 2YWFA 2G3YA 5HTKA 4EJSB 1Z4PX 3D6JA 4GSYA 1DO2A 2PCLA 4GMXA 2VSXA 5FL7D 4BEVA 1XJQA 2ZRNA 3K53A 5KSOA 1ZIOA 2YKGA 2W58A 1FEZA 4DCTA 5AKIA 5ALMA 4HB0A 1YZKA 1E9CA 4ZCIA 2IYTA 2J0SA 4HDCA 4UAUA 4MH0R 4JLAA 1MKYA 3UG6A 2RB4A 2YMQA 1MH9A 1ZCBA 2J0UA 3RS5A 1ZP6A 5KOYA 3N5KA 4DDUA 2HSZA 1TUEA 3FFBA 5CJPA 3W5JA 1W36B 3J7TA 5ALLA 5AM3A 1KO1A 1NL3A 2F9LA 2OBNA 3GLGB 1ZYUA 2VSFA 3MMPA 3VU9A 2F1HA 2I34A 1S8FA 2JA1A 2AMYA 3BGWA 1RMYA 1XMVA 3WGVA 1ZCAA 2H17A 2O8DA 4S35A 5FL3A 2GXQA 4FMCF 1U02A 4QBHA 4PNHA 2NGRA 4TLAA 4LYHA 1W4AA 5C46F 4P33A 1OB5A 4MYHA 1D9ZA 2CK3A 3D7MA 1JI0A 1J8MF 3ZVRA 2VHUA 4HYYA 3VX3A 4OHXA 1PVOA 5JZVA 3K0CA 3PG5A 1I4DD 4Z8YA 1DAIA 1P5ZB 3IGFA 4URZR 2XTNA 1OYYA 4DC9A 5LB4A 4NZYA 1EFRD 1YR9A 3UM9A 1P61B 3ADDA 2ONKA 1YR7A 3EC1A 3DOFA 3I1YA 5DYIA 4BEJA 5JEEA 5CYOA 2FDCA 3CO5A 4C4TA 4MYTA 1KMQA 3PEWA 4YC7A 3VKWA 5J4LA 2GZHA 3AV0B 4M0LA 3AR2A 1OPXA 3D31A 5IF9A 3K0CC 3ZWDA 1DAKA 3E70C 1G7SA 1KZ7B 3GLHE 2HYIC 3LNCA 3IILA 1WRBA 2V8OA 4BLTA 3EPRA 3VAYA 2J7KA 4UARA 5JWRA 2G77B 3U3JA 2OZEA 3NEJA 3ND9A 1X42A 521PA 4XQ0A 1R10A 2VH5R 3FWYA 2ZRAA 1IXZA 3QOFA 4JBYA 4U5XA 2FX3A 4UNNA 4ACBA 5T41A 4C9BA 1KK3A 1U90A 5KSPA 4WZBE 2DYKA 3AUXA 2C88A 3GLIE 4ZDJA 1FTSA 4QL3A 4EJSA 4G63A 1NY5A 5AK4A 1E96A 2A5FA 2HJVA 2DR3A 4MWOA 2DWQA 2YWHA 2AWNA 4H1VA 3IPXA 3G5UA 3R7WB 4Y0AA 4QQFA 4X8MA 4LJ9A 4CDGA 1LNZA 2ZS8A 4LCBA 4A1FA 1U98A 1FW6A 3SQXA 2KBFA 3VR2A 2B6HA 3TKLA 2IYYA 2ZJAA 4PC6A 3P4YA 1NI3A 2PL3A 1F2TB 3RSOA 1W5SA 5J47A 4GOJA 5EXSA 4BFYA 3AP3A 4X8OA 3GLGA 5M04A 5FR2A 3BAFA 2WJJA 4JLJA 3ADCA 2NPFA 2B21A 3AR4A 1GWNA 4XVRA 2HDNB 2QORA 4Z1MA 3OAAD 2F55A 1SVOA 2QSZA 4DLTA 5B30A 2I6XA 1E69A 4ZKEA 4D4JA 3M9LA 5AESA 1T8TA 1Z0AA 4UU1A 2VRWA 5TB5A 4IXNA 1G21E 2FZLA 1YKSA 2H92A 3QJYA 1W36C 3CRMA 4OQLA 2OM2A 5J4VA 4BZQA 5AM4A 4Q01A 5FPTA 3T5DA 4DCUA 4BYGA 2NO1A 4LZZA 4TTQA 1KDOA 2YINC 4URVR 2OYCA 4JL8A 1WCV1 2FN4A 2D74A 4IHQA 4V0ME 4DVGA 1YE8A 2H7VA 1MO4A 1UDXA 5A5GA 3OTQA 3NHAA 2BBWA 2F9MA 1F6BA 4B3FX 5HR5A 4AKIA 5AI4A 2BOVA 3CKLA 1JXOA 3RSLA 4BKMA 3KX2A 3WK6A 2Q6TA 1Q91A 2QRZA 2UZ3A 3ZH9B 3IEVA 3TR5A 1SXJD 3KXIA 2A5JA 3CRQA 1NG9A 1T5LA 4M1OA 4MITA 3AKDA 3EIHA 4A2QA 1U2SA 3PQCA 4QHYA 1KSHA 3KFXA 3WBKA 2RGBA 4C0KA 2KJQA 2VHQA 3O8DA 2HF2A 1W44A 1RKBA 4AK9A 1BKDR 3LBHA 4B3DA 3IIKA 1OFTA 2QTHA 3FVQA 2AUTA 4EZEA 4RSGA 4TL7A 3U7EB 2ZRIA 2UZIR 4RZ2A 1J8DA 1SU4A 1ZRNA 4Q19A 4YCMA 4PC3A 4OCZA 1RYFA 4RZXA 1KYTA 4FD2A 1VECA 3O8CA 2MU1A 1QBKC 4BBJA 1S1MA 5H8WA 4Z8XA 3ED5A 2F43A 4W5WA 2MSNA 4L6CA 3AVXA 3IQXA 3EX7C 1ZM9A 3EPHA 5TARA 3CF2A 4OHZA 2ERYA 3NC0C 1E79A 3R7WA 2A30A 2W0SA 3CX7A 1OB2A 1EFTA 4LJ8A 3AEZA 4NCHA 4Y2VA 2HOQA 2JAOA 1NN5A 1SVSA 2PBRA 1P9WA 1Q22A 3PEYA 1QZXA 721PA 2NO0A 3L8YA 2ZJ5A 4LHWA 1OT3A 3AVPA 4XWKA 1Z2CA 1IONA 3CNNA 3RS0A 5HKKA 1SVLA 2X2EA 4G0NA 1E1QA 2R62A 2JDID 3CWQA 3UMBA 1D2NA 3EPLA 1VHLA 2AK2A 1IQPA 2IF0A 5H68A 2DB3A 3WY9A 2BJVA 2GK6A 3T34A 4M9XA 1CJVC 1GKUB 4QGFA 3SBEA 3WYFA 1Z4MA 1YR8A 2GCNA 2OCBA 2CFRA 3AGQA 4OI1A 4I1UA 4N0EA 4F72A 5AVTA 4HAZA 1BMFD 4QJ3A 4MRPA 2ZRKA 2QAGC 4A82A 3WNBA 3U4QB 4YCLA 2ORWA 2OBMA 4URWR 4BLPA 3FE2A 3RYTC 2BKEA 2P65A 4P4SB 1EK2A 1GG2A 3SNHA 4Q1EA 1OH5A 2G9NA 3PDWA 2QT1A 3IO3A 1U8ZA 1CTQA 1EFCA 1NBMD 2NG1A 5DH9A 3SR0A 5JI2E 2EQBA 3AKCA 2WM8A 4MUMA 1W5TA 4TT3D 4IVQA 1IN7A 2OE2A 2AK3A 2G0TA 4AYWA 4HB4A 4DCCA 1XPRA 1NVWQ 3R8CA 2O8FB 2D2VA 3B1WA 1ZNXA 3Q7QA 4PC7A 3C5CA 2OAQ1 4Q7KA 2IXEA 3KD3A 1YZLA 4TLBA 1JECA 2EU8A 1W1WA 4M8NE 4OJQA 4M1KA 2WJYA 1LVHA 2PT5A 3G82C 4KBFA 1GVNB 2GJAA 2ZANA 1NSTA 3FMFA 1BYUA 1S2MA 1XTIA 2JLSA 2YNMA 3AF2A 4Q7JB 3N1UA 4CF3A 5FPHA 1F5NA 1T9ZA 3L0CA 3AKYA 3PV0A 4WXRA 3F8TA 4DB4A 3NASA 4KLZA 5CIWA 4US2R 3D3QA 1Z0DA 1U7PA 3TJZA 3UXMA 1N6KA 1WBBA 1UBCA 4A2PA 5CDFA 1Q12A 1W0JA 4HSEA 4IVRA 2JLUA 3TLMA 1VG0B 1Z06A 1ZS9A 5IT4A 3OHMA 3P27A 1YU9A 3SLRA 4ZO4A 1A1VA 5ALQA 2RB5A 4TZ0A 4NCIA 1GSIA 1RRPA 2ASEA 4V0NA 1ESNA 1XB2A 2C98A 3AVVA 2YJ6A 3FPSA 1P60A 1TADA 3L8EA 3EZ9A 4Q66C 1AA9A 2CK3D 1TEXA 3RHFA 5G3YA 1ZD9A 3PUWA 4IFTA 4UASA 1ZD1A 1UDWA 3EF1A 1FFHA 4D4LA 1M2OB 5G41A 2Z5FA 2LWIA 3M6AA 2KBEA 1GRQA 3FMIA 2CLCX 1JPNA 1UBFA 3FZQA 1ONBA 1SVMA 5EXXA 1L8OA 2KE5A 4QG7A 2BMJA 2ZBEA 5HKKD 4F7WA 4DLZA 2YVUA 3RDPA 3U4QA 1GKIA 5AK0A 2G6BA 3BXZA 1YHNA 2CDNA 4Y2TA 1WMSA 1W7AA 4AKHA 1NF2A 1YRBA 1WVIA 3HWSA 4OHWA 2JJ1A 4P4SA 4QJ4A 3B9BA 2O52A 4KBGA 1I2MA 5TMPA 2GILA 3RAPR 2OXRA 1H65A 4G5GA 3RRZA 2ZI9A 3B82A 1YDFA 1CRQA 1VCNA 5EP2A 1XEWX 2BWJA 2IUUA 5AM2A 3BWDD 4TSFA 1SVKA 2IWHA 2X4DA 1G3IA 3W3AA 1DPFA 2YOHA 4NCKA 1VG8A 1G5RA 2WOOA 5EUQB 5G40A 1EX7A 1K1EA 2O8FA 3VNUA 3WXMA 1PV4A 3UMCA 1T3SA 2C9MA 1JJ7A 2WWHA 2H18A 2VHTA 1KDRA 1RKVA 4W5HA 4C0QC 2W2XA 1G7CA 3U6KA 3ZVMA 1J97A 3LO5A 3KQNA 2KWIA 2P3SA 2ZAMA 1TQ4A 3CR7A 3SS8A 1B23P 2WFAA 5AIAA 2IYSA 3BFVA 4MRSA 5AVWA 4UMEA 3QXSA 1Z6XA 1KI9A 1TU3A 5FBQB 3T5GA 4DEXA 2Q9AA 3GLFB 4LJYA 2O8CB 1W4RA 2XJ4A 1BYIA 1W36D 3H4MA 4E09A 1E1RD 2GKSA 5C2JB 3LLMA 5CLQA 1X8LA 5CLLA 5FOVA 4GXTA 2UKDA 2PZFA 5HCIA 3QU2A 3GJ6A 3UMSA 1GL9B 4Z1MD 2FH5B 3QU9A 4BRUA 2WF5A 2H57A 1NNLA 2X2FA 2O0KA 1P9NA 2ZJYA 3A6PC 3ZIAD 2I1VB 3HU2A 3SJCA 4K46A 5FUXA 621PA 3ZZUA 2VBCA 1YZTA 3SYNA 1E9BA 3ZX4A 4Y3UA 5AK6A 4NWIA 2QQ0A 1ZNZA 2OT3B 1L7NA 4PANA 1BH2A 4ERNA 1P2TA 4HGQA 3WK9A 3GEEA 1HYQA 3EASA 1KJZA 3A4LA 5AK5A 2CHGA 1IN6A 1TMKA 4JL6A 4AIIA 4KAXA 4EPWA 4PSAA 2FI1A 1NKTA 1TNDA 3ZTYA 4X8HA 3WMFA 3K0AB 5ALKA 3JVVA 3V4FA 3I61A 2DHRA 3R9XA 1ELOA 3FKQA
chains in the Genus database with same CATH superfamily
2GPYA 2PS1A 1ST2A 1P2SA 2ZIGA 1RVV1 4YCCA 3I9KA 1QYCA 2RGNC 4TS3A 5CT8A 2PD4A 1J23A 2ZYUX 1MQ9A 4Q6BA 4AX4A 5C8YF 3DTNA 1D8AA 5EP1A 1PR2A 3QI7A 3T3HA 2EIHA 2CXNA 4IILA 3OPYA 5CAEA 4GL2A 2JB9A 3DWGA 5C31A 1WF3A 3JAKA 5AKGA 1DKUA 1T6XA 2VYNA 1LC3A 3FMOB 4YNBA 4I9HA 3N2EA 3PGMA 4GYYA 1PZNA 3DJFA 2R87A 1E5VA 2IXGA 4NJMB 3UUGA 2R6CA 5AQ1A 1KJQA 1KVQA 2QG9A 3GGDA 5C1PA 2P79A 3C74A 3FX2A 2O2ZA 4RZSA 2P2GA 3U4CA 1H3EA 1KI4A 2RGGA 2EQ5A 1GZSA 1G5IA 1RDFA 3S27A 4I9UA 3WIUA 1L6RA 1BVUA 1YAJA 2PBFA 3DCNA 3PD0A 2HRDA 4OJYA 4FFOA 4ZOLF 2JVJA 4DMUB 3RV4A 3L4EA 3F78A 3JSXA 1YR6A 1U3VA 4M7WA 1JP7A 4MGIR 3I4LA 1OKKA 3REQB 1WZ2A 1SRQA 1U4NA 2ES4A 3QHQA 2VP6A 3HKDB 4GX2A 4OQPA 2IHTA 4IDFA 3IVRA 3W9UA 5JAOA 5JZBA 4PVCA 1Z0UA 1S2OA 3LDFA 5CITA 2WABA 2B36A 5F35A 1FDTA 2ETVA 1I2CA 3F1KA 3CZCA 1P7WA 2YZ7A 2C8VA 4IQFA 3W04A 4EEZA 4YPVA 1HURA 1R66A 1E1YA 1LZLA 2WIJA 5KNDA 2KS6A 4IDQA 1DG3A 4UMDA 4L8WB 5AICA 2PRIA 2NOAA 1VM6A 3H19A 3L1UA 4PTLA 1EZ4A 4ZVNA 2DCUA 1SQ0A 2XH8A 1X1TA 3P45A 4IDAA 3PXGA 4GQIA 3DMRA 4NPAA 4YLEA 1DGQA 1A8HA 3U31A 1BE0A 4JUBA 3AHHA 4LI0A 5ALDA 1QTQA 3RUHA 3WHLA 3V8QA 3KL4A 2QU7A 4D0NA 1ISMA 2FZKA 3VV3A 1YONA 2EZUA 2B34A 2FEOA 2FB9A 1Z38A 3GDHA 3HG7A 2QI9F 4G8DA 4KJZA 3ELUA 2VYFA 3GEGA 3A2NA 3KB2A 4HQLA 4M1QA 1QV6A 4PG8A 3J80A 5LZ2A 1ZVQA 1C0PA 4O4JA 1PSZA 2Q9CA 4YAOA 2D0PB 3HWWA 5B3KA 3O4RA 4HDOB 3K0AA 1KYYA 3LK6A 3GVPA 1KFJB 4LRWA 3QF7A 4TV8A 1O89A 2PUFA 1JA1A 3EXG1 4D8XA 3ZGYA 1YVEI 5KS2A 3STTA 4NVRA 4E5UA 3UGJA 3VC2A 2AGVA 4OGKA 4F97A 3VRHA 1N5LA 4TN5A 3O2QB 1SU8A 3QZUA 1JJFA 4H9GA 5EXEA 2P2LA 3VZSA 4BB9A 1D4AA 1LK7A 2BFBB 5JLAA 3EJ6A 1ETUA 4ZVMA 3EXFB 4DSZA 3JYNA 2VJMA 3THYA 1PDVA 1W75A 1GNQA 1GEGA 4LF4B 4NG4A 1RRCA 1W52X 2OO7A 2YNMD 5AW1A 1OYVA 5BVGB 2AFHB 3WL5A 1G20B 5DHAA 4A8PA 1H6AA 4PN3A 4J0DA 4G5SA 2K5UA 2RH4A 3DAFA 5BO5A 4DXAA 4U6SA 3CISA 1THGA 1KMMA 1X8KA 2FZVA 2DQSA 2PLNA 2FMIA 1IBRA 2I76A 5DV9A 3FMPB 2WIFA 4Y2SA 1NFQA 1VE3A 1JIUA 2C2BA 2QS9A 5AVOA 2BFAA 1EUDB 1Z4KA 3WLAA 4CJXA 5IC4A 3ITEA 5AKYA 1JFTA 2HN9A 4LXGA 1DKOA 4NHEA 1V8FA 2GCEA 4A8TA 4EUFA 3DULA 3PI7A 5ES3A 1J09A 1DKNA 2ODEA 4DLUA 5DXAA 2Y1XA 4DY6A 3THWB 2GF0A 3OOJA 1Q7GA 1HDXA 2DU8A 4I9NA 4QELA 1H8ED 4RF2A 4I36A 3ZD8A 2WU1A 2BFCB 2PKCA 2R96A 3LBIA 3WKCA 4A27A 4DDVA 2Q3LA 2CC2A 3ZE1B 2V0CA 3GRFA 3MZ0A 5LMCA 2M1XA 4QFDA 4ESVA 3RS9A 4Y1RB 2H2AA 3CQ9A 2SCUB 3NAZA 1DRVA 1W8DA 3AP1A 4N8DA 3TQCA 2HBRA 4ZDIA 2C8LA 3HKBB 1XTPA 3WHPA 5MFZA 3T7TA 2EP8A 4UTNA 1STOA 2HRCA 3SEZA 2CCKA 3HJCA 4N6NA 3LWBA 3MJ4A 2BFNA 1WPQA 2ATVA 2ETXA 2YN4A 3B53X 3FYDA 3U39A 4CR6A 2RK6A 1YRWA 1P0IA 1Q1NA 3NATA 3CJRA 3GFPA 3OU7A 4B44A 1KYWA 1OJLA 2Y0PA 2B4AA 3B3JA 3SC3A 1R4NB 3GJSA 4D97A 4URHA 1OAOC 3N39C 2AYYA 1HG1A 3ADBA 3ZBQA 1DXYA 1W581 1WBJB 4TS4A 1YNOA 4WKGA 1KNQA 2IS1A 3G7UA 1LLCA 1YUBA 1EEHA 3RT1A 4CMHA 3GEMA 2A0YA 4MI6A 5TMPA 3O21A 5ECDA 2Q3FA 1DQRA 5B7QA 2F6RA 3V8BA 3VTKA 1GZ3A 1V71A 4F4JA 3NIDB 1OLOA 2G83A 3OCYA 3HL4A 2M6LA 2CHUA 4U2GA 5D2CA 4JSRA 1TM2A 4Q3OA 1P1RA 1RYZA 4CCYA 2SECE 1VJTA 2VATA 2VO1A 2I7DA 2ZOSA 2W4MA 3G13A 1PE0A 2JCXA 2QJRA 3K94A 1U0SY 2FWBA 4V0OA 3DDOA 4LOAA 1N32B 3HDTA 3U16A 4GDFA 4TV9B 1QC5B 4PLWA 4F38A 4K26A 2IYXA 5FPSA 2VJKA 1DFGA 3VHLB 4RTOA 5KTMA 1NYRA 1W4CA 3MTBA 4OXNA 1UBEA 3TOXA 2Z9CA 2CNKA 3AETA 2AR7A 2C4MA 3UT5B 1SHJA 3GVHA 4UULA 5KYYB 2P1DA 2VTEA 1LTQA 1RS0A 3NCTA 2HBZA 3FY4A 1GTZA 2I4RA 4PQRA 1EWYA 3MSCA 1DJNA 4U3JB 4ZOBA 1I30A 2ZAOA 3DWFA 3MXTA 4OMUA 2QWXA 2BM1A 1FFBA 1P8AA 4RX1A 2A9FA 3KQWA 4HWPA 5SY4A 1FX0A 4GI2A 5ICEA 2I91A 2HPVA 3N2KB 1HORA 4JK3A 1TJ5A 1OF1A 4AZ0B 2J1LA 4OG2A 5FQNA 3VMFA 3DLHA 4QNRA 3DKIA 1OFUA 3BGDA 4KRYA 5J1TB 4COKA 1QR6A 1WS6A 2IEZA 3BMCA 3JWEA 3H5RA 3R3UA 4J1NA 4NNJA 4QO8A 4ZPJA 3QPCA 2YVAA 1YHZA 1SR8A 2NVUB 4PV7A 3H1FA 1H4QA 3KKZA 2PFKA 2BONA 2I2DA 2ZT8A 3M6IA 1E58A 4I99A 1CF2O 2YY7A 4D2IA 1HQDA 2ZCJA 1PK9A 5SYNA 6Q21A 3IV6A 3EWNA 3C3DA 3QTTA 3TZBA 3H0KA 4N7MA 5BNTA 2QX6A 4S05A 1REQA 2RGAA 2BMEA 1TCBA 3THXA 4NU0A 4M1EA 4IIJA 4ZQIA 2ZVQX 3V1TC 1BDBA 1JUDA 3ESAA 4RGQA 3IP8A 1A9TA 2ZU6A 5BMVF 1IG3A 4JB2A 4X44A 1NNI1 2RH9B 4D82A 1HNWB 4Z7NB 4M9UA 4E4YA 2W42A 4LA4A 4DL9A 1O94D 3BWEA 3PT9A 3K6RA 3Q3IA 4FOPA 3HNRA 3DHVA 1I13A 2R1ZA 4MGEA 2IHYA 4P83A 1KRHA 3BWXA 1CE8A 1KVUA 3U3RA 1NLFA 1FS4A 4Z4HA 3QMVA 5K3DA 3T0FA 4AZSA 1CD5A 3HM9A 4B3MB 3B5IA 3V00A 3FOWA 2OCGA 3FVVA 1TMGE 3WE7A 1X9IA 4F21A 4DRZA 2WWWA 4QGAA 4WBNF 4NYIQ 1YIDA 3MG9A 3WHKA 4ZTBA 4U5QA 3EGXA 2CHVA 2CEAA 1CDEA 1FYVA 1F5SA 3DLAA 3IS3A 4UBIA 1QIKA 3ZDDA 3HU1A 1U65A 2KMLA 3IAFA 3KDSE 5GV7A 2J9ZB 4JOBA 2L18A 2NU8A 3K71B 2G36A 2JH3A 4V3CA 1B14A 1H4TA 1Y82A 1U0NA 3EFEA 4TT3D 4V0QA 2W2OA 1M0TA 3B6IA 3E9YA 1GITA 4AJEA 4RV4A 5AJTA 1VHDA 3TQFA 1EK6A 2QPTA 3EOAI 3PPVA 5IFKA 3IKVA 2DPLA 1NT2A 2HLDD 4BFSA 2ZBPA 2FJPA 1EUZA 2PWPA 2BHSA 3CRZA 4IKPA 2VJLA 2R84A 4IICA 5K45A 4DY4A 1QP7A 2C9OA 1EWTA 1OWNA 3I53A 4ITUA 3AV3A 5GP1A 2VUHB 1QLWA 1K66A 4RQTA 2GN9A 4IDDA 5KOHA 4C3OB 2B8TA 4IRXA 1YR1A 4I1PA 3FUCA 1QVWA 4EFNA 4RVCA 3T1OA 1V5IA 3GI1A 2ZJ2A 4EI9A 3KVNA 4FOTA 3V8VA 4UNRA 5E8RA 2GXAA 2A78A 4DQKA 4C05A 1RJWA 1GUBA 1W94A 1MF7A 2IPAB 1G6Q1 1NOIA 1U9YA 3KHTA 4JQSA 4LECA 4TMKA 5DTIA 1RWNA 4O4HA 1G8GA 3CRNA 4H4EA 5HFAA 3WNVA 3WV4A 3I58A 1KHHA 3KZ1E 2WUGA 4QYMA 3DVAB 4YPFA 2WFZA 3B2EA 4QECA 3RJMA 3OZCA 2GLXA 3IUYA 2JIZD 1GGJA 1I4TD 3HJNA 4NZ9A 2HQ1A 2XGJA 1XD2B 3QHPA 4YCJA 5K4GA 2X2OA 4GG1A 5HIAA 2R6GA 2PAAA 2B98A 2HFJA 2PVCA 3BG5A 3FZGA 5E1DA 2FFQA 3KT6A 4E2ZA 5H4GA 3RGGA 4MKHA 2PZJA 4UCWA 3T7SA 2RHBA 3DL7A 3AF6A 4HPWA 3HYSA 1YFLA 4F2HA 2I4MA 3PXBA 1FU8A 1TC2A 1ZN9A 2PS0A 4CLRA 2HSEA 5DM1A 1EFLA 2EL7A 3WK7A 2E4VA 5I9IA 1QP0A 4C2TA 5FKJA 3VTAA 1GL7A 1AKEA 1NOJA 1VJGA 2FGKA 3LX5A 1T5OA 2WK1A 4UVEA 4INPA 4N1AA 1GZDA 1G6HA 4G5QA 1ZI6A 1Z8NA 3EG5A 4TM7A 3PEUA 1RM4A 4K9OA 4X5OA 4Y2QA 1B8PA 1QCZA 1YFKA 2BEJA 3Q8XB 4H59A 3EGCA 2PD3A 2CW5A 3WKDA 4CIVA 1V35A 1QVVA 2HAEA 3BH7A 5EWMA 3QWBA 2Y2VA 2O6LA 3TZQA 4KPYA 2PV0A 3TSAA 3VDMA 3DBOB 5LQUA 2A5GA 4JU9A 3MUNA 4I1SA 5ED4A 5K0CA 1IHPA 3UWSA 3UAVA 1N2XA 1ORIA 2G4CA 2I7TA 5ALTA 2IX3A 2C7RA 5AM5A 1GKKA 3BTUA 2J32A 3G79A 3OJ0A 4DBVO 3OD5A 4D9IA 3IDFA 5ENZA 1P5HA 1CNEA 1EK1A 3OPXA 2WJGA 3DBRB 1OQAA 4PAGA 3STWA 1NUQA 2DM6A 1V0JA 3H87A 1Z5ZA 2GFIA 1XALA 2FW1A 2ZYSA 1QQ5A 5FBHA 1ECLA 2O2IA 3TDKA 3HA2A 5A04A 4KE8A 3HTXA 1KQPA 2W4QA 1NR5A 2J67A 1U3FA 1VCMA 4PZ9A 4D74A 1YRQA 4PHHA 4GLOA 5BR1A 1FVOA 1XA3A 3TW4A 2RHGB 3BB3A 4JCOA 1JA9A 2FUCA 1QK4A 2C00A 5G0TA 4PLFA 5LDDC 3BXFA 1XPUA 3ONWA 2A7QA 2OGZA 1U2PA 2ZJ1A 1XELA 5ALUA 4RY0A 4P4UA 4P54A 1WD7A 2Y4OA 3CXRA 3LD9A 3UOWA 3TSYA 4PG4A 5IJ9A 3RUEA 2JIBA 3WB1A 3UKDA 5J4KA 2B0JA 3FETA 3MMXA 3QE2A 1ULTA 5B57C 1UM8A 2QAGA 5FA6A 4Z9YA 3OZVA 3RANA 2EGHA 1SGWA 2YV3A 1JW9B 4KQMA 2R97A 4RVOA 3A1DA 1QO0D 2HMTA 4G9EA 4PFSA 3ZQ4A 3AB3A 4NG5A 5PGMA 4ER6A 1K7EB 5A4FS 1GP2A 4HBGA 4OPMA 3V6MA 2OHIA 3N7AA 3KJNA 2EHJA 3I04M 4QU9A 2PJRA 4IO0A 1IQ0A 1E7SA 3GZ4A 3AUFA 4OIFA 1IL0A 3X1KA 1WZEA 1KQFA 4PGFA 1OFGA 3PJGA 3T38A 3AR8A 1P7CA 3D3JA 3RD5A 4Q3BA 3RVRA 1WJGA 2TMKA 5FRDA 5BYKA 2C9BA 4C88A 3EK2A 5JXJA 5LIRA 2QVXX 4MVXA 3RVLA 2OV6A 1RXVA 3TW8A 4RSHA 2PLWA 3KCQA 2DTXA 1HEUA 2EW2A 4ETWA 2J8ZA 4TMWA 4FFNA 5ENDA 4LRYA 2ZSBA 1YCDA 3NZEA 3QX8A 2EFEB 1Y4UA 2PAFA 3BF7A 4JMPA 4L9SA 5GMOA 2D59A 4CEIA 1IQUA 3VOBA 2V7BA 1NW9B 3FPFA 1Z68A 1U7ZA 2RHRA 4DKJA 1I3MA 4YO8A 2CXOA 1UT8A 2EYQA 3A6EA 2XVZA 1GGHA 3CZQA 3OLCX 4M9QA 1V1JA 4L02A 4ZEWA 4YP5A 2G88A 2W8BA 5K03A 3A7EA 3EZ6A 1U8AA 5DHSA 2ONYA 1TZJA 3D0KA 5JNWA 3LL7A 3ZJUA 2WHQA 4LSGA 1NYLA 3WLKX 1N2BA 4FDMA 5FAKA 5GJBA 3MSXA 1RRFA 3PGXA 4P3PA 3EOBI 4HDAA 4YJ2A 4QTYA 2IYUA 3AG5A 3TI9A 4Z54A 3WGQA 1P9OA 2QUHA 3NRJA 1TO1E 4FYMA 4OI2A 4NK5A 3DL4A 4PEVA 1NTRA 5KYNA 2C4WA 3WZLA 4GQAA 1SULA 2Q8NA 3WRXC 3FVTA 5T3UA 3KETA 1HL3A 1I4EB 3UMYA 3RQIA 2K87A 1PFUA 1PUIA 4IS2A 3TOCA 1QKKA 1RQ2A 2OLEA 2ZUVA 1CWUA 1SG9A 3WBBA 1F60A 4QRHA 3FPHA 4QVGA 3A1TA 2WD9A 4LYJA 2LW7A 3H18A 1VL5A 4ZT7A 5BSEA 4WK2B 4W1SA 3LGAA 3BEOA 2VEDA 3SF8A 3VU8A 4QM7A 1GG5A 2I9KA 2H3HA 3WWPA 5CXUA 5LP1A 4UQLA 4ARZB 1Z6TA 2GZRA 2C04A 3MAAC 3MFYA 1K8RA 2R00A 2WINI 1JBEA 1KF0A 5IG2A 3F3KA 4WZBA 4JWTA 2DETA 1IB0A 2CXXA 2R4UA 5JIBA 3GLIA 1G16A 1OX4B 2CXPA 4LF5B 1FIUA 1G64A 4JR0A 2XMDA 5JXGA 4MHOA 3NTUA 1OC2A 1XQXA 3RODA 4C4OA 3RYFA 3GJ4A 4I1IA 5DVZA 4KMRA 1N8NA 1KFCB 2GRUA 5JS1A 3BXXA 2NXJA 2C0PA 1S9HA 3MWDB 3WAKA 1MEJA 4B8WA 2ECOA 3UN1A 2H00A 2RE8A 1II8A 5GOTA 4P0QB 1LBEA 3NBUA 4GSKA 2GEUA 2G9UA 4PYOA 5SYAA 4BTLA 1HKHA 5LJLA 1EB9A 1KHTA 5AW5A 5JNLA 1VYTA 1XJCA 1NATA 3CSSA 1UFRA 3N87A 3LW7A 2RHCA 1H0RA 3O82A 4FYWA 4JBNA 3OHSX 2B0CA 5DRYA 3CUEF 3GDWA 3KAKA 3ZS9A 2IZ0A 5EJMA 4LE1A 1I24A 1GNRA 3G9UA 5DNDA 3LBNA 3KEOA 4MR9B 1BDHA 2OLKA 3GCWA 1RYYA 3A36A 4JJ7A 3OZXA 1E2DA 2PLRA 4M0CA 4A91A 3QIVA 3K72B 3CT4A 2EDAA 2YW2A 3CNBA 3REGA 2HMUA 1Y1LA 2Z09A 4XUDA 2PUBA 3ANLA 1IBSA 3DNPA 5J40A 1GRNA 2GESA 3EDYA 4CT5A 1R4ZA 5CFLA 5E8JA 2GETA 2J9FB 1XGKA 5BWLA 5ECWA 1GYQA 4UHCA 3CFYA 4Q7EA 4MRMB 1E0DA 4CU2A 3FUXA 1DFHA 2VK2A 4AJNA 2RIPA 2Y0DA 5LYJB 1M6NA 4W4TA 5BRJA 5BW4A 5FNVF 1GNLA 2GPBA 3H7IA 2B82A 4CQMA 3TSWA 4C7OB 1BE8A 3GO4A 1HOXA 2H1OA 1FQOA 5IJAA 4MPDA 3QKRA 1HE3A 2O07A 5EN4A 4US1R 1CSEE 1XJ0A 1E4YA 1PJAA 1KJNA 4LK2A 2E4XA 3K09C 3KK0A 1KK2A 1WSAA 1I1NA 1TYCA 1HWYA 3FH0A 3WG9A 1GAEO 1ZBQA 3Q1KA 3F6CA 4P7BA 5KNCH 2D5LA 3G0CA 1H2HA 1WD5A 5T4FA 4DKXA 5IZCC 5KHOC 4Z9AA 4WGFA 3SJUA 3B51X 4WX2B 2QUJA 4R5HA 2FWAA 1X7YA 1KMNA 3L8HA 3DVLA 1PW5A 2EIXA 1KO4A 4OBBA 3O8BA 5DB4A 3EA5A 4AO6A 2XLCA 1VMKA 1M2FA 1SCUA 1XVIA 3ZPXA 5EQDA 4MWEA 4UUAA 4EGFA 1HR0B 3L7LA 3GJXC 1Z7GA 5MN5A 5KU1A 1OSNA 3EVTA 5HF6A 1ONOA 3W1EA 3ZX4A 1E2LA 3O9MA 1ZA1A 2YDXA 2BGNA 2VPTA 4HGRA 2G9VA 2Q0HA 2VJAA 2WNSA 3KJFA 4EX7A 2PNFA 4KIWA 3SWWA 1DEAA 3JRNA 3FDZB 2JLRA 4GOXA 4K88A 3ZTWA 1IN8A 1EXNA 4PLVA 5E1MA 3JQBC 3GMIA 1IWPB 3D7NA 2OUKA 2FWPA 1AKTA 5JQGF 1H9AA 4DSUA 1QF9A 4IUYA 1VSUA 3OT4A 4I55B 2Z1MA 3MF4A 1U5CA 4RPCA 4INZA 2R8ZA 4FJ2A 1IU9A 1NXWA 2FR0A 2DQYA 4DV4B 4KSBA 2NUBA 4HCJA 1DMRA 2EX1A 3DYVA 4OV6B 1XDBA 2KW5A 1EVLA 1KO8A 1KFKB 3I04A 4ZO7A 3CZPA 1F4PA 5SZJA 3VSBA 5KQLA 2NT4A 5M34A 3VHXB 1JB1A 2O8VA 4E5DA 4LWQA 1Y9ZA 4B6EA 4JB0A 3AY3A 4C0WA 4HDMA 1M6VB 1BVRA 1MNQA 2ZCUA 2VNSA 3BMOB 3M7IA 4Z49A 1S1CA 1WSWA 1OXUA 2QNIA 3FFTA 3UK2A 2AJDA 1K6IA 2Q4RA 4HX2A 2IODA 4Q4JA 3DT9A 3ZV4A 2PRKA 2AJCA 2G09A 3MUFA 1Z6QA 3GHHA 4NBVA 3BIJA 2C31A 5EZQA 5M7EA 5BQXA 4OJMX 2FP4A 3SHWA 2C58A 8ABPA 4YT8A 4TVOA 2ZVPX 1UXHA 1EA7A 3NKVA 5CT4A 4E2XA 4YONB 1OGJA 3OUTA 4MICA 1I5EA 2FW9A 4MV8A 4DSOA 2O05A 3K70B 3BVPA 3QJGA 2P6RA 3FHTA 5MN4A 3TRJA 1XZJA 2RI6A 3V7FA 4FWIB 3OZDA 3DBLA 3HVUA 2QQGA 1INLA 1ZNYA 1T5BA 3DGFC 4YMLA 2BEWB 3FMGA 5KYXB 4RCVA 1QB7A 1NXPA 1SHKA 3COPA 2AX4A 4WDRA 1NBWB 1WXEA 3ZOZA 2FWJA 1UJNA 3PDUA 1CR1A 3WLSA 1RNLA 4YEDA 3VPBA 2ZSDA 2W6QA 2V1UA 3WLPA 3CEPB 4Q1VA 4FLFA 4EMBA 5BORA 3AVUA 1NPYA 1UZLA 3VR6H 3GXOA 4LJ5A 5AIBA 2FPWA 3VR5D 2VP3A 4GD3Q 1SZCA 5AT1A 1RBZA 2W2NA 2Q8QA 3BE4A 3PL5A 4IMPA 3PXCX 4LSMA 5BXYA 4KN8A 3ZJVA 2YHBA 3LLVA 3HA5A 4RMHA 1S4QA 2NSHA 2XZOA 4TL8A 4XFDA 5JYBA 3EW9A 4AZTA 1JIKA 4YRIA 1J21A 5KYGA 4UCFA 1V5WA 1G41A 2C84A 2XWBF 4M6WB 2EJBA 1Y7HA 3LY8A 3ESCA 4KO3S 4M0FA 1TLLA 5ITZA 5LQDA 3NHJA 3JQ8A 1P5JA 3ETGA 3R0JA 4B2YA 1O54A 2WVAA 4RO0A 1BXRA 4DA6A 1XNHA 1US8A 2OAP1 2GPAA 4HNRA 3AUTA 1AN9A 4MVJE 3I2FA 3T9EA 1YV9A 4MVJM 4G1CA 4MS3A 1FYDA 5DISB 2O8BB 1ZJ4A 5CBPB 3G0GA 1GTMA 2ZB7A 2JJYA 4RXTA 3TG2A 1LQ2A 1N5JA 2O7RA 3MCAA 1N25A 4UTVA 5A3SA 5LOVA 4D4GA 1ZU5A 2H1IA 4PXYA 1V3QE 3QYPA 2V9CA 5KAPA 1TA4A 4HV4A 3TUIC 1PR1A 2PBLA 4KAJA 2FW7A 1KZ9A 1LA2A 3KXLA 4UNSA 2FEKA 1D2AA 4IQGA 4ND2A 5K99A 2ZUBA 1OGIA 2BZ1A 1EE1A 2XCIA 3KR2A 3T3GA 4PIMA 1U0HC 5JBQA 1C8LA 2PU5A 1TJNA 3B1YA 1U28C 3DH0A 3GVXA 3K0FB 2OSVA 3HNOA 4LEIA 3RYIB 2BTQA 4E30A 1OHHA 3E1SA 4EA7A 1SZPA 3IHWA 4JY7A 3M82A 1JT9A 3BQMB 3LUAA 2IU0A 2IYLD 2CJWA 1VCIA 4Q1DA 4C7KA 4EZIA 3RADC 4DMKA 3DKKA 4HAIA 5MF6A 3MAJA 1BQEA 2WICA 3N86A 2X9LA 4GMDA 2C2KA 4FC7A 4LCEA 4KBYA 1SCBA 5BN4B 2VP5A 5JJCA 4NQRA 4HUTA 3AONB 4JI7B 3N2GA 4ZK2A 3F73A 1F7VA 1IN5A 2VSQA 1MN6A 1L9XA 2BW0A 2C7VA 3CLUD 3ONDA 1J2JA 4E5PA 4AIRA 4GNKA 3PFHA 3IMEA 1CY0A 4X85A 1YJQA 1M34E 5DI3A 4NFLA 4GDMA 4NLLA 4P7JA 1Q1EA 4HAOA 4ER0A 3MJHA 2HMAA 1W6UA 3NTOA 2RBEA 1K0UA 4FGKA 2GYUA 3HFSA 4AY6A 5C52B 3UJPA 1WPRA 5KJEA 4FHCA 4IGFA 2F7SA 3CURA 1VBNA 2H1LA 1Y37A 2B8EA 2EF0A 2QEQA 1YBMA 4NMHA 4LVUA 2WMYA 2XPCA 4CE6A 4H17A 1AC5A 2I29A 2WTEA 3FYUA 3H99A 3LHIA 3JQGB 4QUEA 4J3JA 3ASUA 3UGKA 1WY7A 1KXJA 1HTTA 2IHBA 2JRLA 1L7AA 4N03A 3HBFA 4UNQA 2OV4A 2V3WA 3GL9A 4WLVA 4BJ6A 2W6JD 4RHTA 2IZ5A 3PZBA 1ZSYA 1NXSA 3IEUA 4O5AA 3DEJA 1ZW1A 4NU6A 1LJUA 4R98A 4RK5A 4FI3C 1DLIA 2Q21A 5IPFA 1QPGA 1XTRA 3L6RA 5CMLA 4EB8A 1RLJA 3NJ4A 1I7SB 1YDHA 3FIUA 1FW8A 1E3QA 3BL6A 1TMYA 3DTVB 1JLHA 5DBGA 3NIFB 5BT8A 2VTBB 4IL5A 4DR5B 4CMAA 3A6ZA 4N48A 3SYLA 5DIFA 4DCJA 2OCLA 3DBHB 3K96A 1S3GA 4ARCA 1AOXA 3IQWA 3H9CA 3KYIB 3NBZC 3RNLA 1WUKS 3EGWA 4D57A 2IHVA 2GN0A 4AP9A 3BUSA 1O6ZA 2A5DA 4GQBA 3C3YA 4HXGA 5IN5A 1DV2A 2OYRA 3HR8A 4BN5A 1QDLB 4YRBA 5JMTA 3RWOA 6LDHA 2QE7D 2X8WA 3PCRB 1GV1A 3F3SA 4EHAA 2BMDA 3A3PA 3V4PB 1J4AA 2QLNA 4HQFA 3FFAA 4EEXA 1AMOA 2C5GA 1FJGB 4J49A 1CUDA 2I6SA 4XLZA 2YC4C 4GT1A 3TINA 1L4HA 121PA 2OV2A 5LA6A 3UHAA 3VH4A 3OZUA 4KODA 1NBIA 4EO4A 3HADA 4Y2YA 2KLHA 1JN0A 3GA5A 2OXCA 1VA4A 4RH3A 3RKSA 2YFKA 1ORVA 3U3XA 3OQJA 1L5ZA 1XRPA 5IT5A 3F98A 3FM9A 2V6JA 4PTZA 4WK6A 3CNOA 2APJA 3QFFA 3UWDA 5ADWA 2D8MA 2QD3A 5DN9A 1T0IA 5EHZA 2D7DA 3E53A 4QUKA 2ZIXB 2O7VA 1KMHA 1KOFA 3HCRA 1IXSB 3MUEA 4JI6B 5L8VA 5JVDB 1M8FA 5BVHA 2C3OA 2VSYA 2AF4C 5EGSA 4WOBA 1GLNA 3NKFA 4Z4EA 3EWAA 2AJTA 2XGSA 1KEZA 4DV7B 4K87A 3KOXA 4RTRA 2P5SA 2BZGA 4YTEA 1YTUA 5CA1F 4DRXB 2WIAA 4MA0A 1F1BA 2AI1A 4Q02A 3KZVA 5J2UA 1FTGA 4J1TA 4ROTA 3TXYA 5E9JA