1RRCA

T4 polynucleotide kinase bound to 5'-gtc-3' ssdna
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
288
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*C)-3'
publication title Recognition of DNA substrates by T4 bacteriophage polynucleotide kinase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
total genus 94
structure length 288
sequence length 301
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrcA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1rrcA02
2AH5A 1QHXA 2ZEJA 4PSVA 4RZUA 2NIPA 4ON9A 3PFIA 1X3SA 4GOXA 1GRNA 4JVSB 4NKRA 4XTRA 1U98A 2QQ0A 1K5GA 2LKDA 4ZKDA 4WW0A 1IN8A 1GNQA 3AH8A 1OE0A 2RGNA 4HSEA 2ZQ5A 5GADl 4D0NA 2BBTA 3SYLA 4R2IA 2VKQA 4QOSA 2V54A 2F43A 4B2PA 1XTQA 2PMDA 4I1VA 2IUTA 3S1AA 2PH1A 3B82A 3QYPA 1KI6B 4V0ME 5AVRA 2XAUA 1N8NA 2AWNA 2ZR7A 2O8EA 2Q4RA 4YH1A 4J0QA 4FCTA 1F5NA 4Z8XA 2WOOA 2BY4A 4AD8A 3VNVA 1ZS9A 1N5IA 1E2HA 2NOAA 1X8KA 2OLKA 2WJYA 4PZYA 4EJSA 3DEFA 5TB5A 3F3YA 5J40A 2Q0HA 3A1UA 3V4RA 4PPGA 4C9BA 1NMXA 3UMBA 5DHAA 2WF5A 1FTNA 1FOEB 1P7CA 1ZD4A 2FUCA 4JLBA 1P9WA 2OG2A 3NDBB 3VKHA 3OEED 4R71A 4JYBA 3PENA 2GJ8A 1US8B 3D3QA 1IJFA 2C98A 3MWKA 1CP2A 5K8UA 1ETUA 2VP9A 2A78A 3GLIA 1LFDB 3AGPA 3IRUA 4G0NA 5CIQA 2OFWA 3JVUA 1RIFA 3WP0A 4Y2RA 5ALGA 2IYWA 4AY2A 2AWOA 1SVOA 1S8OA 3I4LA 3EIEA 3IHLA 4Q4HB 4HUQB 3N1UA 1W2HA 4F4IA 2QAGB 4NCIA 4TYYA 3ONNA 1E6CA 4C0KA 1Q22A 3SEAA 1E2EA 1P60A 3OCZA 3SJZA 5KSYA 4YDHB 421PA 3PR1A 3CZ4A 4JSYA 5HZKA 4RD0A 3LXXA 1AQ6A 1XB2A 3TLXA 1G8FA 4HDCA 4TMVA 2ZI6A 2I55A 1X1RA 4HEJA 4Q48A 4IVQA 2QLTA 5JWHA 4C0LA 3GFOA 4FINA 4C0BA 2NG1A 5L8VA 2YVUA 2JJ2A 4BEWA 2OXRA 2IS2A 3UIEA 4M9ZA 3PEYA 2JEOA 4PO8A 2UVQA 5LB4A 1ZNWA 3SFVA 3HPRA 3FB4A 1IWOA 2PZEA 3I6BA 4OQLA 2IF2A 2PCLA 2WOJA 3BORA 4NV0A 3UKDA 3GLHA 3L8EA 3Q7QA 2A9KA 4MUMA 4EEKA 3VR4A 2W6JD 2F3TA 3OEHD 3GLGA 1U7OA 4HGPA 2I6XA 1R0YA 2CJWA 2GILA 4V0NA 3T1OA 2C9MA 1KI7A 4MRPA 1SXJC 4C7OA 2D74A 2QPAA 4I9FA 4JVLA 3ZS9A 2OEPA 4OBEA 2X2FA 4Q7MB 1OIWA 5GJVC 3QBVA 2J7PD 3KX2A 4B3CA 3WNBA 3EG5A 3ADCA 4MUBA 1CKEA 2Q9BA 5ALRA 2GXSA 1LNZA 3SC3A 1KI8A 1SWWA 1XD2B 1U2RA 1XDBA 3LW8A 1ZD5A 2ZE6A 4RD2A 3THWB 4Q03A 2ZJ8A 5FPYA 4NYMR 4EKDA 2HUPA 2FPXA 5KPJA 4Y0VA 3QPUA 1ZP6A 1N6OA 3BB4A 5EE1A 4F93B 3CNHA 3C4JA 1KZGB 1GP2A 2GZAA 3RRYA 5ALHA 2F6RA 5CJ2A 4A92A 1CF4A 2ZITA 3CZPA 4DXAA 3A4NA 2DPXA 621PA 3GJXC 4C4PA 4XSHA 2JLWA 5JJBA 2R8XA 2ZM5A 4Q02A 1EG7A 1X6VA 4WZBE 4ERNA 3QU7A 2WWYA 2IHYA 4NYMQ 1D2NA 1E2DA 3C7KA 4C4RA 4BRWA 1AN0A 4KFUA 3OIWA 3B8HA 3FYHA 3HR7A 2PZGA 3PCRB 4AG5A 4GZLA 3KQHA 3K0SA 2KE5A 1R6BX 3L1UA 1KK1A 1VHLA 1XVIA 3LLMA 4BLRA 3BFKA 5E0OA 1I2MA 4GT1A 1YMQA 3UWKA 3ESRA 1R5OA 3N2EA 3D6JA 3P20A 4IOMA 1EFCA 2B8JA 3DHWC 4I1UA 2KB0A 2H5EA 2B30A 1DAIA 4U7DA 4CEJA 1L8LA 2FFBA 4GBMA 1DARA 2R8RA 2GHIA 5FL7A 1TNDA 4ZI3A 1U2TA 3GJ7A 3AVXA 2P3SA 4UNQA 1JAIA 4V02A 5KOYA 1Z08A 3SFZA 1Q3TA 1YJ5A 3WMEA 1HEIA 1XD9A 2VSOA 4LDJA 3WP1B 4JLPA 3P26A 5AKJA 1CQZA 1KO8A 5JRZA 1G6OA 2CLDX 2R6GA 3U7FB 5AI9A 3O8DA 1VCMA 3K53A 2GVZC 4HB4A 1RMTA 3PVSA 4OFZA 3O8BA 5AUQA 4FD2A 2VP2A 3AQ4A 1DEKA 4LJAA 3ZD6A 1KK3A 5E4FA 4QJBA 4KJZA 5AK6A 1Z5UA 2GNOA 1I2DA 2ODWA 4LV8B 4HATA 1JQLB 3DZDA 4ARZB 1DBSA 4FMCB 3AVPA 4O2RA 3AB3A 1EK0A 2OO7A 3TUJC 2ZOSA 1N25A 1ANKA 4B71A 3B1XA 3QU4A 4YIKA 3KQLA 4IFTA 2FF7A 1KO7A 2XJ9A 5BN4A 1KSJA 1QVRA 4MGYR 5KTYA 2QYHA 1UKZA 2B1RA 4LC0A 3ZX4A 2GTPA 2PMKA 1XJCA 5H70A 3FMOB 5AKYA 2IYUA 3RSLA 1MH9A 2ONKA 4EELA 1S2MA 1YKSA 4E03A 5IT5A 5ALTA 3ICQB 5AKGA 4A2QA 3RC3A 4TQUS 4B35A 5AI5A 1HQCA 4ZPXA 2J0QA 3SNHA 1E9BA 2N1BA 3KBBA 4EX6A 3LX8A 1M2OB 2FJUA 3VR1A 5AVUA 1VCOA 2F3RA 4G5OA 5JI2E 1F2UB 1P75A 2HJGA 4OQMA 2DCUA 2HT6A 2HF8A 2OCYC 4PHGA 2OFXA 1G41A 2WV9A 2XNDA 4MRSA 3WYFA 3B60A 5ALOA 1AZTA 1IXSB 4ZDWA 1L4UA 2DHRA 2YC4C 1G3IA 2N42A 3EZ2A 1XWIA 2YC2C 5AK0A 4U5XA 4MDEA 3FHTA 1WP9A 2R62A 2JIZA 1JPNA 2JAQA 1YS9A 2ZYTX 5AWFC 1LTQA 3CRVA 1CRQA 1F3OA 3MWJA 5EXSA 3NC0C 4PNHA 3VU9B 3W3ZB 1XPUA 2C77A 4MGKR 4TMWA 5KSPA 4JVMA 2GK6A 2ZTSA 3ZWKA 2BWJA 4MQBA 2QSZA 1VIAA 2OBMA 5CK4A 1IHUA 1Z8FA 3CF6R 3L8ZA 3HLTA 3CRRA 5ALJA 3DAOA 1ZNZA 2FG5A 2IYYA 4V0KA 3HDTA 1RDFA 4E88A 4TT3A 3U5ZB 4MKHA 4Y2XA 1ZUIA 5JSZB 1G3QA 4NE2A 3ESQA 2I7DA 4HB3A 2C9OA 1NY6A 2B7BA 2BDTA 4PHTA 2BDUA 4BX0A 1G5RA 2ZU6A 3A37A 1N0VC 2QBYB 4GXTA 1RRGA 2RCNA 1E1RD 2G1KA 2QM8A 1FW6A 4GL2A 1XEWY 2GXQA 1J70A 4X8LA 4M2LA 1Z2AA 4WVFA 1H8EA 2AN9A 4B6EA 1C4OA 1DS6A 4MGZR 1UKEA 4NPHA 1EESA 1RW4A 4NWIA 4C2TA 3LAWA 3QI2A 2H57A 1E2IA 2C78A 4Y3UA 5TVKA 2G88A 2YINC 1NRWA 3M0EA 4DHEA 3GJ8A 2C8LA 1N2CE 1H8HA 2A3RA 2JCSA 3AF1A 1TTTA 1QQ5A 4MDFA 3W5AA 2RGGA 4Y2SA 3K9GA 3PXGA 4G1UC 1BS1A 4LOAA 4PZZA 4QG7A 2D2EA 1RFLA 4G01B 2XZOA 1F5SA 1DAKA 4XSGA 5A0FA 4RD6A 2W58A 2HXYA 4U02A 1ZJ6A 3DM9B 3ICEA 4EPRA 1CBUA 1ZBDA 1L8QA 2J87A 1VG8A 2NO0A 4PQYA 4DUGA 5IK2D 3A36A 3O8CA 1XJQA 3OFNA 3CLVA 4UKDA 4ZDIA 4ILEA 4BASA 2GBLA 3NIWA 1KAOA 3QNUA 1IM2A 3AUYA 3A4LA 1SKYB 1CEEA 3T1VA 1EWRA 1NKTA 1SVIA 1P72A 4I81A 2YY6A 2GCOB 1TA0A 2J0SA 3ZYCA 1AKYA 3H2YA 3TUIC 4Q7JB 4DLSA 4BFZA 2CFSA 2XSZD 3CF0A 4Q9JA 3WY9A 4YONB 4UMVA 2V7QA 2WFAA 1DO2A 1G19A 4LRWA 1SU4A 1XXHB 1ZU4A 4D80A 1S1CA 1P4SA 1UBEA 3BB1A 1VJRA 5JZVA 1EXMA 1IN5A 4LK2A 2YOHA 3V4FA 4A8JB 3CWZA 3U7GA 4TN1A 5HKKA 1NF2A 4PPFA 2RARA 3KFXA 4TWZA 1HQYE 5F2EA 1W49A 1MKYA 1R0WA 3BAFA 4QGFA 4P4TA 4QXAA 3SJCA 1WPGA 2J0UB 3IJ5A 1AQUA 1HE8B 4OKSA 1KMQA 4BFUA 1BYIA 4R98A 3AF0A 3H84A 2HO4A 3T06B 2O5VA 1KJZA 2NZJA 2WJJA 1S3SA 2BIFA 3OAAD 4Q66C 4YMUA 4LBVA 5B57C 5AVSA 3KDPA 1E4VA 1W5TA 2IUUA 1VIYA 2PJZA 4F7WA 4EJSC 1G7SA 3HWSA 4IFEA 4RCYA 5AVYA 2PX0A 1EX7A 3AEZA 2O0KA 3U4QB 3I1FA 2FV8A 3OZXA 1YR9A 3I62A 3RS7A 5GJCA 4DB2A 3E8MA 4N1AA 5JECA 3OCYA 4Q21A 1PJRA 2JDIA 1GOTA 2ORIA 3SZRA 1Z6XA 4FXPA 4KU4A 2YKGA 4LY6A 1L7MA 4LUCA 4RESA 3FM9A 1Z4KA 2H7VA 3IPXA 2G07A 2CK3A 3CM0A 3E1SA 4PFSA 4L15A 2QROA 3EC1A 5AJWA 2AD5A 4Q01A 2D2FA 1NY5A 2P5TB 3SJAA 3U2QA 4EFLA 5LD2B 1EK1A 5ALDA 4G5GA 1XEXB 2B82A 4A0GA 2FPKA 1G7RA 3NANA 2FEMA 4RKFA 2Z0MA 5JCZA 3KOOA 1W1WA 4KYIB 4FCVA 4W5JA 1I4DD 3C8UA 3LV8A 1FPMA 1E2GA 1ZRMA 5AJZA 2I34A 1KY3A 1KI2A 1XCPA 3UWOA 1G64A 1S2OA 2GA8A 3FVVA 3ED5A 4BBJA 4TSFA 3T12A 6Q21A 2IYEA 3QKRB 4Q1AA 3KKPA 3SQWA 1S3GA 2H17A 4M4SA 2O8BA 2P6NA 4I99A 1OKKD 3IQWA 1G8PA 1MO6A 4L8GA 4BEVA 4XOUA 3LD9A 4RVCA 2NPFA 2FSFA 4Q18A 4DCVA 3AVOA 5BXQC 4BNDA 3P1JA 3FPBA 1L6RA 4QRHA 2QSYA 2ZETA 3I92A 2ZXEA 1S4QA 1ZJJA 3CBQA 2WICA 4LJ6A 4PHFA 4BGDA 2JLSA 2FPRA 3FKQA 3KKMA 1XMJA 2C95A 4DT1B 1UPTA 4KV9A 3U61B 2IOHA 5AESA 3CX7A 4HB0A 2KSQA 2REOA 3CF2A 3NBYC 2VO1A 1KI6A 2XITA 2HYDA 3WRXC 1G1MA 1KJYA 3B78A 2W2TA 2R8EA 3WKAA 1P62B 2JGNA 4ABYA 1ZC3A 1UF9A 3SE0A 1RRPA 1D9ZA 2Q21A 1GRQA 1U99A 2JLZA 3I3SR 3ZZ0A 2VQSA 1II8B 2V6IA 4JLJA 4CVNA 1JXMA 1T5LA 3Q3JB 2HV8A 2OZEA 4QHSA 4QNRA 5SZIA 5F9FA 1YNSA 4A9AA 1Z6TA 2VHCA 3A1WA 3NH9A 2NO5A 4QM6A 1US8A 3KXKA 4QKQA 3OEHA 3P27A 5CJPA 2ODNA 4HGOA 5E7IA 2O8CB 1L7PA 4TYNA 2XTMA 2C99A 4D6PA 4NZYA 1T4GA 4Q4HA 2ZI9A 4HUQA 4KFRA 3K09A 4DIDA 1LF5A 2QAGA 3LH5A 2MMCA 4OI0A 4C0AC 3FDIA 1U8ZA 4KI0A 2IYVA 3B9BA 5AVWA 1XMSA 1X86B 1SVLA 2FE4A 4IVRA 4JBWA 1TJ5A 4LBYA 1TAGA 2EWVA 2QPTA 5BW8A 2XX3A 3N2IA 1N6HA 4BFSA 3IEUA 4MRRA 2GFHA 5G40A 1OXSC 1BIFA 2BKUA 1JAHA 3B2EA 5ALWA 4C4TA 3DOEA 5DN6D 3TK1A 3A3YA 2YMLA 3R8CA 3L0BA 2EFGA 1FQJA 1TADA 2F1RA 5AM0A 4DRZA 3HU3A 1TEVA 3OE7D 5IS2A 5EE3A 1E9CA 1HH4A 1D5CA 4A15A 5J4YA 1Z4PX 2QGZA 2A7QA 8OHMA 1XXHE 1A7JA 3L0OA 1NBMA 1RYFA 4B75A 3EXAA 5B30A 1T0HB 2JJ8A 5L3SA 1WBDA 3W5DA 1EFHA 2C4NA 2DBYA 5BYJA 4EQ6A 4KHZA 3SR0A 3PUZA 4LSGA 3QIAA 1OV4A 4MKFA 3TVDA 4HAYA 2VP0A 5AVTA 3X1YA 3D8BA 3DDCA 3FFAA 4BEJA 1SHKA 3CR7A 3U44B 3F5FA 3ZI4A 3B7GA 3B1ZA 4DVGA 3TKLA 5JJKA 2R8ZA 1XD2A 3FMPB 2CHVA 4TQAA 4RD1A 1D2MA 4DLWA 4Y2QA 3KFVA 3THWA 1WR8A 5AW2A 2QENA 4YCLA 2H1LA 2W83A 3W3AA 3U3RA 2O0HA 4CEHB 1CLUA 1KI3A 5FTKA 2JLYA 4UJ3A 4DCCA 1WQ1R 3RC8A 1DAHA 1G4UR 5GVRA 2HF2A 2ZJ5A 3C41J 4HYTA 2MMGA 1FL9A 3CB4A 3KJEA 2YWEA 4LJ8A 4UNSA 3J7TA 3AF3A 1G8HA 2IHBA 3TQCA 4WXRA 2DYKA 1Q91A 3BS4A 2P0EA 2WJIA 5TARA 3TW8B 4A6XA 3W90A 1Q92A 1MABB 1XEWX 1SWVA 4H9GA 2GJKA 2AUTA 4YGYA 2YNMA 1EFRD 4MH0R 2YMQA 1M8PA 4A0RA 4KX5A 1MH1A 1XTJA 3WMFA 4Y2UA 2CHQA 3SLRA 1KYIA 5AW1A 4LYFA 4XJXA 4Y2TA 1CTQA 5ELXA 3AVTA 1RC8A 4JDPA 1GFIA 1HTWA 2ZYWX 3AVQA 4TTQA 1OXTA 1GSIA 1W36C 2JGAA 5AK3A 2BMDA 4DSNA 4PO1A 4N0DA 1NVUQ 3BIFA 5AVXA 3MJRA 4UAVA 1KJWA 5EQTA 4OYHA 5DO9A 4CF4A 1F60A 3KB2A 3VMFA 1JR3A 2DFTA 4NL4H 3MJHA 4IOKA 3MUFA 4ZCLA 1WBBA 3K0CA 5FBQB 1LF0A 1QG2A 2QE7A 3NEJA 3R20A 4WXPA 4YMWA 5EP3A 2HLDA 5E7MA 2FZ4A 4FMCF 4EAQA 2EARA 1G3MA 4AS3A 2W6IA 4KODA 1BO6A 5AW0A 1GL7A 1GDDA 3CO5A 2RGCA 2ERYA 2G83A 1MR3F 5FTMA 4UASA 3THYB 2ZRAA 4RZ3A 3EW9A 2ZUBA 1KI9A 1AGPA 2ZAOA 3X2SA 3MN1A 4LYJA 4Q1BA 4ARZA 4OD0A 1X1SA 2NYVA 2ZJYA 2Q5EA 2F7SA 5SZJA 5B64A 1S8FA 4XVQA 3DZ8A 3V00A 1Q20A 4A0HA 3KD3A 1E79D 3H4MA 4OJKA 3IB6A 1OF1A 1ZUHA 3JZAA 5B2ZA 2WMNB 3NALA 1G3RA 3TVTA 4D2IA 2HF7A 1GKYA 3EF1A 2C88A 5FUWA 3ZZTA 5CITA 2FPUA 2HYIC 2VP4A 1ZD3A 3VR3A 1KIMA 3BFVA 4JBXA 3DV9A 3FMFA 1WA5A 1RKBA 2Q9AA 4LI0A 3QKSB 1QH9A 3DKVA 1IQPA 4KFSA 5HE9A 3AKEA 2ZE8A 4PQFA 4HI0E 3N70A 3WNCA 2XZLA 2GKSA 1OJLA 4C0QC 4EENA 3KQKA 1XTKA 3WKDA 4RY2A 5HCIA 5EZ5A 2RBKA 3P4XA 2BCJQ 4BKMA 1QHSA 2P67A 1NG1A 1KAGA 1J8MF 1E1RA 1TEXA 5CIWA 1PW5A 1KYTA 2EFEB 5J47A 5TV2A 1KKLA 3QXSA 4GMXA 4RSGA 5AK4A 3LQRA 3LW7A 4R7ZA 2OFOA 3WNDA 5D3MB 3ASZA 3H86A 4Y0AA 2ONJA 4L16A 2FDCA 1KSHA 121PA 2P9JA 1Q1EA 4JMPA 4DB4A 2GWHA 5FUYA 2UZIR 2I1VB 2ZR9A 3VU9A 1N5JA 1SXJB 1HA3A 4JLAA 4W5HA 3AV0B 3T5GA 1F6BA 4PAQA 1YZNA 2WIBA 3M1IA 1KI1A 2ORWA 3EZ9A 4CZ2A 1MV5A 4GZMA 4IEEA 2CL0X 4K8OA 5IDVA 5AUNB 3FZQA 2GMWA 1ONBA 4OK3A 3E5HA 5AW9A 1Y3AA 1E4YA 1KY2A 4Z1MD 1G291 1E3MA 3L0CA 1HE1C 4W5WA 4MYUA 2WTUA 5JSZA 3AF4A 1EWQA 3QU5A 1S96A 5AIAA 2EW1A 1L7VC 4FE3A 3AP1A 2V1XA 1WMSA 3HP1A 2RGEA 4QNMA 4JL6A 3VX4A 4TL8A 2QBYA 3KKOA 3WGVA 4IOJA 1Z63A 1B23P 4MA4A 4RFSB 4QHYA 1ZNYA 2JAWA 2QQEA 2RHDA 2P27A 3AKDA 2ZSEA 2G0NA 1GKUB 3UMRA 1SVKA 4L6AA 2AXNA 2CCGA 4YXWA 4B32A 4B48A 3PIRA 4QL3A 4CF7A 2B8EA 4JL8A 4DCSA 4DLXA 2CFRA 2QTFA 2MSDB 4EFMA 2XOKA 4PSKA 3ZX5A 2CCKA 2K5UA 4NFLA 4ZO4A 3AR6A 4NCNA 3U3OA 4HZUB 2HDOA 1UBFA 1K8RA 3OAAA 4J03A 1SXJD 4RCZA 3TUZC 1CJUC 3ECCA 3KQNA 4ZDKA 3CNLA 3BH7A 2IYLD 3SDZA 2R8YA 1OSNA 3QOFA 1R2QA 5K8TA 3ZQ6A 2ZYUX 3SD7A 2BVNA 4RD4A 3CR8A 2NQ2C 1YE8A 1YRBA 1MT0A 5IHPA 2JLVA 3A1EA 2GAOA 4ACBA 1CU1A 4XWOA 2ZBDA 4M9QA 5AVQA 3GJ4A 1G3UA 3GFPA 3QX7A 2GCOA 2ZRNA 2R6DA 5L3VA 4PQRA 4IRUB 2OYCA 1J99A 2NGRA 4NYIR 3GPLA 2XXAB 3EASA 1E1QA 1KTVA 1NLZA 2ZE5A 1AJEA 1CJKC 1W0KD 1U8YA 1Z29A 5TXGA 1TQ6A 1I4TD 1P61B 1GVNB 5AW8A 4F92B 4D0GA 1XTRA 2ZSAA 3CRMA 5LDDC 4M9XA 2DFLA 3SHQA 1IY1A 2GF0A 2REBA 5JWRA 3IIKA 3LFUA 1TF5A 1YU9A 4JT2A 2LKCA 3GJ6A 4HAIA 1JEEA 3VHXA 3CWQA 4UNNA 2J0UA 4B2IA 4KLZA 2V8OA 1FX0B 1SVWA 3PJRA 2PEZA 4YMTA 5ANRB 1E2QA 4NYIQ 5DYGA 5A3SA 2ZS7A 5A5GA 4Q1FA 4CF3A 1O3YA 1ZD1A 2QMUA 2VH5R 3QJYA 4EPVA 3RS5A 2V3CC 4G9BA 2C9YA 3OESA 3K0EA 2VHQA 3TSWA 3U4QA 5FOTA 4RKEA 1GL6A 4F71A 3ZZUA 1CJMA 2N46A 1D8TA 5FL3A 3WXMA 5HE8A 2WHXA 2GJ9A 2I4IA 2ZE7A 4LCBA 3U19A 2UKDA 3SS8A 2PEYA 3L1VA 3KTAB 3SBDA 3WYAA 2J41A 1YQTA 2E1RA 1RRCA 5AM3A 1OYYA 4QBFA 1A5TA 3C15C 4QQFA 1GNPA 3L43A 1NJGA 1AGRA 1XEXA 4C0JA 5J4LA 3CPEA 3QXGA 2NO4A 3K09C 1YR6A 2CHGA 3FKSA 3GP8A 4JLDA 2FFHA 3WHLA 4ZDJA 2NMVA 2MSCB 4JB3A 4YDSA 4Z51A 4AG6A 5M04A 3QNMA 5AIBA 4JIMA 4CW7A 5KUTA 3QF4B 1KHTA 3AR5A 5JEEA 3NKVA 3MWYW 4KFTA 2ZBGA 4EIWA 2WWWA 1RKVA 2CXXA 4XD7D 5KDDA 2Q9CA 2Z6VA 1OH6A 5AM5A 1Z06A 3CONA 3L8YA 1J8DA 1MRSA 1QHIA 2IYTA 4F4JA 5JS8A 3FHCB 3I28A 3VKGA 1T5SA 3Q85A 5AK5A 3VR5A 4FWTA 2FSGA 2CDNA 3DM5A 3V9PA 3HJNA 4KXFB 3SJBA 5EXPA 1P2SA 2ZRIA 2FOLA 3EA5A 3KJHA 1KNXA 3WMGA 5ALYA 3ADKA 3L2OB 5CDFA 2OHFA 2JLUA 3WK6A 3CX6A 2EAUA 5AKHA 4MKGA 1N6IA 1SXJE 1JNYA 1YZKA 5LBIA 4B47A 5KDLA 3MWLA 2JLQA 1HYQA 3BA6A 1DADA 1PVOA 1WE2A 5AW7A 4POAA 3I8SA 1OFTA 4RJLA 1P73A 1QBKC 4P4SA 2P65A 4URWR 4ASUD 5ALFA 3CZQA 3NRJA 4YCNA 4UAUA 5BN3A 3EPJA 2WWGA 5FOWA 1ZM7A 2FPWA 5LB2A 3TGPA 2I54A 4BFTA 1DG3A 3U3MA 4OI4A 3R7WB 5TMPA 3RAPR 2A2ZA 3L0IB 4JVNA 1VG0B 1II8A 1QHYA 2ZRJA 4NH0A 3RLFA 2FN4A 2GJSA 3SN6A 1A2KC 4X8OA 3NBZC 5AKZA 2EFCB 2YJTD 2EFDB 2PT5A 1J8YF 1YZLA 3B1YA 3IDQA 5FPHA 3TJZA 3L82B 2EATA 1UM8A 2AFHE 3IKJA 4HAVA 4UQOA 2WPDA 3M9LA 3HYRA 1IOZA 3EZ7A 3VR2A 1E9FA 2G77B 4JL5A 2A5FA 2ZI4A 3ZD7A 4EX7A 4KNVA 4WZAE 3T61A 1Q44A 4GDFA 1T8TA 1U94A 2ZI7A 2PLFA 2IF0A 5C1BA 4K46A 4UNPA 2VF8A 2R6FA 4GOKA 4PX9A 3ADBA 3AP3A 2JJ1D 4P0TA 1DELA 2FPLA 1T3HA 3Q8XB 1L7OA 4ZCIA 2P5SA 3GLFB 3E58A 1XPRA 2ZVQX 1RVDA 2WZQA 1J2JA 1KOFA 5J4HA 3NBXX 3BH0A 1E2NA 2D62A 3IIMA 2CVHA 2YMMA 5ALVA 2G80A 3KKNA 1R8SA 3LBIA 1UBCA 3LRPA 1ZUNB 4L5BA 2CN1A 2YJ5A 4YC7A 3R8FA 1QHNA 3AVWA 3N07A 4PPNA 3DOFA 1SVSA 1NMYA 4GRAA 5DLQC 4DSUA 1GWNA 5H68A 1LV7A 5JFGA 3WK9A 2F1IA 4HLUA 5FI1B 5FPSA 3WBJA 4L9SA 2W43A 4M9SA 4V0MA 1P2VA 3ZIAA 4QJ3A 1Z3IX 2G0TA 4M1KA 3AGQA 2GRJA 3LLUA 3O47A 3IHWA 4Q7KA 1W46A 5KO2A 3K0CC 3S6JA 4KCGA 4HGRA 3A1SA 3NASA 4PR0A 4TMKA 3TLMA 1LVGA 4KNWA 2IYZA 1DVRA 1COWA 4Q9KA 1FP7A 2ZSBA 4HGNA 2FGJA 2GK7A 1ZD8A 2HXSA 3AR8A 2R6AA 2IOFA 3UMGA 3L8HA 2CNWA 4J2TA 4W7SA 2WSSD 2Z83A 1DPFA 1ELOA 1Z07A 4M0LA 1TU3A 1NN0A 4WIAA 2ZYVX 4XH9B 3MC1A 1OFHA 2F9MA 5AVZA 2ZRMA 4FW9A 2ZUDA 2IC5A 4JJZA 4KVAA 4CEHA 1OHHD 3QG5A 4BX3A 2AXPA 3FGNA 1Z0IA 4B43A 3P4YA 4F38A 1Q12A 4V0LA 1OH7A 4OI2A 2VPPA 1A2BA 1E9SA 1OXUA 2RAPA 2QAJA 3BRWD 5EE9A 1R7RA 1XPJA 4KBGA 2BMEA 2QP3A 3ZU6A 2QN6A 2QTVB 1MABA 1XPOA 2OBBA 4FMBB 1W47A 2MSEB 1WB9A 3BC1A 1S9HA 3CW2A 1O08A 2VHJA 1OW3B 4I1SA 3J81k 4URXR 2O8FB 5EJEA 3HYCA 1FP6A 2J7KA 4D81A 5EP4A 5EP1A 4NYJR 4LZZA 4JKYA 4A2WA 2W00A 3VR6A 5A4JA 3IBGA 4XOIA 1E79A 3PUWA 4JBYA 1VCIA 3KZ1E 3GJ5A 2ZU0C 5DNYB 4LJ9A 3EPLA 3U13A 2V1UA 5CYOA 1RLMA 3EIQA 2QI9C 1XU4A 1FZQA 1A82A 2EWWA 2FNAA 2RGNC 4UNRA 5AW6A 2PJRA 3LBHA 4O2LA 3SKXA 1MOZA 4GI7A 2EQBA 5FPTA 5AI8A 1E0KA 2B21A 4YQFA 4OQNA 4Q19A 4W9MC 3GLHB 1Z5GA 1IN4A 1G18A 1ZIPA 5IT0A 1E0AA 1PUIA 2W11A 4NYJQ 1OIXA 2CJWB 4TYQA 3MPOA 3ND9A 4DDWA 1DE0A 1TUEA 5AHXA 4BX2A 1AK2A 1T0JB 4DDVA 4ESHA 3I72A 1CR6A 1F48A 1HV8A 1DAGA 2ZJZA 3UK6A 2D3WA 5DYIA 2CE2X 2GVDC 4GMDA 5H1YA 3ZLJA 3AR3A 1SKQA 1E2JA 4NHOA 1FTSA 3QVVA 3THYA 2UZ3A 2AGVA 2PBRA 2F1HA 4G5QA 3M4YA 1FQKA 3AM1A 1GITA 1GG2A 1G9XA 4CGZA 4HAUA 1GKIA 3MMZA 3MAAC 5DI3B 1DAEA 1NP6A 2EVWX 5F98A 4TZ0A 1EK2A 2RGDA 3WK7A 5KDOA 4ZEXA 3F8TA 1WCV1 1Y8AA 3AVUA 4LJYA 3TR0A 4CDGA 3ET4A 3QE0A 1PLKA 1T6NA 1OLOA 1PUJA 1E9EA 2CE7A 1UDXA 3OCXA 3H0KA 2ZRKA 3QUCA 3AVVA 1XCMA 2JJ2D 3IIJA 2DWOA 4LHYA 3AKCA 4LJ5A 4B3FX 4GIBA 3EX7C 3ZUPA 1Z4LA 3OIYA 4LJ7A 1GM5A 2QNRA 3P32A 4A0FA 4CRWB 1D9XA 1G20E 1NRJB 3QBTA 1FUUA 4QJ4A 2O8DA 2O52A 4PPQA 4AYXA 4ZI2A 2FDRA 1NMZA 3QKSA 2X1VA 3OEEA 3MSXA 5AM1A 3WK4A 4R2HA 3QXXA 4PSAA 5ALZA 5AUOB 2VSFA 3GLFE 4AS2A 2QM7A 4N3NA 1RQLA 3QU9A 1HT1E 1MO3A 2GEUA 4QHTA 2D2VA 2QEQA 5ALPA 3LDAA 3Q7PA 2F55A 1DO0A 1Q3HA 1UKYA 2IS4A 2FPSA 3F9RA 2XEXA 1SULA 1TE2A 5H8WA 4CE6A 2HDNB 4E09A 2NO6A 3CRQA 5D3MA 4IVPA 4UU0A 3I5YA 5DSZA 4UMDA 1JALA 4Y2JA 3VTKA 1W48A 4CEJB 3ND8A 3L8GA 4AYWA 1TF2A 4IJMA 3UATA 4HGQA 3BGWA 3WRYC 1XNJA 3PQCA 3OPXA 2ATXA 1KSFX 3VFDA 4BWYA 1ZAKA 3MCAA 4BE7B 5FBVB 1IBRA 1FUKA 1V43A 1Z0AA 2QP9X 1N5LA 2HF9A 4BZPA 3QY0A 4OHWA 2J59A 2QORA 4JLOA 2YBDA 3DVLA 1OXXK 4RETA 2JLRA 4CT4B 2RGAA 4A2PA 3BBPA 5KSZA 1JI0A 4TLCA 4M1MA 2P6UA 2ZS8A 4M21A 4PXAA 2G9NA 5G3ZA 4ZKEA 5DH9A 4UXHA 1BYUA 4PANA 1PZNA 1T5IA 2EYUA 3G5UA 4D4JA 5KNBA 2WHEA 1W5SA 2IW3A 2W6JA 1SGWA 1JECA 4MGIR 1W0JD 1ZCBA 2GEDA 1C1YA 4Z8YA 4BLOA 3BERA 3HPQA 4NCHA 1IXRC 1CR1A 2CFTA 3I76A 4UATA 2RMKA 5HCNA 3W5BA 2RKOA 3LQQA 2OAP1 2EYQA 4Q4AB 2RB5A 4Y2VA 2OCAA 1E2KA 4RFSA 2AHOA 1YVDA 2J7PA 4TLDA 3GLIE 1DG1G 4EPTA 4ZIRB 1E9AA 1CR2A 4M1WA 4KYTA 1W2GA 4LJ4A 1ZNXA 3NHAA 4M1SA 4PTLA 2NO9A 4XPZA 2ZROA 3AF2A 3EAQA 4NCKA 1R10A 2CLSA 5FL7D 5FTJA 3TBKA 4O8CA 1JB1A 1KDRA 2R65A 4OCZA 2ZAMA 3DKPA 5FOVA 1Z6AA 1Z88A 1JUDA 1VTKA 2JA1A 2OUKA 4E5UA 4HZUA 3TSOA 2YWFA 2BM1A 5LD2C 3ZVMA 3E84A 3ZGXA 2F1JA 2OCBA 4DCTA 4M1TA 1FNNA 3K70D 4OHVA 3RANA 1WVIA 1EFUA 4GP7A 5JLJA 1XP5A 4IG4A 3WHKA 3K9LA 1ZRHA 5HTKA 2QMOA 4MKIA 4S35A 1UDWA 1M6NA 3UXMA 2GHTA 2JAUA 1W36B 2J9RA 4IDNA 2W0MA 4MRVA 2BM0A 3LO5A 4TYPA 5G3YA 4L57A 4KSBA 4HAZA 3JVVA 1P3JA 4N0EA 4IOLA 2YYZA 2JAOA 3B9RA 4UU1A 2GXAA 1XP8A 3EWSA 1NVVR 3UG7A 3W34A 1XFAA 2IEZA 3K70C 5ALXA 3Q5EA 4BZXA 2XXAA 1AS0A 1EX6A 3CX8A 3GLHE 2WJVA 1Z4IA 4M8NE 1VCNA 1R5NA 1TX4B 4E22A 1VG9B 3GLGE 1AQYA 3TMKA 3U6BA 2NO7A 4DDUA 2J3EA 1PV4A 3CIOA 5AVVA 2VRWA 2ZRLA 4OJQA 4GSYA 3GYGA 1VHTA 2XTZA 4LHXA 2BJWA 2GETA 3IILA 4DSOA 3NUQA 3BWVA 4NONA 4OQFA 1M7BA 1SVMA 2FGKA 1U7PA 4I1OA 2AK3A 1FX0A 1DAMA 1NVVQ 3ET5A 3GJ3A 2I1QA 3LWNA 3PGVA 1U9IA 3EF0A 4UMFA 2CMKA 1JXOA 3DL0A 1S1MA 5ALMA 4B6JA 4MYCA 4EPYA 3BH6A 3FFBA 3L0PA 1RKUA 2ZVPX 2NZ8A 4KSCA 3TIFA 3SMVA 5G41A 5ALUA 5IF9A 3GEEA 3VNUA 3CRW1 1W36D 3KUDA 3NWJA 2IYQA 1AS3A 4DW8A 1RMQA 3IPYA 4CIDA 2YFYA 2Q3MA 1SHZA 4XWKA 2XNDD 4TTRA 5CB8A 4LHZA 1L7NA 1V5WA 3KTAA 1TL7C 1CRPA 4G5SA 3IO5A 1ZRNA 1GAJA 3RSOA 4ASUA 2AL7A 2JIZD 5FR1A 5L3RA 2WWFA 1QRAA 3X1ZA 3TRFA 4DWOA 4XTCS 5EZ6B 1OT3A 2BKEA 4AK9A 3DMNA 4H1WA 4QGHA 5JHHB 2O9JA 1IN6A 4IDQA 1TJ3A 3QF4A 2VLIA 3CH4B 1TJ4A 2R2AA 4QBIA 4NCJA 4O3MA 2XNSA 4DLUA 3OTQA 1Z4NA 2FFQA 4TT3D 2PCJA 4UJ5A 1U2SA 1KZ7B 1E32A 2VP5A 4BFWA 5E95A 1C9KA 1T91A 4P3YA 3KJIA 1TPZA 2L0XA 1XTSA 5ALNA 4P4UA 3NAMA 1NJFA 4FMDB 1VPLA 3UMFA 3FMIA 1ZIOA 3K1ZA 1XZQA 3AP2A 4HAWA 4D0LB 1RZ3A 3Q5DA 3W5IA 2CCJA 1Z6GA 1H8ED 2JJ1A 2XZPA 5UKDA 2W2XA 4WZ6A 2MU1A 2HEIA 4PHHA 5A3RA 4DFDA 2ZRFA 4JLNA 2A30A 4HLCA 3ZH9B 3GEIA 5JHGB 2F9LA 1L4YA 4RZXA 1XF9A 2BJVA 3QEOA 5LPNA 4EZEA 2FH5B 3N5CA 4UMEA 1H8HD 5P21A 2Q4TA 4CNQA 2REXB 2GO7A 5C4GB 3QXJA 2GXUA 3QUQA 2GDJA 1J97A 3R7WA 2B7CA 1VKJA 4K81B 1RMYA 3WK8A 3C16C 2OAQ1 2CBZA 4DUGD 2BMJA 2IYXA 3OFND 4QGAA 1A4RA 3W6NA 4DLZA 3ZW7A 2FSHA 3IUYA 3TAUA 1E0JA 4WOPA 2AKAB 4QBHA 1VECA 1N6PA 3SHFA 2BBOA 5FTNA 3QEJA 3ZJYA 4URUR 1QHHB 2AD1A 3FWYA 4TL7A 3SKYA 1M34E 4DLVA 2DFKB 4ZV4A 2V7QD 5TY0A 2JASA 1Q1QA 1QVAA 1ZMXA 1F2UA 4I4LA 4OHXA 3RWMB 4DIEA 1NNLA 2MSNA 3U3JA 2QTHA 1KI4A 5AKIA 3SQXA 1UEJA 2KBFA 3ZQJA 3OCUA 2G3YA 4BLTA 4NBSA 2GBLC 5AUPB 2Q6TA 5FBWB 5FFMA 5E3HA 1N6KA 4AKIA 2IK8A 2ZRDA 1ZM4A 5DISB 5EUMA 5AR1A 4A1FA 2HI0A 2GF9A 4DEXA 1Z0KA 1ZD9A 3MLEA 5C46F 2AKYA 1TUIA 4YMSA 4L6CA 1N6NA 2OV2A 3ZVLA 2RGXA 5ALIA 3AKYA 1Z4OA 2QRNA 1ZC4A 4P31A 3N5KA 4KYUA 4BNDB 3JZMA 1NN3A 4IDPA 2V9PA 1RJ9B 1F2TB 5SZHB 4D4MA 3KQUA 3RS2A 2YMPA 1OIVA 4E07A 5AKLA 2WAYA 5IK2A 4C0HA 3U6KA 3OCVA 1KDTA 4DJTA 2J46A 2ZJBA 2ZSFA 3LVRE 2JDID 3PUXA 1RRFA 3NXSA 3VAYA 3W8RA 1YRAA 2ZXUA 2CK3D 4BLPA 4CYMA 1E98A 2CLCX 3OCWA 3G82C 5BYKA 4KITB 3NEYA 3QXCA 4AI6A 1VYTA 2VEDA 4PAMA 1G5TA 3R9KA 4YCMA 2XSZA 2XGJA 4BYGA 1E2FA 2IS6A 4MWOA 2B8TA 3K0AB 1HURA 2NPIA 1W7AA 2XB2A 1VMAA 4IHQA 1KO4A 4D4LA 2QGNA 1TQ2A 3ETLA 3DO6A 4AWXA 1QQ7A 4Q4LA 5KHOC 4PAOA 4GOJA 4TSFD 4KAXA 4BQSA 1BMFD 3IGFA 3RWOA 1CULC 4XIGS 4PC7A 1DOAA 2BHRA 3FGOA 1ZCAA 2QPOA 1CXZA 1K5DA 1YR8A 2ZJAA 1P6XA 1CIPA 5AM4A 1GRRA 1SQ5A 3D6TB 2RB4A 2VHTA 4G3XA 2YJ4A 3PGLA 1LB1B 1B0UA 2YV5A 3UPUA 3A1CA 1M7GA 4LWZA 1OH8A 2TMKA 1Z83A 1HT2E 2KWIA 3QQ5A 1NSFA 3AR7A 3T1QA 5FBRB 3UG6A 2O8FA 3K1JA 4DDTA 5FH9A 2RGBA 2O0JA 2W0SA 4URYR 2QMHA 2DWQA 4HUTA 1T8UA 1KO5A 3HYTA 1T9HA 1CR4A 4A82A 4YLGA 1SZPA 4QM7A 4D25A 1XXHA 1LVHA 2J5XA 2WM8A 2IT1A 1AZSC 5FBLB 4TL9A 2WF7A 5CK5A 4A8JA 2PKEA 3U26A 1X8JA 5HZHA 3M1YA 2DB3A 2ZPTX 4PZLA 4O0MA 2OSBA 2FMXA 1ZM9A 3SU8A 4Q47A 3RYTC 3VKWA 1II0A 1OKKA 3IBYA 4Q9IA 5L3SB 5G53C 5ALSA 1U0JA 3NBFA 3R9XA 3TH5A 4EQ6B 3T5DA 2CEAA 5AKXA 2FSIA 1Q21A 1G16A 5C4MA 1DTSA 5AM2A 3PCTA 3LVQE 3FPAA 3B85A 2Z4RA 1L8OA 2GJAA 1CR0A 1FMJA 1GIAA 4HYYA 2XB4A 1S9DA 4NU0A 2FFAA 4BFYA 5DI3A 2V55B 2HSZA 4FFDA 1P2UA 3MGCA 1KGDA 1OPXA 4OK5A 1CJTC 1NVWQ 4CF5A 1QZXA 2VBCA 2WMOB 3A1VA 2HCBA 2YWHA 3EA0A 3N8GA 2QL6A 4DSTA 1NN5A 2FU5C 4P33A 3QLEA 1R5BA 1G21E 1OFUX 2LCFA 3TAHA 2J1LA 2C96A 3QUSA 4HDOB 2QAGC 5DHFA 3Q9LA 4US2R 3RABA 3PG5A 1HY3A 3REGA 5BQ5A 5AW4A 4FN5A 3VHLB 1QHGA 4EPWA 5JI3E 5EE5B 1NLFA 5BN5A 2ZRGA 3QKRA 2X2EA 3SYKA 4EUNA 4XVUA 3EPKA 1NBMD 3T15A 5D3QA 2EFHB 4CEIB 3B6EA 1IY2A 4DZZA 1OH5A 1W0JA 2WIAA 1XX6A 2G1AA 1WF3A 4A4DA 1Q57A 1KMHB 2G1JA 1J90A 1LY1A 1KK0A 2AR7A 5B58C 1JJ7A 3I5XA 3K0FB 1NG9A 2BEKA 3T35A 1XCGB 2ASEA 2OT3B 1VYVA 4AKEA 5AICA 3BJIC 2P6RA 4QFMA 4WBSA 4DT1A 3MMPA 2D4HA 4BRUA 4TMXA 5JS7A 1U8AA 3EC2A 4HLQB 3QPWA 3D7MA 4B3XA 4IFBA 1WDTA 4B74A 2WF6A 3RFUA 3G0HA 1RLTA 4Q4JB 3GCGA 1ZOLA 1TMKA 4ZEWA 5FUXA 5DN6A 4IXNA 2OXCA 3Q72A 1G17A 4L9WA 4A6PA 2NO1A 4QGGA 4RZ2A 4UXIA 5CB6A 4Y2PA 3WKCA 2BEJA 5IT4A 3RDPA 2C2HA 5KSOA 2VIIA 3U7HB 3OE7A 3CNOA 1JJVA 4ZCMA 3GFTA 3THXB 5F3WB 4KN8A 1U9IC 4LHVA 4P32A 2DQSA 2CVFA 1N6RA 3ZVRA 1ZU5A 2ZJ2A 1FEZA 2FWRA 3C5CA 2O8CA 3A1DA 3BXZA 1M74A 4B33A 5CM8B 1YR7A 3ONWA 4FCWA 4Q4AA 3U60B 3B1VA 4XWAA 4DLTA 1Z47A 4UW9A 2C9CA 4HB2A 5L3QB 2QY9A 1NI3A 1MRNA 1IONA 4B6FA 2DR3A 1YV9A 3CH5A 4ZIRA 2PR7A 2RAVA 4F72A 2OM6A 2ANBA 4AP9A 2OE2A 2SHKA 4BECA 3KKQA 2FEAA 4JLKA 2QA5A 1G8YA 1IN7A 1T9ZA 1E94E 4BUJA 3NDPA 4YIHA 1ZINA 4B76A 1U81A 1JR3D 5FTLA 3KXLA 4Q7LA 1Z4MA 2BDEA 4TLAA 4TLEA 4UM7A 2AX4A 1T3LA 2QE7D 1CS4C 4H1UA 4GFDA 4RFVA 4AC9A 2Q3HA 3EWIA 2HLDD 4WA7A 4XVRA 2H18A 2G0AA 2W6ID 1RYHA 2ZI3A 4Q1EA 3WBKA 1FNMA 4DKXA 5AI0A 2B8WA 2O2XA 1XMVA 3U7EB 4JLMA 5AI4A 3UM9A 1KNQA 3EARA 4NP6A 4JYCA 4AURA 3TW4A 1WZCA 3EZFA 5ALQA 2R6CA 4XE5A 2WKRA 4BLQA 3CPHA 3SBEA 1O03A 2ZRCA 1EFRA 1UBGA 3NIBA 2B1QA 3FTQA 1J7KA 1UKVY 2F43B 3FHOA 4NAVA 4B44A 5KNCA 2ZR0A 3RNLA 3S1AB 5A3QA 1UFQA 2ZRPA 1G8GA 2KJQA 4S2EA 4DLYA 2ZBEA 1NBME 2WWIA 2O8EB 3OHMA 721PA 3ZTYA 1YDFA 1W4AA 1N6LA 3QGMA 1AA9A 3U44A 5GVSA 2BV3A 4EJSB 4OI1A 4US0R 2HEGA 2X77A 3BFXA 4YMVA 3R9WA 1OYWA 1Z6YA 2B0CA 1VJ5A 3KC2A 4EDHA 2QZ4A 2Y8EA 5IRCD 1Q1ZA 5AKKA 5CM9C 2ODEA 3NC1C 2P69A 3QF7A 4B3DA 4GP6A 4BLSA 4U00A 3PUVA 2WAXA 3GLIB 3EPRA 1NIPA 3LA6A 2IBMA 2PL3A 3KB1A 3LBNA 4HZIA 1XD8A 1KSGA 2ZREA 3C14C 2V6JA 2PZFA 1P9NA 2EU8A 3IEVA 2ERXA 1EGAA 4B34A 2I3BA 4D82A 2OILA 4OL0A 3RRNA 2AFIE 1JEDA 2XJ4A 2GHQA 4M53A 5K8LA 2FPMA 521PA 1GNRA 5AJVB 3DMDA 3TE6A 2IUSA 4TMTA 821PA 2YWGA 3OIUA 1EFTA 3GQBA 3RVBA 5KYKA 4MRNA 5EXXA 2C8KA 3TSZA 1NLYA 2QMEA 2ZS9A 1I4LD 1OFIA 3GD7A 3HU1A 1R8QA 3X1DA 2W4MA 3QVUA 3P96A 3ZWDA 1E9RA 4LYAA 1XMIA 2GCPA 2ZJOA 1KDOA 1U0LA 4JZKA 2IOFK 2YHSA 4UM5A 4XQ0A 4IKEA 3MG9A 4FMDF 5J4KA 2FA9A 2QUZA 1NNEA 1TQ4A 3OF5A 2OM2A 1QG4A 5F9HA 2FX3A 5TDHA 1II9A 1M7HA 1GTVA 4NDZA 3U3KA 3T34A 4BFXA 3GLGB 5FI0B 4C7OB 1T3SA 4OQXA 3O8RA 1VFPA 1GL9B 1PLJA 2GAAA 4F4CA 2ZRBA 2IS1A 1JR3E 3BWDD 5C18A 3QENA 2Q3FA 4X8HA 5JBQA 2I33A 4MUAA 3NH6A 3MD0A 2WJHA 4B3BA 3W5CA 1G5PA 3MRSA 4GNKA 2W2VA 2OLJA 4YXWD 5GJBA 2Z4SA 3T1TA 3M6AA 1ZW6A 2YOGA 3W8NA 2BMFA 3SYNA 1Q1BA 1QQ6A 2XOKD 4TMZA 4ITRC 2WKQA 3A4MA 3LXRA 3DNPA 1N5KA 2G09A 4DBLC 3QG1A 4V0OA 5J5CA 1LS6A 3THOA 1AIPA 3FVQA 2ODAA 1QYIA 2VSXA 1D2EA 2E87A 4LX0A 4KX3A 1OB5A 1TU4A 1L2TA 4JKIA 1R0XA 1UJ2A 4C0SA 4PC2A 2G6BA 4LC1A 1Z22A 1P2TA 3R4CA 1XJ0A 1MO5A 5E7JA 5AW5A 5DIFA 4B2LA 2ZIAA 1OXVA 1RLOA 5EE0A 4HAXA 1U0HC 1TQDA 4KO8A 4M22A 5HR5A 2GEVA 4TQ9A 2X4DA 2VF7A 1N0WA 3RF6A 4Z1MA 4PO9A 3WKEA 1BOFA 3AVYA 1RE0A 2ECKA 2WKPA 3DDHA 3B9PA 4II7A 4C2UA 3B5JA 4LPSA 1QHHA 4L4UA 2C04A 3UANA 4D4KA 3REFA 1IXZA 4LYHA 4A36A 5JJIA 1VYUA 2D06A 4LPKA 1E1QD 2A5GA 1KDPA 2ATVA 3BE4A 2A5JA 1UEIA 2WJGA 4Q9LA 2ODBA 2JATA 4I9GA 3RS3A 2VHUA 1NF3A 2IL1A 3RRZA 3QUBA 1ZM2A 1Z0DA 1JPJA 2OA0A 3L0YA 5FPKA 3FOZA 3EPHA 5AW3A 3NG1A 5AJYA 3WYGA 3SOPA 3ZDQA 1GUAA 2YN4A 3LY5A 2IWHA 3C5HA 3B8EA 1HUQA 5DI9A 3PEUA 3QSYA 1Z28A 1BMFA 3QKUA 1VDZA 3BOSA 3KXIA 5ALKA 1ESNA 1AM4D 1Z0JA 1SXJA 3IQXA 4OHZA 3PUYA 2V4ZA 1RPZA 4QBGB 2IWRA 3K70B 3CUEF 3E81A 3L8FA 1Z4JA 4NABA 4Q5IA 3A58B 3RS4A 3TNFA 2H16A 4CT5A 4URVR 4TZ6A 1RJ9A 1QDEA 1F2TA 4QJ5A 4A8JC 4AIIA 1ODFA 1E96A 1ZYUA 2FEOA 4JS0A 4Z54A 2BOVA 4LHWA 4C4SA 2B6HA 3QKTA 3X1WA 1KO1A 5KU1A 1Y63A 2VP6A 1IJEA 4LGMA 4OHYA 3AUXA 3B1WA 1YZQA 4AKHA 5C2JB 1ZD2P 4P4SB 5FOSA 1NIJA 1Z4QA 2J0VA 2C03A 1P5ZB 1R0ZA 2IYRA 2ORVA 4IDHA 5GJWC 2JLXA 4JLVA 3K9NA 2P2LA 1W0KA 4MYTA 1IY0A 2VTKA 3FKSD 3K0AA 3FPSA 4IEIA 1T5TA 2YJ6A 2HCJB 1YHNA 2VL7A 1WRBA 1A1VA 2XTNA 3VX3A 1PLLA 3KUCA 4KLNA 2YZ2A 4AYTA 2WWXA 2DFNA 2DWPA 3HR8A 4MITA 4V03A 4BPBA 1LS1A 1DAFA 4HDQB 2WF8A 3EZ6A 5K8IA 2PQ0A 3MFYA 5FP0A 3ZVNA 3CPJB 4PC3A 2BBSA 3W6PA 4DLRA 2VA8A 4DC9A 3KZXA 3ZTWA 4FYPA 3BK7A 4Q1DA 1N3BA 5JCPA 4FI3C 3RHFA 5JMTA 1N9KA 5SZKB 3L5KA 1E0SA 2GESA 3I73A 3NTUA 3RRMA 3A6PC 1RKQA 3GEHA 4Y2YA 5JWOA 4JSTA 5FR2A 3EIHA 4O25A 5CLLA 1YZUA 3IO3A 2QT0A 1XRJA 1GILA 2B92A 2VYFA 1YZTA 2IXEA 4D26A 2ZRHA 1H65A 3A1TA 2DY1A 4TL6A 2IA5A 1D6JA 2WSMA 1SKYE 1G6HA 4DCNA 3I32A 5BWMA 1XBTA 2IYSA 2H8KA 2YOFA 3I1YA 2KI5A 3A8TA 2QP4A 4JJKA 3VQTA 3HU2A 1KK2A 4OK6A 5DE3A 4TYWA 4EFNA 4JT4A 1K1EA 4HLDA 3KJGA 3UMCA 4XD7A 2ZSDA 4OHFA 2R9VA 2D7DA 2WPDD 3QXHA 3FE2A 3KL4A 3AR9A 1BKDR 4UARA 3QUTA 1E99A 4M1YA 4DWJA 2Z5FA 3ASYA 2BCGY 2PT7A 3WK5A 2H92A 3UMSA 3L0SA 4B3GA 1AKEA 4NTZA 4ZEVA 5ALEA 2PX3A 4Q1CA 1QF9A 1NN1A 221PA 4PC1A 4KVGA 1ESMA 3RS0A 3OIVA 1O87A 3R09A 5EUQB 2D7CA 1OB2A 4AKGA 3DPUA 1P9RA 4R9UC 1W4RA 4LBZA 4IDOA 1K6MA 4WAUA 2LWIA 5KNDA 3ADDA 2C8VA 2HT1A 3CNNA 1NVXQ 2G06A 2YJ3A 2Z43A 2CL6X 2HJVA 2HOQA 1UADA 2WF9A 1E9DA 1MO4A 4URZR 2PLRA 4G63A 2P11A 4BZQA 2ZBFA 3B9QA 4C30A 3W5JA 4MYHA 3B13B 3W6OA 1CJVC 5EP2A 5FOXA 4BFVA 2BBWA 5JRJA 5ALLA 4LV6A 2X8AA 3R9IA 2QT1A 2RH5A 3BB3A 3H1TA 2HHLA 2OCPA 4PC6A 3E70C 2ZI5A 4B73A 2ZG6A 4FIDA 3ZIAD 2WBLC 2HCFA 4CEIA 1Z0FA 4G5RA 2GZDA 1U90A 1Z2CA 1YZGA 1KMHA 4NMMA 1BH2A 1JQJC 2FZLA 2KBEA 1W4CA 3WKBA 3GJ0A 1COWD 2QU8A 4TTPA 4RD3A 2IXGA 4TLBA 1AS2A 5KPDA 2GZHA 3I61A 2GCNA 1FMLA 2OESA 3K0FA 1E69A 1VG1A 3QPVA 5CYPA 3AR2A 2QRZA 3KDSE 5JEDA 2WM9B 2RHMA 4HLUC 2G08A 4ACAA 2CNWD 3PDWA 3LX5A 1G7CA 1NL3A 1UAAA 1E2PA 4IW3B 4EPXA 1S0UA 3NHBA 5EXTA 1Q0UA 4UXJA 3GMTA 2FI1A 2ZUCA 3L7YA 1X8LA 5CDFE 5DGXA 3PEVA 2R44A 4QC2A 1JR6A 5AKEA 3K8YA 2AK2A 2NTYC 2WVJA 4Q4JA 1U02A 3W9YA 3WGUA 1X42A 2JARA 2ZANA 4X8MA 3D31A 1GZSA 1NSTA 4ESVA 1NKSA 4IXMA 2FUEA 1LW7A 1XTIA 2OBNA 1N0UA 3ZS8A 4GPTA 1W4BA 3SF0A 3VAAA 1IAQA 2QG6A 2X19A 3CKLA 3F0TA 3THXA 1G7TA 2C5LA 3EWAA 4KBFA 2OBLA 4FWIB 4LV5B 3SI7A 5HPYB 5CLQA 5FUVA 4DEYA 1XZPA 1W44A 3E2IA 3NVAA 4Q9HA 4H1VA 2A5DA 3I8XA 1WXQA 1M1YE 2ANCA 1Z5ZA 1JBKA 1ZM3A 5L3QA 1E2MA 1XEFA 1E2LA 2BC9A 1R4AA 3K9HA 3LNCA 3PEWA 2WWHA 3TR5A 5JJLA 2AMYA 5FOUA 2HX1A 5AJXA 2IXFA 2CL7X 1TF7A 1G4AE 4F91B 2WSSA 4C3ZA 3GLFA 3AR4A 4M1OA 1RQNA 3BD9A 2J45A 3TQFA 1KKMA 5HKKD 5J4VA 5T41A 3PITA 2O8DB 2IEYA 1OHHA 4BEBA 2O8BB 3PV0A 3QU2A 2E9SA 4US1R 1ZVQA 1FFHA 3X1XA 3SHWA 4DCUA 2IX3A 4LBWA 3N28A 2A5YB 5AI6A 4Q00A
chains in the Genus database with same CATH superfamily
1B3BA 1QHXA 1GQRA 1R4MA 1VP9A 3OZSA 4N01A 2NIPA 4MQEB 1V2GA 1X3SA 3KPVA 1GRNA 1SUCA 1XVAA 4JFAA 4JVSB 4NKRA 4X1OA 1E4EB 4O33A 1T15A 4ZKDA 4NBNA 5FWNA 4KGVA 5LQDA 1IN8A 1GNQA 3MMXA 2HMUA 3WQBA 1Z18A 1E1KA 1FK8A 3N8DA 4NLLA 3USZA 3O75A 4H6VA 2WM3A 3SYLA 3G2JA 1QRSA 2YN2A 2AYXA 2H1SA 5F23A 4QOSA 3TJMA 3ZHCA 2GARA 2F43A 1NW6A 1XTQA 4B2PA 2H2DA 2IUTA 3QYPA 4KLCA 5A06A 3RAGA 5AOAA 4M8IA 1N8NA 1JZTA 2CLEB 3ZN2A 1BCSB 2XADA 3A3KA 2DQKA 3ZBUA 3JVIA 2PL5A 1SH7A 2XB9A 4NBUA 4ERXA 1F5NA 4AD8A 1WTCA 5F7JA 5GV8A 2HSEA 4U7PB 3DEFA 3AZOA 1SBZA 3F3YA 4G0PA 5HF5A 4CCYB 4C6RA 1NMXA 2WF5A 1P7CA 5JC8A 3EEOA 3F3MA 2V7TA 3NDBB 1E3WB 3SZUA 1UDAA 5E9QA 3OEED 4JYBA 2HFKA 1VMKA 3LQYA 2XYPA 3GLIA 1LFDB 3AGPA 4II2A 4XYLA 4EHHA 1XZMA 2OFWA 3D0RA 5SY4A 3O4HA 2VHEA 4A10A 5TPZA 4AY2A 1MHPA 3A2LA 2BUCA 4N3CA 2PHZA 2IXAA 4JJ8A 2FLKA 1L9KA 2QTVA 2JAHA 3D4IA 4XX1A 2BEWB 5ICSA 5H0IA 3ELDA 4IPTA 1PO7A 3RSHA 5J43A 2QAGB 4NCIA 5DXJA 4C0KA 3TZBA 3SJZA 5KSYA 3OMWA 1KMMA 3PR1A 1A7AA 4WMLA 4J0IA 4RD0A 3CEHA 3TLXA 4GF5A 4EF4A 1G8FA 2Q1SA 4HDCA 4TMVA 1BRTA 4MIOA 2ZI6A 3V1MA 4L7QA 2KQUA 4QATA 1EP9A 1WV0A 3CLUC 2QLTA 4Q48A 3WTCA 2QG4A 1T4CA 1YNOA 3GT3A 2E4ZA 2DRIA 2JBAB 4MV1A 4F5DA 4F5WA 1QTNA 1YZYA 3H05A 1K92A 1T25A 1OLSA 2RI6A 3LU1A 3LWBA 4PFKA 4WGGA 3VPBA 5JCOC 2RE8A 2D00A 1VL0A 1C7QA 2WTXA 4ROSA 3ZV5A 1J2UA 2EKZA 4F4UA 2NSDA 3I6BA 2C5HA 3LYUA 5K09A 3WFIA 2PCLA 3OQMA 4EEKA 5KNBD 2FSUA 3BL8A 2A9KA 4GM1A 4ZANA 3VR4A 3ZGLA 5BW6B 4HGPA 1U7OA 4MI1A 4N5MA 2CJWA 4V0NA 3SC4A 3T1OA 3X2EA 4XB6B 4FNMA 4C7OA 1SXJC 3MXTA 4I9FA 2GYYA 3EVFA 2OXFA 3WRXA 2X2FA 1OIWA 1YFKA 1JXQA 4RPCA 5GJVC 1H4QA 2J7PD 2H29A 2DC1A 3WNBA 5HS6A 1LFAA 4BUZA 4Z0PA 1NV9A 2W48A 1CKEA 4MUBA 1V3VA 4EW1A 2XD9A 4X3CA 1T1EA 4BPRA 1LNZA 5D86A 3RUPA 2CV1A 1SWWA 2CLOB 1DWOA 1L5OA 5T3UA 4I1PA 1ZD5A 2AMJA 2ETXA 3HWX1 3LW8A 2ZE6A 2GPSA 3AEYA 4EKDA 1DBPA 3VAZA 5KPJA 3ICOA 5JU6A 3A3OA 2E82A 1BD4A 5KX5F 3R6DA 4YXFA 3CNHA 4F0JA 2WUWE 3ORSA 2Q8NA 4N0PA 4JC0A 1CF4A 3MUNA 3ZG6A 3H6HA 3CZPA 1ISHA 2JLWA 1RU3A 4XSHA 3I1JA 3U0VA 1RXSA 5TMEA 5A4AA 5JJBA 4MKRA 4WZBE 4DL9A 3D4PA 1P77A 1KXJA 2NNWB 4HNAB 4IDAA 3DMGA 1D4ZA 3EJWA 4NECA 4C0XA 1PUXA 2IHYA 1D2NA 4QD3A 4M38A 3C7KA 2HJRA 4AB1A 4QTYA 4WCFB 4BRWA 4KFUA 1XMQB 1DQSA 3B8HA 3WGJA 3I6ZA 3DGEC 1AO0A 1NM5A 4N9QA 4P4GA 4NU0A 1QPZA 4PNZA 2CSXA 1T8RA 3L1UA 1ZX1A 3D59A 4BFYA 3LLMA 4O4IA 3BFKA 4ZGBA 3FJOA 3K94A 4G4JA 5DOZA 4Q12A 5F7XA 1JHPA 3N2EA 1BQ4A 1W94A 4GAEA 4JX9A 4X85A 2ZQYA 3AEQA 4HYEA 1QONA 3DUWA 5BWNA 4JXZA 4U7DA 4M7RA 3NCTA 1SG6A 4P0PB 4GQIA 5IDYA 1LRLA 1SCNE 1U3DA 3IDZA 5BWCA 1XDZA 4KRXA 4WJKB 4V02A 1JAIA 5EXDA 2CNBA 3BBLA 3L05A 4R8KA 3RSFA 4ALMA 1G8AA 4QYMA 2VSOA 3M6IA 4I3HA 3TE7A 4J0HA 3P26A 4JLPA 3HU5A 5KJ1A 1NJ6A 3QE3A 4TXMA 3TQIA 4GLJA 5BSHA 1WXGA 3CRNA 4ZD6A 1VCMA 2XXBA 1ZK3A 5JNWA 3PVSA 4DSZA 4I3FA 3O8BA 3FRJA 4I50B 5DTMA 5ECDA 5AUQA 4NV3A 3KCQA 5HMLA 5BNIA 2CVOA 5HQ3B 3OKCA 3ZD6A 5A2GA 1H3FA 1ZL0A 4KJZA 1NJ5A 2DLDA 1WXEA 5AK6A 4RACA 5BW4A 4XJVA 3JATB 1DBSA 3D9QX 2JH8A 4EKEA 3F96A 4AJKA 1YVEI 1EK0A 2M9MA 2OO7A 3EXIA 4E12A 5HIKA 5IJ9B 3EZGA 3KQLA 1P0QA 5JPIA 4IFTA 3CF4A 3C6YA 4JP3A 4MS3B 2CV2A 1TZKA 3TQTA 2QD3A 3C8ZA 4KZPA 1FU7A 1QVRA 2EG9A 4MGYR 1SUWA 3UZUA 1SCUB 1U9JA 3G1TA 3GU3A 2RBEA 1L4KA 1MQ8B 2BSAA 2JKZA 3A2MA 1E1LA 2WU3A 1Z33A 5JSQA 3STWA 3OOEA 2JB9A 5AKYA 2L82A 1M1YA 1YRWA 3HABA 3EQ7A 3GLRA 5EMNA 3GP3A 1KR2A 1X0VA 3PDHA 4MAAA 2YVKA 3ICQB 1XL1A 3RVRA 3VBCA 3IC5A 4FEAA 1M0TA 4DAOA 4INOA 1WKCA 3A14A 4GMGA 3ZE1B 2CVPA 1CC1S 1HQCA 4LZNA 1SRRA 1VMEA 1E1YA 4UBMA 2NXJA 3SNHA 2J0QA 1XQ9A 4JUIA 1E9BA 1OXBB 1EGQA 1QAMA 2QQFA 3KBBA 4UEWA 3QV2A 4XAQA 4EX6A 1QOQB 5AVUA 1VCOA 2F3RA 5DF1A 5JI2E 3T38A 4YP0A 1BOOA 1N2HA 1P75A 2Y4NA 3JTMA 1X7YA 3BCHA 1EHYA 1VHDA 2DCUA 2HF8A 2HT6A 4QDKA 4V3BA 3V9AA 2AQ8A 4PHGA 3WO1A 2J3MA 3BX1A 2WV9A 4BP3A 1A95A 1JHRA 3WYFA 4PONA 1AZTA 4ZDWA 1QFYA 1L4UA 1KAHA 3IYLW 1Z5NA 1G3IA 2R11A 3IOEA 2E48A 2YC2C 4FM9A 4O63O 3LUDA 3UAVA 4CKBA 3FHTA 1BSVA 2HMTA 1JIJA 4DPLA 4EGAA 3M6WA 1OUMA 3HEBA 1F3OA 4FEEA 4JP2A 3OX2A 3VU9B 5C8YF 4MGKR 4OKNA 2YHAA 4ME6A 3GXOA 5TQ0A 3ZWKA 3E9RA 1CD5A 3FOCA 2BN4A 4ZHSA 1LU9A 3HLTA 2YFKA 4M0FA 1NXOA 1Y4SA 2Q49A 3DAOA 3S0JA 3UW3A 1CZLA 4FHGA 4FNAA 4P5EA 1X77A 2EFYA 2QVXX 4Y2XA 2VWPA 5JSZB 1RWBA 4PRLA 4NE2A 4TGLA 4CODB 2I7DA 2X8LA 1RXYA 4KIFA 3RVPA 1BZYA 1NXXA 1JDZA 1SR8A 1R16A 4BLWA 1TD1A 2ZU6A 1SC6A 3D3WB 4GXTA 1ST2A 4ND4A 1JEJA 1E1RD 9ATCA 1JQDA 1W9HA 2DWUA 4GL2A 2GNPA 3MINA 1UOPA 2GXQA 4DZRA 4M2LA 3TLCA 2AN9A 2VAVA 4I5GA 4PLFA 4NPHA 1PR9A 1PFGA 3FXAA 5CFPA 3QI2A 5KJFA 1V9SA 5TVKA 1A0OA 4JEIA 2G88A 4RIHA 4BTEA 1JEQB 1U31A 2JCSA 1Z82A 3OLXA 1ZH6A 4CLRB 1TVKB 1RI1A 4GR4A 2RGGA 1ZLYA 4MVJH 3BE5A 3PXGA 4G1UC 4KE7A 5F5LA 4FX2A 3VR0A 4AZVA 2XZOA 4XSGA 4DMFA 3YASA 2P9BA 2W58A 5EJ9A 1JG2A 1CBUA 2NO0A 4PQYA 4NPCA 2ZIZA 4DUGA 4JOCA 3THRA 3WB0A 4L2IB 1XJQA 1K8YB 3OFNA 3MJSA 1OWPA 1RXEA 4KMSA 4RE5A 4UKDA 3SJUA 4EHIA 1LBTA 4B0PA 5LLDA 2WUGA 3AUYA 5INTA 3DGFC 1CEEA 3HCRA 2Q4BA 4E6EA 3MCTA 1W1IA 4I81A 4YWJA 2GH1A 5G02A 1TA0A 4A2CA 3TPZA 3TUIC 4MHSA 4UMVA 1RQGA 2V7QA 2WFAA 1Z4NA 2FPGA 3CEPB 3FYDA 3RGWS 1P4SA 3BB1A 2GEJA 2VCYA 4LK2A 3IKVA 3L1KA 4TN1A 5A1TA 1NF2A 2BSXA 3PDUA 2C31A 4FS3A 3AQIA 4KFCA 8LDHA 3V8QA 3PZBA 1QKIA 1HE8B 2XRMA 4BFUA 1V4BA 4OLJA 3HJAA 3H84A 4B45A 3VDXA 1MJGA 4FC6A 3T06B 3REQA 1AHPA 1IDOA 2O5VA 1BXRB 2NZJA 2WJJA 3ETJA 3OAAD 4ICIA 1NURA 3ETDA 4JJ7A 4YRQA 5AVSA 3K2BA 4F7WA 2IUUA 5CA1F 4EJSC 3RIGA 4IFEA 1TUBB 4UCFA 4N39A 4BNNA 5HRUA 2QTCA 4MYDA 3DBLB 3IT0A 1EX7A 2HMWA 3AEZA 2OTCA 2GM4A 2O0KA 3F78A 3QVJA 1XCBA 4ZODA 1I1HA 1YR9A 3E8MA 5I3ZA 5GJCA 3N87A 4GBGA 2FQWA 2V98A 3LPLA 4N1AA 3WSVA 4BO3A 2QRKA 1DMRA 3BG5A 3H1EA 5DKFA 4FXPA 3EXHB 1L7MA 2AC4A 1KJ9A 4R0VA 5SY6A 5LM3A 2H7VA 4G5XA 4RDCA 2V97A 1ZN2A 4PZAA 1EWTA 2ZAIA 5E8JA 4ZXFA 2BD0A 3HVKA 4B7AA 5L4SA 1R6UA 4MRMA 3OEYA 3EC1A 3OLQA 1AH2A 2AD5A 2P5TB 4A7PA 2RONA 4UFPA 4RLFA 5LD2B 4F86A 4G5GA 1WUHS 2B82A 2R1ZA 1BWSA 2GAIA 3D4NA 2Z0MA 2AG8A 5JCZA 1H2WA 1W1WA 3GGDA 1NDHA 3M6LA 1JKIA 3C8UA 3LV8A 4G0ZA 2BFNA 3R3WA 4UM8B 1E2GA 3LBYA 3RVOA 3FYCA 2H08A 2J5KA 1G64A 1H05A 3AG5A 3PC8C 3NTXA 4ZVRA 1KGSA 5BOVA 3S5UA 1U8EA 1S3GA 2DKFA 1JFTA 5FXMA 3OFSA 1A1SA 3PFNA 3OETA 1F8XA 1NW4A 3U5TA 4Q18A 3GOHA 3LKZA 1CUIA 3AVOA 3BRCA 4DCVA 3K1TA 3L1HA 5I7EA 7MHTA 4ZQFA 4MQEA 3C98A 3GRVA 2W98A 3DQQA 3OJCA 3MJDA 4GR9A 4NFSA 2FZ5A 2ZUUA 2AI2A 4ADSG 3E9MA 2VP3A 4KUHA 4RHEA 2C4VA 4XCVA 1MX1A 2ZETA 3I92A 2C5EA 4J7CA 5EEHA 2IHJA 3UB3A 1N7HA 4ARVA 1ILWA 4D96A 3N3BC 3KKMA 1Q14A 4LY9A 4RDXA 4KV9A 2Y2VA 1NWCA 2B2XA 3QVWA 4GRDA 4EW3A 2ADMA 2QR3A 3AZQA 3V1TC 3AJRA 3CF2A 4LWQA 3LE8A 2ZCVA 3WGZA 3STUA 5FLXA 1AKRA 4DCGA 1BCSA 1UWCA 1Y7IA 3C7TA 1GPMA 5ELLA 5CNMA 1NRXA 5HFJA 1P62B 1EFPB 2DSNA 4ABYA 2E6KA 1G2QA 1ZC3A 2OV3A 4W82A 2AFVA 3ERCA 2AOTB 2CXOA 2J4CA 4CCYA 2CLIB 2OFPA 4LQ4A 3PWKA 5H83A 4DBLE 3ZZ0A 2ZIUB 4JLJA 1K7SN 1P4HA 1T5LA 1YK0A 3B3JA 2HV8A 4FNGA 1E3WA 3AK4A 4QHSA 3JR7A 5GQSA 1AKTA 5F9FA 4JOBA 2I8LA 2I7XA 3AY6A 1AQLA 3AYXB 3NTOA 1DKUA 3WDLA 3C85A 4QKQA 5KKCA 2Z5VA 1KJQA 2ZFUA 3FNIA 3QEBZ 1OREA 4KDCA 6GPBA 1JAYA 1E62A 1QYXA 4FWBA 5E7IA 4ZVTA 1L7PA 1WDMA 2XE6A 1HNZB 3AXTA 2P6MA 3DZGA 4D4HA 4LRSB 4NZYA 1T3TA 1VDMA 3JQQA 1D2CA 2BEWA 1FUIA 1JPVA 2QAGA 2PX6A 3FROA 4OI0A 3ND7A 3ULKA 2V6GA 3K6RA 4DV6B 2A0UA 3VPAA 3GMDA 5KYTA 4IVRA 1E18A 2A94A 2OC9A 3BM5A 1TAGA 4JBWA 3MS7A 1QB8A 5F4ZA 2EWVA 2J48A 2QPTA 4QSHA 1TO1E 3T7KA 4PICA 3IEUA 3S2ZA 5G40A 4DJJA 1Z74A 3RUAA 4F85A 3Q8MA 2ECFA 1YB5A 2EV9A 3CSUA 2JBAA 5DN6D 4DN6A 3TK1A 3G5MA 4EK9A 3L0BA 2JA2A 2VNSA 2WU1A 2O4UX 3V8RA 3RBVA 2EFGA 4L8LA 3VJMA 1XI2A 2F1RA 4YRNA 2IIPA 5AM0A 2R6R1 4ISCA 4BZWA 4E1VA 3HU3A 3ND5A 3JXEA 5EE3A 4B79A 2VC2B 1D5CA 4AN4A 1P29A 2QGZA 1G5QA 5HEKA 7ABPA 1D04A 2UZAA 3L0OA 5DMXA 4YP9A 1I7NA 1RYFA 4XUCA 2ZKLA 3S7ZA 2V5AA 5CVDA 5I6DA 5L3SA 1DGQA 1UXHA 3NR2A 3R3VA 4FYVA 4RMNA 4AJ9A 1PFYA 2C4NA 4HY3A 3AHIA 4UULA 4KHZA 4EQ6A 2ZWVA 3GBSA 2YV2A 3AZPA 4P3KA 3NOVA 4MKFA 4MVCA 1QVWA 4GC5A 4H0NA 4HAYA 5AJHA 4DCPA 4E70A 2XUHA 1TZJA 3W9UA 3CLRC 2JH3A 3ZI4A 4MVJA 2JEYA 2VH1A 3A6ZA 1GTSA 3TKLA 5F64A 2ZJ4A 1JB9A 1EE2A 2I2FA 4DJ5X 4U7TB 2Y1DA 2O48X 1PSZA 3DZIA 3RE1A 2X58A 2IP2A 3TNDA 2H1LA 3PRYA 3QYAA 3QE4A 1CLUA 2LD4A 4LRUA 3L07A 4BN5A 4Z4FA 1KEUA 3ORHA 4W99A 6LDHA 3NWBA 3P0FA 1LX6A 2ZDQA 1WQ1R 4QLOA 3RUCA 2C5AA 1E8DA 2BFWA 3IRVA 2NU6B 1I5RA 3D4OA 2ZJ5A 2OHVA 5I4CA 4MMZB 2G72A 2FUG1 3OZGA 3J7TA 5IKPA 2G4VA 3AF3A 2IHBA 4AZ0B 2R0QC 3R7SA 1V37A 4ETWA 2P0EA 4UHKA 5TARA 1BX0A 1DEAA 1HZJA 3TW8B 1ML4A 5KVCA 2FZEA 3W90A 1HQKA 5JZ9A 3D5TA 5LDGA 5BSUA 2P1RA 2VNJA 4WCFA 1SWVA 3EDOA 1CP3A 4I4TF 3MWDB 5ERYA 4WV3A 1BDMA 3OTGA 4MH0R 1WD7A 1XTJA 2CHQA 4D43A 3VOTA 3BGIA 3TOVA 3CT6A 1VI5A 1R88A 5KOHB 1PFVA 2JBWA 1GFIA 2C4TA 3LDGA 4PNEA 4NK4A 2ZP1A 1D0IA 4IIBA 2VYQA 3NJ8A 2JGAA 1W36C 1A2QA 2W8BA 4R9VA 1I5EA 2GBFA 3ZOZA 1H69A 4H1TA 3ZWBA 3PPYA 3LZDA 3I2YX 3BIFA 1D09A 1FFCA 3NTRA 4HN9A 4RGVA 1XTZA 4V3CA 4ENRA 1KJWA 5DO9A 4WBXC 4HXGA 3GI1A 3UHFA 3KB2A 1WMEA 3VMFA 3KEQA 1FDRA 1JR3A 4BQFA 1Z2NX 2FCAA 4FLFA 4YJKA 5JSKA 3RM3A 1VC2A 1Z7GA 2H63A 3R20A 2BLNA 4WXPA 1J0AA 1LK0A 1QV7A 1SRQA 2X9VA 2FZ4A 3L18A 4AS3A 3VC2A 1OAKA 1JS1X 4KODA 4WNAB 1EB8A 1PT5A 4J91A 3V80A 2RGCA 4I50A 5K4HA 2BEUB 4L8YA 5HQ3A 1XVTA 1MC5A 1EHIA 2B25A 3OE4A 4HYQA 4LQLA 3ZDYB 2VAXA 3IUSA 3IVGA 3J80A 3TDNA 1AKVA 1VKOA 2ZAOA 3HK2A 4LYJA 1CQWA 1Y4AE 3F6PA 1C80A 4PFQA 1Y8ZA 5B64A 2XUZA 3I01A 4PN3A 4XX0B 1U3TA 3OLCX 2YJGA 1DKQA 4P93A 3G7UA 1FU4A 4I4CA 3ZNQA 1OF1A 5IM4A 3QUAA 1E1DA 4RPGA 1G3RA 3SSNA 2WAOA 5K3BA 1GKYA 3EF1A 2C88A 1BX3A 3EBPA 4DEVA 4D3FA 4JSRA 4NPAA 3REOA 4JP1A 4PVDA 4DILA 1KZ1A 1EUZA 3VR3A 3WZ2A 2CD9A 1KIMA 4JBXA 1K6JA 1Y1LA 1A9RA 1B73A 1H0HA 1RKBA 1WA5A 2Q4RA 2Q9AA 1T9GS 1XHEA 1IQPA 2ZTUA 3CEAA 3DKVA 3I9KA 4KFSA 1SCJA 1U8CB 4HI0E 4NARA 2CZQA 2LIVA 2GKSA 3HC7A 3I2IA 4M7WA 4MGHA 4IQ4A 4TX1A 3DE1X 3KQKA 3D2LA 3RG2A 4OX9B 3GC6A 3UJPA 3M4ZA 4KB5A 1J8MF 1E1RA 5DX0A 1OXKB 1GNSA 4S0ZA 1G66A 1KKLA 3ADOA 4PRZA 4RSGA 4J9UE 4EG1A 2OFOA 2HSJA 2QZSA 1FNDA 1L7XA 2YWXA 3D6UA 1JFFB 5KTKA 1HE4A 1J24A 2CLMB 2ZYAA 4L16A 2AJLI 3K9QO 1R8YA 3RT9A 2GWHA 2YDXA 5FUYA 2UZIR 4CDMA 2ZR9A 3AMVA 3PQFA 3VU9A 4F45A 4BRZA 1HA3A 3KEMA 4JLAA 4W5HA 4WCVA 5THQA 5JFTA 5K0FA 4N5LA 2WIBA 5B1HA 4CZ2A 5A1JA 5AUNB 5IDVA 2QD5A 3SWWA 3PJEA 1WMFA 1N1EA 5G0TA 3E5HA 5AW9A 1L5WA 4YRJA 4J6FA 1KY2A 1Z6QA 1G291 5FJIA 1NBAA 2ZKIA 1HE1C 3BMOA 1Z6PA 3MJ4A 2WTUA 5JSZA 3AF4A 3QA9A 4H0CA 4KXXA 5TEVA 2QDKA 5JV5A 5MF6A 3CSSA 1EUDB 1PD1A 4O29A 3O2NA 1CUYA 1L7VC 4FE3A 5AIAA 1U6JA 1PFQA 3IE2A 5EIBD 3U7JA 3D3WA 4JL6A 3SHTA 4TL8A 5FPPA 3U4MA 1X1BA 2QZPA 4MV6A 5FAKA 1Z63A 3G9UA 1B23P 3C8MA 3NHPA 4MA4A 5K8VA 1KQGA 2V0GA 3VNAA 2QQEA 5A0VA 4QYSA 4R1SA 1SVKA 2D1TA 1D5WA 4QWWA 4ZT4A 6NULA 2AFHB 1YQDA 2PTHA 3GDFA 3H3JA 2PUDA 4DCSA 2CFRA 3JD2A 4EFMA 5LZ4A 3E9QA 4K8RB 3AERB 4NFLA 1JEQA 1XMPA 2G40A 1DDIA 1LPPA 3MTBA 2X1HA 3D6HA 4ZO4A 4NCNA 1C9EA 1U1IA 2WT9A 3SX4A 4CLRA 1TVKA 4IDGA 2HDOA 3K72B 3IP6A 1LBIA 3OAAA 4NE9A 1EP2B 1CJUC 1FDVA 4C2AA 4IJKA 4KC0A 1Y4UA 3BH7A 3K92A 1OSNA 3QOFA 1SPBS 2P6PA 2XQGA 4G9GA 1F7VA 3JD3A 4L2IA 2V7WA 1MENA 2NW6A 2OCXA 1YE8A 2W6MA 3IV6A 2GAOA 1OAAA 3IBSA 4J1TA 4LVNA 4ACBA 3NXKA 4IMJB 4LF7B 5EIWA 1GU0A 2ZBDA 5AVQA 1UMBB 1QGED 3GJ4A 4OH7A 4IS2A 3FYSA 3QX7A 5HZGA 5DWDA 2R6DA 3MGBA 3TS1A 2PRSA 5L3VA 2OYCA 3DF7A 2NGRA 3GPLA 1CVLA 1E1QA 1AJEA 2EKLA 4M7PA 1JFVA 1PGQA 5DTEA 3OMXA 2W2KB 2R8OA 4GI2A 3PXEA 4JBGA 2COUA 1X1AA 3CRMA 3K32A 4XWYA 2IU0A 2YQ4A 3SHQA 4D0GA 2XWPA 3ESBA 4BU1A 1QGOA 4QXMA 5JWRA 4ESOA 2ZTHA 1YU9A 4QUGA 2LKCA 4HAIA 3V48A 3SX0A 2B1IA 1PJLA 2DKOA 4NENB 4AF6A 1FP2A 4OGKA 1FLVA 2X9QA 4ROTA 4UM9D 4BP8A 2FKAA 4RPIA 1BXRA 1E2QA 2D13A 3HHPA 3KSDO 4GI3A 2G82A 5DYGA 3IJPA 1FFGA 2E4YA 5A3SA 3W7VA 4D4IA 4Q1FA 1FPQA 1RHKA 1TUBA 3TLAA 4FGWA 4EPVA 3DBLA 2Y0EA 1MPXA 2GF2A 3GN1A 5GOZA 1OX6A 5K0SA 1MXFA 3S99A 1JQEA 4GLFA 1XA0A 1GL6A 2XPCA 3TXAA 3HBMA 2JHGA 4F2PA 2ZSHA 3WXMA 3ROXA 1GUDA 2WHXA 2I4IA 3EXHA 2VA9A 4WKBA 4X60A 4HUJA 4Q3OA 3U19A 2UKDA 5T7BA 4BB5A 4JROA 1XA3A 3OECA 4EJMA 5JDIC 1BU5A 1W6RA 2EL7A 1GCGA 1MB4A 2E1RA 2LTAA 3T52A 2JK1A 1GVHA 3C15C 4GPZA 3L43A 1PJ2A 5BVGB 1MAUA 1AGRA 5ESDA 4C0JA 1PNQA 1JG6A 1BGXT 1MX5A 3K09C 4I8IA 4N47A 4G41A 3WSWA 4HG2A 4QFCA 3WHLA 2MSCB 4PGMA 4JB3A 4IIGA 3M49A 5DX8A 1UWVA 4AG6A 4AMVA 3ZCXA 4BLUA 5M04A 1SAYA 5KUTA 3LQ4A 3FLMA 3PUKA 2DZDA 2GBIA 2QR2A 2Q9CA 3M83A 3PDIB 5MN5A 1Q0TA 1Z06A 3CONA 3L04A 4TM8A 5I8ZA 1G8SA 1M75A 4F4JA 3FHCB 3HJCA 4XQ9A 1TTPB 5MN4A 2Z8YM 3Q85A 3AIIA 2O14A 3GFFA 4FWTA 3IUNA 1HWYA 1O9BA 2XVZA 1FP4B 2NUAB 2GCEA 3SJBA 5EXPA 3N6RA 4MUGA 5BT9A 1N75A 2L42A 1KNXA 1B93A 5CDFA 2QB5A 3WK6A 3HRIA 1N6IA 4XDGA 5BYAA 4C87A 3VNRA 1U3WA 3IDAA 1SURA 1KBOA 3A6EA 4QGSA 3NEPX 3AHGA 3VZDA 2JCBA 1LDEA 2UAGA 1LLUA 3V33A 1GG9A 1NOKA 3NRJA 2KS6A 3HCDA 2IW1A 1F8FA 1EFPA 1GGMA 2G5GX 5FOWA 3FTCA 2P30A 2I54A 4PLHA 3WI7A 1FW8A 1ECPA 1SOWA 1JV2B 3KIPA 3DA8A 1J0CA 2ZT6A 2ZYIA 2FW0A 3AEXA 4I4NA 4K9SA 4L5YA 3TDMA 5LQNA 4ARCA 5M29A 5TMPA 4R1UA 4E46A 2FMUA 1NW9B 3HNRA 5LP6C 1U7UA 3SLKA 2JKVA 4NH0A 5C7LO 4TXNA 1UFKA 5C81A 2C2YA 5F76A 2GJSA 3DOIA 3EMBA 3F5QA 1NNSA 3C3DA 1KOLA 2PFKA 4B3HA 1TYEB 3HB4X 4HF7A 1IYZA 2YJTD 5J2TF 2EFDB 4BBPA 1J8YF 3IDQA 4X71A 4P6VF 3TJZA 1UM8A 3M9LA 4NJOA 1IOZA 4FC7A 1JHDA 1HDEA 2R4QA 5D1NA 1H9BA 1DCKA 1NMEA 3LLSA 2MJLA 4EUKA 4Q4DA 2IVZA 4WZAE 1DZ3A 1ZH2A 8GPBA 1T8TA 4GDFA 3FJYA 1G20B 4A0QA 1FDWA 2C00A 4K46A 1ZSNA 4IMIB 5KTNA 4PX9A 4LMRA 1K97A 5IMSA 4RF3A 3T7JA 1YTLA 3QWIA 2W4QA 5IVPA 3LHDA 3DMTA 3E58A 1MGPA 4H7KA 3GOQA 4YLEA 5JW6A 3G9XA 1N1GA 1OBCA 1E2NA 1X74A 3K31A 1O6CA 2EX1A 2H11A 2W6PA 2D62A 3S2SA 2R4UA 3IIMA 2OORC 4XVHA 4D8YA 6AT1A 4GQBA 2PU7A 1JR4A 1L0BA 3QMWA 3M4NA 1Q0LA 3CN7A 3M6XA 3TZEA 1HT3A 4OIFA 3ZCUA 2DR0A 3WWZA 3N07A 3TTWA 3DOFA 1NMYA