1RRCA

T4 polynucleotide kinase bound to 5'-gtc-3' ssdna
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
288
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*TP*C)-3'
total genus 94
structure length 288
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrcA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rrcA02
4GOXA 4LJ6A 1KMHA 4TLBA 3KKOA 1XPOA 1LS1A 1VHLA 1HV8A 2PEYA 1ZCBA 1T6NA 3KZ1E 1SHZA 1ZC4A 5EE5B 4O2LA 4Q9KA 2ZU0C 4UJ3A 4CE6A 2RGAA 4CZ2A 3GJ5A 2J7PA 2DWOA 3GCGA 3BH6A 2H1LA 2UVQA 1UF9A 4BBJA 5K8LA 2XB4A 5JI3E 2QEQA 4BZXA 1Z2AA 4DB4A 3K9LA 1GL9B 1R2QA 5TXGA 3DHWC 2MMCA 1QZXA 4HB2A 4PXAA 3KB1A 4Q1AA 4PSAA 3ONNA 3KUCA 4FFDA 2FPLA 3ZU6A 4MDEA 1F48A 1IAQA 1H8EA 2JGNA 1E69A 3OEHA 4IFTA 2ZI7A 3E8MA 1XJCA 1DARA 4DDVA 5AUOB 1FTSA 4RVCA 2CL0X 2PCJA 1ETUA 5K8UA 6Q21A 1E2QA 4OI4A 1RVDA 1NKTA 3SKXA 1UAAA 1RLMA 1QRAA 4PC7A 3V9PA 1OPXA 2B6HA 2XNSA 3ZQ6A 2I55A 4ZDIA 3MJRA 2ZVQX 3RSLA 1LF0A 3WMEA 4TMTA 1NY5A 4BLPA 5DH9A 1YKSA 2G1AA 2PJZA 3N1UA 1Q21A 4TLAA 2YJTD 1NIPA 5TB5A 4LHVA 3ZLJA 1U0JA 1X6VA 4ZCLA 1ANKA 1RZ3A 2JDIA 1G5PA 4JT4A 2J0SA 4BYGA 2HCBA 2QE7A 4M1OA 5DISB 3EX7C 3KOOA 1GRNA 4OHYA 3QVUA 1HYQA 2CLCX 4BZQA 1KKMA 3DKPA 2XTZA 5GJBA 4P4SA 3LDAA 3A6PC 4NYMR 5AJVB 4R7ZA 4FMCF 2JAQA 1SXJA 4TTPA 3LRPA 1DPFA 5BN5A 1VG1A 1X8KA 4UMVA 4YGYA 5JEEA 1OXTA 1VDZA 3AUXA 5AKKA 3KKQA 2RGEA 2OCBA 5AVSA 4A6PA 1ODFA 3PVSA 3L1UA 3JVUA 3THXB 4JLPA 1Z6AA 5FOTA 4Y2XA 3KKMA 1EFRD 5C4MA 2X19A 1B23P 1OIVA 1G5TA 4QGAA 1P9WA 1Q12A 2WKQA 4E03A 1TTTA 2GJKA 4KFUA 1GNPA 3CX8A 1OXXK 4LJ5A 4RZXA 1RMYA 1MRSA 1GVNB 4IDNA 2QTFA 4AK9A 4A6XA 5B30A 4BX3A 1KAOA 3BBPA 4M9ZA 5FBRB 2ZJAA 3RDPA 1WR8A 2AGVA 2F1IA 3C41J 2QL6A 3SFVA 3WHKA 1ZJJA 4A15A 3S1AA 1P4SA 5EUQB 1Z88A 3QXGA 4HLDA 5L3VA 1SKYB 3ZGXA 3C5CA 4GT1A 1BYUA 2C04A 2C77A 2G3YA 5CJPA 3V4RA 5K8TA 2OUKA 4GI7A 4HAXA 2VA8A 4EDHA 2CBZA 1N0UA 2OBNA 4YMVA 3U5ZB 3R9WA 2IYUA 2IT1A 4UXIA 2H92A 2CDNA 2XJ9A 4F91B 2HF8A 2JAOA 3P4XA 1E9FA 1GRRA 2OILA 1S2MA 3IO5A 1YJ5A 4AS2A 4EUNA 2P5TB 4CGZA 2YN4A 1KAGA 3IRUA 1H8HA 2QORA 2RGCA 3RYTC 621PA 1N6LA 2RGBA 1SVKA 3BFXA 3NEYA 5DIFA 4EZEA 4Q4HA 2BMEA 2VHJA 3MC1A 5CDFE 3WK8A 3AVPA 3EF1A 1IM2A 1T0HB 2YINC 3TVTA 1F2UB 5H1YA 1CBUA 3WKCA 3R09A 3OCUA 2IF2A 4XSGA 1I2MA 4Q9IA 3S6JA 1SXJE 3LLMA 5C46F 1E9BA 2WSMA 3TAUA 3MJHA 5KSZA 3PEVA 1CJKC 3T1VA 4JYCA 1WVIA 2YMQA 1NN3A 1RC8A 4BPBA 4BLOA 4UU0A 2J0VA 2IYSA 2IUSA 2G08A 2QA5A 1FFHA 1XP8A 3I92A 1GDDA 3UK6A 4CVNA 1G8PA 1NMYA 5J40A 4MYHA 1NVVQ 1XPJA 3HYRA 3VKHA 3TSZA 1KO4A 3K0CC 3X1WA 5IHPA 3PGLA 4UM7A 3WP1B 4M9QA 2VTKA 4OQXA 2ZYUX 3AR6A 3UMRA 1IN4A 5AI5A 2RAVA 1P61B 2ZJZA 1JR6A 3LX8A 2OE2A 4LOAA 5FL3A 2IS4A 2A2ZA 4F4CA 3N2EA 1KK3A 1E2JA 4JLKA 3EPLA 3LY5A 1G3IA 1PJRA 5DO9A 4Q7LA 3OTQA 3HU2A 1EXMA 3PUZA 3QXSA 3B6EA 1I4TD 4WXRA 2G09A 2ZRFA 3N70A 1E6CA 1EWRA 4TYPA 1D6JA 4ARZB 2BKUA 1MOZA 2HXSA 4TMVA 3A1VA 3DKVA 3C8UA 3NG1A 2G0AA 3HLTA 3M9LA 4TT3A 1Z6XA 4EKDA 1NLYA 4C2UA 2D3WA 2FEMA 1NRWA 1U0HC 3Q5DA 3AQ4A 4KYUA 4TSFD 2VSXA 1II8B 3OE7D 5FPKA 2I33A 1E2IA 2FWRA 4CIDA 4RSGA 2O8BA 4UM5A 4PANA 2D7CA 3LV8A 2RGGA 3DMDA 4KVAA 3L0BA 1XTIA 1Y63A 2JLVA 3P32A 5SZKB 3QPUA 2Q9AA 3KTAB 4LHZA 2PH1A 4PSVA 3U3RA 1L6RA 3KKPA 2FI1A 1NJFA 3TR0A 3U26A 1AKYA 2BM1A 5H68A 5FOVA 2QRNA 3A37A 5AUNB 4PHGA 3T5DA 2PT5A 5FR1A 2HYIC 4URYR 3W90A 5CIQA 1JQJC 3CX7A 4Q1EA 4KNWA 2ZYTX 5LD2B 5AIAA 1ZYUA 2CLSA 2V55B 5FL7A 3B2EA 1Q92A 3H86A 4X8LA 3K09A 3KUDA 3NH9A 3RVBA 3NAMA 1OB5A 2OO7A 2H17A 2QYHA 1DO0A 2HUPA 1XDBA 4NAVA 3I4LA 3GLGB 5FUYA 5KTYA 2IYQA 1EFRA 3IDQA 4YIKA 1ZCAA 3PCRB 2P6RA 3N28A 4U7DA 1KO8A 1OYWA 4LJ4A 2VRWA 1TF7A 1J70A 4PHFA 1N5KA 1KO5A 4MKHA 3CPEA 3FB4A 1BOFA 2GXSA 1JI0A 2AX4A 2WVJA 2ZSBA 4LDJA 4NYIQ 3OE7A 5CLLA 3R8CA 4PTLA 2WTUA 1PUIA 2OCPA 4G5OA 5EXTA 4B73A 3NDBB 3A4MA 5IK2A 1SZPA 3T34A 4FMCB 3TR5A 2CL7X 4FMDF 3P4YA 4IFBA 4MUMA 4EJSB 2YBDA 1TQ4A 2OV2A 2Z0MA 1Z5ZA 3RWMB 4R9UC 4TQ9A 4XWAA 5AVYA 4YXWA 1GG2A 1NLFA 2XJ4A 3KFXA 3U60B 4UAUA 4Y3UA 2ZI6A 3C14C 3D6JA 2W6JD 2C9OA 3THWA 2PLRA 1GWNA 3BORA 3FWYA 4GMDA 4TN1A 4URXR 3GLGE 5A0FA 4M9XA 5C2JB 2IHYA 2DY1A 1W2GA 2I1QA 2ZS8A 4Y2SA 4ABYA 2PKEA 3WGVA 4NDZA 4LWZA 3B9RA 3I72A 1N6KA 1AGRA 4DLUA 4HB3A 1ZNWA 2Q3FA 3TH5A 4Y2VA 5EXPA 5J4VA 4HAUA 4QBIA 3WK4A 5J5CA 3NEJA 2CE2X 3KDSE 2ZYVX 4P4SB 4Q9HA 3L0OA 3VTKA 4GNKA 1VG8A 5FPHA 2EYQA 1JXOA 2LKCA 1ZD3A 5HZKA 2J87A 4FI3C 3T1TA 4IEIA 1AQYA 4MGKR 1KDRA 4B3CA 3UG7A 4MDFA 1R5NA 2IYLD 4HLCA 4ZEWA 1UKZA 1EFTA 1R0ZA 4ILEA 1XVIA 2W2VA 1DAIA 2QM7A 3EASA 4DCVA 1J8YF 1U8YA 2BKEA 3KKNA 5KDDA 4IG4A 3FMOB 1K1EA 1IBRA 4MUAA 1E0KA 3NANA 2ZRGA 4E5UA 5G40A 4F4JA 3NALA 1RFLA 2NO6A 3Q3JB 2V3CC 4RD0A 4D26A 4OCZA 2FDRA 1R8SA 3TBKA 3FYHA 3ND9A 4HSEA 2RHMA 3GEEA 5ALDA 2BDTA 1OSNA 2PX0A 1E0SA 4JS0A 4DEYA 5JMTA 3KBBA 1QG2A 4K8OA 3K9NA 1CR2A 1OKKD 3PUVA 4HZIA 4TT3D 5J4HA 2O8DB 3DVLA 3H1TA 2HF9A 1G3RA 2PX3A 4TMZA 4DCTA 4V02A 1C4OA 3CRVA 5JJBA 4I81A 4NL4H 1EFCA 2VF8A 3EZ9A 3OCWA 5AM5A 2B8JA 1FX0A 3RRMA 2ATVA 5DN6D 3CPHA 4YDSA 1IOZA 1S4QA 3VFDA 1DTSA 1YR9A 2ZIAA 1KI6A 2BOVA 4DUGA 4BNDA 4MH0R 1KOFA 4DIDA 1DELA 4NZYA 3VU9A 2QRZA 2JAWA 2VP2A 4URZR 1Z4KA 3FDIA 1WCV1 1ZNZA 1IN5A 5B2ZA 1BO6A 1EG7A 3PQCA 4KAXA 4CEHA 2PZGA 1J2JA 1U9IA 1WDTA 4OK3A 2GILA 2FGJA 3ASYA 5FOWA 4UU1A 4NABA 3BWDD 1N6RA 2RGXA 1DEKA 5FPYA 1W49A 3K70D 4PC6A 1G8HA 2CNWD 2JJ2D 3ZTWA 4A8JC 4FD2A 3ZD6A 4RD4A 1G3MA 1ZIOA 1KDPA 5JBQA 1Z8FA 4BUJA 1D8TA 3UXMA 3U6KA 5KSPA 1OF1A 1W44A 3U3KA 4A36A 4W9MC 1VG9B 2ZUDA 2REBA 1M7HA 2W4MA 4B34A 2ZQ5A 3WK6A 1ZU4A 3JVVA 2YWHA 2FSHA 4M2LA 2V54A 2JLQA 1CULC 2R6FA 3B7GA 4MWOA 3NVAA 3NHAA 4JSYA 2REOA 5AI0A 1NP6A 3D7MA 2GF0A 3RS4A 2EYUA 2IXFA 2OFWA 2R8RA 2EW1A 4G5QA 2IUUA 2BCJQ 2Z6VA 4TQAA 2OXRA 1E0AA 3WNCA 4WVFA 3EPHA 5JSZB 4DCUA 2OESA 4Q48A 3L5KA 4PHHA 1DAMA 5FUVA 2FPUA 5EP4A 4YH1A 3ZDQA 2CHVA 5AKEA 3A58B 4YCLA 4KSBA 4OHVA 4ZEVA 5C4GB 1SWWA 1E0JA 3NC0C 2IOFK 5AICA 2ZRCA 2GHIA 2AHOA 3MGCA 4JLJA 3X1ZA 1XMIA 5H8WA 3GLFB 5FBQB 1HURA 1FMLA 3IBGA 3IEVA 4L57A 1JEEA 3QG1A 4NCJA 2IWHA 3T61A 1XP5A 3NIWA 1Z0DA 2PL3A 3WKDA 2J0UA 2AR7A 4AKEA 3OCZA 2W58A 3QQ5A 1UDXA 5JCZA 2CL6X 3I61A 3FPSA 5HPYB 2P11A 2QBYB 1Z29A 2QSYA 2WJJA 2YWGA 3OHMA 2ZRBA 5AK0A 2YJ5A 2F43A 3HP1A 5L3SA 4F7WA 2HXYA 1GNQA 4ZI3A 3RWOA 2FJUA 2W6JA 4AG6A 5TARA 3CWZA 1N0VC 1Z4QA 3TIFA 5AW8A 2HCFA 1DAKA 2OT3B 1P6XA 3FHOA 3MSXA 5FTJA 4B3BA 3GPLA 5AKIA 2GBLA 2ZI9A 3LA6A 5J47A 4Q4AB 4OL0A 1MT0A 3K0FB 2GCOA 4TLDA 1YDFA 4IDPA 1E79A 1QYIA 1QHYA 1U90A 2WAYA 3EWIA 3AP1A 1YR8A 2Z4RA 4EENA 3PUWA 2QAJA 1IHUA 4B2PA 4KBFA 2NIPA 1IY1A 4KSCA 5DSZA 4DT1B 2ZXEA 1ZM3A 1C9KA 1UKEA 3A3YA 2G88A 1II9A 4U02A 4LCBA 4Z1MA 4ACBA 3SJCA 3N2IA 3D31A 3R9XA 2XSZD 4OHWA 4GPTA 4P3YA 5KDOA 5F2EA 2GJ8A 5HCNA 2V8OA 3IEUA 3SMVA 1W36B 4NHOA 3A1CA 3PENA 4JZKA 3TKLA 4NCKA 3C5HA 1T5TA 3E70C 3C7KA 3GLGA 4BEWA 1UPTA 3CR7A 3CR8A 3W6OA 3FPBA 4G63A 2OHFA 1T9HA 1KI2A 3OEEA 3U3MA 1NSTA 4IFEA 2PCLA 5AK4A 4KXFB 2YOGA 2BHRA 2BBTA 3SEAA 2IS6A 1CR0A 4MA4A 3LLUA 1S1MA 3F3YA 4G5GA 2GJSA 3W5BA 2W0MA 1F2TA 5AJXA 2O8CA 1PLKA 4D82A 3KQNA 1L8LA 5AK5A 1Q57A 4AURA 2DFLA 4WW0A 1ZU5A 3AR5A 2KI5A 3SYNA 1MV5A 2G9NA 1CKEA 1KJWA 1LFDB 3Q72A 1ZMXA 2DYKA 2J7PD 5ALEA 1BKDR 5AW2A 1Z6TA 1ZD4A 2D2FA 2A78A 1OHHD 2QTVB 5L8VA 2C5LA 3I8SA 1N6OA 2VO1A 5A3QA 3GJ4A 2BJVA 4UNNA 1IY0A 3E84A 2EATA 1W48A 1UEJA 3UMBA 2VP4A 3MCAA 2OBBA 1XCPA 1G4AE 3ZTYA 3QU9A 3U3OA 3CIOA 3B1VA 5KSYA 5AM0A 4TLEA 2RMKA 1Z4JA 2BDUA 2C9YA 3QE0A 3QU7A 1KI4A 1TMKA 1IY2A 1GSIA 1M7BA 3QOFA 3CWQA 5CYOA 3GFOA 3B78A 1KI9A 1XMSA 2FFAA 2MU1A 2ANBA 1MO4A 1F3OA 2N42A 4O2RA 3SF0A 5ALIA 2NMVA 2C99A 2WIBA 4B6EA 2GZDA 2WWHA 4M8NE 2GXQA 4XJXA 5BN3A 3E2IA 2WF5A 1BH2A 4MYCA 2CFRA 1TAGA 3IHWA 4V0ME 5DI3B 2R8ZA 5A5GA 3LX5A 4H9GA 1ONBA 4UNRA 5J4LA 4RJLA 5KOYA 2O8EB 2GF9A 2Q4TA 1Z0JA 4L16A 4YXWD 4MGZR 3QSYA 3T1OA 2ORIA 2FPSA 4M53A 4Z51A 2WF6A 2CJWB 4O3MA 3EZ6A 2G1JA 1XD2B 5JWHA 5LB4A 1CTQA 3ZIAA 4YLGA 4PNHA 3PGVA 1XX6A 1GAJA 2OCYC 2VYFA 1XTQA 4MGYR 1O08A 2JAUA 3E81A 2MSDB 4MRNA 3SQXA 1ZC3A 3GJ6A 1TJ3A 4KO8A 2HT1A 4DZZA 4Q4JA 4F93B 1H8HD 3C15C 1WB9A 5EZ6B 2WSSA 1E9RA 1SHKA 2RKOA 4QNMA 5CK4A 2HCJB 4CEHB 2ZUCA 2FN4A 3Q7PA 1FNNA 2G0TA 3ZZTA 4CEIB 3EW9A 4B3GA 4QHTA 2AXPA 4FCVA 1K8RA 4IOKA 2J0UB 1XPRA 2ODNA 3AB3A 5G3YA 4LV6A 4AY2A 3CNHA 1ZOLA 2N1BA 5FBWB 3NHBA 3EC2A 1UEIA 4B75A 3AUYA 1GITA 5IT0A 1R10A 3AH8A 1Q1QA 4TZ6A 4UARA 2V9PA 3B1XA 4A0HA 3L0YA 4H1WA 3RRNA 4Z8YA 5KDLA 3QEJA 1KO1A 2DHRA 1TJ5A 5BXQC 5EQTA 1ZJ6A 1KTVA 5DI9A 2ODBA 4RKEA 1F6BA 3BB1A 3SS8A 4DLTA 1NF2A 5FTLA 1U7OA 4M1WA 4E09A 2HOQA 4YMUA 3GLFA 1UBFA 4CEIA 3JZAA 3OIUA 1WA5A 4AYTA 2GVZC 3CNLA 3VQTA 2G06A 2NPFA 3B9BA 3KDPA 5ALHA 1S9DA 1UBEA 1Z0KA 3CZQA 3AVUA 3WRYC 2YWFA 4TMKA 4TL8A 4L6AA 4RZ3A 3MRSA 2OG2A 2A5GA 1KHTA 2EFEB 5KO2A 2VEDA 4FW9A 4DFDA 4GZMA 5CJ2A 1XFAA 4BEJA 5AVQA 3DDCA 1M2OB 1PV4A 3VKGA 1ZBDA 2BC9A 4TYYA 2B30A 4B3FX 1N25A 3PIRA 1VFPA 1IJEA 3KJEA 2FMXA 5JECA 2OXCA 5AM4A 2A5FA 5G41A 4P32A 1OIXA 4H1VA 2YKGA 4JJKA 5EUMA 5JS8A 3VX3A 3ADDA 2EFHB 5ALKA 1S3GA 4B47A 4ZO4A 1NF3A 4BWYA 2P9JA 1KKLA 3D3QA 3HJNA 1ZUHA 1AK2A 4S35A 3G0HA 4UMEA 2G80A 3OESA 2NYVA 3Q7QA 3EWAA 3REFA 1ZD1A 4PAMA 3E1SA 2I34A 1CJVC 5EP1A 2AFIE 2EARA 3CRQA 1BIFA 3PUYA 4JLNA 3MMPA 2C03A 3TLXA 4A2WA 3QKUA 3HWSA 3EIQA 3AEZA 4KLZA 1OFIA 2VP6A 3BK7A 2AKAB 4HUTA 1XCMA 2DB3A 3EC1A 1QQ7A 1OE0A 1G1MA 2ZITA 1GP2A 3WY9A 4AC9A 2K5UA 3REGA 1GOTA 2FEOA 4CYMA 3GLFE 2VKQA 2Q0HA 4HDCA 3NBFA 3TSOA 4QBGB 4KBGA 4RD2A 1E2PA 2B8WA 2DCUA 2GK7A 4TL6A 2XOKA 1DS6A 4XQ0A 2RGNA 5JCPA 3T12A 3FPAA 1YVDA 3EZ2A 4H1UA 3W9YA 4QJ3A 3W5AA 4Q1CA 3RHFA 3DPUA 4PX9A 3GLHB 2ZXUA 2H16A 3FM9A 4Q5IA 4TMWA 4GP7A 1T5IA 4RY2A 4EIWA 3SLRA 1N5IA 2GETA 2YJ3A 1YS9A 4RD6A 2WM8A 4OK5A 3VR6A 2GESA 4WAUA 3GLHE 3TW4A 2RGDA 3ZS8A 4BFUA 3L0PA 3K0CA 4OJKA 1WBDA 2OFXA 1AGPA 1FUKA 1W4BA 4P0TA 1HEIA 3BJIC 4MRRA 2P3SA 1BYIA 3X1DA 2HF2A 2ZSAA 3B9PA 3SE0A 1Z0IA 2KE5A 3EF0A 2EWVA 2PZFA 3FOZA 3K0AA 4TZ0A 2VIIA 1Z4MA 4DSTA 3UIEA 5IS2A 2QMOA 3J81k 1AQUA 4MQBA 1QQ5A 3F9RA 2FX3A 2GKSA 1J97A 1DAEA 1DBSA 2EFDB 221PA 2JLSA 5GJCA 5JHGB 3FGOA 5GVRA 3IIKA 4HUQA 1A7JA 2B8TA 4L9SA 4ESHA 2BV3A 3RFUA 1M8PA 4US1R 3BD9A 1HE8B 2ZPTX 5AK3A 5ALPA 3FKSA 4LI0A 4LYHA 3GJXC 1UDWA 3AP2A 5JWRA 3ESQA 3I1YA 5IDVA 4M1MA 3O8CA 3W5CA 3BWVA 3CF6R 5F9HA 1GM5A 2CHQA 2IYZA 2IXGA 3R9KA 1A2KC 3B60A 1OJLA 2I1VB 3MWKA 1Z3IX 1JR3E 2AUTA 1XEXB 2QU8A 1BMFA 1RQLA 2DFNA 2H57A 2XITA 4NCNA 1TA0A 4LV8B 2IYVA 4M1TA 2R8YA 4C0BA 2WPDD 4DIEA 1A5TA 4AWXA 1E99A 2HYDA 1YZNA 3G5UA 4JKYA 4AD8A 1EX7A 1EK1A 1X42A 1L4YA 1Z28A 3B1WA 3DZDA 2JCSA 2FDCA 2QE7D 3AGQA 3HU1A 1SVSA 4C4SA 2Z83A 4Y0AA 2YJ6A 3ADKA 2OBLA 4DLZA 5CB8A 1OH8A 4Q7KA 5LB2A 1RPZA 1OFUX 1M34E 1S0UA 5LBIA 3BH7A 3VX4A 4D0GA 4MUBA 4OI2A 5E7JA 1E1QD 2V7QA 4MITA 4TL7A 4HYTA 3ZS9A 1KI6B 1XZPA 3FGNA 1VCNA 4NCIA 2H7VA 4YCNA 2DWQA 1DE0A 1T91A 4ZIRB 4IHQA 4POAA 4LZZA 2CCJA 2ZAMA 3AR3A 3KFVA 2YNMA 1XEWY 2HLDA 1KY2A 1WP9A 1EK2A 2D74A 2B82A 1T3HA 1PUJA 2EFCB 1LF5A 1E9CA 3ZQJA 1RRPA 1K5DA 3QKTA 4URVR 1P72A 2WKPA 2RH5A 2XAUA 3THOA 4OQNA 4FMDB 4FXPA 3CNOA 1RQNA 4BFXA 1MH1A 2JASA 3KL4A 1NL3A 4QBHA 2LKDA 3U7GA 3ZW7A 4DDTA 3U61B 4Y0VA 1OHHA 5DN6A 4A92A 1T5SA 2FH5B 3TGPA 5ALSA 4QKQA 4DLYA 3FVVA 4X8MA 1L7OA 4KVGA 4PQRA 4D4MA 1RJ9A 1SGWA 2O0KA 3RC8A 3KJIA 2WMOB 1LW7A 4XOIA 3N5KA 1FUUA 1BS1A 521PA 2DBYA 5FH9A 2F3TA 4Q4LA 1LS6A 1JUDA 1A4RA 2P5SA 2BDEA 3B1ZA 4XPZA 1ESMA 5AKYA 1G8FA 3BERA 1E9AA 3O8RA 3AR2A 4WZAE 5CB6A 4EFMA 3OFND 4GFDA 1KY3A 4LYAA 4V0OA 3SR0A 4BFSA 721PA 3U44B 1R7RA 3ZYCA 4DSNA 1II8A 4ZDKA 3PR1A 2G07A 2HSZA 5AVWA 3AF2A 5KNDA 3QU4A 5ALFA 2Q5EA 3OEED 3EA0A 2NO9A 1RIFA 4HLQB 4W7SA 4DSUA 1M1YE 2D7DA 2ZRAA 4PR0A 3VNVA 3ZVMA 1XB2A 1XXHA 2CJWA 1SVWA 1PLJA 3PITA 3CW2A 5A3RA 3TNFA 5ALVA 3W8NA 4DEXA 2ZEJA 3PEWA 2P27A 2WWWA 3CF0A 1R5OA 4CF3A 1JJ7A 2EWWA 3K09C 5P21A 3U4QA 2YJ4A 3A1DA 3UM9A 2BMJA 1JBKA 3IB6A 2WFAA 4AKIA 4HDOB 4HGRA 4FE3A 2CLDX 4Q4JB 1J8MF 3DOEA 4AKGA 5DI3A 3FMPB 3D8BA 2WJHA 4UNQA 4JL5A 4BEBA 1D2MA 3EPRA 4PZZA 4MGIR 4UQOA 2WICA 3AKEA 1W0JD 4KYTA 4LX0A 3ICEA 4D25A 3EARA 3UMGA 4PHTA 2RB4A 5DYGA 3QUBA 3WRXC 1XD9A 3FTQA 1QQ6A 3SJAA 4JVSB 2C9CA 1Z5UA 3BB4A 2YHSA 3QXHA 1QHNA 3CLVA 2RGNC 2QY9A 3CX6A 4E88A 1G64A 4XTRA 2IK8A 5JFGA 1MABA 1OXVA 2CHGA 3EIEA 1UKYA 5KNCA 5BW8A 2ZR0A 3S1AB 1PLLA 1TU3A 5FP0A 4B3DA 3VAAA 4OQFA 3CF2A 3HDTA 3R9IA 2ZJ8A 1VIAA 3NBYC 2ASEA 3A4NA 2X2EA 4LJYA 4XH9B 4D0NA 2QM8A 2VSFA 3ETLA 2FPWA 1E1RA 3OPXA 4UATA 3RS2A 2C8KA 4HUQB 2JLZA 3UPUA 4Q02A 1Q3HA 3RANA 2PLFA 3NWJA 1I4DD 2GFHA 4PPNA 2C96A 1FL9A 1KNQA 1V43A 1F5SA 5AHXA 3B13B 1KK1A 1XTJA 2YYZA 3WKEA 1XXHB 2B0CA 1RRFA 3K0FA 1KSJA 3K0AB 4X8OA 2GHQA 3AR7A 2VHCA 1G41A 1N3BA 4NKRA 5A4JA 1TEXA 4NYJR 5AVTA 3FZQA 1KZGB 1YR7A 2I3BA 1H65A 1NBMD 1YZLA 2GK6A 3K9HA 2R2AA 4KCGA 1GTVA 4QHSA 4WA7A 2NO0A 2YMMA 5FTNA 2J3EA 2B92A 4UJ5A 3WYGA 4BFWA 2P69A 2R6DA 3THWB 3MWJA 2FPMA 1KSGA 5FBVB 1XEFA 4A0FA 3K70B 4C2TA 4B6FA 4Q66C 1ZRNA 1YE8A 2DFTA 2ANCA 4BZPA 4GIBA 4Q1DA 5E4FA 4UMDA 1AS2A 4J0QA 4PZYA 5KYKA 2CVHA 1HH4A 2GHTA 3RABA 3SJBA 4Y2YA 3I5XA 3F5FA 3QXCA 4N1AA 4NH0A 1TF5A 1HE1C 4US2R 2P0EA 4W5JA 1Y8AA 5ALMA 2I54A 5AR1A 2KB0A 2Y8EA 1QF9A 3QGMA 1CU1A 3U13A 3EZFA 2XNDD 2ZS9A 2VP5A 3AF4A 2QT1A 4GMXA 2XGJA 1S8OA 1D9XA 3WYFA 1XTKA 1AQ6A 1CR4A 4JIMA 1EWQA 5IT4A 4KITB 1P2TA 2ZU6A 1L7NA 1XRJA 4EAQA 4FMBB 1G6HA 1V5WA 4JL8A 4JKIA 1NNEA 2FF7A 3M1IA 4A0GA 1E98A 2F1RA 1JNYA 2CXXA 1J8DA 2NPIA 2Z4SA 4DC9A 2E9SA 2VSOA 4F71A 1IN7A 4G5RA 5JRJA 4CF5A 1Z08A 2RCNA 1W36D 1R6BX 1XTRA 3AKYA 2W0SA 5EP2A 3RS3A 1SKQA 1TQDA 4X8HA 2YMPA 2CE7A 3A1EA 4EPXA 2WJIA 3HR8A 5CIWA 4HGPA 1YZGA 3UANA 4GL2A 4HYYA 1X8JA 2J46A 1E2NA 2C9MA 2VQSA 2R8EA 3JZMA 2ZSDA 2GJ9A 1OKKA 5CM8B 3PJRA 1N6PA 5E7IA 3RSOA 3VHLB 3KZXA 3F8TA 2ORWA 3W3ZB 3KJHA 1E94E 2Q4RA 4Q7JB 4NWIA 4LJAA 4QNRA 3N5CA 1KIMA 2Z43A 3MWLA 4A2PA 4B43A 2W83A 5JI2E 4KI0A 4QRHA 2IEYA 3SKYA 3ASZA 5JLJA 4MKGA 3A1SA 3SI7A 1ELOA 1FOEB 3H2YA 4B6JA 2VPPA 1Q0UA 2VHTA 3NTUA 1N6HA 1KI1A 1NJGA 2GA8A 4JVNA 2C8LA 4BLSA 1U8AA 3QENA 2AN9A 2XXAB 1VJ5A 2HJGA 1M6NA 3VR1A 1UBCA 2E87A 3QXXA 2P65A 2SHKA 3SZRA 5AW4A 2ZSFA 2ZAOA 4QJBA 3ZJYA 3VAYA 1HTWA 5AI8A 2ZS7A 4NONA 3WHLA 1B0UA 1GRQA 1SULA 4JL6A 5JSZA 1MH9A 2OAP1 2ZTSA 4Q9JA 5KPJA 2QAGC 1R5BA 1T8UA 3L0SA 1GKUB 3KX2A 3NDPA 4NMMA 5E3HA 2BEJA 2IF0A 1GL7A 1P2UA 1K5GA 3MFYA 4M22A 1N8NA 4Z1MD 2JLXA 2KBFA 1UKVY 2YV5A 2GJAA 3SC3A 3ECCA 3T5GA 3TW8B 3RNLA 2WSSD 2XNDA 1MO5A 4OHZA 1KMQA 3CNNA 1E2LA 5EXSA 5AJZA 1YR6A 2ODWA 4DCSA 3GEIA 4EQ6A 5E7MA 4IKEA 4JVMA 121PA 5EZ5A 2O2XA 1MRNA 2J41A 4I9FA 4V0LA 4DRZA 2A3RA 4ZIRA 3GJ0A 1NKSA 4YQFA 4OK6A 1LNZA 1X3SA 2V4ZA 2G6BA 3MN1A 3M1YA 3IJ5A 4FINA 4TTQA 5AKLA 1NN1A 2JIZD 1XJ0A 4JT2A 2R62A 3T15A 2XXAA 4IW3B 4LV5B 1NVVR 3O47A 4O8CA 5HKKD 3FMFA 5FFMA 1EK0A 4I9GA 3ZX4A 1NG1A 3RAPR 2IS2A 3TUIC 3RC3A 3ZUPA 1P2VA 5ALLA 1A2BA 1IQPA 3QYPA 3AR9A 3WMFA 1ZAKA 5AWFC 4R98A 5CM9C 3FKSD 4I1OA 3K0SA 3I62A 4I1SA 3CUEF 1VJRA 2VHQA 1KYIA 3OIWA 1J90A 1KSHA 2IXEA 3PEYA 2IOFA 4PPQA 3L2OB 4A2QA 3T1QA 2ZE8A 3QF7A 2ZROA 2WWYA 4PC3A 4JLVA 4DWOA 1GKYA 2H8KA 2ODAA 1RKBA 1TQ2A 1E9SA 1VHTA 5EE3A 3LXXA 1VYUA 4NU0A 4TQUS 1N2CE 4Q4HB 4QXAA 1X8LA 1ZINA 1KI7A 2R6AA 3VR4A 1KDTA 3THYB 1Z5GA 1H8ED 3K1ZA 4RCZA 2J7KA 4Y2PA 5IT5A 1G8YA 1RW4A 2YVUA 1CLUA 4JLAA 3WGUA 2IW3A 4Q19A 4KHZA 4RETA 3X1YA 1X1RA 5GVSA 3QPWA 4YMWA 4DLRA 3ZZUA 3KB2A 1JEDA 4TTRA 4Y2RA 5AKZA 4KYIB 2QI9C 5EXXA 5KU1A 1C1YA 1YNSA 1I4LD 3HU3A 2BVNA 4BRWA 4EJSC 4TYWA 4LJ9A 4QOSA 4D0LB 1HQCA 3L7YA 5ALUA 2FGKA 1ZP6A 3VNUA 4UMFA 3DM9B 2DR3A 4LC1A 2Q9BA 4OJQA 2XZOA 1FTNA 3V00A 1NNLA 4NV0A 3CRRA 3OZXA 2JA1A 4ON9A 3TMKA 2P2LA 4BFYA 1RKVA 4LBVA 3IILA 3NRJA 1ZD5A 3LW8A 3PCTA 3VR3A 4XIGS 3L8FA 1K6MA 4PO1A 1NVUQ 4YMTA 2ZE6A 3FHTA 3LVRE 1JR3A 2YOFA 1Z4IA 4C0KA 5HCIA 2BIFA 1DADA 1OW3B 2ZR9A 3CRMA 3OCVA 3BFKA 1YZUA 1NI3A 4ACAA 2NO4A 4XWKA 1JXMA 1PW5A 1YRBA 1U0LA 2HI0A 5LD2C 2VF7A 5KPDA 1L8OA 4NYMQ 2I6XA 1JB1A 3L1VA 4MYTA 3TE6A 4AYWA 4KFTA 4YONB 1SXJB 2HHLA 1FP6A 4IOJA 4FIDA 2CMKA 3W5IA 4CDGA 4OQMA 4PO8A 4LYFA 3DNPA 4V03A 3ND8A 1J99A 3ZVRA 5ALGA 1Q22A 1LTQA 4LHWA 5BYKA 3UMCA 1AIPA 3UWOA 1AM4D 1DG3A 2WZQA 2VP9A 4HAYA 3E58A 4XOUA 2D4HA 4Q7MB 1IN8A 2GZAA 1G4UR 1ZD9A 3ET4A 4ZDWA 1L8QA 2GRJA 2ZSEA 2ZJ5A 1R0WA 3GMTA 3R7WB 4CNQA 1IXSB 1CJUC 1XTSA 4L8GA 2J9RA 4RZ2A 4OFZA 4A8JA 1OH6A 3AGPA 3C4JA 5AW6A 2IL1A 4LJ7A 3Q85A 4L15A 2ZOSA 4OQLA 1F2TB 2F9MA 3K8YA 5FPTA 1QHSA 3FHCB 3I1FA 5JJIA 3QI2A 4Q9LA 3PEUA 1NSFA 5AI6A 3SD7A 4IEEA 5AW5A 3Q9LA 3R8FA 2GBLC 1IWOA 3GEHA 2HLDD 4QG7A 4Q4AA 2BBSA 4PZLA 5CLQA 2FFQA 4F72A 4MRVA 3GYGA 3WKBA 2W2TA 2WHXA 4OKSA 1G8GA 3WYAA 4BFVA 4EQ6B 3KXLA 4Q03A 4Y2JA 1X1SA 3MWYW 2W43A 4FN5A 3QF4B 1FMJA 2QG6A 3P27A 4RFSB 421PA 2E1RA 2ZI5A 1FEZA 1E1RD 5AVVA 1KJYA 4M4SA 4B2LA 2QNRA 4GZLA 4HZUB 3DDHA 2FG5A 2IYXA 1UM8A 3CM0A 4DCNA 1Z4NA 4B2IA 1G7RA 3IPYA 3IO3A 1U81A 2XTNA 3VHXA 2Q3MA 5EJEA 2ZJOA 1P73A 1R0XA 1DVRA 2BJWA 5TMPA 3TLMA 5AKXA 4PC1A 5KUTA 1NVXQ 3TAHA 3ZZ0A 5T41A 4R2HA 1WBBA 1VIYA 3PUXA 1EGAA 5FOUA 3M6AA 3TSWA 1G7TA 4OBEA 3BGWA 5B57C 3PDWA 1KNXA 3K9GA 4YDHB 1D5CA 2WJYA 3U2QA 3I6BA 4EEKA 1XEXA 2W2XA 1UBGA 5AUPB 4YCMA 2IEZA 2HEIA 4C0LA 2IYEA 2GDJA 3LFUA 3QBTA 2ZRDA 3LQRA 3AVXA 2NOAA 3ZD7A 2JJ2A 1G9XA 5TV2A 4P4TA 3EIHA 1T9ZA 3QXJA 4NE2A 3RLFA 1WF3A 4A82A 4RKFA 3QG5A 2C78A 1NVWQ 5G53C 1U7PA 1RDFA 1Y3AA 4J03A 4RFSA 2V6JA 2ZRLA 2P6UA 2H5EA 2IS1A 1N5LA 1NMZA 4KX3A 1ZD2P 2QP3A 3O8BA 4UW9A 1KI8A 2AKYA 1L7MA 5D3QA 2TMKA 3QKSB 1PVOA 1FNMA 4ZKEA 3X2SA 2BWJA 1Z22A 4URWR 2QQEA 2XX3A 4IDHA 1NLZA 1W4CA 2NO1A 4BASA 3K0EA 4IOLA 3I73A 1RYHA 2ZG6A 4N0DA 2NZJA 1WQ1R 2ONKA 2GAOA 2B21A 4P31A 1CIPA 4JLOA 5D3MB 5E95A 2KSQA 3IQWA 3ZI4A 2ZBFA 1XF9A 4IDQA 5ALZA 3OFNA 4QM6A 1E9EA 2JJ1A 1RKQA 4KX5A 1G21E 2ZRPA 3QIAA 2WHEA 4C4PA 3ZH9B 4ERNA 1Z06A 3IKJA 1Z63A 3SFZA 3L8GA 4B32A 1W4RA 2YC4C 2BY4A 4B3XA 3B8EA 4L9WA 4RZUA 4IVPA 4OHXA 5BQ5A 2OM6A 3I28A 4M0LA 4LPSA 2KBEA 3EG5A 4NCHA 1NY6A 3NASA 1CJMA 2QSZA 3VKWA 2UZIR 2HO4A 5AKJA 1QBKC 4HAIA 1AJEA 1YZKA 4MYUA 2RHDA 4GOJA 2B1RA 5AW3A 1A1VA 2QGZA 5ALYA 3ZX5A 2HDNB 1ZS9A 3W5JA 2NO5A 3VR2A 3FVQA 1TE2A 5ALQA 4IRUB 4QFMA 1SVMA 5TVKA 3RF6A 1OV4A 4TYQA 2PR7A 1ZM4A 2ZYWX 3IIJA 5AIBA 3DOFA 3UKDA 2R6CA 4WBSA 4B33A 3QUTA 4I4LA 1CR1A 4C0HA 1Q1BA 2ZETA 2J59A 3GLIA 1LVHA 2O8CB 2QTHA 3I8XA 1GZSA 3FFBA 2OZEA 2X4DA 3LBHA 3HPQA 1Z0FA 4C3ZA 3SDZA 2RARA 1AA9A 1FQJA 1O03A 3U3JA 2QPOA 5EP3A 1W46A 1JAHA 3QLEA 4IXNA 1Z4OA 4HAVA 1OXUA 4YMSA 4N0EA 2BMFA 1KDOA 1E2KA 4BGDA 3MMZA 1AS0A 1M74A 2ODEA 4MKIA 4GSYA 2C4NA 1IJFA 2V6IA 1U94A 4B76A 2WF8A 4NFLA 1FQKA 2CCGA 3THXA 3MG9A 2VLIA 2DFKB 3D6TB 3QEOA 5J4YA 2XTMA 2FPXA 1W0KA 1TPZA 2JLRA 2CFTA 1SXJD 3U44A 2FA9A 1G3UA 2FU5C 1QHXA 3W8RA 2IX3A 3LNCA 1P3JA 4W5HA 1BMFD 2ORVA 1TADA 4MKFA 2WM9B 3EWSA 3U19A 1P75A 2BEKA 1TNDA 2IBMA 1DAHA 2VP0A 2YZ2A 3A4LA 4KFSA 1OIWA 5F3WB 5L3RA 1W1WA 1QHIA 3LXRA 3I32A 5AJWA 2J45A 1G20E 2YWEA 1GUAA 1TUEA 1CEEA 3CH4B 1VCOA 2ZVPX 3KJGA 1W7AA 1P9NA 5UKDA 1ZRMA 2F3RA 4XVUA 4ZCMA 1NBMA 3ICQB 3W3AA 1TL7C 1NRJB 2VBCA 4D2IA 5DE3A 3GLIE 1D9ZA 2ZJ2A 2OCAA 4U00A 4OI1A 1COWD 2JLUA 1QHHA 4HLUC 1WPGA 2RBKA 2FSFA 3GLIB 3NBZC 1SQ5A 1E2MA 1SWVA 2G1KA 1VPLA 1JALA 5AK6A 3TRFA 1N9KA 4CEJA 4M21A 2EFGA 5DGXA 1O87A 2IYRA 3QU5A 1MKYA 4HI0E 2ECKA 1VTKA 2ZBGA 4BE7B 4D80A 2BBWA 1E1QA 1KK2A 2V7QD 1WE2A 3IPXA 3V4FA 4A8JB 5AM1A 4P4UA 1P2SA 4RD1A 2GVDC 3W6PA 3O8DA 3ZVNA 1E2FA 2ATXA 1S3SA 2GZHA 3AKDA 3GFPA 2BM0A 5GADl 3FKQA 1XNJA 4CW7A 3KXIA 1FPMA 5HKKA 1E4YA 3AF1A 4Q21A 2PT7A 5AW9A 5GJWC 4PC2A 5DNYB 1W0KD 3Q8XB 4ZKDA 5FTKA 1TUIA 2X1VA 4R2IA 3FE2A 4CF7A 2JARA 4PAOA 4NTZA 1DOAA 1KJZA 4QHYA 1SU4A 2QMEA 3LBNA 5B58C 3NUQA 3KQHA 3AV0B 2O8EA 3WXMA 1ZM2A 2WOJA 2CNWA 1DAGA 5A3SA 3BAFA 5H70A 2D62A 2KWIA 2A5DA 4JYBA 4YC7A 1SVOA 1YU9A 1E2EA 5CDFA 4C30A 1NIJA 2ZI4A 4RFVA 2F9LA 2O8BB 2O8FB 5J4KA 1A82A 2OFOA 3WK7A 1L2TA 4IDOA 2ZUBA 4Y2UA 3K1JA 1IONA 4BECA 3LH5A 4HZUA 5IRCD 3OAAA 5AVZA 1YHNA 2ZRNA 1L7VC 4R71A 1U2RA 1F60A 2AFHE 3A1UA 3BA6A 2QROA 3B1YA 4PPGA 3BRWD 1GL6A 3QVVA 1WZCA 2A7QA 2R9VA 3EXAA 3WKAA 3W5DA 3IBYA 2EAUA 1E4VA 1RKUA 2AH5A 2GWHA 2WJGA 4C7OA 1YRAA 4HGOA 3U7EB 1QDEA 1OB2A 2CK3D 4U5XA 2D06A 3B85A 2Q6TA 3ED5A 5AKGA 1T8TA 3MD0A 5AI4A 2FV8A 2PBRA 2XZPA 4K46A 1QVRA 4GOKA 3EPKA 8OHMA 3QUQA 4EELA 2MSCB 1G19A 4BFZA 4LGMA 5C1BA 3GLHA 4FWIB 4HATA 3G82C 3HYTA 1X86B 1G7SA 2GEUA 3WP0A 4TMXA 4QM7A 1NN0A 2BCGY 4LBZA 1RE0A 2ERYA 3R7WA 3CKLA 2XOKD 4AIIA 2PJRA 4C9BA 1D2EA 1G16A 1CS4C 4JLBA 5CITA 1T3SA 5BYJA 5JEDA 3SN6A 2GXAA 4BQSA 2O52A 3PXGA 5AW1A 4Z54A 5BWMA 1WXQA 2WAXA 4IOMA 1ZVQA 4DDUA 1W36C 1S2OA 2ZJYA 2ZREA 1WRBA 2GEDA 2QENA 2JGAA 1S8FA 2R8XA 2IA5A 4DKXA 4FWTA 4Z8XA 4C0SA 1JJVA 1AKEA 2QQ0A 4I1UA 3SYLA 1XPUA 3ADBA 4AP9A 4MRSA 1G3QA 3A1WA 3AF3A 5ELXA 1Z83A 2C8VA 3AVTA 5HR5A 2H18A 3BIFA 4BLQA 1IXRC 1Q1ZA 4DLSA 2FPRA 4XD7D 3QU2A 1TJ4A 2A30A 2I4IA 3B82A 4EPVA 5F9FA 4Q01A 3A8TA 4NYIR 3A1TA 3LQQA 5CK5A 3SU8A 4EPYA 4JVLA 2FZ4A 1FP7A 2F1HA 2YC2C 2HV8A 3PG5A 4JSTA 4WZBE 2IC5A 3U4QB 5AVXA 2O8FA 5AM2A 1U2TA 1VCMA 3CZ4A 2D2EA 2G77B 1W5SA 4EPWA 5JJLA 4URUR 1YQTA 3QF4A 3RS5A 5ALRA 3DM5A 2GO7A 1G6OA 3CONA 3SJZA 4GXTA 2AK3A 3DMNA 3L8YA 5ALTA 4BEVA 3MAAC 4II7A 4PSKA 2AXNA 1ZRHA 2F55A 2NZ8A 2Q9CA 2EQBA 3NIBA 1RMQA 1DO2A 1KYTA 5FBLB 2CVFA 5GJVC 5FUXA 1L7PA 2W11A 4YIHA 2B7BA 3QKRB 4DW8A 3QBVA 5FI1B 2AWOA 821PA 1HY3A 4BX0A 1XBTA 2PMDA 1VKJA 4KFRA 3SOPA 2WWGA 4QJ5A 4JBWA 4Y2QA 4DB2A 2FUCA 1TQ6A 3GJ7A 3TUJC 4D4KA 5ALWA 5AM3A 3NH6A 3AVYA 3J7TA 5L3QB 3DO6A 2IYYA 1TU4A 4G0NA 5FL7D 4G1UC 3ZWDA 2AMYA 1AZSC 2MMGA 1XU4A 2ZR7A 4DSOA 2RAPA 5LPNA 4ZPXA 5AJYA 1RJ9B 2C88A 5JRZA 1KO7A 1E9DA 2OM2A 2OAQ1 3HPRA 4I99A 2A9KA 1UJ2A 1PZNA 2OBMA 1R4AA 2O5VA 5ALJA 1COWA 3LO5A 3VMFA 1XCGB 3A36A 1AZTA 1Q91A 5FPSA 2P67A 1RRGA 1GKIA 4CT5A 3MLEA 4IVRA 3RS7A 2QMHA 4XE5A 5FOXA 4TYNA 5G3ZA 4L6CA 2REXB 1W47A 4G5SA 4O25A 1E2DA 2C95A 2GXUA 2QP9X 2O8DA 3OF5A 2FZLA 3QKRA 3GQBA 4UNSA 2Q21A 1CJTC 4LC0A 4UASA 3AKCA 2QZ4A 4FCWA 4HAWA 1RYFA 1MO6A 1QG4A 4PPFA 4M9SA 2HJVA 2YMLA 1SVLA 3H0KA 4C7OB 2ZRIA 4PFSA 5L3QA 2OYCA 1Z07A 4UXHA 1T4GA 4TSFA 4A1FA 3KD3A 4DHEA 3L8EA 4ZDJA 4Y2TA 3OIYA 2QT0A 3R4CA 4FCTA 4G3XA 3VU9B 1US8A 3AM1A 3KQLA 1ZNYA 1XMJA 2Z5FA 1VG0B 1ZUNB 3RRZA 3SYKA 2HT6A 1MR3F 3EAQA 3W34A 1Z6YA 2MSEB 2X2FA 2VHUA 4WZ6A 1YZQA 4ESVA 2PQ0A 5DHFA 3KQKA 1KI3A 1OH7A 5BN4A 3OAAD 4TL9A 3BXZA 4IVQA 4WIAA 4LBYA 1J7KA 1MABB 2FEAA 2GCOB 3PV0A 4O0MA 3LD9A 4C0QC 3WK5A 2ZRJA 1P9RA 3CPJB 4HB4A 2YY6A 4ZCIA 4AS3A 2ZE5A 2DWPA 4GP6A 1L4UA 1JPJA 3QY0A 4M1KA 1JR3D 4GBMA 5DYIA 2FFHA 2W00A 4CF4A 5HZHA 5B64A 2FFBA 2FSIA 1Z4LA 1G291 1HUQA 1EFUA 3QX7A 4RD3A 3HR7A 1R8QA 3P1JA 4AI6A 4P33A 3UWKA 4BNDB 2OSBA 1YMQA 4F4IA 2IHBA 1US8B 1FW6A 4DVGA 4RESA 4A0RA 4I1VA 4UNPA 4CRWB 3UG6A 1Q1EA 3NXSA 2QBYA 1E79D 4EX6A 3QNMA 1JECA 1P62B 1JAIA 3NBXX 4QC2A 3QJYA 4XTCS 1ESNA 5JWOA 3QNUA 1DAFA 1RRCA 4BRUA 2FPKA 4CT4B 2A5YB 2R65A 2ZE7A 4HDQB 4DDWA 5AI9A 1SVIA 4G01B 3H84A 2HDOA 1W5TA 2V1XA 2QMUA 3IUYA 1S1CA 4Q1BA 3TJZA 1I2DA 5AUQA 4A4DA 1F2UA 2AL7A 4BKMA 1XJQA 2IWRA 4JBXA 4RCYA 1JPNA 3NC1C 3L8HA 1NN5A 2FSGA 1CRQA 2KJQA 1U99A 1RMTA 4JLMA 4DWJA 3FMIA 2ONJA 3PFIA 4N3NA 4M1SA 1NMXA 1XEWX 3GJ3A 1ZM7A 3ZWKA 4BFTA 2X77A 4E07A 3AVWA 1P5ZB 4IXMA 2C2HA 2IYWA 4QL3A 3I3SR 5JZVA 5FTMA 3QKSA 4Q18A 5AW7A 2J0QA 3RS0A 3KTAA 5SZJA 3LVQE 1CQZA 4ASUD 2WF7A 4HB0A 1D2NA 2AK2A 2G0NA 1Z4PX 4DLXA 3Q5EA 4HGNA 2WOOA 2WV9A 3M0EA 3CBQA 3LW7A 1T0JB 2JIZA 2WBLC 2QAGA 1CR6A 1W2HA 2B1QA 4LHXA 5DLQC 4C4TA 1P60A 1II0A 3OCXA 4DJTA 1CP2A 4F92B 5IK2D 1N5JA 1AS3A 3ET5A 4KV9A 3ZIAD 1P7CA 1N6NA 4D81A 2AD5A 2NG1A 3QPVA 4DLVA 3M4YA 4B71A 5AVUA 1Z2CA 1Z47A 3N8GA 4UKDA 2PMKA 3KC2A 2Q3HA 3UMSA 2VH5R 4DT1A 3HYCA 2QUZA 1W0JA 4DLWA 3DV9A 5ALXA 4BX2A 4C4RA 4HAZA 4BLRA 3TUZC 1XD8A 4L4UA 4PQFA 1S9HA 2QLTA 3AR4A 4JLDA 3LAWA 4OD0A 2XZLA 1QHGA 1HA3A 3WNBA 5HE8A 4HLUA 2ZRHA 2G83A 2IYTA 2F43B 3R20A 4B35A 5L3SB 4Q00A 1Q44A 3TVDA 1MO3A 2WMNB 3X1XA 4LSGA 2LWIA 3CO5A 4LY6A 2GEVA 4XSHA 5HTKA 1ZIPA 4TLCA 4XWOA 5F98A 4QGFA 1E96A 2CFSA 3U7FB 1Q20A 2O0HA 2J5XA 1E2GA 3ONWA 2QAGB 4PAQA 1U02A 2UZ3A 4B44A 1ZW6A 4KU4A 1R0YA 3DL0A 4Q1FA 2L0XA 4A9AA 4HGQA 4EFNA 3UATA 4D4JA 4DUGD 4EX7A 4JDPA 2C98A 3ZVLA 1Q3TA 2B8EA 2O9JA 3KXKA 1OT3A 2ERXA 3OIVA 4NBSA 2FUEA 1LY1A 3L43A 4DCCA 2GCNA 3FFAA 4LPKA 4LHYA 2FOLA 2QGNA 4KJZA 1GILA 3TQFA 2I7DA 1IN6A 4NYJQ 2CN1A 1T3LA 5TY0A 1M7GA 3WK9A 3THYA 1T5LA 2ZRKA 4OHFA 2W6IA 4KLNA 3L0IB 2CEAA 3LWNA 4CEJB 1UADA 4KNVA 3BH0A 5LDDC 1KZ7B 2JJ1D 1TX4B 3F0TA 3NKVA 2RB5A 2V1UA 3DZ8A 2P6NA 3CRW1 4TWZA 2PEZA 4B48A 4LJ8A 3K53A 2NO7A 3L82B 1OFTA 2ZJBA 2CK3A 2LCFA 2R6GA 1ZM9A 3DEFA 5JS7A 1ZD8A 1F5NA 1CXZA 3GJ8A 4QGHA 2WWIA 4Q47A 1ZNXA 1VYVA 2JATA 1XMVA 1TEVA 1KSFX 2GCPA 4PQYA 1RLOA 1GIAA 3TQCA 3CH5A 4D4LA 3MPOA 3AR8A 1U8ZA 4EPTA 4LUCA 1KMHB 1G7CA 2ZANA 1OH5A 2JLWA 5AKHA 2J1LA 1N0WA 4EJSA 4J2TA 4EPRA 3L0CA 2ZBDA 1TF2A 1LV7A 4V0KA 3B9QA 3BFVA 5AVRA 2WWXA 2DQSA 1VCIA 1E32A 2R44A 1FZQA 3WNDA 3SHQA 2NTYC 2DPXA 4HEJA 4S2EA 5K8IA 4JB3A 3B5JA 1U98A 2ZI3A 5ALOA 5FOSA 1OFHA 1YZTA 1GFIA 1G5RA 4LRWA 3AF0A 1AN0A 1OLOA 1U9IC 3C16C 3CB4A 3GD7A 1XD2A 2W6ID 2HEGA 4WXPA 1EFHA 2UKDA 1VYTA 1O3YA 2B7CA 2EVWX 2NQ2C 1HT1E 2WPDA 3MUFA 4BLTA 3OCYA 4QJ4A 5EE1A 4ZV4A 4XVQA 2XEXA 2JLYA 2AWNA 1FX0B 3IGFA 2QPAA 4V0MA 5EE9A 1QH9A 2QPTA 3IQXA 4ZEXA 2JDID 3AP3A 5HE9A 4ZI2A 1GNRA 2YFYA 3UMFA 3TK1A 1KK0A 4JBYA 2NGRA 2WIAA 4ASUA 2HX1A 4C0AC 2F1JA 2JJ8A 4GDFA 2BMDA 4V0NA 1XXHE 4MRPA 1XZQA 4QQFA 5IF9A 1VECA 4DXAA 1Z6GA 2VL7A 1E2HA 3H4MA 5D3MA 2OEPA 5TDHA 3P26A 1SKYE 4NP6A 3SHFA 4GRAA 2EU8A 1U2SA 3BC1A 3BOSA 3LBIA 2FNAA 4KODA 3EA5A 2FE4A 3GFTA 1NG9A 2GAAA 3BE4A 5KHOC 2WKRA 4ITRC 1LB1B 3WBJA 3OEHD 4LBWA 2PZEA 3GP8A 1IXZA 5E0OA 2WJVA 1SXJC 3CZPA 1JQLB 1QHHB 4K81B 3QUSA 5ANRB 3SHWA 5FUWA 3KQUA 3SQWA 2IOHA 1Z0AA 2ZM5A 2YOHA 3DAOA 1ZUIA 4UAVA 3SBDA 3EPJA 1N6IA 5CYPA 3BB3A 1OXSC 2WF9A 5AW0A 4L5BA 4OI0A 3WBKA 5M04A 5ALNA 5FR2A 3AVVA 4E22A 4US0R 2BBOA 3ADCA 4QBFA 4W5WA 3P20A 5SZHB 2XB2A 4KN8A 2QN6A 4WOPA 3RRYA 2CCKA 3BS4A 2A5JA 2ZBEA 2ZRMA 3IHLA 1HQYE 3SBEA 1DG1G 3WMGA 5KNBA 1UFQA 5KSOA 2D2VA 2OA0A 5FI0B 4ARZA 3N07A 5DHAA 3AVOA 4AG5A 2HF7A 3T35A 1E3MA 4AYXA 4D6PA 4FYPA 1VMAA 1CF4A 4F38A 1G18A 4B74A 4NPHA 2F7SA 1NBME 4LK2A 1EESA 4OYHA 3AVQA 2N46A 3L8ZA 4XD7A 3I5YA 3W6NA 5JHHB 1RLTA 1XWIA 5C18A 3U6BA 3EZ7A 1G17A 2IUTA 2GNOA 2GMWA 4JJZA 2MSNA 2WWFA 4AKHA 3P96A 1WMSA 5JJKA 4JMPA 1OYYA 4UXJA 4G9BA 5SZIA 2QP4A 3QUCA 3VR5A 4PO9A 2AD1A 1S96A 3B8HA 1QVAA 4LYJA 3U7HB 1YV9A 2XSZA 3I76A 3E5HA 3T06B 2OLKA 3SNHA 1HT2E 4IJMA 5EE0A 4DBLC 1KGDA 2X8AA 5AESA 4EFLA 2JEOA 4M1YA 1CRPA 2F6RA 3K70C 1EX6A 4C0JA 2OLJA 4QGGA 2O0JA 3IIMA 4XVRA 1LVGA 3ESRA 1W4AA 2GTPA
chains in the Genus database with same CATH superfamily
1PF7E 1NV9A 5HGJA 2JH3A 3EXIA 1VQ1A 3KYBA 5BR7A 3PQ8A 5JTTA 1PFQA 1ZC4A 6ABPA 2J7PA 2DWOA 4GE3A 5H9VA 3F98A 2H1LA 1C9MA 4WZBB 2BR3A 1UF9A 2FWIA 3D3EA 5LN1A 1QX4A 2B34A 3EGDB 4KACA 4KIFA 1WZ2A 4ZD6A 4DG8A 3BGOS 5E6SA 3VSCA 2CUKA 4HG2A 4JP1A 1Z2AA 3AW9A 4NMLA 4G97A 1PQWA 2E55A 5TXGA 3NBAA 4S0XA 5FWDA 3DHWC 5MGNA 4HB2A 3KFLA 4Q1AA 3FCAA 3OKCA 5EKUA 1H8EA 1P1BA 2JLBA 3OEHA 2P3QA 2ZI7A 5LZ2A 2I3ZA 3WZMA 5AUOB 5LBUA 3ASVA 2QF7A 2Z6QA 6Q21A 3ZV7A 1J2RA 1CIVA 4OI4A 5C9ZA 1FCJA 1XZEA 5EJFA 1MP0A 3KU1A 2VYVD 6PFKA 4PC7A 1P81A 1NW5A 5ADUS 2I55A 1R4NA 1ULUA 1JA1A 3F5QA 2G7MC 2ZVQX 4Q0MA 3ZQ6A 1ODLA 1S01A 1RWWA 1Y7HA 1P3Y1 1UBMS 3B3JA 1NY5A 4FHFA 4R0VA 5EKTA 4EGQA 5DH9A 4NJMA 1BJTA 2G1AA 2CLOB 3MGGA 4L50A 3ONFA 1QSGA 4LHVA 3P7MA 4OJYA 1RZ3A 4MGEA 1DMSA 1F20A 1WHTA 2WWTA 4I4TF 4BYGA 4AG3A 4PN7A 3ACBA 4GOOD 2A9FA 4I2VA 4LCJA 1MEOA 2ZTHA 2CLCX 2XVAA 3H9GA 4BZQA 1KKMA 1QP7A 3LDAA 3A6PC 4YREA 2RGYA 4EUSA 4R7ZA 3OOWA 4PYQA 4N7BA 2JAQA 1M6EX 1T29A 3D5QA 3LRPA 4JYPA 1R4MB 5JUWA 1MNAA 1MO2A 1TQHA 1YOVA 1VG1A 3C97A 1ZUNA 4PLFA 4UMVA 4J3NA 3ZXSA 5JEEA 5AKKA 4LE0A 3AUXA 1T36B 4N0QA 2C4KA 2H2FA 1PJBA 1L7BA 2OCBA 2BKVA 1BGXT 2A9RA 2RGEA 5H7XA 3ETHA 3F71A 2OAGA 1RQGA 2SCUB 4HMQA 4J2HA 2D5LA 2FFRA 4Y2XA 3ENVA 1EFRD 1XAIA 5B53A 3QE9Y 3KJZA 1B23P 2PMCA 1OIVA 4E03A 1DJLA 1Q12A 2IFTA 2WKQA 1J4AA 1GNPA 3WFZA 1RMYA 5EI5A 1MRSA 1GVNB 2OENG 4IDNA 4PQEA 4A6XA 4AK9A 4MRMB 3R5KA 4YUZA 5IXJA 3GDOA 1K89A 3BBPA 3DZGA 3I9V6 1VKHA 3RTGA 2BI8A 1T1SA 4Z7QB 5TPZD 1BSVA 2F1IA 2XVYA 4N82A 4C5AA 1Y1QA 2OVFA 2R1TA 4WT7A 3GAAA 2ZBQA 3OTHA 2Z8XA 4ZRMA 5JXJA 1CCWA 4HLDA 2JCGA 5L3VA 2WNHA 4OYYA 4ZMSA 3C3DA 1P6UA 3I4CA 5CJPA 4MW7A 2Q29A 3ZNOA 1HDZA 2OUKA 2Q5IA 4GI7A 2VA8A 4P4LA 5ALFA 1N0UA 4D8VA 1FFSA 5LZ8A 2XJ9A 3ELDA 5DT9A 2JAOA 2HF8A 3VZSA 4KXLA 1UBUS 1JZSA 1DJOA 2P5TB 5FEUA 2RGCA 3LDUA 1NUPA 4EW2A 5K0GA 3KUKA 2RGBA 3BFXA 1F7UA 4ZZ1A 5JS1A 1F6WA 2QVYX 2ZB2A 4FKZA 4WLFA 5IBQA 3KETA 2C4UA 3LUKA 3TVTA 2ZAGA 5HCUA 2OZKA 2PGAA 4J7CA 3WKCA 1UC9A 2R4TA 2AHRA 1I2MA 2P6MA 1I6MA 4NESA 2PUEA 3S6JA 1SXJE 2G25A 2F8SA 2WSMA 4NFSA 5BWCA 4BLOA 4UU0A 4DCMA 1B26A 1ORIA 2IYSA 3IXQA 2FLWA 2G08A 3DNFA 3I92A 3KLNA 3PSHA 4OTZA 5DX1A 4R1TA 2JBAA 1G8PA 3TS1A 4BNMA 5BMVA 5J40A 1CQJB 2X8BA 1NVVQ 1XPJA 2AG1A 4K6FA 1RAHA 1EGQA 4C06A 5IHPA 4EG8A 2C2XA 4MQ6A 1DC8A 4M9QA 4RVDA 1RXCA 3HB0A 1JKIA 1RSZA 1C80A 3I23A 4MW4A 1FU4A 5E1BA 2NT3A 2ZJZA 4ZCSA 4WBNA 3DV2A 1HEYA 4IRMA 1OX4B 1Y1TA 4KDRA 2A2ZA 3NHRA 1TVEA 4JLKA 4NQZA 2BEVA 1A88A 1Z35A 3OTQA 4Q7LA 1EG2A 1JA9A 3UH0A 1VBNA 4XX0A 3ZDFA 1EXMA 1PWEA 3OJXA 1NVAA 1I4TD 1N2GA 2ZRFA 1R9NA 4Z4GA 1I0LA 1I24A 2A1UA 1D6JA 2J67A 3RC8A 2DMRA 1RBZA 2BAGA 2IU6A 1ZIXA 3ZTTA 4L2IB 4DOMA 5EHXA 1CUGA 3HLTA 5AO9A 1RYMA 4JOSA 4RPKA 4BJHB 3Q6MA 3RT9A 1Z6XA 2FEMA 1NRWA 3A14A 3ELYA 3DOHA 4X65B 1Y7PA 3EYWA 4CXMA 2VSXA 1II8B 4G85A 5DM2A 3F67A 3BMCA 2C4MA 3TJRA 1JEOA 3BTSA 3E5NA 5FV4A 3OP1A 2C2MA 1EUDB 4YN3A 4CIDA 2FZGA 2PV7A 3PPYA 3DAPA 3ZK9A 1W88B 4CMAA 4OX9Y 2RGGA 2J3HA 3DMDA 3L0BA 1N2HA 3DMHA 3P32A 4XEUA 1XDZA 1X70A 2EKPA 2Q9AA 4XIYA 1RZVA 3BGDA 4U7HA 5B1IA 2PH1A 2RI0A 4PSVA 4E6EA 1NJFA 1PZMA 1GTL1 2I65A 3FF1A 2DT5A 2J32A 1AKYA 3UWPA 3AJEA 3EGVA 5FOVA 3G6WA 4PZPA 4Y9SA 3KSDO 3MAJA 2Q7XA 2BKAA 1CUBA 2PT5A 2ZR8A 3PNQA 4URYR 5F12A 1NMSA 3BHJA 1R6DA 2WIGA 5D00A 2H6EA 4G26A 1K6EA 1C3OB 4EW1A 2AE1A 3CBGA 4KIJA 4Z9BA 3ZWNA 3ICVA 4PSUA 1D2AA 3LP6A 2NM0A 5GM2A 3OMWA 1CYDA 2NSHA 2O2SA 1N8TA 3LLCA 1ZYUA 1IBKB 3NJRA 2HL6A 4GU5A 3QPAA 3T7AA 3VO2A 1KQ3A 5CFPA 3NAMA 2GCGA 3NH9A 5J5AA 1XMOB 3KYDA 1GZDA 3AIIA 2H17A 3EULA 4FYMA 1SUDA 2AN5A 4H6WA 4QD3A 4W8GA 3D1LA 3ZHRA 1LD3A 1M76A 1YC5A 5TQ2B 4ITVA 4CM1A 1ZCAA 2AVNA 4NF2A 2Q7OE 2GH1A 2FSVA 3N28A 1U80A 2IDMA 4E2WA 1OYWA 2EBWA 4U7DA 2P6RA 2ROQA 1N5KA 1YTUA 4MKHA 4YWJA 4F8JA 2VBFA 3CPEA 3FB4A 2GXSA 4TT8A 2AX4A 3U7QA 4TYMA 1RHQA 4FD3A 5BVGB 3R8CA 2VH1A 4PTLA 2WTUA 4V1CB 3CLSD 1SZPA 2ZTLA 4FMCB 2R1UA 4MI9A 1R0KA 2VRNA 1JIVA 1P0MA 2OV2A 2ZWMA 3R6TA 4WFJA 4YQZA 3RWMB 5AVYA 5C8YA 3J80A 1FYFA 2VSYA 1GG2A 4WN3A 1O77A 4K1LA 1D5WA 2C83A 4F1KA 2FJPA 3MQFA 4OQQA 1H2HA 4UEQA 1SQ6A 3THSA 3KTDA 4M9XA 2RHGB 1W5BA 2PKEA 3DZIA 4NDZA 5CCDA 1Y7IA 4LVNA 2D5IA 2L18A 3H2JA 4MVJH 2Q2WA 4JR2A 4W6ZA 3ERCA 3ONVA 3GMIA 4IQGA 3HCFA 4DADA 3NEJA 4C05A 1K98A 4IDGA 4L0QA 2XCSB 2IPMA 3EZNA 1THMA 2LUOA 2L82A 1XQWA 2JBAB 3QRWA 3KSAC 2J87A 4FI3C 4JP8A 4IQ8A 4KSYA 4IEIA 4KAJA 4MGKR 5IVIA 3TQHA 1HORA 1KDRA 3UG7A 2J3KA 1R5NA 2IYLD 4MDFA 3RVOA 2HRZA 3KKEA 3UB2A 2QM7A 1CT9A 5EA2A 1Q1GA 3PRYA 5JFOA 3P9ZA 1K1EA 2PD6A 3AHIA 2WG0A 2GBIA 3NANA 3R3VA 5I4CA 1QIIA 4UREA 3QITA 3NALA 3L7OA 4GKVA 3P4UA 2NO6A 4D26A 4RD0A 3IUQA 4ZHQA 2Z58A 4D4GA 3FYHA 3ND9A 3P2EA 3N3BC 1A96A 2Q8QA 1CZOA 4ZO7A 1OKKD 3PX2A 4JQZA 3NR2A 4LQDA 2IOQA 1UANA 3E8SA 4QQNA 4DCTA 1C4OA 3CRVA 2A0XA 1JHXA 1HDGO 3EHDA 4I81A 1EFCA 4L1KA 2VF8A 3OCWA 4LMAA 2IH5A 4NK5A 5CEEA 1ZZEA 3RRMA 2ATVA 5CDSA 4LCEA 4YDSA 2V7UA 1S4QA 1QAOA 3GU3A 3P45A 3VFDA 6GPBA 5K99A 2OB2A 4YRIA 3SZLA 2BOVA 3DMPA 3ABSB 4BP9A 4NCXA 4UFNA 4DUGA 1ONPA 1DELA 1O97C 2RJOA 1IZ0A 3BF7A 2H07A 1XTVA 1QRSA 3VU9A 2ZIGA 2JAWA 2QRZA 1JZQA 4O4LF 3TPFA 4BQOA 4EHJA 5JNWA 1WCV1 1N77A 1ZNZA 1A5BB 2EHJA 5E1OA 3RT7A 5C80A 1TA4A 3S4YA 1TB4A 5JAOA 3U7IA 1QUEA 1WQ4A 2OD9A 2TMDA 4IF4A 2QM0A 1PJ3A 5K0EA 3IMGA 2Y67A 5FOWA 5CNIA 4MVJD 1QH1A 4NABA 5HFNA 4BMDA 1N6RA 3IBFA 1VCHA 5T6MA 1E5XA 1W49A 2XVXA 2JZCA 4QOGA 2V0GA 4BNNA 3K70D 1GZ6A 4L51A 1G8HA 1PGNA 5JZ9A 2FFJA 4A8JC 2EX4A 3ZD6A 4BMCA 2WJWA 4BUJA 1Z74A 3KSZO 1W44A 3TD6A 4PICA 2ZUDA 3VC1A 3QI7A 4OU4A 2NUTA 1ZU4A 3SZ3A 3ID6C 5BV0A 1XAGA 4EYKA 2HWYA 2AMJA 4IQFA 4LZJA 3IMFA 2JLQA 1CULC 1VP9A 3HCPA 4DJEC 1U7TA 1QOQB 3NHAA 3RC2A 2REOA 4G07A 1K68A 2EYUA 1VKNA 2IXFA 2R8RA 1NM5C 3HN7A 4R2KA 2JNWA 2UZ1A 2BLNA 2CXOA 4G5QA 3OPYI 4PWYA 1E0AA 3A31A 3FNQA 5IJAA 4DCUA 3PIIA 5JSZB 1MVLA 1B6RA 5H80A 2FPUA 2O57A 3IAHA 4YH1A 2B4AA 2CHVA 3D2CA 4XA8A 2Z2IA 4KSBA 1VXOA 4M86A 4OHVA 4ZEVA 5C4GB 4L85A 1QVVA 1V26A 3AHEA 4U7FA 3V55A 1NQ5A 2IW1A 5WRFA 3BVPA 2ZRCA 3A0UA 1YAHA 3MGCA 4GHWA 4ER0A 4F5YA 3IVXA 2EZTA 1KH3A 5HBGA 2YZGA 4L57A 3IEVA 2HRDA 2Q1YA 1JEEA 1PCXA 3QG1A 4X1OA 4B3TB 1E3QA 4NCJA 1GGNA 2Q6VA 1XP5A 4HR7A 4HD8A 5EG5A 3NOVA 3WB2A 3BBLA 1OVGA 4OSEA 3CLSC 5F7XA 3PVZA 3I61A 4UE3S 2J9FB 2QBYB 3F7TA 2BKXA 5GOTA 5AK0A 3HP1A 4F7WA 1J06A 1GNQA 3HI6A 4G0MA 1GZ5A 4AG6A 5TARA 1CUXA 1Z45A 1Y4DE 1XT6A 2ALJA 3K4HA 9LDBA 3TIFA 3NV7A 2Q1SA 1P6XA 1XHEA 2IPXA 3HA2A 3L05A 4ZYXA 5D1HA 5T67A 5J47A 1JNXX 4Q4AB 5BNIA 1MT0A 4DKJA 3K0FB 4TLDA 4WKCA 1PQUA 4EI2A 1YDFA 2WB4A 3SXJA 2JEZA 2YUIA 3EY9A 3UXHA 3A0RB 3SM3A 2WAYA 3R8XA 4XGKA 5A5DA 1VHJA 1IU9A 5ADHA 3UQYS 4QREA 2Z4RA 1ZR2A 4WUTA 4FFOA 3M2PA 3WYDA 2WHPB 2ZXEA 1C9KA 3V8MA 3ISVA 1DXYA 4XUEA 3QVMA 4Q12A 5I7WA 4TXNA 4ZO8A 2HK7A 3RAEC 4KEAA 1CFZA 3LG2A 3LY9A 5F78A 2FRDA 2XCTB 2XSZD 4P3YA 4GPTA 1SQGA 1MAAA 2JI7A 3DG9A 3IEUA 5EFOA 3SMVA 1W36B 1H0HA 3TEMA 5HF6A 4PGGA 4U2CA 3TKLA 4NCKA 1T5TA 4FNGA 4NVRA 1ENYA 2N3ZA 2G9ZA 2W70A 4FOLA 3GLGA 4EABA 3RVLA 4MVJF 4J9UE 2P8SA 1Q0HA 1WSWA 4ENTA 3K6KA 1I14A 2OHFA 1T9HA 1ES9A 3IJRA 4FDTA 4C43A 3OEEA 4X63A 3V42A 2PCLA 4UTNA 1V1RB 1ZG3A 3PNOA 5AK4A 3VU8A 3AL3A 5G0TA 3P19A 4FQ7A 4JXKA 2XHEA 4K9MA 2X0IA 3CLTD 1T8PA 4PLZA 4R81A 5LP6B 5J2UA 4BY9E 1XVUA 2QG9A 3LVBA 2G1PA 2Q2NA 2XVMA 4TGLA 1PLKA 1F0NA 1Q57A 4OHMA 1NPDA 5GM1A 3P9XA 3DTYA 2PYIA 2KI5A 3CLUD 4RVSA 2G9NA 1DQPA 1LFDB 3TRJA 5BR4A 4E5YA 2DYKA 1SU6A 5FBZA 3QHQA 3IA2A 3MW8A 1X1BA 3CZ5A 2C5LA 4EVSA 4G1CA 1N6OA 2WU8A 4D7AA 1GNSA 2BJVA 1HTBA 3GJ4A 3HXPA 5A3QA 1T2UA 2EJWA 3UMBA 1UEJA 3FDXA 2VP4A 4RHFA 5JVDF 1XCPA 1G4AE 2GYVA 2WUFA 3A9SA 3ZTYA 3QU9A 3F5DA 3AVUA 3B1VA 4R9RA 4UTRA 1P1IA 2A9JA 3H3XA 4TLEA 5EWMB 5IJ9A 1HNXB 2O2GA 2FRVA 1Q0LA 2C9YA 4MVYA 3HCRA 3QU7A 1GG8A 1GSIA 1I5OA 3CWQA 4WBNF 4MXDA 1ZONA 4X54A 1DCKA 3GFOA 3BE5A 4TTAA 4B0PA 1JW9B 5JDIC 3VKFA 1H85A 1XMSA 4TV9B 3C3CA 3TM4A 2N42A 2JAXA 5C3MA 3I42A 5DTJA 2C99A 3OHSX 4L5YA 1C8VB 1ORWA 2ZB3A 4JN6B 4K28A 4B6EA 1AO0A 3LO8A 1TYAE 2LXNA 5DK4A 2XE8A 3S44A 3QYAA 4AMYA 2X1LA 1BH2A 3UTDA 1QCZA 3OQPA 3C3MA 3PFKA 3P9PA 4DQDA 5DI3B 5I5EA 3H9QA 3D6FA 4K5QA 4H9GA 1L4NA 4GBJA 3IUMA 4RVUA 3MS4A 3F6PA 2GF2A 4RJLA 1GQSA 4HNTA 2CJPA 3HM9A 2QK4A 4K2HA 4P2GA 2Q4TA 4YXWD 4L16A 1U3FA 3FWNA 4P4GA 3T1OA 3RJZA 2R96A 1O95A 4WOJA 2CJWB 3VISA 4B4WA 5I9IA 1XD2B 5LB4A 1N75A 1CTQA 2ZBPA 4FHCA 3E9ZA 4INOA 3ZIAA 4ALMA 1T4MA 1T5OA 3QLUA 3WGZA 1CUYA 4TVOA 2GS9A 1EXDA 3HZZA 5E1MA 2MSDB 3RAGA 1I9GA 3TBFA 1GQYA 1NFQA 2AOUB 3SQXA 4KO8A 4PG5A 1OROA 3IVMA 4INPA 2PTHA 3ORQA 1H8HD 2E4WA 3C6ZA 3RO7A 2WSSA 1WB9A 2Z5LA 3V8EA 3ABZA 5CK4A 1G66A 1UZUA 3MA0A 1BQ4A 4WCFC 3UT5B 1ZNQO 3Q7PA 3VO9A 4CEIB 3ZZTA 4F9TA 2GUGA 1K63A 3N2YA 4FOOA 2ZUWA 2JHPA 1CERA 3DLAA 3H11A 1XPRA 5C81A 1PR2A 3AB3A 4UBMA 2AJDA 5FA8A 5F4BA 5CBKA 3KEQA 4LV6A 4AY2A 2QTRA 5KNCH 2N1BA 5FBWB 3NHBA 1J09A 4DBVO 2VPWA 1K97A 3H5IA 1P18A 4BQNA 2XQVA 3KT0A 1R10A 3SSNA 3DO8A 1T34A 1IHDA 3DMRA 1TAUA 2IXBA 4C7JA 4TZ6A 3L0YA 3KQQA 5L3ZA 2ID7A 3NM4A 5EJGA 5BXQC 4JQYA 4WJZA 1KTVA 2TS1A 2ODBA 4N01A 4AN1A 4MIKA 4PZCA 1U7OA 1XUOA 2NXWA 5FTLA 1X7YB 2HOQA 3ZV4A 1XZIA 4YMUA 2XADA 1M1XB 3JZAA 4UTOA 1WA5A 3B9BA 2NPFA 1EXNA 4KL8S 3ZU2A 2B98A 1S9DA 3MRTA 2OQVA 3UAOA 1UBEA 2IP1A 3DE5X 3URMA 3WRYC 5BW4A 5EJAA 3ZLBA 2DLCX 1DOHA 5KO2A 2A5GA 2HMWA 1H1LA 2FLVA 1AQLA 4G0XA 1XRQA 4ZI7A 4LXXA 1ZH8A 1CUEA 3FX2A 1KZHA 5AVQA 4JUFA 4NIMA 5IPFA 1VMDA 1YA8A 3EW7A 2O7NA 4YO8A 2Y1WA 1ZBDA 3OC0A 3R5HA 1PV4A 1I4WA 1PWHA 3VKGA 5DPMA 3GFGA 5BNTA 1U28A 2RHHA 5KKAA 2XYVA 1KQNA 3PIRA 4B7XA 2L19A 2W6OA 3K4PA 4N5HX 1V8BA 4AJ9A 3OQJA 3ROPA 3S27A 4I9NA 2PU7A 4DM4A 1PNOA 1ZWKA 4GEGA 4H1VA 4OXXA 2ST1A 2O14A 1NNI1 4JJKA 5EUMA 4FB5A 5JS8A 4XJVA 4CTNA 4Y1RB 5ALKA 3IP3A 4ZO4A 4BWYA 5IHXA 3MGAA 1ISSA 1D2GA 1KKLA 1ZUHA 3KJFA 4IIJB 4KO2S 5JDCC 2HFKA 1HE5A 4G4SO 1DG9A 1UQTA 2NYVA 4KE6A 3Q7QA 4M0PA 4UMEA 1WXDA 1XQXA 1ZD1A 2QT9A 2I34A 3CLHA 3JYOA 3TBHA 4D9GA 1I3OA 4AS1A 3CRQA 4MEJA 5CDYA 4NE9A 2Z09A 3TG8A 2H7YA 3AEZA 3EIQA 4RMGA 4L5AA 4W7HA 3G7SA 3JYQA 3HCDA 4MJLA 1BNCA 2OORC 3NAZA 4QAQA 2DB3A 4UHEA 3ZE8A 3REGA 2JCYA 3FHJA 1KAMA 1W1IA 2VKQA 4AO6A 1B8NA 1G5QA 4D41A 3K2BA 3G0OA 3T5MA 3NBFA 2D59A 4XFDA 3ZJ4A 1M6VB 4QBGB 4KBGA 4J0EA 3F4KA 3D1JA 4G1VA 2XOKA 1YRQA 3WYBA 3ND5A 4XQ0A 4GZ5A 1IQUA 2RGNA 4EY7A 3FPAA 4YJKA 5MN6A 2ZYIA 5C34B 3JRNA 1KEKA 3GLHB 2ZXUA 3FM9A 4GSKA 5E8RA 4C0WA 3LCMA 3VZCA 4BPRA 2PA3A 3SLRA 4ZOQI 2GETA 4Y9DA 3D8NA 3OPYB 4RD6A 3Q3GE 4FCCA 3SHVA 5FWAA 2GESA 3H18A 5BWNA 3FA2A 3GLHE 1EJ6A 3K0CA 1SBHA 2C0QA 2ZPUA 3IKMB 3T1NA 3U3XA 5K2OA 3M4JA 2QLFA 2RI1A 1BYIA 3UJNA 2EIXA 3NNNA 1Z0IA 2WYUA 2CLLB 2PZFA 2I8LA 4IZIA 3FOZA 3K0AA 1BHQ1 1Z4MA 3I9LA 3UIEA 5IS2A 1U8CB 1NUSA 5IZCA 3U1TA 5MN4A 5P8WA 4AZVA 3BFJA 3L6UA 3T7KA 1SBNE 1OWMA 1V3QE 1DAEA 1RPJA 1V8ZA 2EFDB 1HDRA 1Y7LA 1X92A 4IKOA 4ZK6A 1ESCA 1HL3A 3NW9A 5ES4B 5G0WA 2R0QC 3IIKA 3LECA 5CFMA 4G09A 3RFUA 4DGQA 1NW9B 1HE8B 4P0QB 3I5MA 3IHKA 1WV1A 4CLHA 1K8ZB 3K5PA 2PIAA 2Z2JA 3FKSA 3OH8A 4A27A 2VSNA 1L5FA 4HXGA 1XN4A 3W5CA 1MMFB 3BWVA 3DDOA 3DP7A 3VYSB 4QDJA 3CF6R 3FOEC 1JEYA 5F9HA 1GM5A 3DXYA 1WP4A 2C3UA 3B60A 3JQ8A 1ZN7A 2H5JA 3HO6A 1Z3IX 1JR3E 4HWKA 3H9BA 1FUYB 2QU8A 5DYNA 2XITA 1TA0A 4F3RA 4LV8B 3HVJA 2A1IA 4F86A 3A28A 4M1TA 1E1MA 1BKYA 1YWGO 2OZPA 4C0BA 3GELA 4J0JA 1THTA 1OTYA 3HLYA 3N2ZB 1Z9BA 4PYRA 4AWXA 3HZRA 3G5UA 1YKGA 3RCBA 4A3SA 4DJDC 1Y8QA 1EK1A 1X42A 3FRJA 4EB6A 4UHKA 3T3IA 4MZDA 4LDRA 2HIAA 2AG0A 2JIRA 1RR6A 3HUTA 2Z83A 3HWWA 2GM5A 3ADKA 4AO7A 5CEJA 1AKRA 4H08A 3KR2A 1OH8A 4Q7KA 2ECFA 3EGEA 1YCHA 3OA0A 3WL4A 2V7PA 3Q8MA 1S0UA 1VHQA 4ARIA 1Y3FE 2HQRA 2WJAA 2XVZA 7REQA 1BKSB 1FUIA 2AOTA 1CJSA 3HDQA 2CUTA 4MITA 4WGGA 3U56A 3JR3A 3FGNA 4CTOA 2DWQA 1DE0A 1X1QA 2WZDA 3VXKA 4LZZA 2CCJA 2WU1A 2ZAMA 1PJAA 3I58A 2BMWA 3AR3A 1MD9A 4LSWA 5F7ZA 1XEWY 2HLDA 3IP1A 1JU3A 1PN3A 4KN5A 3PK0A 1FVFA 2D74A 2GN8A 3L6OO 1T3HA 2V5UA 1K5DA 3B3QA 3QKTA 4P53A 2WKPA 3QLUC 2XAUA 2ZVJA 2GEJA 3R77A 5ED4A 1JDZA 4XLTA 4FMDB 3V7WA 4RA6A 4J3FA 4KWIA 1EP2B 1CFJA 2XDQA 3RKUA 4DDTA 1XXLA 2W9XA 3LFHA 5JLAA 5TMEA 3OQNA 4ZN6A 3JPWA 1B7GO 3TGPA 4Q3LA 3UGKA 2KW5A 4DLYA 1L7OA 4N9QA 4OHPA 2FN3A 4X8MA 3MHPA 2O0KA 3SXUA 4D4MA 1OQAA 4CN9A 3N5KA 1LW7A 4XOIA 4BO9A 3T3NA 3DE4X 3ZOKA 2ZUTA 3DZCA 5JNVA 1N78A 3OO0A 4KQIA 1UK8A 4CQLB 2QXUA 4Q4LA 5IEBA 3T1YB 4WD3A 1YS4A 1A4RA 2PKQO 2VDQB 3KYJB 1Z17A 1OAOC 1C8BA 4WLEA 4XPZA 5D8DA 3ZGYA 4ZT4A 4QU8A 3HVRA 1SCKA 4RH0A 2Q3LA 4NZPA 5JVDA 4M99A 1EVKA 1BOOA 3AR2A 3O8RA 1IY9A 1B0PA 2PLWA 4KWEA 4TVKA 3K9WA 1M10A 1KY3A 1U4SA 2CZGA 4GFDA 4MA0A 3R5SA 4V0OA 4X92A 3HYSA 3UJ9A 1II8A 3DS8A 3PR1A 1LV8A 3AF2A 3GH1A 5IAGA 5KNDA 3Q7IA 1DQYA 3PQ6A 5IJ0B 1Q16A 3EFHA 3ICWA 2NO9A 3V4LA 1BE6A 3D7RA 3TIIA 3VOAA 4XYBA 1EFAA 4IEFB 4TUYB 3O38A 4S0ZA 1SVWA 1PLJA 2FPIA 2QX4A 3TNFA 4HDMA 5ALVA 4JYAB 3VH4A 2BCEA 3TQSA 2ZEJA 3MBOA 3PRKE 4NBNA 1C7IA 1ZH0A 1P2DA 1R5OA 3CF0A 1U3CA 3K09C 3PNMA 3W3AH 1YGPA 3UM9A 2YJ4A 2WT8A 5KMGB 1JBKA 3C5EA 3W79A 3UICA 3FLAA 3VYVA 4BMSA 3DOEA 2Q0XA 2R7KA 5DI3A 3D8BA 1OGJA 2OD7A 1D2MA 3EPRA 4A10A 2QTLA 3MQ2A 3ZJ5A 3HM2A 4MROA 5GMOA 4UPDA 5BR1A 5KWIA 1ML3A 1HZZA 2FXIA 2EBHX 3EISA 4XB1A 2HRQA 2RB4A 3IUJA 1H3FA 5SYAA 3SJAA 1KERA 2C9CA 1V25A 4MPRA 1U2PA 3BB4A 3OHPA 4DV5B 2YHSA 3JVDA 2WYHA 4FDAA 3X2FA 2QY9A 3CX6A 2YXLA 4KPYA 3K6SA 2GO1A 1P4RA 1G64A 1PT5A 2AEFA 2IK8A 2Q2VA 3B12A 3PDCA 4H3VA 3EEIA 4EEZA 1OXVA 3UNXA 3BTOA 1NBIA 1G98A 1T5HX 1JEYB 2PGLA 1PLLA 3CEHA 3DULA 4B9EA 4MDYA 4B3DA 2QTZA 6REQA 3R3SA 4BNWA 1UBRS 3QV1A 5IVKA 4M6WB 2ZIXB 2QD2A 4GS5A 4LQ4A 1NT2A 4LJYA 4D0NA 2XNCA 1TJYA 5E2AA 1E1RA 4LK3A 4UATA 2C8KA 3IAEA 4MW5A 4Q02A 1Q3HA 3SEQA 3M6LA 2PLFA 4EY6A 1I4DD 4Z3OA 1G63A 3ANXA 4Q1VA 1QP0A 4RJJA 1MZPA 5JCJA 2XW6A 4LVCA 3QPCA 3AFIA 3B13B 1KK1A 2VVTA 3C5VA 4NOLA 2NUAB 3RJTA 2B0CA 5J5VA 3VPGA 2AEMA 3WKEA 3K0AB