1RRCA

T4 polynucleotide kinase bound to 5'-gtc-3' ssdna
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
288
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
molecule keywords 5'-D(*GP*TP*C)-3'
molecule tags Transferase/dna
source organism Enterobacteria phage t4
total genus 94
structure length 288
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrcA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rrcA02
3ZS8A 1IONA 1OFTA 2D7CA 3QYPA 3ZUPA 3ICQB 4JSYA 4GMDA 1DAGA 3QKSB 4L8GA 1E0AA 3K0EA 4P31A 1RMYA 4PO8A 1AN0A 3GJ8A 3SBEA 2C9CA 3LXXA 3EC2A 2WOJA 3WKDA 1Z83A 2JDIA 2HF2A 1NN0A 2CJWB 5K8IA 2CL6X 1ODFA 2GJSA 4TYQA 2ZYTX 4TT3A 4Q47A 3KKOA 3FB4A 4BFSA 3UM9A 4MKFA 3AQ4A 4U00A 1FEZA 2XSZA 2D74A 4P3YA 1XZPA 3RS5A 5FPTA 4YGYA 4A15A 1KK0A 1F2TA 2HOQA 3R8CA 4FIDA 2QROA 4NL4H 1RVDA 4Q02A 1NBMD 1NN3A 5KSPA 1NNLA 5C2JB 1CJMA 1ZOLA 1D9XA 4LV8B 2GBLA 3UWOA 1N6NA 3EPRA 3OCVA 1KYIA 1G7SA 4PFSA 2GVDC 5JMTA 4YC7A 1QG2A 4NTZA 5CK5A 3QU7A 4XIGS 1LB1B 3KC2A 4UXIA 2ZSEA 4AS2A 1G3RA 4FINA 1FMJA 1CBUA 1NNEA 3SN6A 2YWFA 4CF5A 2R8RA 1RRFA 3PVSA 1RE0A 4TL9A 3U3JA 1L4YA 3UMFA 3WNBA 5FBRB 1SVMA 3L8EA 3JZMA 2X4DA 3W8NA 3C8UA 2PEZA 3QNUA 3P1JA 3TAHA 4FFDA 1JR3E 2GJ9A 1BYIA 2UKDA 1OIXA 1Z47A 3X1DA 3QQ5A 2ZJAA 4DWOA 1DEKA 4HYYA 2A2ZA 5TMPA 2BJVA 1AIPA 1XPRA 4ZKEA 1NRWA 1W4CA 1U9IA 2J9RA 3ZVRA 4YMTA 1Z06A 2GZHA 4G9BA 3QKSA 1DTSA 1E2DA 3FGOA 3BFXA 2HF9A 4DLVA 1BMFD 2J3EA 4YMSA 1TQDA 2C9MA 5DYIA 3ZYCA 4ZDIA 5AVRA 3N8GA 1OKKA 2ZM5A 3NHAA 3I1YA 2BKUA 2YZ2A 2V54A 1Z0DA 2ZAOA 1E79A 3LQRA 4EPYA 3K0AB 4JSTA 4Q48A 2CJWA 2O52A 4TQ9A 4HZUA 3P32A 1G4UR 2VHCA 2J0VA 4FCVA 1Z29A 2VF7A 3TMKA 1WMSA 5F98A 1ZD4A 2XITA 3OFNA 1Z22A 1KTVA 4QFMA 1M6NA 4IVPA 2F9MA 3AGPA 2RAVA 1R0WA 2RB4A 1E2IA 4Y2JA 4RVCA 2NG1A 3A4MA 4WIAA 3A58B 1OHHD 3IHLA 4TMKA 1R0XA 1Z6AA 2CDNA 3AF4A 2DBYA 1DAKA 4NZYA 2AGVA 2AK3A 2WF7A 5AHXA 2O0JA 2V8OA 2JGAA 4GXTA 2NZ8A 3K1JA 4WZAE 4BFXA 2NTYC 3G5UA 3CH5A 1EX6A 5EE1A 4R71A 1U2TA 4KYTA 2WKRA 2PT7A 4C30A 1KAOA 1UAAA 4GOKA 1KIMA 4EELA 3QX7A 3RSOA 5SZKB 2WWYA 1QHYA 1KAGA 3KJGA 4G5RA 2B8EA 1TE2A 4QBHA 1JJVA 5ALUA 4QBGB 2FDCA 4Q1CA 2HLDD 5JI3E 1OV4A 2QORA 2C8VA 1K5DA 1WRBA 4NYMQ 4XWKA 2E87A 4J2TA 1XEFA 5JWOA 3W5CA 3GFPA 1KSFX 4IDNA 1FNMA 1NN5A 1GRQA 4NKRA 4OHWA 3AVOA 4OD0A 4M1KA 1DAHA 5CB6A 1Z08A 4DDVA 3HPRA 3M6AA 2CCJA 1FL9A 2DR3A 2JJ1A 4CEIA 3KQKA 3VKWA 1MT0A 3A1DA 1HQYE 2Q4TA 3L8ZA 3ZTYA 2IC5A 2P3SA 4Q4HB 5LB4A 3K0AA 4ZO4A 2FX3A 3RAPR 5A4JA 2QQ0A 3EIQA 3PUWA 4PPNA 3RHFA 2ATVA 3MPOA 2G09A 5FOVA 1FTNA 4E03A 1NL3A 2OBBA 1UDWA 3LNCA 3ZWKA 5CDFA 3GPLA 3B1XA 4DVGA 1G5PA 4P4SA 4LYHA 3DZ8A 1F5SA 2WPDA 2QT1A 1LVGA 2VA8A 3OAAD 1G8GA 2QQEA 1G291 4KHZA 1M8PA 3ED5A 1G3UA 1E2JA 1P2UA 5FOTA 2H57A 3R20A 1WE2A 4RFSB 1DPFA 2RGAA 2V7QD 3MFYA 4UU0A 2PBRA 1SKYE 3LA6A 4DHEA 3MN1A 1OFHA 2GAOA 2ZVPX 5CLLA 5JEDA 1S8OA 5LD2C 1LS6A 1GKUB 3HU1A 4P4TA 4A0FA 5G3ZA 1EFRA 1HH4A 1GSIA 2R8YA 4M9ZA 1XPOA 4ZEVA 4MKIA 2WKPA 1N5IA 4BQSA 4Y2QA 3ND8A 4TQUS 1Z4OA 1E2KA 1J70A 1YZTA 3KXLA 1XNJA 2J59A 3IBYA 4A92A 1T0HB 4LC0A 5A5GA 4PO1A 4AYWA 4ZEWA 3C4JA 3U26A 3DM5A 2AUTA 4PSVA 1G3QA 2ZRMA 2IS6A 1HTWA 1LTQA 4ERNA 1G18A 3VR4A 2DFKB 2IXEA 5KSOA 2DHRA 4C7OA 5ALDA 2ZSBA 4CZ2A 3ZU6A 3BS4A 3RVBA 2ANCA 1XDBA 4DDWA 4C2UA 1N2CE 4F4CA 1JUDA 2QLTA 2GJ8A 1II8A 2QG6A 4HDOB 5FUWA 4KNVA 2YJ4A 4O8CA 4M1WA 4AG5A 2GVZC 5FTMA 2WTUA 5AVUA 4L6CA 5FTNA 4JJZA 2W2TA 3GJ4A 4G1UC 4O3MA 3R9KA 1VYUA 4PSAA 1JECA 1V5WA 2RGEA 3MMPA 1OW3B 2FSFA 3KQUA 1OJLA 3D7MA 1UBEA 2D7DA 3IPYA 3TJZA 2V4ZA 2PCLA 2GJKA 3CRQA 2BBWA 3DHWC 2OG2A 4V02A 5A3SA 3IEVA 4A0GA 3FVVA 3CRVA 3ZIAA 3QOFA 3ZI4A 2W4MA 2VP4A 3SYLA 1A82A 4FYPA 1HT2E 4AP9A 3L8FA 1E2QA 3V4RA 5L3QA 3NHBA 2G88A 4IKEA 4US0R 2YY6A 1X6VA 4PC7A 1DBSA 4ZEXA 2J7PA 2JLXA 3EIEA 2QMEA 1F48A 1Q3TA 3F3YA 3O8BA 3SJAA 2AHOA 4B48A 1TU3A 1Z3IX 4MGYR 4LYJA 4IJMA 4M4SA 3GLIA 5L3RA 3TLMA 1E94E 4GZMA 3B85A 3TIFA 3ET4A 1G21E 1E1QD 2GF0A 5AI8A 2W6IA 4JKYA 1E9FA 1NSTA 3DKVA 5AR1A 5FI1B 1KI9A 4JLPA 4L5BA 4A9AA 1FUKA 2DB3A 3CIOA 2FEOA 2CHGA 2C78A 2WJHA 3SLRA 4KLNA 3UMBA 4ILEA 4R2IA 4D4MA 1JR6A 2WMOB 3B1WA 3WKBA 2BVNA 1RZ3A 1TF2A 4LHZA 2NO0A 1XMIA 2IXGA 2HF8A 2RB5A 3QU2A 1T5TA 2AN9A 1TL7C 1W47A 3MUFA 5G3YA 2AXPA 4Y2UA 3SHWA 4EFLA 3PITA 3X1ZA 4D81A 4NV0A 2O8CA 1GZSA 4QGHA 3RS2A 3N5CA 2OFWA 2I6XA 4M21A 2ZEJA 2D06A 4LPSA 4AKHA 1P60A 2RH5A 4QHYA 2FJUA 1X8JA 4Y0AA 2QY9A 2Q0HA 2ZR0A 2DWOA 2YFYA 2ZBDA 4HGPA 3I8SA 1W36D 1MKYA 4UXJA 3IILA 2FN4A 3L0SA 4UKDA 1ZRNA 3GLHA 4LBZA 1HQCA 2OBNA 3UKDA 4DCSA 1D2EA 2WWHA 3IB6A 5ALWA 3QPWA 3K70D 2J45A 4JL6A 4EFMA 5EP4A 2GA8A 4DLXA 1Z6YA 5G40A 5AW9A 1YKSA 2OBMA 3D31A 3N70A 2HUPA 3H84A 4A2PA 2QPOA 4CE6A 1AQUA 1L8LA 4D25A 2P6UA 3MWJA 4CT4B 5IT0A 4GMXA 1XJ0A 3PUZA 1AQYA 4LHWA 2YKGA 3AR9A 4JLNA 4V0OA 3SOPA 4ZCLA 3EASA 3CZPA 2IOFA 2QUZA 2BHRA 3F8TA 1QRAA 5J5CA 5IDVA 1S0UA 3DDCA 4HGQA 3NBZC 2W6JD 3BOSA 5KNDA 1XVIA 1AS2A 2QU8A 3TQFA 1LFDB 3VMFA 2C77A 4HUQA 3UPUA 2RGGA 3WP1B 1G3MA 2Q9BA 2NO7A 3V9PA 3U4QB 3CF0A 5FL7D 3AVPA 3THXB 1KO1A 2GTPA 1D5CA 3EZ9A 3W3AA 4PHTA 2VP0A 4QNMA 2F1RA 1ZM7A 5J47A 5JJLA 2ZBEA 1ZAKA 1Q44A 4ZDJA 4EZEA 5JSZB 1L2TA 3QKRB 1IQPA 2XZPA 1RDFA 4KFTA 3IBGA 3ADCA 3X1XA 4DB2A 1WQ1R 2GAAA 1F6BA 1FNNA 3GJ0A 4II7A 2OHFA 3KJIA 1OIWA 4JLVA 2Y8EA 4JBWA 4D82A 3FPSA 5JHGB 1EWQA 3QXHA 4BEWA 2J0UA 3FKSA 1E9BA 4IEIA 1O03A 1DO2A 4TMZA 3I5YA 1SHKA 3VNVA 3BB3A 3WK5A 3B8HA 4YLGA 5H70A 2V6IA 2CCGA 3THOA 2JLRA 4OI0A 4A8JC 4UMDA 2JGNA 4ZKDA 1CRQA 4PZYA 3SYNA 3SS8A 4DUGA 4F71A 1RYFA 3I4LA 8OHMA 3GLGE 4M53A 1RKVA 3X1YA 4IOLA 2UZ3A 2ZS7A 3PCRB 3N1UA 1P2SA 2VP2A 2O8BA 3JVUA 3E8MA 2X19A 3ADKA 3ECCA 1KJYA 4IDHA 4ACAA 2FA9A 2NMVA 4HAYA 1X42A 2ZI7A 4FW9A 5L3SA 2ZXEA 4OK6A 4RCZA 3NIWA 2H18A 4W9MC 5FOWA 1N5JA 3A8TA 5AVXA 1ZM4A 2HXYA 3RS3A 3TR5A 5KUTA 3FE2A 2VHUA 3PEYA 3NBYC 5F2EA 1W48A 4BLPA 5DI3B 4DDUA 1GWNA 3A1UA 4XH9B 3GCGA 4B32A 3C14C 2O2XA 3OEED 4LCBA 3T61A 4NONA 5JLJA 5SZIA 1G4AE 5AM1A 5IK2A 3VKHA 5ALSA 3GJ6A 4BNDA 2MMCA 1GP2A 4Q00A 3ZQ6A 2VKQA 2CFTA 4UMEA 1NMZA 2XOKA 2HEGA 5JSZA 4M1OA 2YJ3A 3QKRA 2X2EA 4LJ5A 2QNRA 2LKCA 2GK7A 4QHTA 2X77A 3RRNA 2GRJA 1JEEA 1KMHA 2GEUA 4HAZA 3ZJYA 3U7HB 4N3NA 4ABYA 1SWWA 2CL0X 1CU1A 1NY6A 1XTSA 5DN6A 2ONKA 4D26A 2RGNC 5AIAA 3L1UA 2WSMA 2JLWA 2F6RA 2BDTA 1D9ZA 3HU2A 1BO6A 3CWQA 4Z8XA 2CK3A 3AVYA 1A4RA 2GESA 3ZQJA 2ORIA 3VTKA 1E9EA 2ZRAA 1EFHA 2OXCA 4DXAA 1VFPA 1KNQA 4E88A 1QF9A 3ZVMA 3GYGA 3L0YA 5ALOA 4UAVA 1WDTA 3IIMA 2FG5A 4OBEA 3CF6R 1L8OA 2OCPA 5K8LA 5BN5A 2AH5A 1RRPA 3ASYA 3VR1A 3W9YA 3CNHA 1ZUIA 4PNHA 2IYUA 3ZD6A 4NWIA 1Z4LA 1AA9A 1KDPA 1QVAA 2OLJA 3I3SR 4HB0A 2B8JA 2P11A 2G0TA 4FWTA 3RRYA 1FZQA 1SULA 4XTCS 4KYIB 3QG1A 3CKLA 3ND9A 1JALA 1N6LA 3R9IA 4HB3A 3G82C 3UK6A 4B75A 3A37A 3HLTA 3MMZA 1HY3A 2I4IA 3W5AA 1SXJC 3CBQA 2CFRA 2ZYWX 2R65A 4QJ3A 2JCSA 1II9A 1Q22A 2REXB 4WZBE 2BBTA 3BB4A 3LY5A 4G5OA 2G06A 2ZUCA 3K9HA 5AVSA 3K8YA 1L7VC 2ZRKA 2C98A 1Q1EA 1PLJA 2ZAMA 3EW9A 121PA 2W0SA 4HAUA 5CJPA 1I2MA 1ZS9A 3FHTA 2QGZA 4BLSA 1E9CA 5BYKA 3SJZA 3ESRA 1T9ZA 4URUR 4MUAA 3UATA 3FHOA 4NCIA 4R2HA 1G8HA 3OF5A 5J4KA 4WAUA 2IWRA 1COWD 4JLMA 1E1RA 2YJ5A 2ZI3A 4IXNA 4XSHA 5EE5B 5LDDC 4TN1A 2GF9A 3NKVA 2RKOA 2BBSA 3DEFA 3UG6A 4RKEA 5AUPB 1COWA 1UM8A 1Z0AA 2CMKA 3O47A 3QXSA 1NVUQ 1X86B 4IOMA 4B34A 5DNYB 1P73A 3IQXA 2ZRLA 1XMVA 2FFBA 4Q1FA 4PC6A 4XSGA 1XPJA 1D2MA 4URVR 2F3RA 3I8XA 3GLIE 1SU4A 4MKGA 2YWGA 1SKYB 3R9XA 4A8JB 2QE7A 1RLTA 2HF7A 3WNCA 1BIFA 3CONA 1VKJA 4LWZA 3OE7A 1ELOA 3QKTA 4EIWA 1G17A 3CNOA 1VG8A 1NF3A 4TMWA 2RHMA 4MKHA 4C3ZA 3EPLA 1CR1A 2VF8A 4DB4A 2NYVA 2BV3A 1YZKA 3T1OA 5AW0A 4LBVA 3MJHA 3KOOA 2HXSA 5AKIA 1AZTA 3Q7QA 3EC1A 2J46A 5FL3A 2IYRA 3KXIA 3LBNA 3A4LA 3QG5A 4HDCA 2OBLA 3IRUA 2XTNA 2OFOA 4KX5A 3VQTA 2ZG6A 2A5DA 3WKAA 4UNRA 2ERYA 4BEVA 1GFIA 3A1TA 4CF7A 1FP6A 1HYQA 3SNHA 1PW5A 2ZQ5A 2EARA 4GL2A 4M9XA 1KDOA 4C0JA 1R2QA 4GP7A 4D4JA 2QM8A 1P5ZB 3LLUA 3NVAA 3QXJA 4U5XA 3RRZA 2Z5FA 4M2LA 4UMVA 1RW4A 1N0UA 2GHTA 1KK2A 1VIAA 2FV8A 3B13B 3FMPB 1CJTC 1G16A 4JLJA 2ZPTX 4OYHA 4Z1MA 2XXAB 3AR5A 3GLHE 4BECA 3T12A 1W4RA 2H5EA 2ZRPA 4CF4A 2XB4A 1DAFA 1G7TA 4HATA 4I1SA 5AW2A 1TEXA 2PEYA 1JXOA 1XTRA 1ZD2P 521PA 5AUNB 2C8LA 4C9BA 2ODWA 2VP5A 3LAWA 1CJKC 4PQYA 4YMVA 2CCKA 4Q9LA 2WZQA 3SDZA 3WNDA 4JB3A 5JZVA 3LLMA 1W0JD 1U7OA 3M1YA 2B1QA 4N0DA 2GMWA 2X1VA 4TYWA 1ANKA 4LX0A 1OIVA 1Q1QA 3Q85A 5DE3A 4A8JA 3SFVA 4NCJA 3V4FA 2VSFA 4BEBA 1QYIA 5A3QA 3U19A 2VQSA 1TPZA 3KXKA 1ZNXA 4ARZB 4AIIA 3THYB 1KI6A 3LVRE 2HI0A 3CX7A 2A9KA 1CR6A 3OPXA 3VNUA 1PZNA 4M1MA 3AVUA 1CJVC 3GFTA 4V0NA 1DAEA 4MITA 1KI7A 3UXMA 1RRCA 3ADDA 2ZBGA 2Z4RA 1K8RA 5JJBA 1P9RA 1TF7A 4PAOA 3GJ3A 3EZ6A 1G1MA 1EESA 2JAQA 2FNAA 5ALLA 4GBMA 2I3BA 4GOJA 4CT5A 1GVNB 3OHMA 1KO5A 3I72A 3J7TA 3AEZA 4MH0R 3RFUA 5J4VA 4UM5A 3VR6A 2B7BA 3B2EA 4UJ3A 4URYR 4A1FA 1R6BX 3SBDA 1IXRC 1HV8A 5AJVB 3KTAA 4EPTA 1IJEA 3WHKA 1AS3A 4XVRA 3GLFB 1F3OA 5KO2A 3ICEA 1NF2A 1ZIOA 4LV6A 2FPXA 3UMSA 3VFDA 4GNKA 3I76A 3AR3A 1SVLA 2GEDA 5KPDA 2YJTD 4YDSA 4EQ6B 1GM5A 1SWVA 1EFCA 2NPFA 3QBVA 4D80A 3RC3A 4R9UC 4Y2PA 3GEEA 5SZJA 2GK6A 3QGMA 2RGNA 2HV8A 2JDID 1XRJA 4Q03A 3FDIA 1E2HA 2QAJA 3AP3A 2AL7A 3A1VA 1Q57A 3BB1A 1QBKC 4I1OA 3DNPA 3RNLA 2J41A 4TSFA 3QNMA 4TT3D 3EZ2A 4TYYA 1DE0A 4IOJA 4NPHA 2V1UA 3L5KA 3DMNA 2XSZD 1ZNZA 4CEHA 5AW7A 1NVWQ 4E22A 3K0FA 1IN8A 1FTSA 2XX3A 4QL3A 3EWSA 1VMAA 3THYA 2FZ4A 3DMDA 4Q4JA 2PLFA 3REGA 1ETUA 3SHFA 2ZE7A 2DPXA 1P9WA 1NMYA 1ZCAA 1HT1E 5HKKD 2YMPA 1A1VA 4GDFA 3NIBA 3AGQA 1CR2A 2IYSA 4URXR 1ZU5A 3TR0A 5ALZA 5E0OA 3N2EA 4J03A 2FU5C 3QENA 1M1YE 3A1EA 3KKMA 4D0NA 4F93B 4HYTA 2R2AA 1SXJA 4UU1A 1EK2A 1U0HC 4Q7JB 2V55B 4HLDA 1M74A 4NDZA 5ALKA 1U0LA 2QTFA 1TTTA 4LI0A 1W5SA 5KU1A 4DEYA 4BWYA 3FPBA 1UDXA 4KITB 1YU9A 4KU4A 2ZJYA 1W0KA 1G5TA 3GJ7A 3QU4A 3WMEA 4HGNA 3GLFA 4KVGA 4Y2RA 1N0VC 4D6PA 1NLFA 1YMQA 5FUYA 2ZSDA 1VHLA 1E2NA 2ORWA 5CM9C 4OI1A 3QLEA 2QAGC 5AVVA 2NGRA 3IJ5A 1XTJA 3LO5A 5CYPA 3BAFA 5AVWA 2XEXA 2KBFA 3PUVA 1YVDA 4JBXA 3PIRA 1E2FA 1NLYA 4Q9KA 3AKDA 3OCYA 1CR4A 1OKKD 2XJ9A 3ZH9B 1IN4A 1ZCBA 1E79D 4A4DA 3RLFA 3RSLA 3B5JA 1P6XA 1QHIA 2C96A 2JLVA 4AK9A 4CW7A 2FSHA 1Z63A 4C0BA 2AKAB 3OFND 4BE7B 3Q72A 5DLQC 4DSTA 2GEVA 2FZLA 4JYCA 1Y8AA 1XEXB 1S3GA 1Z6TA 2OESA 3GJ5A 4LHYA 3U61B 2IYTA 1N6KA 1N9KA 1RC8A 5FOUA 3AKCA 1XXHB 2ZRHA 1XP8A 1UEJA 2V6JA 3GJXC 3MD0A 2YHSA 2F55A 5AW4A 3EZFA 4TLAA 2ZE5A 4P32A 5E7IA 1UKEA 1NG9A 1U02A 3AUYA 2HX1A 4Y2XA 5FTLA 4DIDA 2QBYB 3I61A 3SKXA 2O8FB 2Z83A 1IBRA 4B44A 3QXCA 4K46A 4TQAA 2PR7A 1KKLA 1VCNA 2VTKA 5EUQB 2WF9A 4DCCA 5D3MB 3ONNA 5AM3A 2R6AA 2R9VA 3Q8XB 1ZRMA 3TSZA 5AM0A 1G8FA 4JIMA 2YMQA 1W7AA 3QPUA 3WGVA 2CE2X 2BMDA 5ALYA 5AI5A 3PEVA 1VCOA 2OLKA 4PC1A 4EJSB 3CPHA 3VR3A 5C1BA 2Z43A 2ZI6A 3P20A 4XWAA 1UKVY 3TUJC 3U3MA 2WF5A 3DV9A 3C7KA 2RARA 3N5KA 1GNPA 1NJGA 1KGDA 1RYHA 2IL1A 3C15C 3KD3A 2Q3HA 2FOLA 3OCWA 2Z6VA 5JCPA 2FF7A 4CEJB 1W4BA 2J0SA 5ALGA 2H8KA 3PJRA 2I7DA 4LJ6A 4I1UA 3KFVA 4PPFA 1U2SA 3QE0A 1S1CA 2XGJA 4GZLA 4DT1B 2ZJ5A 2FEAA 5AJYA 4MRPA 2IUSA 1Z2CA 5EXSA 3M9LA 1OH8A 1P4SA 2JJ1D 3C41J 5GVRA 3IIJA 1S2MA 4UASA 2O5VA 4QGFA 2ZU6A 5AW1A 1Z4QA 2ZUBA 4XOIA 1NP6A 2NZJA 3BD9A 2ZJBA 1J99A 1OF1A 1U2RA 3B1YA 3AF1A 4BPBA 5IT5A 4X8MA 5EE3A 1KI2A 5TV2A 1A2BA 4Z54A 3SYKA 1P75A 3L43A 3KX2A 1P61B 621PA 1ESMA 5DSZA 2R6FA 2ZTSA 4URWR 2ONJA 1OYWA 2RAPA 3QF4B 1X8KA 3BORA 5E4FA 1MO4A 2WPDD 3VU9B 2IS4A 2RMKA 1XXHA 1FX0B 3EAQA 1WF3A 1IWOA 1DVRA 3AVWA 4BX2A 4GSYA 1ESNA 4OHXA 5JI2E 5FI0B 2VP9A 4RD6A 2AXNA 1Z6GA 2REOA 4M1SA 4A6XA 1BS1A 5AVQA 2G3YA 4KNWA 2IYXA 4LGMA 3KFXA 5KHOC 3AKYA 5AKKA 1U94A 1EFRD 1U99A 2IF0A 4KV9A 4NCNA 4MRSA 4Y0VA 1DAMA 3L0IB 1N5LA 3GEIA 3LX8A 3QIAA 4LC1A 1MO5A 1XD2B 4D2IA 2ZSAA 5C46F 1ZM3A 2YBDA 5DI9A 4DJTA 5G41A 2EFHB 3RRMA 1JAHA 4KFUA 2JJ2A 4B3CA 3KJHA 4MDFA 4Q01A 1Z6XA 4IW3B 2C4NA 3TUZC 1GL6A 1CP2A 4C0SA 1G8PA 4DLSA 3UMGA 3LWNA 3QUBA 1JEDA 2BKEA 4BZPA 1A2KC 1TU4A 2AK2A 2WWGA 1EK0A 2REBA 5B58C 1N6IA 5K8UA 1Z4IA 3CM0A 4HAVA 1A5TA 2RGDA 3CW2A 4JBYA 3A1WA 4KJZA 4PSKA 4AURA 3NH9A 3Q7PA 2PX0A 5AM2A 3FOZA 1W2GA 1KI3A 5IT4A 2N42A 5ELXA 2QAGB 2R8ZA 1PV4A 2MSCB 3N28A 4QNRA 3AF3A 4KBGA 3K0SA 2ZI5A 3ASZA 2A78A 5AKEA 4QHSA 1QDEA 3AP1A 4YDHB 3CR8A 3AR2A 1TADA 1UBCA 3OCUA 4OHFA 4G01B 1NJFA 3GD7A 4EAQA 2VSXA 3KBBA 2CHQA 4DCVA 3CX8A 1R5NA 4RCYA 3C16C 3LQQA 2WV9A 5P21A 4Q4HA 1MO3A 1QHSA 3ZIAD 4YQFA 2FMXA 2CN1A 2XTMA 1P62B 1DG3A 1U8AA 1XPUA 1EFTA 2BBOA 2CE7A 2IEZA 3VU9A 4PXAA 1JXMA 1FX0A 1ZRHA 4KVAA 1S2OA 4R7ZA 5AW5A 5EXTA 2YV5A 2B21A 2FFHA 3H4MA 4QOSA 1QH9A 2FUEA 2YC2C 3DOEA 1KNXA 1QHHB 2J7PD 2QRZA 2GXAA 2XAUA 3TRFA 1B23P 1XBTA 4B2IA 1I4LD 3TK1A 4ZI2A 5JRJA 3OIUA 4X8HA 2WF6A 3AV0B 5AK6A 5ALVA 1ZM2A 3IO5A 4RFSA 2ZE8A 2O8EB 1XD2A 1RKBA 1X1SA 2PCJA 1T9HA 2W6ID 3WMGA 1KK1A 3L8GA 2E1RA 1P2TA 2QRNA 3KQNA 2ZS8A 2QGNA 2SHKA 2ZRCA 3H0KA 5TVKA 3UIEA 2AKYA 3ZZUA 2YVUA 2FPRA 4LDJA 3NEJA 5GJWC 3BK7A 1KI8A 4BYGA 4BLRA 3QUQA 3BBPA 3WKCA 1W5TA 4JJKA 4DFDA 2ZANA 3OCZA 1R5BA 4EFNA 4C4RA 1XTKA 5KSYA 1WA5A 5B57C 1W36B 1EK1A 3WK6A 5IS2A 1AGPA 2W0MA 2VHTA 4L9SA 3TH5A 1U8ZA 3ESQA 4DCTA 3L1VA 4EENA 2PKEA 2VIIA 2WSSA 1ZD3A 5AI4A 2QAGA 1P9NA 2J1LA 1VHTA 3QEOA 2PL3A 3CPEA 3QF7A 4KFSA 4XD7A 3K70B 2B0CA 2C04A 1OH7A 1US8B 1N5KA 4EEKA 1LVHA 5HCNA 4IG4A 2B8WA 5FOXA 4ESHA 3P26A 4W5WA 1RLOA 1PUJA 3FKQA 2IS1A 1E9AA 1W46A 2ZJ8A 5JRZA 1RQNA 3QVUA 4C0HA 5BN4A 4KSBA 2J87A 4DLWA 5KDLA 3EXAA 2V9PA 4O0MA 5H1YA 2ASEA 2J7KA 4D0GA 1R7RA 5T41A 2O0KA 4A82A 2OE2A 1H8EA 2F43B 2RHDA 2WBLC 2ZRGA 3NBFA 5FR1A 2JAUA 2ZROA 4A6PA 2YMLA 4QQFA 5A3RA 3W5BA 3K53A 1DARA 2P5SA 1S3SA 1SXJE 1NVVR 1MV5A 1XEWX 1E99A 3QJYA 4NP6A 1QHHA 1NVXQ 5GJVC 5AIBA 3RC8A 4M9SA 3T15A 4AKEA 2EFGA 3R7WB 4HDQB 3B1ZA 4DSUA 1KSHA 2XB2A 3MCAA 4MUBA 4BKMA 4KCGA 3CRRA 1BOFA 3HWSA 1N3BA 4K81B 1KI4A 1FP7A 4JLKA 2QTHA 5FH9A 5D3QA 4DIEA 4UARA 1L4UA 2GXSA 2GILA 3SI7A 1VYVA 1OYYA 1T0JB 2CVHA 4MA4A 4V0KA 1YR9A 2W2XA 4XPZA 5UKDA 4IHQA 4RKFA 5JS8A 1K6MA 1JBKA 5KSZA 5TDHA 1YR8A 4IFTA 1HURA 2KB0A 5ALMA 1H8HD 4LJ8A 1BKDR 3OIWA 1Z5ZA 1ZNYA 3A4NA 2NPIA 3MWYW 4EUNA 5IF9A 5FR2A 1ZP6A 4NCHA 5AKLA 1L7PA 3AR6A 4B2LA 4AC9A 3HDTA 2FH5B 1C9KA 5FOSA 1H8HA 2VPPA 2BOVA 421PA 5C18A 3P96A 3AVTA 4K8OA 3ZVLA 4TZ0A 2W43A 4OK5A 2OXRA 2FPSA 4FMCF 2BCGY 3U3KA 1G9XA 2IS2A 3FKSD 5AJXA 4BRWA 1JJ7A 4AWXA 5F9HA 3MWLA 5E3HA 3AUXA 2CXXA 3B9PA 3BJIC 4FCWA 3W8RA 1TUEA 4HEJA 4BBJA 2B1RA 4LK2A 1BH2A 4US2R 4UNSA 1XJCA 2ZUDA 2CBZA 3ZS9A 1RLMA 4TYPA 1R4AA 2IYZA 2P67A 2HT1A 3K9GA 1MR3F 3LFUA 4DUGD 2OEPA 4TLEA 3AF2A 3GEHA 4F92B 2JAWA 4C0AC 1LF5A 3H86A 5AUOB 4F7WA 4DBLC 4TL7A 4DSOA 2VHJA 3BFKA 1YE8A 4XVUA 2A5JA 3AF0A 1YR6A 2P0EA 3NH6A 1DOAA 4A36A 5EZ6B 1X8LA 2A3RA 3KL4A 1T8TA 3BH0A 1UPTA 4L16A 5ALIA 1O3YA 2C8KA 1GITA 1TF5A 4L6AA 3FFBA 2GNOA 2QPTA 1VECA 2JLSA 2BY4A 3D3QA 2CLCX 3FFAA 5HPYB 3U3OA 1Q1BA 1E6CA 4ZCMA 1J8DA 2OFXA 1CULC 2YINC 3LBHA 3LRPA 2I55A 1U0JA 5LBIA 1IN5A 2B6HA 2WHXA 5IK2D 4JVNA 4NAVA 3GFOA 1NSFA 4BGDA 1N6PA 6Q21A 4MWOA 3MGCA 4B2PA 2WJJA 1DELA 3NG1A 2HHLA 1YHNA 3VAYA 2XOKD 1GKIA 3SF0A 1NG1A 3SFZA 1EGAA 3BA6A 3U4QA 4ASUA 4B6EA 2W00A 3THXA 4DW8A 5AI0A 1QHGA 2DYKA 5DO9A 3BH7A 3EARA 4NYIQ 4Q4AB 5DN6D 2FI1A 4QBFA 4HLUC 2VSOA 4B43A 1E2EA 2CK3D 3T5DA 4F4IA 1GL9B 4TTRA 5CDFE 4TL6A 5B64A 1QQ7A 1SVOA 5J40A 3ADBA 4UJ5A 4MRNA 2IF2A 3LDAA 1TA0A 2HT6A 3T1QA 2RGBA 4LBWA 5JBQA 5FTKA 5KDOA 4LY6A 2F3TA 4Q1BA 2JAOA 1KI1A 4RD4A 4NYIR 4ESVA 3WY9A 4KODA 5AESA 5AM4A 3GQBA 2YJ6A 2B30A 2DCUA 1OB5A 5EUMA 2C9OA 2EATA 3C5HA 3ONWA 2XNDA 3EPKA 2ZI9A 1Z88A 1ZIPA 2R6DA 3CUEF 2LCFA 4B3BA 3O8CA 4YXWA 2R8EA 2GCNA 3W6PA 5AM5A 3NBXX 1PUIA 4V03A 4QJBA 4FMCB 4OQXA 3PQCA 1NIPA 1E4YA 2QMHA 4BZXA 1JR3A 4EPWA 3HR8A 4G0NA 4BFYA 3B1VA 2C88A 1MH9A 1X1RA 3AM1A 3WGUA 3OIVA 2OAQ1 2G0NA 4L57A 1UFQA 1ZU4A 4JVLA 4UNQA 2D62A 4XQ0A 2Z0MA 4TMVA 2OUKA 5DI3A 1XP5A 5ALJA 1FQKA 3S1AB 1S8FA 4CVNA 1F2UB 1SVIA 4QKQA 1YJ5A 1GDDA 3TVTA 2ZR9A 4M0LA 5L3VA 3WHLA 5DHAA 1E1RD 3IKJA 4E09A 3TQCA 4A2WA 4DCNA 1YZGA 4WW0A 1OPXA 4YMWA 4CGZA 1J2JA 4ZV4A 2QP3A 4JLOA 4GI7A 4LRWA 5HKKA 3LXRA 1D2NA 3RWMB 4XJXA 1RMTA 4Q4LA 1GNQA 1AKEA 1SHZA 4Q18A 2WOOA 1LS1A 1EX7A 1TQ2A 3AH8A 1WR8A 1U8YA 2QE7D 2ZU0C 3TE6A 3RYTC 2PZEA 2FGKA 3OE7D 3T1TA 5KDDA 3BH6A 3SE0A 2BMJA 3L0CA 3E70C 1T3HA 2QN6A 2KJQA 5CJ2A 3E58A 4BRUA 5BWMA 3AR4A 2CEAA 3IDQA 4C0QC 1G64A 1P72A 2HDNB 1N6RA 3CB4A 4EPVA 1QHXA 3PV0A 4H9GA 3EX7C 2FFAA 2ZJZA 3I6BA 4GP6A 3VHXA 2QMUA 3DAOA 4FCTA 4KFRA 1Z5UA 4PPQA 4OI4A 2QP4A 2PJZA 3NXSA 4PR0A 3MWKA 2OV2A 3OEHA 1OXVA 2GCOB 3HP1A 3MG9A 4NFLA 3FTQA 2ZRJA 1Z0JA 3S1AA 1QQ5A 4JL8A 3PXGA 3DDHA 1KDTA 4UAUA 2I1QA 2B8TA 1OB2A 4Z1MD 2QZ4A 4C4SA 5BQ5A 1ZYUA 3T1VA 1UF9A 1XF9A 1RRGA 1XX6A 1XEWY 2IYYA 1II0A 1XD8A 1ZBDA 2VLIA 1E98A 2FFQA 4JT2A 4RZ2A 5ALTA 4TLCA 3GP8A 4BEJA 1T5IA 2OM6A 5C4MA 2RBKA 3NAMA 1AS0A 2HJGA 4BX0A 1CKEA 1T91A 3QUSA 2IX3A 3VAAA 1Z5GA 3RDPA 4Q7KA 1XTIA 4W5JA 4D4LA 2G6BA 2GDJA 1NI3A 4KBFA 5HE9A 2CNWA 1Q1ZA 2IOHA 3RF6A 2DFTA 2GWHA 3CZQA 4MRVA 4NU0A 2JIZA 2QI9C 5AWFC 5EQTA 3TAUA 1UBFA 1TJ5A 3I32A 2MSNA 4LJ4A 4M9QA 3B9RA 1R5OA 2IA5A 1QVRA 4TWZA 3RABA 1KDRA 1WBBA 4OHYA 3PGVA 2P27A 4HZIA 3AR7A 2ZS9A 4NABA 1GNRA 4AI6A 2FPUA 4B74A 1KZGB 3I73A 4DRZA 2G1KA 3PEUA 5JHHB 1E96A 1O08A 1HA3A 4Q1AA 3WBKA 1OSNA 4TZ6A 4PAMA 3I62A 2EYQA 4NYJQ 3FGNA 2FSIA 3H2YA 5FUXA 4FI3C 2WIAA 2EQBA 4DLUA 4LJ7A 5ALQA 2WVJA 4KX3A 2DWQA 3WK7A 1YDFA 2RGXA 3ZD7A 3R8FA 4HSEA 4B3XA 1K5GA 4C4PA 3ET5A 2GCOA 3BGWA 4L4UA 4EJSC 2DFLA 2C99A 5ALPA 1IM2A 3WKEA 3A3YA 3NC1C 4DLTA 2AFIE 5FBVB 4A2QA 4NYJR 1N25A 3E1SA 4OK3A 4KYUA 4C0KA 2PH1A 4GT1A 4NCKA 1IOZA 4O2LA 2WAYA 5TXGA 1UADA 3BFVA 3NANA 5ALHA 3UANA 3L0PA 2X8AA 3BC1A 3Q5DA 3QVVA 3FM9A 1F2TB 1IY1A 1DADA 2XXAA 4B35A 2C2HA 1NMXA 3FVQA 4HLUA 5SZHB 2FWRA 4X8OA 2EFDB 4YIHA 2WFAA 3I28A 1YV9A 4Q7LA 4EDHA 5HZKA 1WZCA 2JEOA 2N46A 1Z07A 1CR0A 1ZVQA 4O25A 4TSFD 2CHVA 1HEIA 4UXHA 1TMKA 2GETA 4IDPA 2I54A 1PLLA 4MDEA 1Z4NA 3B8EA 1TX4B 2XTZA 1EWRA 2ATXA 2ZYUX 2NQ2C 3LW7A 1XCPA 4MQBA 2HYDA 1J90A 1IXSB 4CYMA 3VKGA 3ZW7A 3B6EA 2VL7A 4EPRA 4ARZA 3RS0A 5DGXA 3ZZ0A 3ZX5A 4QG7A 1XJQA 2WWWA 5FPSA 1QQ6A 4FE3A 5ALRA 1P3JA 4RSGA 2QYHA 2WJVA 3QXGA 2YWHA 1SXJD 1XTQA 5KNBA 3CPJB 3CWZA 1T5LA 2F1HA 2VEDA 3AVQA 5DH9A 5FPYA 1WPGA 4QGGA 2IHYA 2HSZA 2C9YA 1NLZA 2KBEA 2ZITA 3T34A 2PX3A 3WP0A 3FHCB 2P6NA 4RJLA 1AJEA 2Q9CA 3LW8A 4DWJA 1W49A 4OI2A 1W0KD 4HZUB 5FFMA 1FPMA 1OLOA 2IXFA 5AK3A 3QPVA 3L82B 3A1CA 2ODBA 4HAWA 1R8SA 4IFBA 2EAUA 2WM8A 4BFWA 2EWWA 2WMNB 1G19A 2WIBA 2ZE6A 3I92A 3H1TA 4Y2SA 2XJ4A 2AWNA 3SC3A 2H7VA 1OFIA 4E07A 4EQ6A 2BM0A 3L2OB 3NC0C 1GOTA 2IHBA 2ZETA 1UEIA 1E2GA 3QI2A 3QY0A 4CRWB 1Z4JA 1T5SA 821PA 1NBMA 3QSYA 1UKYA 4MRRA 1U81A 1TJ4A 3B60A 4U7DA 4EX7A 2YOFA 1L8QA 5AK0A 4AY2A 3SJBA 3ZTWA 2Q3MA 4FMDB 2X2FA 3WK8A 2VO1A 4PX9A 3GLGB 2B82A 1E2PA 3PCTA 3QBTA 2OO7A 5KNCA 1ONBA 3LBIA 3B82A 4Q66C 5HCIA 1AKYA 1LY1A 2BMEA 3K9LA 1D6JA 4I1VA 3DPUA 3Q9LA 3PR1A 5ALNA 1O87A 1Q0UA 5AK4A 2CFSA 1MH1A 5AK5A 2FSGA 2TMKA 4MGKR 1VPLA 4CF3A 4B33A 3FMOB 1YNSA 2IBMA 4QGAA 4PC2A 1GRRA 4C2TA 3PDWA 4V0MA 5CM8B 1VCMA 1F5NA 4Q1EA 4I9GA 4CEIB 4WXPA 3WXMA 1G7RA 1Q12A 4G5GA 3V00A 2G0AA 4MYTA 5KOYA 4KO8A 3IGFA 1JQLB 3VR5A 3L7YA 4Q7MB 2KE5A 1W1WA 1E9RA 4LYAA 1R0YA 3W34A 3HYTA 4RD0A 5K8TA 1BMFA 4CIDA 2G83A 1E0JA 1DO0A 5AICA 4UNPA 2QSZA 4B6FA 5BYJA 4ZDKA 1W36C 4MYCA 4DCUA 1Q20A 1KY2A 4P4SB 4PZLA 2GXUA 2IYLD 1G6OA 1S96A 1G3IA 5ALFA 2ZBFA 4QJ4A 3K70C 4H1VA 1VIYA 3AKEA 4JL5A 3ZZTA 4H1UA 2Q9AA 4MYHA 2ZVQX 2QMOA 4PPGA 4B6JA 3T5GA 4WVFA 5G53C 5HE8A 1WBDA 2R44A 4RETA 4GIBA 2FUCA 1OHHA 3HYCA 3NASA 5AJZA 4OJQA 1Q21A 3CRW1 4BX3A 2Q3FA 1MOZA 4HUTA 5FBQB 3DOFA 1J97A 1SVKA 2VHQA 3BERA 3NUQA 1HUQA 3GLGA 4HGOA 5AKXA 2IEYA 2BJWA 1G41A 1F60A 2A5FA 4KSCA 3ZWDA 3FYHA 4UQOA 5AVYA 1V43A 5GVSA 2CL7X 1XEXA 1C4OA 3VX3A 1OH6A 4B71A 1YZQA 2ZJOA 5GADl 4ZIRB 1SZPA 4Q1DA 4C7OB 2Q4RA 1NRJB 2EU8A 3SHQA 4PHGA 4OCZA 1FFHA 2J0QA 4LJ9A 5AKYA 4A0RA 2HLDA 1FOEB 1IY0A 4TTPA 3J81k 2QBYA 2A7QA 2F7SA 2RGCA 1II8B 4HLCA 3TBKA 4E5UA 2HYIC 2O8FA 4AS3A 4G5SA 1P2VA 4OFZA 3EIHA 2JJ2D 1FW6A 3NEYA 5D3MA 1DG1G 3MC1A 3KKPA 3L8YA 3IIKA 2MU1A 3ZVNA 4RD1A 4Q9IA 2DQSA 3A6PC 4YCMA 4NYMR 1KY3A 2ZR7A 3FWYA 3BIFA 1E9DA 1T3SA 2F1IA 1TEVA 3OIYA 3Q3JB 4OQNA 4AG6A 4EJSA 2R6CA 2Z4SA 4F4JA 1L7OA 3L8HA 4JVSB 3SQWA 3R09A 5ALEA 1G5RA 5DISB 1ZC4A 3B9BA 3CNNA 1AZSC 3DO6A 2EWVA 4JLAA 4JZKA 5JEEA 3W3ZB 2B7CA 2C5LA 2WWXA 2ZI4A 3M1IA 3PENA 3THWB 4CEJA 1GL7A 4NE2A 5L3QB 2QL6A 3IUYA 3BE4A 5AUQA 2OZEA 1JPJA 4JLBA 1K1EA 3SJCA 2G07A 2G77B 4DT1A 2IK8A 3CH4B 2W11A 2NO6A 2O9JA 4DZZA 2WJYA 4OKSA 3OAAA 4PHFA 1NN1A 4DLYA 2PLRA 3GLIB 1M7HA 2CLSA 2PMDA 5B30A 1AK2A 2V7QA 4N0EA 2IWHA 2GHIA 4DDTA 4YCNA 3P4YA 1YS9A 3WBJA 4JMPA 2R8XA 1M7GA 1IY2A 1GTVA 3U6KA 1RIFA 3WYFA 5KTYA 2OM2A 3U7GA 1RKQA 1S4QA 2VRWA 3QF4A 3OTQA 4ZIRA 3QUTA 1ZD9A 2R62A 2IUUA 3K09C 3NTUA 4PHHA 1Q91A 3SKYA 4X8LA 4Q9JA 1PJRA 2NO1A 1ZUHA 4OL0A 3EF1A 2EVWX 5AKGA 2P65A 2WWIA 3ZX4A 2YN4A 1NKSA 1YZUA 4RD2A 3TSOA 2VH5R 4M8NE 2EFCB 2VBCA 1RJ9B 1E0KA 4DC9A 5DYGA 5BXQC 2O8CB 3KJEA 1VJ5A 1LNZA 3RS7A 2PQ0A 4MGZR 4KN8A 2BDEA 1W4AA 1Z0IA 5E95A 1I4DD 1XFAA 4LYFA 4RD3A 2I33A 3B7GA 3QU5A 4XWOA 1WCV1 4UMFA 2QEQA 1MRNA 1ZNWA 3SEAA 1ZJ6A 5LB2A 4BLQA 3EA5A 4DSNA 3AR8A 4YCLA 1E0SA 2WAXA 2QP9X 5JFGA 3GLHB 3THWA 4XE5A 2WSSD 1XCMA 5JCZA 3U13A 4FXPA 4URZR 3KQLA 1E32A 4XD7D 5IRCD 2BEKA 5GJBA 4B73A 1VJRA 1LV7A 3W5JA 3WYAA 1CQZA 5AI9A 1C1YA 4AYXA 2FPLA 3DL0A 4W5HA 3SD7A 5AJWA 2JATA 3QXXA 3L0OA 3ZDQA 1X3SA 4DKXA 1OXTA 1NVVQ 1CXZA 4PZZA 1L7MA 3K9NA 3SZRA 2FPWA 2WF8A 2WWFA 2V3CC 1H8ED 2KWIA 3TW8B 1XD9A 1B0UA 2JLZA 2ORVA 1XMSA 3M4YA 3RWOA 4ZI3A 3KB1A 3W90A 3WRXC 3G0HA 5LPNA 1KO7A 2QT0A 3R4CA 2H17A 3NALA 1E1QA 3Q5EA 4IFEA 2EW1A 1T8UA 3BRWD 1N0WA 5H68A 1S9DA 1N6HA 3A1SA 2NIPA 4Y2VA 2XZLA 4Y3UA 4HUQB 1ZJJA 4KLZA 5EE0A 3UG7A 4ZCIA 3M0EA 3WK4A 4G5QA 2A30A 4H1WA 1M34E 4MYUA 1JQJC 1QZXA 4NHOA 4F91B 2OA0A 4AD8A 4IEEA 1E69A 3MSXA 1CEEA 2MMGA 5IHPA 1CRPA 1RJ9A 1S9HA 4KI0A 1ZM9A 1TAGA 3ETLA 2KI5A 2O8EA 3NDBB 4YMUA 3GLFE 3AVXA 3QUCA 3K0CC 1VTKA 3P4XA 2YWEA 4HAXA 4DEXA 2CVFA 2ZYVX 2JA1A 1VYTA 1JB1A 2J0UB 1YQTA 4BFTA 3BWVA 5AKJA 5AW6A 2E9SA 1CS4C 1IN7A 1OXSC 2P9JA 3C5CA 2IOFK 4NBSA 2YOHA 4UM7A 5DIFA 2BC9A 2P5TB 4U02A 2BIFA 4JDPA 5FPKA 1NBME 3WK9A 4S35A 4QXAA 1R8QA 2ZRNA 4C0LA 2H1LA 1WXQA 1JAIA 3AB3A 4Q21A 3QKUA 1ZMXA 3W5IA 5JJIA 2GZDA 3F9RA 5JWRA 3FMIA 2IYQA 1CTQA 1H65A 4Q9HA 5HTKA 4BLTA 2O8BB 3E84A 4CNQA 1US8A 4ACBA 4F72A 2Q5EA 2P2LA 3AP2A 3KB2A 5LD2B 2FDRA 1VG9B 2D2FA 4IXMA 4L9WA 2F1JA 5L3SB 3O8RA 1GIAA 1SGWA 1SVSA 4MUMA 2LWIA 3DM9B 5CB8A 2PJRA 3FZQA 1EFUA 4XOUA 1UKZA 3BWDD 1KJZA 2EYUA 2L0XA 3CNLA 4G3XA 4S2EA 1CIPA 4CDGA 4EPXA 2HCJB 2AD5A 2IYWA 4V0ME 3B78A 2QM7A 2F43A 3PUYA 1YZNA 2ZRFA 3EG5A 4PC3A 1OXXK 1HE8B 1R10A 3U2QA 3U60B 2ERXA 3MAAC 3PUXA 1ZC3A 5TY0A 3VR2A 2W6JA 5CYOA 4HLQB 1KO4A 2A5GA 3O8DA 4IDQA 4BNDB 2BMFA 1CJUC 3VHLB 4RFVA 2Q21A 4B3FX 3R7WA 1GAJA 4ITRC 5FBLB 3U7FB 1HE1C 2G80A 1DAIA 1YRAA 3CF2A 1WVIA 4HB2A 5AVTA 3CZ4A 1XU4A 5FL7A 2G08A 1KMHB 2AD1A 2ODNA 2P69A 1MRSA 1PLKA 2OILA 3EPJA 4I9FA 2AX4A 2Q6TA 3KUCA 4BASA 2DFNA 2OT3B 1MABB 3QEJA 3JVVA 4FD2A 4LJYA 3SQXA 1KK3A 3CLVA 3W5DA 2NO4A 3X2SA 1XCGB 4OHZA 4Y2TA 4B3DA 1IXZA 3UWKA 1Z28A 4WXRA 3WMFA 4TMTA 4LSGA 721PA 2ZSFA 5J4HA 3TW4A 4MGIR 3CRMA 3P27A 5B2ZA 4ASUD 2HO4A 3SMVA 2ANBA 4Z51A 4BZQA 5JECA 2JARA 2WKQA 1RKUA 1FMLA 3RS4A 1M7BA 3ZLJA 2O0HA 1L6RA 5CIWA 2FPKA 2VYFA 5FBWB 2YMMA 3W6OA 2I34A 2AR7A 3DZDA 5EJEA 4WBSA 4BFVA 2GCPA 2OYCA 1KHTA 2FGJA 1KYTA 4R98A 5FTJA 4BUJA 3PGLA 1XXHE 5GJCA 4M1TA 2V1XA 2FPMA 4I81A 3EPHA 1UBGA 2YOGA 2HCFA 4ZPXA 5AKZA 1T6NA 5CIQA 3U6BA 2JLQA 1N6OA 3D6JA 1AGRA 5TB5A 4ON9A 1VDZA 5DHFA 4QC2A 2PZFA 4UATA 2BM1A 1UJ2A 5L8VA 3EA0A 3AVVA 4Y2YA 2ECKA 5ANRB 4P33A 4TTQA 4DLZA 3WRYC 4AKGA 3I1FA 3K09A 2JJ8A 4UNNA 2XNDD 2GO7A 4A0HA 3FPAA 4YONB 4N1AA 1AQ6A 3KZXA 1E4VA 3VX4A 4PTLA 3KKQA 4YXWD 3OEEA 2P6RA 3UMCA 2QA5A 3NRJA 1BYUA 3W6NA 3U5ZB 2ZXUA 3KUDA 1Z8FA 2YC4C 4RZUA 1SQ5A 2WICA 2OCAA 3U44B 3IPXA 2IYVA 1PVOA 5CK4A 1ZW6A 2C03A 1JR3D 4PQFA 3LD9A 1ZINA 1J8YF 3U7EB 2ZJ2A 2EFEB 4LHXA 1MABA 5BW8A 1Z0FA 4RY2A 3HPQA 1XMJA 4M1YA 3IQWA 4HB4A 1I4TD 1IN6A 3F0TA 2J5XA 5J4YA 2H16A 2QPAA 1IAQA 4D4KA 4WZ6A 1GUAA 5EE9A 1YRBA 3IEUA 3HYRA 2HDOA 1TUIA 2F9LA 4BFZA 3A36A 4ZDWA 1A7JA 3TLXA 4IOKA 1ZD1A 3EZ7A 2UVQA 2BCJQ 4TL8A 2YNMA 4YIKA 2ZRBA 2AWOA 5BN3A 3LH5A 4DLRA 1RPZA 2GJAA 3LX5A 1QHNA 4LBYA 4Q5IA 1AM4D 1DS6A 1XWIA 3TNFA 1G8YA 2D2EA 1Z0KA 3U3RA 1TQ4A 1KO8A 1VG1A 3DKPA 4Q4AA 4US1R 4B3GA 2GBLC 2OCBA 2AFHE 2B92A 4HI0E 2PZGA 4LOAA 3F5FA 1SKQA 1IHUA 1TNDA 1U90A 4FWIB 3OESA 2GHQA 3HU3A 4LJAA 3KQHA 2UZIR 1N8NA 2H92A 1Y63A 3EWAA 1J8MF 1KMQA 1VCIA 1Z2AA 1KSJA 2QTVB 2RCNA 4GRAA 1KKMA 4NMMA 3T06B 4BLOA 3JZAA 4JLDA 1WB9A 2VP6A 5EXXA 1J7KA 2A5YB 1Z4KA 1OXUA 3D6TB 2WHEA 1XZQA 1CF4A 4YH1A 2OSBA 1FQJA 3REFA 3T35A 1NKTA 2GKSA 2HJVA 4L15A 5F3WB 2ZOSA 4EX6A 5C4GB 3SR0A 1FUUA 2IT1A 3U44A 4F38A 1D8TA 1JI0A 5KYKA 2W83A 2ZREA 1G7CA 4JYBA 2NO9A 2PMKA 4XTRA 3KDSE 1U9IC 3TKLA 4HAIA 1E9SA 2D3WA 2ZIAA 3N2IA 1S1MA 2NOAA 4HGRA 4I4LA 5AKHA 5CLQA 3K0CA 4Q19A 4LV5B 1IJFA 3MLEA 3OEHD 4IDOA 4OQFA 2JASA 3IHWA 3HR7A 1W2HA 2GFHA 3KDPA 1OE0A 1TQ6A 5A0FA 3UMRA 3QU9A 1JNYA 3LV8A 4TYNA 4JS0A 3MRSA 5JWHA 3TGPA 2XZOA 3SU8A 1ZUNB 1G20E 1T3LA 2QSYA 1GILA 2N1BA 1Z4MA 1F2UA 3EF0A 3K1ZA 4O2RA 1WP9A 1KJWA 2BWJA 1Z4PX 1KI6B 2W58A 3OZXA 3NWJA 2WJGA 2CNWD 1OT3A 3CO5A 4W7SA 3TVDA 3HJNA 4KAXA 2JIZD 4TLDA 1JPNA 4PO9A 4M22A 1KOFA 4GOXA 4B47A 1U7PA 1KSGA 4AYTA 4QM6A 1TJ3A 3EWIA 3L0BA 5FP0A 2ODAA 4PQRA 4WOPA 5J4LA 1E3MA 1RQLA 5AW8A 2CLDX 4FN5A 2R6GA 3IO3A 1OFUX 3GMTA 4POAA 5TARA 1M2OB 5HZHA 5EP3A 3TSWA 3D8BA 2O8DB 2GXQA 3R9WA 1KZ7B 3LVQE 4OQMA 3WYGA 3PEWA 3TUIC 4TLBA 4WA7A 2IW3A 3KTAB 4LHVA 3X1WA 3ZGXA 1RMQA 4NH0A 1R0ZA 4OJKA 2D2VA 4TMXA 3S6JA 2DWPA 3CX6A 5M04A 5F9FA 4QBIA 4RZ3A 2IYEA 4UW9A 2NO5A 2W2VA 3KZ1E 4QJ5A 2D4HA 4I99A 2PT5A 3RANA 2BDUA 4G63A 2MSDB 4LZZA 1T4GA 2K5UA 1EG7A 1E2LA 5EZ5A 1Y3AA 2IUTA 4KXFB 3BXZA 4QRHA 4GFDA 4IVRA 4FMDF 4IRUB 5EP2A 1SVWA 2XNSA 3E2IA 4LPKA 5EXPA 1OH5A 5FPHA 2FE4A 4BFUA 4OHVA 2AMYA 1Q92A 4CEHB 3MJRA 2DY1A 1W0JA 2I1VB 1NIJA 3K0FB 2G9NA 1MO6A 2JLYA 2WJIA 4Q4JB 1LW7A 4OQLA 5AW3A 2ZRIA 5JS7A 4XVQA 2ODEA 5CITA 2KSQA 3I5XA 1VG0B 2BEJA 4Z8YA 5EP1A 1I2DA 1EXMA 1GRNA 2JLUA 2WM9B 3CR7A 4C4TA 5ALXA 5AI6A 1RFLA 1L7NA 1LF0A 2QENA 5FUVA 1U98A 5JJKA 4RZXA 5HR5A 3N07A 3E5HA 3E81A 2HCBA 2G1JA 1P7CA 5E7JA 1XB2A 4RESA 221PA 3KKNA 4JKIA 1SXJB 4P0TA 2G1AA 2ZRDA 3DVLA 4J0QA 4B76A 1E2MA 4AKIA 5AVZA 1ZD8A 2HEIA 4JT4A 4QM7A 1QG4A 2O8DA 4IVQA 2GZAA 5KPJA 3FMFA 2C95A 3NDPA 1G6HA 3PFIA 3B9QA 1YZLA 2YYZA 1GG2A 1ZD5A 4JVMA 1GKYA 1W44A 1Q3HA 1NY5A 5E7MA 4PAQA 2MSEB 4P4UA 4FMBB 4EKDA 3PG5A 3OCXA 4GPTA 2LKDA 4V0LA 1YR7A 4LUCA 2OCYC 4PANA 5H8WA 1CLUA 4D0LB 2FEMA 2OAP1
chains in the Genus database with same CATH superfamily
1QZZA 4TOIA 1IUPA 3EGDA 5IP5A 2A86A 2PTGA 1TXGA 3IV6A 4X54A 5CX1B 4E1BA 1JLKA 3ICQB 2Q1TA 4FJ1A 3AUSA 4L8GA 3K0EA 4NV3A 2ZIFA 3R1IA 1KFKB 1C3OA 1RQ7A 2IX9A 1P2GA 2PYIA 4J2HA 1AN0A 2F4NA 5E9JA 3TJMA 5KX5A 1Y7LA 2ZJ4A 3EC2A 2WOJA 3DB1A 3WKDA 4EJ0A 5IBRA 2JZNA 4N01A 5TPZA 2A1TR 4HH0A 2HF2A 4L0CA 2D1QA 1XLUA 3WJ1A 1HDOA 5K8IA 1LPOA 4IIGA 1AHNA 3IODA 3AXTA 2ZYTX 4FGKA 3RBXA 3KKOA 3FB4A 3MT8A 3UM9A 4MVJD 4NULA 4U00A 3ZBQA 2XSZA 1R6XA 1F2TA 5DTJA 1NZDA 2CUZA 2PUJA 4NL4H 1JH9A 1T6ZA 4Q4DA 1CJMA 1KYXA 3EPRA 3QYJA 4LV8B 1N6NA 4F1WA 1AKTA 1IY9A 1KYIA 3BK1A 4MV0A 3X2SA 3FI9A 4ARSA 1O9BA 2OY0A 3E3LA 5JMTA 1N92A 2HWUA 2TYSB 3OPMA 2X2PA 3T3DA 3QU7A 4HXEB 5IZ4A 1LB1B 4UXIA 2ZSEA 3SZGA 1FMJA 1CBUA 1NNEA 2VNJA 3AUKA 2GAFA 4XLLA 4AMVA 4HXFB 1RHJA 3FTFA 2JEYA 4TL9A 1L4YA 3WNBA 1JLHA 1MAAA 1SQGA 2JFZA 1BCSA 3C8UA 3QNUA 1N9ZA 3TAHA 5C0OE 2VH1A 5HHTA 2OLEA 4P0PB 2V6MA 1JKXA 3H9GA 5E2AA 1TYEB 4U0JA 2A2ZA 3TTVA 3X2EA 3T9FA 4AVYA 1E3WB 5TMPA 1AIPA 4RABA 5FBZA 4MWZA 1T13A 1GN9A 4NFSA 5EZYF 2J9RA 2W4QA 4YMTA 1Z06A 2GZHA 3OWOA 4QODA 3OE5A 1E3TA 1E2DA 1KZHA 2HF9A 4NBLA 4DLVA 2ZSIA 1XMQB 5G0SA 1BMFD 2J3EA 4IINA 1TQDA 3ZYCA 2TSYB 3T3GA 4N54A 3COPA 1SKBA 3MT9A 1KZ1A 1HTBA 2V54A 4A16A 1E79A 3LQRA 4HD8A 1DTWB 1GVHA 1Y7TA 2F00A 3K0AB 4OJNA 4P84A 3V33A 4HTAA 3L01A 2J0VA 3ESAA 2VF7A 3OTHA 4MIKA 3Q8LA 1NBEA 3O3CA 2I6GA 2ZIUB 3HJTA 5F98A 1Y1QA 1Z22A 1KTVA 3AL2A 3Q41A 1YS2X 4ER6A 3CLTD 1ZUWA 2F9MA 3GVXA 1WUJS 5AHOA 4Q3AA 3AGPA 5GM1A 1RYEA 4A5OA 3JASB 3WICA 2K7ZA 3NIGB 4JA2A 2ZBPA 3OT1B 1HPLA 3N3BC 2NG1A 1MJFA 3AI2A 3IHLA 1R0XA 1KY4A 2HRBA 1DAKA 4UHBA 1C3JA 3I2FA 3OM0A 4RIFA 3LHKA 3V8PA 3LTNC 4M7PA 1PE0A 2AN3A 2Q3LA 2WF7A 2JGAA 1PQWA 1U2TA 4S1TA 2NTYC 4KYTA 5EE1A 3H5NA 3V2HA 3UT0A 1E8DA 4C30A 4HPJB 1W19A 4B0PA 1CUFA 1KAOA 4F9EA 2OFFA 4KN6A 4GOKA 3Q15C 4EG8A 1UXKA 3QVMA 5I7FA 1PWZA 1WPRA 1KAGA 3STHA 5IM4F 4QBHA 2Q6LA 3C1OA 4JT9A 4MW6A 5KTSA 4JBIA 1U8CB 2FDCA 5LN1A 3DPIA 2LCIA 4YAIA 5LP6B 4M1EA 1YI8A 1M8FA 1RAFA 3ND7A 1E3WA 4H1TA 5K4GA 1N34B 3W5CA 2PUGA 1KSFX 1DMSA 3NO4A 4NKRA 1TRKA 3RSGA 3D0OA 4OHWA 1FVXA 4FR2A 4OD0A 4M1KA 3DZKA 5GPBA 3ZXIA 2PGDA 4L2IB 3D6VA 4HFRA 4FZRA 3UOGA 4DDVA 4TV8B 3KSBC 3GRZA 5DM1A 4LKOA 2DR3A 4YAGA 4EF4A 4N0PA 4UTPA 1GGHA 3JQGB 3KQKA 5AQEA 5I9BA 1KZ4A 3DUFA 3Q1LA 4G4SP 3L8ZA 5AYVA 2ZIVB 3D0QA 4Q4HB 1XRMA 3A6DA 3K0AA 4ZO4A 3RAPR 4E5MA 1FFWA 3VU3A 3OIGA 1USIA 3EIQA 3SXUA 2OPHA 1QYWA 4FFSA 4GICA 2OWEA 2ATVA 4ALMA 4RKQA 1OILA 2ZWIA 1CJCA 3SX2A 2AFHB 2J8ZA 3EGCA 4IJWA 3GUVA 3FH0A 3G5MA 4RQUA 4RLFA 2UUOA 1GUZA 3JASA 5CDFA 3GPLA 2VLBA 3OT5A 4P4SA 5EIHA 1BS9A 4DMHA 5G4LA 1LVGA 2VA8A 3ADOA 1G8GA 1C14A 2E5WA 1I6LA 2NXEA 2X4IA 1GARA 1V11A 3LF2A 2ZSUA 5BO5A 5FOTA 2F3UA 1WE2A 3KEOA 4ND7A 1IWPB 2PBRA 4NJEB 3FCSB 3LA6A 5JYCA 2GAOA 3V1YA 2ZVPX 3H8WA 3ZHOA 4A23A 1GPH1 4BC0A 3BYZA 3HU1A 3LUKA 3WL5A 4DBLE 1ULBA 5IULC 5G3ZA 4COKA 3CZ9A 1UAYA 4NBRA 1QRTA 1GSIA 1RXYA 4F5DA 1Q5PA 5AOCA 3B70A 3CO0S 4BQSA 2WKPA 5CDYA 4Y2QA 1Z33A 3ND8A 1PI3A 1Z4OA 1E2KA 3QX8A 1RCUA 4DNOA 4KPEC 2Z5GA 2ZRQA 5LYJB 1IQRA 4RLSA 4A92A 2H5JA 5DN9A 4BTEA 5A5GA 1T1JA 2LNDA 2AUTA 4PSVA 4MUEA 1G3QA 1OPRA 1HTWA 1U7ZA 1YI1A 1FNBA 2VC2B 1LBQA 5IANA 1Q7RA 1X2EA 2PX4A 4JUDX 2OCDA 4TT8A 5KSOA 3M3PA 5ALDA 2QK4A 4C7OA 1UC5B 1UK8A 5A0TA 3LUDA 3MILA 2QLTA 1IXKA 1JUDA 1NSYA 4M9RA 3WS7A 4AURA 4QSHA 5CG2A 1VLMA 4F4CA 4EF5A 1KF0A 1RYNA 4L2IA 1II8A 1R12A 4HDOB 4XYGA 5DGHA 1TZJA 1T2NA 4KNVA 2Q6OA 5BNWA 4UEKA 3ZV5A 3ERCA 3EVTA 1XZBA 5AVUA 1G20B 4L6CA 1WDWB 5FTNA 4JJZA 2W2TA 1TZ2A 3GJ4A 3IELA 2QR3A 4BB6A 2XYQA 4B31A 4X44A 4KR7A 1O5OA 4PSAA 5EEHA 1V5WA 1QRDA 2QG9A 2FSFA 4HJRA 4JJGA 2V0CA 4TTJA 5E38A 1PBTA 3CEMA 3SVZA 1VE1A 3HBAA 2H0AA 2P4EA 2PCLA 3DHWC 2O4CA 4V02A 5A3SA 1T4CA 4A0GA 1JW9B 2JPDA 4MLZA 2GPBA 1VCHA 2HFJA 1OY1A 2NZYA 3N0TA 3WNZA 3D8NA 4FHEA 3ZXUB 3L8FA 4PG4A 2F3PA 4K6GA 4LVUA 3DTVB 5L3QA 2XNCA 1P7YA 5L7WA 1YSCA 3FCYA 4L74A 3O4FA 4PC7A 4ZJUA 1XCBA 2W48A 4WFIA 2JLXA 2NACA 1F48A 3SJAA 1XI2A 1DRUA 2AJLI 2ZT7A 1O94C 3O8BA 4O2AF 4B48A 4L4YA 4YRZA 1V95A 1USGA 1JWAB 5IBQA 1HRDA 3E9NA 1E94E 1VHDA 2BKVA 3B85A 3ET4A 3HCOA 4NNPA 2GF0A 1YE5A 1HORA 2W6IA 3H2IA 1NSTA 3KR2A 4XJVA 2OV3A 3C74A 4GGPA 2RONA 2FOXA 4QULA 3M6UA 4CKEB 5IARA 4Y67A 2HAEA 4QBTA 3VBEA 1SG9A 1CW2B 4JLPA 4L5BA 4V24A 4A9AA 3KYCA 3MGKA 3RR2A 2C78A 3SLRA 3UMBA 4EFDA 2WMOB 3L3BA 3TJRA 2WZBA 2MSLA 5J2TB 3T5BA 2B2CA 1JE1A 3PL5A 2NSLA 1TF2A 1T1RA 3IIEA 3V46A 5BSKA 2RB5A 2H7YA 2BR5A 1ECPA 3W2EA 5G3YA 2OD7A 3DBRA 1L9XA 3I9JA 2B37A 1HDIA 4JP2A 4NV0A 2AFIB 1CNEA 3IOEA 2QUKA 1RR6A 4P86A 5EZSA 3W8DA 3KEQA 2BMAA 2O8VA 3UXYA 4MVJE 3L6CA 4HGPA 4QHYA 5A3JA 2QY9A 1JFVA 2Q0HA 2OHGA 2PX2A 2VRNA 3OM1A 4DDHA 4KE6A 2QMYA 5JVDA 2JD1A 4FJ2A 3RG2A 3DT8A 1GGKA 1FTWA 1P7WA 4HN2A 4HNAA 4JN6B 3UKDA 1V8BA 2WWHA 1GADO 3QEMB 1NLUA 3CEHA 3QPWA 4J76A 2J45A 1FP4B 2NYUA 1SC6A 3C3AA 3MJTA 4P3NA 4OHMA 5EP4A 4PONA 4L85A 3ABOB 3SM9A 2ZXFA 3ZJ4A 1XNQB 3ZHCA 2OBMA 5KTKA 2CV0A 2HBQA 3H84A 3DH0A 1JDTA 4CE6A 1L8LA 1PT8A 3UGJA 3FTPA 3TEJA 3W06A 4NJOA 1T3ZA 5AH0A 4BLWA 4QG3A 1QYCA 3AR9A 2DETA 1FC0A 4V0OA 3SOPA 5PNTA 4ZCLA 4BWGA 4K40A 1ILWA 2H1OA 3EASA 1FXUA 3OECA 2V4MA 5LUAA 1U7DA 4FFLA 1CVIA 4TMFA 3DBHB 1SK8A 4HGQA 3DDCA 2ZULA 3MWDB 4Z86A 5HW0A 1CD5A 2W6JD 3T5AA 2P9ZA 1VIVA 2H2WA 5SYMA 1IN1A 2QU8A 2JF0A 3VC7A 2P2NA 3O4GA 4HUQA 3TM5A 5HUJA 3IE0A 3K5HA 3WP1B 1G3MA 4EW6A 4F3NA 4MS4B 5FL7D 1MHPA 3OUUA 3THXB 1KO1A 1V8OA 2BEVA 2GTPA 3HUDA 4PHTA 2IOQA 1UP7A 1ZM7A 1IM8A 3D8HA 4F5ZA 2BFBA 4RVFA 5DXFA 4NS1A 2AOUA 2VOEA 5JSZB 1YBHA 2XZPA 2AFIA 2Q3DA 5TT0A 2GAAA 2XW6A 4DB2A 1FNNA 1QKKA 2XUAA 3KJIA 1RWMA 3ULKA 1N3LA 3FDFA 3JSXA 4R1NA 3A9UA 2ZW9A 1CEXA 1CZKA 2D1SA 5AXAA 1XVVA 5F7OA 1EWQA 2VHVA 2GERA 1SOAA 1WPQA 2QWXA 4KBYA 1YC5A 2C42A 4QATA 4I55B 3RAJA 5AXCA 3D8RA 2CLMB 4HYEA 4MWDA 1N5MA 1VI2A 2GS9A 3WK5A 4Z9AA 3OZVA 4YLGA 2QXUA 3D3NA 2K4MA 5JZOA 1TRHA 2JLRA 4QOEA 2H0QA 4A8JC 4UMDA 5DCUA 4E30A 4OI0A 1QO7A 1UPBA 3BIOA 4PZYA 4MPRA 2Y2UA 5E1OA 1QYDA 2GPWA 4DUGA 4BNUA 1RIIA 5JQGB 1ZXXA 3IEXA 1BU5A 1JLSA 1U2QA 2DPGA 3X1YA 1C9YA 2UZ3A 2ZS7A 2D54A 3N1UA 2K2QB 3PC3A 5BUCA 2E5FA 2JGLA 2X19A 2X3YA 1LRJA 3ADKA 3M5PA 3ZNPA 1W29A 2WMYA 1HNNA 1H22A 1KJYA 1JIXA 1NNI1 2ZCVA 3L41A 3PK0A 4HJXA 4IDHA 5KYWB 4UQPA 3ZHVA 1T29A 1ADYA 4CMEC 2WJ3A 1WV1A 4AMBA 5FOWA 3O1JC 4GQIA 2RI0A 2M1XA 4W9MC 3DAPA 1IBKB 5K99A 1M5UA 1L7QA 3FNBA 4V2UA 3LGXA 3P52A 1Q7EA 1F38A 3TR5A 3PEYA 2XA9A 4Y2JA 4X63A 1U3UA 2J5KA 3UOAB 3T61A 2IIPA 5JLJA 3PWKA 2IGBA 4V38A 2AUMA 5IK2A 3I39X 2H1IA 4J75A 2HEGA 2EFJA 2HQ1A 2Y0CA 5JSZA 4M1OA 2DE0X 4RYLA 5HIJA 4DYHA 4MJ7A 2GK7A 3ABIA 2JFUA 3F98A 1RWOA 1XNRB 2GEUA 5I01A 1RZRA 5T57A 4PZAA 3E4CA 4UPEA 1FDOA 1E3SA 5AIAA 2OD2A 2RGNC 4K9MA 4TRJA 2JLWA 3M1AA 1JHZA 2BDTA 1U2DC 3HU2A 3CWQA 2XB9A 2OZKA 4GL4A 5JY1A 1GGJA 2IHTA 4LRSB 2ORIA 4LRQA 3VTKA 4OXQA 2M6LA 2D13A 2X5KO 1VFPA 2FB9A 4PSUA 3GYGA 1MO2A 1B6TA 1WB6A 5ALOA 2II6A 1MJGM 3D7NA 3I8OA 4XWWA 5KKNB 1L8OA 3CF6R 1W73A 3DOCA 1BSVA 4IYRA 2DQ4A 3A3KA 5BN5A 5JQGA 1RRPA 4NBKA 3OLCX 4Z4IA 3UENA 2QQ5A 4PNHA 3G23A 1VRWA 3RC9A 1VSVA 3ZCUA 7REQB 2B8JA 4OU5A 1QVAA 3I3SR 2FQYA 4HB0A 4ONEA 1K7CA 5IW8A 3SHTA 5CLHA 5JUWA 3FOFC 4MW5A 1Z2NX 2D1TA 1YCHA 3PR2B 4O4LA 3SLGA 3PL1A 3TCXB 1EZZA 4OXXA 3QG1A 4IICA 1KU6A 3WIBA 1NZJA 3NJRA 1UFRA 2DHEA 3G82C 3OU6A 4L0DA 3R9IA 3UK6A 4B75A 2CFCA 4KO1S 1HY3A 1C8VB 4E33A 4UUPA 2GARA 4R6XA 3W5AA 3IUEA 4F5YA 2QVYX 2B4YA 1O97C 4MJLA 1Q22A 2REXB 4WZBE 5EL0A 5IYZB 3LY5A 3J7AC 1A9ZA 3PDCA 1HT0A 3D5QA 2NPOA 2IJGX 4E12A 2CLFB 2ZAMA 3CG0A 121PA 2G9VA 2W0SA 5DGTA 2ES4A 1TZKA 2QGZA 1FY2A 4LCJA 3TZ6A 1E9CA 4YALA 2A1TS 3DAFA 3IBTA 3VH2A 4R2HA 3L4JA 3KB8A 4FKBA 1G8HA 1TO2E 3QFCA 5LBTA 1T2UA 4V1CI 1MORA 1JVBA 2QRGA 2XI4A 3OHPA 4ZD6A 3A6ZA 2ZI3A 2WV7A 1YULA 4IXNA 1D4AA 1GG9A 3AM4A 3CVUA 3ND5A 1CUCA 2IYPA 2J5RA 4LDZA 1I6MA 1EE2A 4F6LA 1JIQA 3ED1A 4IZHA 1NDUA 3FAZA 2JKZA 2WU0A 3OX2A 3TOSA 4M83A 4ABTA 3FFWA 5EHNA 4RKEA 4RKRA 5AUPB 1UM8A 1Z0AA 3K92A 4K9KA 3QXSA 1X86B 3WWPA 5DNYB 1E7QA 4YUXA 3JAMA 4UD6A 1XMVA 3FETA 4IFIA 4XSGA 2VJKA 3D6HA 1O89A 3JQQA 1GGNA 5H5JA 1QLJA 1SU4A 3I8XA 2QE6A 2HZBA 4GMFA 1HC7A 1DB3A 1Z5VA 3NBKA 3WNCA 1J0CA 4F6RB 1VKJA 2R5NA 4RBNA 4LWZA 3WX0A 3FOWA 5BN1A 4Q7QA 4C3UA 1C3VA 1GUDA 2PR2A 1M6EX 1WXHA 1UWCA 3WV4A 1A98A 2RHMA 3MXOA 4MKHA 4LWPA 2BV3A 2E89A 4HDSA 2GZ3A 4D9KA 4QVIA 4D1YA 4YASA 2HXSA 1PGOA 1Q7GA 5AKIA 5E2BA 4GSLA 1UUFA 1OVGA 2EKDA 3EC1A 4MB6A 4MMXB 2A84A 1O77A 2BCEA 1UMBB 3ABZA 3KP1A 3O93A 3IRUA 3QG5A 2IBSA 1T8SA 4KX5A 1USKA 5HS6A 3V4OA 2LPMA 2ZG6A 3D3JA 3VQTA 5JS2A 3NT2A 4UNRA 1V8ZA 4NCXA 2QTVA 3IHTA 1MGOA 2OZLA 1JDVA 2PUCA 4C43A 2H59A 3SNHA 2ZWVA 4TVBA 3UVEA 2DEUA 2ZQ5A 1GAXA 2CBGA 4M9XA 5B3AA 4C0JA 5FYQA 1IG0A 3MINA 1JILA 2QM8A 4CLRA 4OLBA 4LSWA 4N8DA 4NAUA 2CW5A 2HHJA 4U5XA 2R1UA 1TW3A 4UMVA 2G70A 4D44A 5HJ5A 5LBUA 5I5EA 4ZCPA 3U40A 4HADA 3FMPB 3Q3VA 2GVNA 3GFQA 1G16A 4Z1MA 5HDQA 4JI8B 4WN9B 4AMGA 2VP3A 4YUAA 1S5PA 2E55A 2ZRPA 2IQ5A 2GM4A 3E3MA 1DAFA 1E7WA 3BMOB 2PEYA 3MUNA 2C5BA 3E9DA 3OCJA 4D9NA 8AT1A 3ABQB 4RF4A 3ZDEA 2ZTHA 2SCUA 2H8GA 2YXBA 5JZ9A 4YMVA 4Q9LA 4XQEA 4YAOA 1Z36A 1NBIA 5ES4B 1J1ZA 3MLBA 5F2NA 2F1OA 1Z6QA 1NASA 4DTCA 3I01A 1N8SA 2X1VA 4TYWA 1ANKA 2CNDA 2VQ6A 3JQ6A 3KAQA 2IPNA 2YHIA 3IP3A 4MVJM 4QFDA 4GDMA 5DE3A 3X1JA 5BVHB 2A6PA 2YIJA 4WJKB 4F6RA 2TECE 4MVJH 1QYIA 3GBVA 4C03A 1YZFA 3NW9A 1DI0A 1K06A 2VQSA 3PNLA 4O8ZA 3KXKA 1GGFA 1SUEA 3HA3A 1XQ6A 1E7RA 4E5NA 1UMCB 2UUCB 1LCIA 1S6YA 1PYOA 2A9KA 3KPWA 1CR6A 1Z45A 2OL4A 3EAGA 5EXEA 4KP7A 1PS9A 1PZNA 3Q6MA 3VPFA 5KJ6A 1RRMA 4BP9A 1KVQA 1NAIA 1GKLA 1KI7A 3X3HA 1T1SA 4D92A 2ZBGA 2HBYA 4AJ9A 1UMBA 1E4EB 1TF7A 4FKMA 4PAOA 4W8OA 5IG2A 1XNHA 2J9FB 2LIVA 2CJYA 2VAPA 9GPBA 1SR8A 2AEMA 1U7WA 4ZHQF 2I3BA 4GOJA 5LL6P 3CPSA 3OFKA 1M2OA 1PT5A 1GVNB 1ZMTA 2A59A 2P7HA 3DGFC 3MYYA 2ZPAA 3VR6A 1F7VA 4URYR 2Z5VA 5K2MA 1ZI8A 3EQ8A 4IXTA 3PE6A 4UVEA 4WSOA 5AJVB 5TEWA 1Z18A 1UXJA 3ZDFA 3WWZA 1RLUA 1ATZA 4EPTA 1PNVA 3G1TA 1H93A 1F3OA 1NF2A 5LP6C 1IE3A 2ILVA 2JIPA 3RTCA 1EVZA 1V9CA 1H4QA 2JGRA 1VLJA 2QYOA 4WN9A 3HZOA 4TZKA 2QM3A 3I76A 3T95A 1UJ5A 1SVLA 3IEPA 5KPDA 1GM5A 1MB3A 1YKGA 3F6RA 2BGKA 3FYDA 3KT8A 3BMOA 3BRCA 4JNCA 4R9VA 3PHGA 4MRMB 4Y2PA 4ZT4A 3ROQA 3UT5B 2NU6B 4TRNA 3GAAA 4I8DA 1FFCA 1UXGA 4LE1A 4ZVPA 4XDZA 3NDIA 4MUIA 4U7JA 5SZJA 2V03A 3V4VB 2JDID 4Q03A 4W5NA 3AP3A 1XDZA 2AL7A 2VXYA 3EVCA 2GTHA 4QDJA 2CVQA 3BB1A 1QBKC 4I1OA 2J41A 3K1YA 3QNMA 4TT3D 4JI1B 1ID1A 3I9OA 3NC4A 1DE0A 4NPHA 3L5KA 3RBVA 4CEHA 4ZVUA 4OHPA 1M2WA 1BAPA 1ABEA 2Q3CA 4UBJA 4UPVA 4EY5A 1FTSA 3PDWA 2IODA 1TCBA 1UMKA 3EWSA 2FZ4A 4LZOA 4MQLA 4P2BA 4Q93A 4GYWA 4Q4JA 1L4GA 3OZSA 4H08A 3VGJA 1E63A 2DPXA 3T3HA 1G5QA 3JX9A 2CLKB 4UVDA 5K3CA 4JJ8A 3HTXA 4OMCA 4GDFA 1PT7A 2IYSA 3QPBA 1T36B 1ZU5A 3AFIA 1M2FA 4RGBA 1E4EA 2JVIA 4EHHA 4URXR 3DD5A 5DULA 4R01A 4GI2A 3WLJA 3U37A 4D0NA 4F93B 1EM6A 2GFQA 4UFNA 3ZD8A 1GKKA 3NTOA 4M0DA 1U0HC 2DFDA 4O4IF 4Q7JB 2X9GA 2IH5A 4J16A 3TLCA 4W8GA 1OZGA 1FYVA 1N5RA 3KQYA 4BJHB 2Y1FA 5BURA 4RK7A 4FR0A 2E1PA 4LI0A 3IT1A 4G1BA 4XDGA 3OA2A 2C94A 1NV9A 4KITB 1EVLA 2G76A 1PTJA 2ZJYA 1G5TA 3QU4A 3L1KA 1UODA 3ER6A 4HGNA 3WMEA 4G25A 1QIGA 3QLUA 3AFOA 3TSAA 3GLFA 5TQVA 3OZRA 4Y6SA 4B45A 1BWRA 2QAGC 4X1OA 1YCGA 2NGRA 4JB8A 1XTJA 4I14A 4CDNA 5AVWA 1R4NA 1ODTC 1WXFA 5HTOA 3UWPA 2NU6A 3GJQA 1B15A 1BA3A 1EFLA 1EP2B 1GXSB 2EQAA 2IIVA 1ODJA 2VBIA 3IX7A 4G4SO 3UAVA 5BQXA 5SYAA 4E3WA 5JSHA 3GUZA 2CMHA 4TM8A 1QMPA 1RKXA 5IABA 2BFFB 1P6XA 3OKAA 1MOPA 1QHIA 4IX1A 2PA0A 4HQRA 4X24A 2D59A 1TW2A 4CW7A 3M33A 3I0MA 1QC5A 2Y67A 4FFMA 1KXJA 4N40A 3DVSX 2FPPB 4NPCA 5KQPA 1R4MB 2GEVA 5COQA 4CV3A 3FYUC 2V65A 1S3GA 5IJ0A 5EJ4A 1GCUA 1R3DA 1RM3A 3U61B 3I9LA 2PO5A 2VT7A 1RC8A 3L77A 5FOUA 2PKRA 2QVLA 3NRBA 1UEJA 3MD0A 1C80A 3ANLA 5NLLA 3JYLA 2F55A 1EJBA 2JFGA 1W581 3HADA 5E7IA 4P32A 1U02A 1UKEA 1NG9A 4XWGA 2X2OA 4O3FA 4G0XA 2QBYB 2NX2A 2YN2A 3JQAD 1YTLA 4GLBA 4K46A 2ARKA 2BGRA 2PR7A 4R2XA 1B93A 5ADUS 5K8JB 1LBHA 2R6AA 3PE3A 3Q8XB 5D7NA 1G8FA 1PR4A 1ZWKA 2YMQA 2PIAA 4QEZA 3WGVA 1W7AA 1VCOA 2EKBA 2OLKA 2VNHA 3H8VA 4M0EA 3VR3A 1HNWB 2VUHB 2ZI6A 3DEHA 4KREA 3TUJC 1UKVY 2G25A 3N5KA 3IOMA 3KU4A 1RYZA 4IIEA 2IIBA 1NJGA 4TS9A 4D3ZA 3KD3A 3C15C 4OX9Y 1QDUA 1X9GA 1ZKDA 2Z6VA 1HZZA 2APJA 4CEJB 2ZUFA 1TM7E 4KWEA 1TMYA 3D6MA 4RTNA 1O1YA 4PPFA 2AV6A 3BILA 4YJHB 4GZLA 1O58A 2V7GA 3V4ZA 5FBKA 3AMVA 4DMMA 3P9PA 5EJ9A 4AQ7A 5EXSA 3M9LA 1OH8A 2Z56A 4A27A 4WT7A 4PPYA 1Z8HA 5GVRA 4YRIA 4MPDA 3U3DA 1S2MA 3HVRA 2ZU6A 4Z99A 1XK7A 2HWYA 2PFSA 2XQKA 5HXAA 3IKMB 4OLFA 4XOIA 4F2HA 1NP6A 1ZH2A 3MCZA 4HKTA 2NZJA 3F46A 4IIVA 4G9GA 1SMKA 3BD9A 4UQLA 3EVEA 5ILGA 1XQ1A 3CG4A 5FPQA 4BPBA 5IX8A 4C4AA 4U4AA 3PPYA 2FPPA 4Z54A 3PC7A 1KY5A 1P61B 1ZL0A 1SURA 2ZTSA 4F9TA 1OYWA 4I08A 4MW2A 2L19A 1IWBB 2WPDD 1NVBA 4UUNA 1YJ8A 2RMKA 5EG5A 3OPVA 1JSRA 2VKTA 3OMLA 3ZE8A 3B3QA 3EOAI 2ZAIA 2NWQA 4CHTA 3T5MA 4B6RA 5JI2E 4YRKA 4RD6A 2AXNA 4A6XA 4M1SA 4DPMA 4P4GA 1BS1A 3N39C 3WLAA 4LGMA 5TS2A 5KHOC 2DGDA 1EFRD 3PXDA 4Y0VA 3NJ4A 4ZYZA 4HYQA 4MRSA 1DAMA 3L0IB 3QIAA 2A4MA 3GEIA 2J9ZB 4ML3A 4PVCA 1E6WA 4O1HA 2WRZA 4DJTA 4JP5A 4EGCB 4N0QA 5G41A 3PFCA 3RRMA 1AO0A 1WHSA 3NNDA 3ROEA 4B3CA 3KWJA 2NXNA 4IW3B 1FK8A 1GL6A 2IYNA 2PRZA 1G8PA 3NCTA 1WSBA 3E3OA 2Q50A 3UJCA 3VR4D 3CZ5A 1CUVA 1SCJA 4B84A 4EDFA 1A2KC 1TU4A 1OAKA 1UBUS 2REBA 2O2SA 3WKEA 4FYIA 5TMDA 2CXQA 2GYYA 4ALNA 1A5TA 2ISQA 4IMIB 3RFVA 3KSRA 2RGDA 4JBYA 2VWQA 2K6GA 4YJHA 5FLYA 1QG0A 2ID7A 2P5UA 4AN0A 4B5KA 4C6TA 7ABPA 2H1FA 3RT9A 4OOEA 1I3NA 3EEBA 4KEAA 1KI3A 5IT4A 4ANFA 3W2TA 1ORWA 3AU9A 4FWBA 1WVMA 1L4FA 2DBZA 2A78A 4QHSA 3RUIA 2AZXA 2H3HA 3CR8A 3G8DA 2R7LA 1U0NA 4X1IA 4LVNA 2XYRA 3DXFA 5E1MA 4G01B 2GPYA 1GYPA 1NJFA 2QUAA 3EG9B 3GD7A 3EVZA 3KBBA 1KQOA 4XR4A 5CHYA 3FOCA 5BN4B 5LCXA 1JQEA 5JYBA 4CLOB 3LQQA 4FLMA 3QYAA 1H5QA 1MVLA 5JTUA 1P62B 2WUGA 2CMGA 4KVAA