1RRGA

Non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, dimeric crystal form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
177
Chain Sequence
b'GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAT ADP-RIBOSYLATION FACTOR-1
molecule tags Transport protein
source organism Rattus norvegicus
publication title The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.
pubmed doi rcsb
total genus 53
structure length 177
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrgA00
1QHHB 2AWOA 1XX6A 2PEZA 3CX8A 2V1XA 4PAQA 4EJSC 2QAGC 2J0QA 3LDAA 2XSZD 2ZAMA 4K8OA 1SVMA 1KI7A 2J45A 2GHIA 2KI5A 1R5BA 3TH5A 3K09C 4QNMA 5FL7D 3T34A 1N5KA 4O2LA 5AJYA 1KI6B 5H8WA 5CYPA 2V6IA 4Q03A 1XXHB 4EAQA 4ZCMA 3A4NA 1ZIOA 3H2YA 4IW3B 3ZYCA 1SVLA 2IYUA 4TLBA 2L0XA 2OV2A 1OXXK 2BJVA 1U2RA 3GJ0A 4KO8A 2R62A 4OI4A 3ZDQA 3I5YA 1HQYE 2PZEA 2ZI6A 3CNNA 4D82A 5EP4A 3MWJA 3QXXA 4G0NA 1FFHA 3HDTA 1S8FA 3I1FA 2JLVA 1N5JA 1CRQA 2FWRA 4KI0A 5FPYA 2IHYA 3ZZTA 4WZBE 621PA 1KTVA 1UBFA 3GP8A 1OH8A 2ZRHA 2VBCA 1AQUA 5IRCD 1PLLA 5FPHA 5DIFA 4A6XA 2EFEB 4LV6A 2IBMA 1KMHB 2AWNA 2ZU0C 3BAFA 1U9IA 1NVVQ 3X1ZA 4N0DA 5EP1A 2O0HA 3RS0A 1P72A 1LY1A 3RS3A 1X3SA 2H57A 4KCGA 4ZDWA 4DB2A 1FUUA 2FA9A 3FFBA 3TAHA 4DLYA 4DSNA 2ZYWX 4BEJA 5FOVA 5FTJA 2Z43A 3RYTC 1ZC4A 1FP7A 1AJEA 1KK3A 3AVOA 5CK5A 2AR7A 3TKLA 3V00A 5G53C 4MKHA 4EIWA 5DGXA 3HWSA 4BLTA 1AGPA 2JJ8A 2NO6A 2D62A 4DXAA 4I1SA 2XZLA 4JL5A 2QMOA 5LDDC 2Q3FA 2GAOA 1IJEA 5HR5A 4YXWA 3PXGA 1GILA 1NJFA 1OXTA 1DADA 4Q9JA 2PX3A 4TL7A 1NIPA 4B3GA 4BFWA 4Q4HB 1G5PA 1G7RA 2JJ2D 4JYCA 5L3SB 3B1XA 2BMDA 3LVRE 2WSMA 4LHWA 1KKMA 3LXRA 3U3KA 1E2QA 1NBMA 2O0KA 4URZR 4TT3A 5E7MA 1KO5A 1XWIA 2BIFA 3KJEA 5H68A 4EPRA 1NKSA 3B85A 1Z08A 3TUJC 1OFUX 1QRAA 5HPYB 4X8MA 1LW7A 1WF3A 4NBSA 3UMFA 4PHTA 4LBWA 5FPTA 2I3BA 5E4FA 5P21A 1J8YF 2QRZA 2XTMA 2WOJA 1L4UA 2CHVA 4ZV4A 3AKCA 3RDPA 2XEXA 4LYJA 1E3MA 5AK0A 5SZKB 1JALA 1SVSA 3E1SA 3QG1A 3NDBB 4RZUA 1I2MA 4NTZA 2VHCA 4UNPA 4NCNA 2B8TA 2RGEA 3JZAA 5K8IA 1XDBA 3ZIAD 1V43A 4G3XA 2VSXA 2ODBA 1U8YA 2WAXA 2ZRLA 3M1IA 3NDPA 4HAZA 4PHGA 2CVFA 1R4AA 2RGNA 1HYQA 1KI3A 1U0LA 2WWXA 4UNRA 1R10A 3X1YA 3I73A 4N1AA 1G21E 4RKFA 1TL7C 2DYKA 2DY1A 2GVDC 3HYRA 3I32A 2WTUA 1WBBA 1S9HA 5GJCA 2NO1A 3FMOB 4NYIR 3KUCA 4JJKA 1YZNA 3ZD7A 3IIMA 2GKSA 3CPJB 3TR0A 3ETLA 2WJJA 1ZUIA 4H9GA 2AXNA 2ZI9A 1XTRA 3F3YA 1FMLA 2IUUA 3OEED 2PH1A 3E70C 2HUPA 2IYXA 3MWLA 3VNVA 4KYUA 3CO5A 5EE0A 2R6DA 1E9AA 2ZRKA 2WHXA 2ZRBA 4RJLA 4QKQA 5KOYA 2ZS8A 1FQJA 1OB5A 4JKYA 5HCNA 1BH2A 4RZ3A 3VR5A 1M74A 1UKZA 1UEIA 3OAAD 4RCZA 3THOA 1G8PA 4I81A 1OV4A 1QHXA 2IWRA 1E2MA 3BH0A 1ZP6A 4IDNA 4AYXA 1OHHA 5CIWA 1NMXA 1ZVQA 2BCJQ 2YHSA 4O25A 5HE9A 4IVPA 2D2FA 4TZ6A 4A8JC 3KFVA 3VX3A 2IUTA 4Q4LA 3BXZA 1KAOA 3BH7A 3HYTA 3AVYA 3PUXA 2EVWX 1D5CA 3W9YA 3BH6A 2WKPA 1S0UA 4PO1A 4Q7JB 5CDFA 5HTKA 4HAXA 2AFHE 1U8AA 2NQ2C 3KJHA 4IKEA 4B47A 1A2KC 3MWYW 2QU8A 2PT7A 2P6RA 6Q21A 3WNBA 4A6PA 1A2BA 3CUEF 2VO1A 5C1BA 1VCNA 2RH5A 4DDTA 2P5SA 2YOGA 4IFBA 4KLNA 3W90A 4NL4H 4EPYA 1G18A 3I5XA 5JCPA 2OZEA 2PMKA 1U0HC 4NCHA 2WMNB 5AJXA 1F3OA 1GG2A 1CLUA 1OKKA 3P27A 1PJRA 1U0JA 1E2KA 4KJZA 5GJBA 1RIFA 2R6FA 2XAUA 1F2TB 3QF4B 2KB0A 3C41J 4MRPA 2F7SA 5BYJA 3UXMA 1W44A 4D25A 2N42A 2XB2A 4YDSA 2J7PD 2MSEB 2NPIA 1J8MF 4V02A 3SQXA 5IDVA 4QHYA 3I61A 1CU1A 1HY3A 2WICA 4OI0A 4QM7A 3LFUA 4XD7A 4IEIA 5FUVA 1DEKA 3L8ZA 2XB4A 4RFVA 2O8CA 4JLDA 4EPXA 2J41A 3GJXC 3PUYA 1N6OA 4PPQA 5EE9A 2J0SA 1OIWA 1D9XA 2HXSA 1JEEA 1NN1A 3SEAA 4B3BA 2IXEA 4M1WA 2GJSA 3HP1A 5D3MA 3IQWA 4UXIA 1GRQA 3DL0A 4L9WA 5FR1A 1RFLA 2MSDB 1SGWA 4MKFA 3KQKA 1VIAA 2D4HA 2IS4A 5B2ZA 1CKEA 3ND9A 3ZQJA 1IY0A 1G3UA 5G40A 4DT1A 1W4AA 4LX0A 5JSZA 3UK6A 2VP6A 5BYKA 3AVXA 1Q3HA 2JATA 2ZUDA 5F9HA 3MFYA 4E5UA 3BIFA 4V0LA 2WV9A 5A5GA 4TWZA 1E9SA 3FMPB 3C5CA 1TF5A 2IYVA 4KYIB 2ZJZA 5TY0A 4A92A 4L4UA 4WZ6A 3R7WB 2FZ4A 1O3YA 2FGKA 4AWXA 5TDHA 4YXWD 1H8HA 3ZQ6A 1ZBDA 3PEVA 1R0YA 3AP3A 3MLEA 4CIDA 3Q7PA 1RJ9B 1NG9A 4C7OB 2VQSA 1N6RA 4Q4HA 5CJ2A 5FOXA 3U6BA 5JRZA 1NN3A 4XVRA 4DCSA 1ELOA 1QG2A 2JGNA 3BERA 3JVVA 2AN9A 4TTRA 4OK3A 4EPWA 4V0KA 2FFQA 1SVOA 3QEJA 4TLEA 5HKKA 1XPRA 4YMVA 1XF9A 1HE1C 1S9DA 2ODEA 2ZRNA 1BMFA 1IBRA 1DAFA 1E1RA 1NF3A 2CNWD 2D74A 2WPDA 4DIEA 2WPDD 1P2TA 2LKCA 1XMIA 4R71A 5JSZB 5TXGA 1EESA 5J40A 1N6PA 2BEJA 2ORVA 2XOKA 3C5HA 3FE2A 1ZRHA 4RSGA 1YU9A 3BOSA 1JR3A 2GCNA 3CIOA 1ESMA 3NKVA 5TB5A 2XGJA 4X8OA 2F9LA 2R65A 2GZHA 3VAAA 5IHPA 4JLNA 4DEXA 1KK2A 2GCOA 2C03A 3UANA 2QM7A 1TU3A 2C9YA 3Q8XB 5E95A 4DVGA 4QHTA 1VG0B 1ZCAA 5KTYA 1CJKC 4OL0A 1KIMA 2OCBA 4OQMA 1VCMA 2VP5A 2ZJ2A 4FI3C 5JCZA 3M6AA 1WB9A 3WY9A 1T8TA 5LPNA 4DCUA 1NL3A 3LXXA 1E0JA 2HF9A 3OHMA 4M1MA 4RY2A 5F98A 1HQCA 3TSZA 2KSQA 5CDFE 2J1LA 1LS6A 4GZMA 4PC2A 3NEYA 1G4UR 3VU9B 1TUIA 3W6NA 1S3SA 3GLFA 2ZROA 4C30A 3HJNA 5AJZA 4CEJB 4Y0VA 1G64A 3ZVMA 1TQ2A 2KBEA 2XSZA 3RSOA 4D4JA 5JI3E 3AP2A 2RKOA 3SZRA 3LW7A 3HPRA 1OHHD 1LV7A 1EK0A 1XEWY 3F0TA 3MJHA 3RC8A 4ZCIA 3IO5A 5C18A 1D9ZA 1XNJA 5LD2C 4Q1EA 4ITRC 1I2DA 3OFND 5KO2A 2OXCA 2P5TB 4MA4A 2J0UA 2NG1A 3H0KA 3TLXA 4JVNA 1P9RA 3PUZA 1GNRA 5FUWA 3LNCA 1XEFA 2IA5A 1AN0A 1D6JA 3BD9A 3FPAA 2QSYA 4NP6A 2PEYA 1RJ9A 4V0NA 3MWKA 4TSFA 2J9RA 2FPMA 4TLAA 4LYAA 2CMKA 4B3DA 2W58A 3NBXX 3ZVLA 5J4VA 4JKIA 3RANA 1SQ5A 2YV5A 4CZ2A 1ZNWA 3D31A 4QNRA 1CR4A 2QM8A 3QI2A 4KITB 1JJ7A 2BKUA 1GL7A 1SKQA 3BGWA 5GJWC 1ZNXA 5IT5A 3W34A 3CNOA 2CL6X 2GBLC 3BS4A 4Q4AA 3WHKA 1UBCA 4A0HA 1IXZA 1YR8A 3W3ZB 3EWAA 3EZ6A 3GCGA 2BBTA 1DAMA 3A37A 1XBTA 4AYWA 3TW4A 2ZR9A 3BFXA 4EQ6B 1DOAA 3Q7QA 4RVCA 3N5CA 3WYAA 2JLZA 1AS3A 1JB1A 2XJ9A 3CR7A 5FBLB 2RGGA 4HUQB 4Q1DA 4JVLA 2HYDA 2O0JA 3LWNA 1E9FA 1WA5A 2GJAA 2OUKA 4B44A 3AVWA 1UFQA 3IGFA 1OFIA 2ZR7A 3ASZA 3B1WA 3L0OA 3K70B 2ZE5A 1DAKA 4DHEA 4IDHA 1VTKA 1EX6A 4KFTA 1AGRA 4P4SA 4H1UA 2F3TA 1SXJD 2QP9X 3WRYC 1ZCBA 1E96A 1XRJA 2QPTA 2CJWB 1E2FA 4URWR 2NGRA 1M7BA 1KY3A 4LJ4A 1Z0KA 3QVVA 4CW7A 3B78A 2GK6A 1HEIA 3I72A 3S1AB 2ZJAA 2C5LA 2IYZA 1VCOA 3SHFA 5EQTA 4CF7A 2QGNA 3TSWA 3IBGA 2JEOA 3NH9A 3O8BA 1F2TA 3QF4A 4LUCA 4S35A 3FB4A 4GZLA 3OEHA 4D81A 1KDTA 4KU4A 2ZVPX 4Q1FA 3TW8B 1P75A 2WWGA 1VYVA 3VKHA 1MRSA 2QMUA 2GESA 3PV0A 1NP6A 4KBGA 4GI7A 3PUVA 3NC1C 3Q9LA 3RRMA 4DDWA 2F1JA 4HYYA 1L4YA 2AK3A 4ZI3A 3ZS8A 2ZEJA 1GAJA 1WDTA 2F55A 4TYWA 2OFWA 3K0AA 2ZRDA 4JL6A 3GFTA 2FU5C 1P4SA 3B60A 5AJWA 3S1AA 5CM9C 3ZIAA 3GEHA 4ASUD 3EC1A 2CHGA 2O8DB 3EC2A 3FKQA 1VYTA 2YOHA 3I92A 3QPVA 1VCIA 1YZUA 2PLRA 4JVMA 4ESHA 2CE2X 2BWJA 3PENA 4L8GA 2QBYB 2W6ID 4LWZA 1QZXA 4Q1BA 3EPJA 3GEEA 2BHRA 2ZJOA 5BXQC 2IC5A 5FTNA 1KO8A 5EXPA 1N0WA 3SDZA 4BFXA 4TTQA 1R0ZA 1YKSA 3SR0A 4GOJA 4JIMA 1AM4D 1G3RA 1G4AE 1ZNZA 1GL9B 1M34E 1W0JD 2ZSDA 4FD2A 4C0LA 1W0JA 1NIJA 3SI7A 2BDTA 3PJRA 5M04A 1XD8A 1HT2E 5DN6D 3R8FA 3AF0A 1UKYA 4NYJQ 2RGAA 1ZU5A 5FTLA 3FHOA 4ZO4A 4M9ZA 3W6OA 4HUTA 1G7TA 4D0LB 2FFAA 2VHJA 5EXXA 1KKLA 1GITA 1US8A 1YJ5A 2UZIR 3TAUA 2ZR0A 4BECA 4DCTA 1A82A 4TYYA 1B0UA 1OF1A 3WXMA 3AVPA 1R0XA 3AF4A 3MMPA 3KZ1E 1ZD1A 1CR1A 2GEVA 2ZE7A 2FDCA 1SZPA 2NOAA 4P32A 1KO1A 1Z07A 2VSOA 4Q01A 4GP6A 4R98A 3RWOA 2YINC 3AP1A 4GT1A 4Q48A 2C9OA 4C0BA 4JSTA 1UKVY 3V4RA 2JAQA 3AM1A 3DZ8A 3DO6A 4Z1MA 2REOA 3D3QA 1VECA 2AK2A 5FOSA 4TL6A 1Q21A 3B2EA 4GMDA 1GKIA 2Q9CA 3DZDA 2ZAOA 3OESA 2R44A 2FPKA 4EUNA 3KQHA 2V6JA 1Z47A 2CL0X 2QA5A 4EPTA 4L16A 3SFVA 1II8B 4IDPA 3CRVA 1IOZA 2VHQA 4BWYA 4OJKA 4A4DA 4C0KA 1J7KA 3NBFA 5CM8B 2ONJA 1XEXA 3DEFA 4QGFA 1XTJA 4KVAA 3AH8A 3B1ZA 2QRNA 3U60B 2QAJA 3LVQE 3A36A 4PPGA 1G19A 2GAAA 1Z29A 4K81B 3WMFA 3LBNA 2ZUBA 3OF5A 3L0SA 4RD6A 3OIUA 2GDJA 3A1UA 4B32A 1SVIA 3VHXA 1D2MA 1ZD8A 4TL9A 4M1KA 5F3WB 4HB3A 2GZAA 2R9VA 4OI1A 2GBLA 5L3QB 5KPJA 3Q85A 3CRW1 5FL7A 1OH7A 1Z63A 1KAGA 2CHQA 1G16A 3CPEA 1R7RA 4M2LA 5DO9A 1Z6YA 2GETA 2QPAA 4XD7D 1NJGA 3K0CC 4B35A 4ZDIA 4LBZA 3ZLJA 1TF2A 1Y3AA 1GVNB 2H5EA 1PLKA 2VSFA 1EGAA 3CKLA 2W2VA 3ND8A 4L15A 1W36D 4Q66C 2VIIA 4RD2A 1LNZA 4URVR 1YRBA 2FSFA 3IO3A 2OBLA 4LJYA 4L9SA 1R0WA 4MGKR 4OK6A 1P60A 3FDIA 1X6VA 3CNLA 1GM5A 4ARZA 4FWTA 1E0SA 4JVSB 1XU4A 3FKSD 1FUKA 1KO7A 1E0AA 2EFGA 4R2IA 3DKPA 3SE0A 1NI3A 3H1TA 1XPUA 1IQPA 2GXUA 1D2NA 1EFRA 4LCBA 3FKSA 2CE7A 1OPXA 4DBLC 3KUDA 2VP2A 5KDLA 3MGCA 2ZPTX 3RRYA 4JLAA 4HLDA 4OQXA 5D3QA 2QTHA 2O52A 5EP2A 1NSTA 3WBKA 4TMWA 2V3CC 2QGZA 2F3RA 3CLVA 4WBSA 2FEMA 2EW1A 1NN5A 2DFKB 2ZS7A 4ACAA 1NLYA 2WAYA 3SOPA 4JMPA 1JJVA 1X8KA 5KDDA 1NMZA 1NVVR 1A7JA 1NSFA 4EKDA 2QE7D 4ZIRB 4LHXA 2GXAA 2QBYA 3NEJA 2QENA 2YKGA 1X8LA 3B13B 4LV5B 4NYMQ 5JFGA 1KSFX 5L8VA 4OQLA 4Q9IA 3UMSA 2EYQA 3FFAA 2IWHA 3K70C 3CF0A 4LBYA 1VHLA 2G1JA 3BE4A 2QAGA 4FCTA 1S2MA 1Z0JA 2W0MA 3BJIC 3NH6A 4Q47A 1RZ3A 4OKSA 1KDPA 1IN4A 1MKYA 3AUYA 1X8JA 2AKAB 4OQFA 3GJ4A 4QBGB 4JS0A 3RS7A 1OW3B 4D80A 4HAVA 3MRSA 1G6HA 2J59A 1MOZA 3V4FA 1FZQA 4V0ME 3KDSE 4QL3A 1Q57A 3DKVA 4YC7A 2W6JA 4LOAA 3GFOA 2G3YA 3KTAA 4OK5A 3KXLA 4RD1A 5CITA 1LS1A 3OIYA 4BLPA 3PQCA 4G5QA 4CEIB 4LPKA 2IHBA 2WWHA 1KNQA 3ZGXA 1ZAKA 4U02A 2KJQA 1OJLA 5DYIA 4J0QA 4BFTA 2P67A 1KI2A 3QG5A 4WIAA 3KFXA 5UKDA 1KJYA 3AV0B 2OSBA 2EFDB 4PQRA 4AIIA 3KB2A 1BS1A 1MRNA 2F1RA 5EE3A 3CH4B 1G7CA 4LJAA 4EFMA 3REGA 2WJIA 4XOIA 4DSUA 1XB2A 2J0VA 1H8EA 2ODNA 2PCJA 3GQBA 3UWKA 3UWOA 4MGIR 2O8BA 5KYKA 1EFTA 4D4LA 3BWDD 1MABA 3VFDA 2A5DA 1CS4C 1DS6A 4ILEA 2WWIA 1ZIPA 2OBMA 3P32A 4KSCA 3H86A 3PCRB 3U3MA 2RGDA 3ECCA 2VLIA 2FGJA 1WE2A 2WJGA 2V4ZA 4RD0A 5JLJA 1XMSA 2E87A 2FEOA 4U7DA 3GLIA 1QHSA 1DELA 2A5FA 3FOZA 5BN4A 1ZM3A 4PC3A 3KQNA 1GNQA 2GWHA 4NKRA 4XIGS 3GFPA 1IN6A 3Q5EA 4DEYA 1YZLA 4Z8XA 1N0VC 1QHNA 2MSCB 2JJ1D 3NWJA 2IX3A 1G3QA 5EE1A 3CH5A 3A4MA 1YR7A 3VKGA 4W7SA 1M7GA 2DPXA 2PJRA 4ZKEA 4G5GA 4NU0A 4KXFB 2KWIA 4KODA 3LY5A 4XWKA 2P6UA 1WMSA 3K1JA 3AGQA 2CCJA 4C7OA 4BZXA 4KSBA 5E7IA 3SJBA 2WJVA 2C96A 1WXQA 1NMYA 3CBQA 3FVQA 3LBIA 4I99A 4V0MA 5K8UA 3SFZA 1TQ6A 2ZRGA 4JLPA 2B21A 4P3YA 1P62B 5JEDA 3T5GA 3GJ5A 1N3BA 3T1VA 2RB4A 1NY5A 1TNDA 4BLQA 1FNNA 3CZQA 4C9BA 2ZANA 2P0EA 1C1YA 3VTKA 1US8B 4ARZB 2F6RA 2E9SA 2ZSEA 3X1DA 4CEJA 4LJ9A 3QKRA 3OE7A 1BKDR 4OHVA 3WNCA 3DMNA 1EFHA 3AUXA 4I1UA 1EXMA 1NLFA 2BVNA 1CXZA 1E9DA 3KJIA 4MRVA 3EPHA 1FX0A 1XTIA 4RZXA 5JEEA 3QPUA 1XZQA 1YQTA 2V8OA 2GTPA 2Z5FA 5FI0B 1QDEA 3FYHA 1E1QD 2BV3A 4RD4A 1GOTA 4US1R 2AHOA 1KSGA 1MV5A 1T9HA 1EFRD 2D06A 3L2OB 3WYFA 1T3HA 1EG7A 1XJCA 3M4YA 3JZMA 2EWWA 3GJ8A 1A1VA 2NPFA 1KHTA 3T1TA 1H8HD 3AB3A 4AG5A 3BFKA 1UF9A 1SULA 4Z51A 1Z83A 1HTWA 3CWQA 3DHWC 3BC1A 4CRWB 1N6KA 1TX4B 2X19A 4OJQA 3VQTA 3CW2A 1CBUA 4JJZA 4D0GA 5ELXA 1F5NA 1JI0A 2OLKA 4PPNA 5KHOC 2C98A 1RC8A 4MGYR 5JWRA 3L82B 3I3SR 1R8QA 1M7HA 4I1OA 4QBIA 4Q7LA 2QMHA 2GVZC 2IS6A 1Q1EA 1Z6AA 2IEZA 4LHVA 2FH5B 3IBYA 1XCMA 1NY6A 3P4YA 3AVQA 2W6IA 1R8SA 3ZJYA 3R9WA 1S1MA 4QM6A 721PA 4HDOB 2WWWA 2YWGA 1ZD9A 4IOLA 2FMXA 1IY2A 1T5IA 4JT2A 5FPSA 3CF2A 4MKIA 3U7GA 2X1VA 5E7JA 3NTUA 1CP2A 1AK2A 4DLXA 4TZ0A 1Z6XA 5EZ5A 5HZKA 1NN0A 4DSOA 1T5LA 1OYWA 2QQEA 1GUAA 8OHMA 1U9IC 3K0FB 1W4CA 4MYHA 3A58B 1E2GA 4DRZA 2YWHA 5KU1A 3ZVNA 4M9QA 5JS8A 1KZGB 1DG3A 2QMEA 4NHOA 1VMAA 1SXJB 2I1QA 2WWFA 5FI1B 1UDXA 1LVGA 1E32A 3LQQA 3CONA 2YVUA 3A1VA 1E9RA 1Z2AA 1ZMXA 2RGXA 4FWIB 3U7EB 1BIFA 3IPXA 2GNOA 2CLCX 2ONKA 1W5SA 4HUQA 4A2PA 4A2WA 3IEUA 3CZPA 1Z8FA 5FBQB 1MABB 4PZYA 1G6OA 5FOUA 4GDFA 1W0KD 2HF8A 3B82A 2EWVA 2ZRFA 4WVFA 3EX7C 1SXJE 2ECKA 4O3MA 2OCAA 1FP6A 1DO0A 4BFYA 1AKYA 4N0EA 5GVRA 2H16A 1P7CA 2H17A 2WKRA 4ERNA 3DM5A 4C4PA 3HU2A 2QZ4A 3FGNA 3QSYA 2BBSA 2NO0A 4FMDB 4M1SA 2CVHA 2XTNA 2O8DA 3ADCA 1YZQA 2RHMA 1KK0A 4JL8A 1IAQA 1ZM9A 2IW3A 4CEHA 1E98A 3QKSA 4CT4B 3GLIE 3OZXA 1C9KA 4LPSA 1C4OA 3R9XA 4QFMA 3AF2A 4HAYA 3SYKA 2QY9A 3EW9A 3EWSA 2GJKA 2DB3A 1HA3A 4NCKA 1EFUA 3LLUA 2ZU6A 4KHZA 2HT1A 3MUFA 4PO9A 4PSAA 5J4YA 2FFBA 5TVKA 3TVDA 4UQOA 4YMWA 3RHFA 3IEVA 2XITA 4HLQB 1E2EA 2VPPA 4BUJA 5JHGB 3AKDA 1S4QA 2WMOB 2C78A 4Q9HA 3UPUA 1LFDB 2FFHA 2VP4A 3U5ZB 3O47A 4DLRA 4IDQA 3SJCA 4UNNA 3KX2A 1ETUA 1ZYUA 2JLXA 5HZHA 4WA7A 3LLMA 3FTQA 3P26A 2FSIA 4FIDA 2OLJA 3B8HA 3KKQA 1GRRA 5J4KA 4Q4JA 5FH9A 1GZSA 2QPOA 1E2IA 1XEXB 2ZE8A 3QIAA 1SVWA 1TF7A 2HYIC 4CVNA 1R6BX 2PJZA 1U94A 2QTFA 3EXAA 1Z0DA 3GJ3A 4LYHA 5FBVB 1FW6A 3EA0A 3GJ7A 3GLFE 2YC2C 2J46A 1VIYA 1OH5A 4KVGA 2FF7A 1P2VA 1P6XA 3EIEA 3GJ6A 3PITA 4HZIA 3NHBA 1XTKA 4N3NA 1RYHA 3QXCA 1BYIA 4XJXA 3NXSA 4Q00A 5AWFC 2JJ2A 3U44B 5HE8A 3SNHA 2ZRIA 2IYQA 5JWHA 4C3ZA 5FTKA 2CDNA 3DPUA 4RKEA 4YMUA 1SXJA 3LV8A 2WM9B 4AG6A 1P73A 2E1RA 3IIJA 2QI9C 3D7MA 4OI2A 2QUZA 1OIXA 5CLQA 3RWMB 3IHWA 2JCSA 2O5VA 1RRPA 1E1QA 2DWOA 1J2JA 1G5RA 1G1MA 1DE0A 2J7KA 4PANA 1TADA 1P2SA 2QORA 4ZI2A 2OM2A 1RRCA 4FMCB 2IXFA 2IYLD 1Q0UA 5JWOA 4Q9KA 4QBHA 1U90A 2ZREA 4JBWA 1I4LD 1QVRA 3C16C 221PA 4M9SA 1P3JA 5LB2A 1QVAA 1CF4A 1YZTA 4A8JA 4F93B 2N46A 1MO3A 3LX5A 1W4RA 1VDZA 2IYWA 1PVOA 1OE0A 1K5GA 1TAGA 3N70A 4HDQB 1IN5A 2C99A 2G77B 4DZZA 1M6NA 2WIAA 2X2EA 3CRQA 5BW8A 1QHGA 4XSHA 4TT3D 2BM0A 2IF2A 3T5DA 1NBMD 3QKUA 5L3VA 1Q12A 1KJWA 1HT1E 1ZW6A 4CDGA 2O8EB 2WBLC 4LJ7A 1RE0A 1WQ1R 1W5TA 4IRUB 4TMKA 4BLSA 3B1YA 2KE5A 4OHXA 1VG8A 2A7QA 3VU9A 1II9A 1FTNA 5DI3B 2RMKA 4GNKA 1G8YA 1GL6A 1CULC 1CJUC 3IUYA 5AUPB 2DCUA 4D4MA 1OH6A 3EARA 1TQ4A 3EZFA 2ZJ8A 4PQYA 1OB2A 1XFAA 3Q3JB 5H1YA 5JECA 4QOSA 5L3SA 3M0EA 2DFLA 2H92A 1Q22A 1XCGB 1H8ED 2YYZA 5DN6A 3UATA 5TMPA 1RW4A 3K0SA 3SQWA 4AKGA 1COWD 1GP2A 2ZIAA 3HU3A 3QUSA 1GKYA 4HZUB 2UKDA 4OHZA 3T61A 1S3GA 1E1RD 2BKEA 1AZTA 1Q44A 1QF9A 1GFIA 2CNWA 3A1WA 3KKNA 4QJ4A 3ZH9B 4BASA 1MT0A 1NVWQ 4PZLA 1B23P 1PZNA 2Z83A 1GIAA 5HKKD 4BE7B 2O8CB 4NYMR 5EE5B 4K46A 4ACBA 1OFHA 5IF9A 1TMKA 1KI4A 2WSSD 5EUQB 5JJKA 4GBMA 1BMFD 2P65A 2JASA 1ANKA 2XNDD 3WMGA 2H18A 4D0NA 1UBGA 2JIZD 1E79D 1U81A 4IJMA 4XSGA 1BO6A 3TBKA 4HAUA 5J47A 1JAHA 3TUZC 2OT3B 1NRJB 4P4SB 3LBHA 4XWOA 1JNYA 2DR3A 1E9EA 3QE0A 1DPFA 1G5TA 2WZQA 1OSNA 2FN4A 3OEEA 5DISB 1Z5ZA 2VRWA 1Z0IA 3L8YA 1J70A 1K6MA 4HDCA 121PA 3SBEA 1DAIA 1EFCA 3NVAA 3GPLA 3BB1A 4LSGA 4NCJA 1OXSC 5JHHB 1E2LA 4C2UA 2UVQA 3KXKA 4P0TA 2LCFA 3UKDA 2JJ1A 2QROA 3VR4A 1T3LA 3BB3A 2NZJA 1IHUA 5FFMA 3NC0C 1PLJA 1UKEA 3R20A 4O2RA 3WNDA 3GLGE 2HT6A 3B9PA 2QP4A 4BQSA 4QJ5A 1OXUA 4LV8B 2C9CA 1E99A 4XH9B 2I4IA 1P2UA 5LD2B 3K0FA 4PSVA 2CBZA 1IN8A 3T35A 4PQFA 2PCLA 2ZQ5A 2XNSA 4MUBA 3RABA 4ZDJA 2G88A 1AA9A 4HEJA 4Z1MD 3U61B 5B58C 5K8TA 3FMFA 4FCWA 2XXAB 1G8HA 1KI6A 1W47A 2DFTA 3I4LA 1U8ZA 2GXSA 3A8TA 1IONA 1I4DD 4MYUA 4EPVA 4F91B 2JLUA 3PEWA 2AD5A 1KYIA 1JQJC 4TSFD 1IM2A 1MO5A 4KAXA 2P2LA 4F4JA 1A5TA 3QENA 4MITA 2ZRPA 4HI0E 4JT4A 1UDWA 1UAAA 3G0HA 3DM9B 5J5CA 2ZJYA 4R9UC 5LBIA 2FE4A 1FOEB 4NE2A 2AFIE 4FW9A 4GRAA 4TMTA 2GRJA 2ZYUX 1W48A 1YHNA 3C15C 3A1SA 4ABYA 2JLQA 4WXRA 3TMKA 4A2QA 2FJUA 3TSOA 3GLFB 4KFUA 2GA8A 4IOJA 2CJWA 1OYYA 1PUJA 5F9FA 4GL2A 3I8XA 3EZ2A 5BN3A 2V7QD 1FL9A 3WYGA 2Q9BA 3ZD6A 4Q19A 1E2HA 3UIEA 4YQFA 3OIWA 4CEIA 5AUNB 3SHWA 1N5IA 2F9MA 3U3RA 1P61B 2ODWA 2RAPA 2R6GA 4KFSA 2CCKA 4R7ZA 5K8LA 4C0SA 1ZM2A 2LWIA 2ZSBA 3ICQB 1LF5A 3K53A 3QF7A 3R8CA 3U4QA 3CB4A 2X8AA 4XWAA 4PTLA 4IOKA 4JZKA 2QG6A 3D6TB 4BFSA 2ZRAA 2B8WA 3CRMA 4QHSA 4BFZA 5F2EA 2JLYA 1H65A 2BJWA 2JLSA 3VKWA 5FOWA 3PVSA 2XXAA 1YR9A 3QKRB 4M1TA 4M1OA 1Z6GA 2MMCA 4DWJA 4HLUC 1NKTA 2FPLA 2Q0HA 3THYB 2ANCA 2G0TA 4OHYA 3D8BA 3KKMA 3KQLA 4Q18A 1E6CA 1Q20A 1ZUHA 1BOFA 2O8EA 2AX4A 2QN6A 3EAQA 4EJSA 5FL3A 4YMSA 1KDOA 5SZJA 4LC0A 4LJ6A 2PX0A 1JBKA 1N5LA 1RRFA 3I62A 5DHAA 1G8FA 1J99A 4EFLA 4AY2A 4PXAA 3SYLA 3FHCB 4M8NE 2GF9A 1JXMA 4A0RA 3U3OA 2XJ4A 5KNBA 4ASUA 3CWZA 3P4XA 2GJ8A 3K70D 4NMMA 1XD2A 2BCGY 2H7VA 4AD8A 3LAWA 1HE8B 2D7DA 3RVBA 2IYYA 4TYQA 4Q9LA 5C4GB 5L3RA 2V1UA 5CK4A 1AIPA 821PA 3PG5A 2HCBA 1NLZA 2R6CA 2VHUA 1T6NA 4TTPA 3AQ4A 4A15A 3THYA 1F60A 4LI0A 1Z6TA 2UZ3A 2BEKA 3X1XA 3RSLA 2RGBA 1NVUQ 3EIHA 3RLFA 4DC9A 3AGPA 4Z8YA 2WIBA 3ICEA 3N2IA 2DWPA 1M2OB 5IK2A 3RAPR 2GILA 2YWEA 4Q21A 3K0EA 3U4QB 3TK1A 3AKYA 4C0AC 2ZUCA 4YLGA 1KSHA 4V03A 3RS4A 4HATA 3REFA 1PUIA 4KFRA 2WWYA 4JLBA 2DFNA 1FX0B 2YWFA 1CTQA 1M1YE 4M4SA 5H70A 4AKEA 2QQ0A 4PHFA 3O8CA 2GZDA 4LHYA 2ERXA 1OIVA 3VR2A 4TN1A 3BK7A 4A0GA 5J4HA 5BQ5A 4DCNA 2CEAA 1N2CE 4P33A 4QC2A 4B34A 4IVRA 4JSYA 4DIDA 1T4GA 1RPZA 1UJ2A 1WRBA 1Z06A 3HR7A 2IF0A 2BM1A 1G291 4Q1CA 4HSEA 4B74A 3NBYC 3B5JA 5CLLA 2N1BA 3KXIA 4MRNA 2YOFA 4UJ5A 5DNYB 1IY1A 4MYCA 3T12A 1KGDA 3GLHE 3AKEA 1W4BA 2FOLA 2HXYA 1LTQA 1GKUB 3F8TA 5B57C 2A2ZA 4I1VA 4B71A 4F92B 3UG6A 2W0SA 4E03A 5AUOB 3T1OA 4MRRA 3GLGB 2A78A 4FN5A 1L2TA 1XMJA 1W49A 2AL7A 3TVTA 1Z0FA 4C0JA 2NTYC 4IEEA 3OAAA 3IKJA 5DYGA 5GVSA 5JBQA 1BYUA 2Z4RA 5DHFA 3GLHB 2ZJBA 2OXRA 5FOTA 2OCPA 4FXPA 2OCYC 3QKSB 3U6KA 2QAGB 3B9QA 4BZQA 4B6EA 3CPHA 1G41A 1T3SA 2DWQA 4W5HA 4GFDA 5FBRB 2C95A 1N6LA 3TR5A 2BBOA 1DAHA 1JECA 2B92A 2WVJA 2FNAA 1L8QA 1FNMA 1YE8A 4LJ5A 4MH0R 4RZ2A 1E69A 1O87A 4UNQA 1UBEA 4AC9A 3ZVRA 1NBME 4PC1A 5KPDA 4DLWA 2W00A 4MDEA 4BLOA 4AK9A 3C7KA 1AKEA 521PA 5E3HA 3L0IB 1F48A 4UXJA 5FBWB 1OFTA 4FMDF 1KMHA 3TQCA 4HB2A 3DDCA 2WKQA 3MJRA 1II0A 2WJYA 2CXXA 4QGHA 5D3MB 1CEEA 1KK1A 2X2FA 1WP9A 1IN7A 2I1VB 2GF0A 3VR3A 3SJZA 2ORIA 3BB4A 4EQ6A 5A4JA 1YRAA 1V5WA 1DVRA 1F2UB 4DJTA 3NBZC 1AZSC 2H1LA 3IILA 1P5ZB 4G1UC 4G01B 4G5RA 5JMTA 4GP7A 4ZKDA 3THXA 2R8RA 2VA8A 4F4CA 5KUTA 3X1WA 1G3IA 3KKOA 4QJ3A 1W1WA 3QOFA 3W8RA 5BWMA 4JYBA 2IXGA 3K9NA 1XPOA 4X8HA 1W36B 4PO8A 2DBYA 2EQBA 2VF7A 3FMIA 3GLHA 3MCAA 1KI8A 2GXQA 4DLSA 3OEHD 4OHWA 3A1TA 3RRZA 1P9WA 2ZI5A 1TEXA 2JDIA 5FUYA 1UM8A 2GJ9A 4D4KA 4M53A 1Q3TA 3EA5A 1K8RA 1G3MA 2Q6TA 3W5IA 2ZS9A 4AYTA 3QXJA 1KZ7B 4B3XA 2ZE6A 2BBWA 2OAQ1 5CB6A 4TL8A 2HCJB 5DI3A 1DARA 2EU8A 4PC7A 4XTRA 5EP3A 1XZPA 2ZRJA 3CX7A 4B2IA 1VYUA 1XJ0A 3QVUA 1X1SA 1KO4A 4GOXA 3TRFA 1KJZA 3PIRA 3HU1A 5KDOA 3THXB 3TQFA 3ADDA 5AJVB 4URUR 4ZDKA 4MRSA 1DO2A 4P31A 1QHIA 1XP8A 3K9HA 2IS2A 4GMXA 4URXR 2A9KA 5J4LA 4M9XA 1N6NA 3LO5A 3EASA 1W46A 2ATVA 5DE3A 1RVDA 3H84A 4PSKA 2ZI7A 2JDID 5DSZA 5JRJA 3X2SA 4G5SA 2WJHA 4BEBA 4A9AA 2XNDA 5CB8A 2Y8EA 1SHKA 1KNXA 3AEZA 3RC3A 4PR0A 2OESA 3MAAC 3Q5DA 2HDNB 3T1QA 1Z0AA 5EJEA 3CM0A 3NIBA 3GD7A 3WRXC 1VPLA 3TNFA 3AVVA 4JLJA 1VHTA 1E2DA 2G6BA 2QL6A 5EXSA 1G7SA 2EYUA 3QEOA 1T91A 4LY6A 2H8KA 2V55B 4Y0AA 1AQYA 1XTSA 4F7WA 4P4UA 2MMGA 2HJGA 4LK2A 1YZKA 3GEIA 4II7A 2PL3A 3KKPA 2DHRA 2AKYA 1E2PA 1FTSA 3G82C 3QXHA 5EXTA 3SN6A 1JAIA 3U44A 5JJIA 2JA1A 3LRPA 1GNPA 2VF8A 4AKHA 1JR3E 4WAUA 4H1VA 2IYTA 2A30A 4RFSA 1ZJ6A 3ADKA 2CL7X 2XOKD 1G20E 4PC6A 3EPKA 3LD9A 2FZLA 1AS2A 4OBEA 4C2TA 3BBPA 2J0UB 3GLGA 2OFXA 1KOFA 3ONWA 1FMJA 1SHZA 2BMFA 1E9BA 3W8NA 3CR8A 4S2EA 5L3QA 4ESVA 4EJSB 4UXHA 3P20A 4BFVA 3THWB 2P6NA 5EUMA 3DOFA 4CT5A 2IEYA 3K8YA 3LH5A 1G9XA 3EZ9A 5GADl 2XZOA 4EDHA 4MQBA 3THWA 3SJAA 1TEVA 5C4MA 421PA 3AVUA 1IXSB 2QT1A 3CF6R 3GLIB 2F1HA 1MO4A 2FV8A 2CCGA 3AVTA 2IS1A 3CRRA 2LKDA 2G0NA 3QBVA 5B64A 4IXMA 1U98A 2ZSFA 2ZYTX 4US0R 3VX4A 4E22A 4L5BA 1Z28A 1W2GA 2ZSAA 4WZAE 3WHLA 4MGZR 1JEDA 1QG4A 4Q1AA 1P9NA 5KSYA 3E2IA 4HAWA 4V0OA 4E07A 4A8JB 4TQAA 3QNUA 1Q1QA 2IYRA 1N6IA 1GRNA 3OE7D 4ON9A 1Z3IX 5DLQC 2A5GA 2B6HA 2R6AA 4CEHB 4AI6A 1E4VA 1JXOA 1TU4A 2IUSA 4DDUA 1KSJA 2CK3A 1WCV1 2VH5R 1T8UA 3NG1A 4PAOA 1EX7A 2J7PA 1VG9B 2PT5A 1L7VC 2RGCA 1YVDA 3R9IA 3E5HA 2YJTD 4QG7A 4X8LA 5G41A 1NVXQ 1GWNA 4IHQA 2BMJA 3VR1A 4D26A 3KL4A 4LDJA 1Z2CA 2Z0MA 3PUWA 1XMVA 2OHFA 4DUGD 4F38A 1LB1B 4EFNA 2VP9A 1CR2A 1D8TA 2REBA 3W3AA 4RCYA 4B3CA 1XD2B 1KI1A 4IFEA 5BN5A 4FMBB 4F4IA 2ZRMA 1U99A 2FSHA 4GSYA 2C8VA 2REXB 5SZHB 1R5OA 2A5YB 2OILA 4B2PA 4B48A 3LQRA 2JLRA 1T0JB 2V7QA 5GJVC 1M8PA 4W5JA 5DH9A 3PR1A 2QSZA 2W83A 1OXVA 2YC4C 2ZVQX 2QEQA 3MG9A 4POAA 3T06B 3VR6A 1MR3F 1WBDA 2RGNC 4PAMA 2QE7A 3C8UA 3UMRA 4OYHA 4A0FA 1CR0A 4JLMA 4MKGA 4NCIA 5TV2A 3PFIA 2NIPA 1PV4A 1JR6A 2G9NA 3WMEA 3J81k 1G17A 3SC3A 4XVUA 2QNRA 1XXHA 4LGMA 4M1YA 2BMEA 1XD9A 4UJ3A 4TYPA 1D2EA 4TLDA 3K0AB 3EPLA 2G1KA 4UNSA 5C2JB 1YZGA 3U7FB 3L0PA 3Q72A 2Z6VA 3FWYA 1W0KA 4NYJR 5LB4A 4IOMA 4MUAA 4BFUA 2ZXUA 3U7HB 2JLWA 5G3ZA 3AF3A 4TLCA 1N0UA 4HB0A 3V9PA 1N6HA 1SKYB 2ZETA 3VHLB 4A82A 1Z22A 1S96A 3W6PA 3EZ7A 2JIZA 3IPYA 2ASEA 4HLCA 3FHTA 3IQXA 1QHHA 3QJYA 5KSZA 2KBFA 4PX9A 3K0CA 1ODFA 1ZM4A 2WSSA 4DCVA 2R2AA 3MSXA 3TIFA 4DLUA 3SU8A 1LF0A 3B7GA 2G83A 5CYOA 5C46F 2SHKA 5FPKA 1NG1A 2Q21A 4Q7MB 3UG7A 3WBJA 1COWA 1SKYE 3MD0A 4C0QC 2AD1A 4CGZA 3I8SA 1TUEA 4G5OA 4MDFA 3N2EA 1KDRA 2NO9A 1K5DA 1IXRC 3O8DA 1E4YA 1XTQA 4WOPA 2V9PA 3QQ5A 3O8RA 1KY2A 1UEJA 4HZUA 2OBNA 3BFVA 4M0LA 3QBTA 1X86B 2ANBA 3CX6A 2BC9A 2GCOB 4TMVA 2FG5A 3KQUA 5JZVA 3BORA 5A0FA 4P4TA 2B7CA 4B73A 1MO6A 4BPBA 3A4LA 4YDHB 1KI9A 4WW0A 4E09A 2OFOA 1DBSA 4I4LA 1ONBA 1E2NA 3KB1A 3ZZ0A 1NNEA 2PMDA 1VG1A 2VTKA 2ZI4A 2F43A 3U2QA 4DLZA 2O8FA 1ZU4A 4QGAA 1CRPA 1J90A 4YMTA 1OLOA 2P3SA 4NPHA 4LHZA 5KSPA 2J5XA 4ZIRA 2PZFA 1ZC3A 3OIVA 1XXHE 1FQKA 4KLZA 3GMTA 3ZS9A 4LBVA 4C0HA 4A36A 3AF1A 4QGGA 2EFCB 4URYR 1ZM7A 2W2XA 3QY0A 1CJMA 1TQDA 1R2QA 3TUIC 1ZNYA 3EIQA 1OKKD 4B2LA 3B1VA 3ADBA 2RHDA 1QBKC 4GPTA 4RFSB 5CIQA 2XX3A 5AUQA 1A4RA 3K9GA 4PPFA 4NONA 3WP0A 1DG1G 2Q3MA 2PLFA 1DTSA 3R7WA 3DOEA 2ZJ5A 2C77A 1ESNA 5EZ6B 5FTMA 2PBRA 1UADA 4O0MA 2X77A 2IT1A 1RRGA 2NZ8A 2VL7A 3RS2A 2D2EA 2IYSA 4US2R 3HR8A 2XTZA 2F43B 3NHAA 2K5UA 4QXAA 2O8FB 1X1RA 4JLOA 3L43A 3SS8A 3DMDA 4QRHA 4LRWA 4DT1B 4DKXA 2OG2A 1SVKA 2ZI3A 4M21A 3TGPA 1CJTC 4KV9A 2HJVA 3ZZUA 5JI2E 3WP1B 5ANRB 1Y63A 1DAEA 4B76A 5JS7A 4OQNA 4BRUA 4DUGA 4TQUS 5KNDA 4FCVA 3IIKA 1GTVA 3DVLA 5HCIA 4JBXA 1ZUNB 1G8GA 1SXJC 2Q3HA 2W2TA 2VP0A 4U5XA 4JLKA 4ZCLA 4B43A 4PFSA 1F6BA 2J3EA 2Q9AA 3C14C 1GDDA 4W9MC 2O8BB 1ZINA 1KMQA 2GEDA 3QPWA 4DDVA 2ZRCA 4HB4A 4KBFA 1E9CA 4BLRA 1E94E 4Q5IA 4IDOA 2CK3D 4AKIA 2A3RA 3ASYA 4W5WA 1RKBA 3RS5A 1Q1ZA 4TMXA 3A6PC 3T15A 3LW8A 1UPTA 3H4MA 3IDQA 2ZTSA 4IVQA 4NYIQ 4B6FA 5JJLA 4M22A 5FUXA 3B6EA 4A1FA 3QXSA 5SZIA 2F1IA 1RYFA 3HPQA 4QBFA 2NMVA 4JBYA 4LZZA 4R2HA 4LC1A 4D2IA 4Q02A 2J87A 5B30A 1AS0A 1W2HA 4DB4A 3KTAB 1II8A 2YZ2A 2HV8A 4PZZA 3K09A 1EWRA 2BOVA 2ERYA 4NZYA 2A5JA 4ZPXA 2AXPA 1HV8A 5KSOA 4MYTA 1E2JA 2NO7A 4LYFA 2Z4SA 2XZPA 1I4TD 1R5NA 4FMCF 1DAGA 2VHTA 1JPNA 1MH1A 2D7CA 2IK8A 3OFNA 3JVUA 2C2HA 2V54A 4DLVA 3G5UA 4JLVA 2B7BA 2ZYVX 3W5JA 2TMKA 2OAP1 4BGDA 1JR3D 3LX8A 1VKJA 4PHHA 4RD3A 2VYFA 2GEUA 1E0KA 3IHLA 3KJGA 4DSTA 3BRWD 3PEUA 1E79A 1JQLB 3F5FA 2VEDA 4B33A 1CIPA 4B3FX 2GCPA 4NH0A 2ZITA 3VMFA 4XVQA 4HLUA 2PZGA 2D3WA 1JPJA 4D6PA 5IK2D 1F2UA 3C4JA 4IXNA 1IJFA 1XJQA 2YNMA 4TYNA 3K9LA 2ORWA 1N25A 2FSGA 2RCNA 4GOKA 4DLTA 2FX3A 1GSIA 4TQ9A 2QT0A 2CLDX 5CJPA 4XTCS 1HH4A 2W6JD 1HUQA 1W36C 4AURA 5KNCA 2QTVB 5G3YA 2HEIA 2QP3A 3TE6A 5AR1A 4WXPA 5FR2A 3TJZA 2C04A 3LA6A 4YONB 4TMZA 4U00A 3EG5A 4FINA 3RRNA 3SBDA 2HLDA 1YR6A 3U3JA 2OO7A 1W7AA 1XCPA 2WOOA 4Q4AB 4Q4JB 3QKTA 5DI9A 4BRWA 4UKDA 2GK7A 2OE2A 3VNUA 2EFHB 1TTTA 3PEYA 1TPZA 3RNLA 1S1CA 2HLDD 2ATXA 3SYNA 4BZPA 3P1JA 1XEWX 2ZM5A 4CYMA 1FPMA 4Z54A 1Q1BA 5TARA 1EWQA 4LJ8A 4B75A 4Q7KA 2OEPA 1OT3A 2CLSA 1QHYA 2IL1A 1CJVC 1T0HB 4NDZA 1HURA
chains in the Genus database with same CATH superfamily
3BHNA 3M9XA 2MOKA 3RBXA 4FC6A 1JQEA 4UUNA 2AWOA 4CKCB 2HX1A 2PEZA 3GMDA 3RFXA 2FQ1A 3ZX4A 2REQB 3RQSA 5FT9A 3N59A 4K8OA 3M49A 1P1JA 1P8JA 2OO5A 1SVMA 1KI7A 2J45A 4KUEA 5KI6A 1G0OA 4BGUA 4DLAA 4KIGA 3CLRC 4EZIA 4FYKA 5AJYA 4B0OA 4FOOA 3BZUA 5LOVF 2QVCA 3KP1A 3QHPA 4Y9TA 5FO1A 4BS9A 4ZVKA 3F46A 1JTEA 1Y42X 3P0RA 3I0NA 3F8WA 3LK6A 4IJKA 5EYPA 2BE7A 4Q03A 4EAQA 1U1EA 3D1LA 3DE7X 3A4NA 1KAMA 3R7AA 1ZIOA 3AR4A 1Q17A 4UHJA 1JMKC 2L0XA 2OV2A 2ZRQA 1FRZA 1B8NA 5AQ1A 3HXTA 1DZ3A 4XR4A 4ZOLB 3QLTA 3GJ0A 1Q0LA 1OX5A 2BRUA 2OGZA 2R62A 3EG9B 3F8SA 4OI4A 3I5YA 3IAEA 4C20A 4D82A 1B15A 1X9IA 2HEGA 3MWJA 4H7PA 5IC6A 3S2IA 3BTSA 2DFDA 2NACA 1YR3A 3I1FA 3I8OA 4GX2A 3X44A 1N5JA 3A04A 3V1KA 3L5KA 1C9MA 5A6SB 1OH8A 3IUMA 2VBCA 4NXNB 1AQUA 1L3BA 4BAZA 1PLLA 1IHOA 2QD3A 5FQNA 1HNZB 2DGDA 2EFEB 3UF0A 4UULA 3ZEIA 3QYFA 2WTXA 1NF8A 2ZU0C 1KMHB 3Q8MA 3BAFA 3TFWA 3VYUB 2PL9A 2YJZA 2FR0A 2V4MA 5HCUA 1SR8A 1CIVA 3X1ZA 3RYCB 4TTIA 3J7AC 5G0UA 5EP1A 1N3IA 2VJPA 4XX1A 5CLHA 3RS3A 2Z9DA 3L8DA 3DQZA 4KCGA 2HBQA 4J1NA 3AJ9A 4N7MA 1KOJA 1A5ZA 3JARA 4R31A 3LX6A 4ZVOA 1DU4A 4FMPA 4AIRA 1KZ4A 2O3JA 1E6UA 4BEJA 5FOVA 3T8YA 1MHTA 2Z43A 1CVIA 1AJEA 1ZC4A 1FP7A 4QSHA 5BQFA 1JQ3A 1KK3A 3AVOA 5CK5A 3PWSA 5G53C 3WLTA 10MHA 4W9NA 3U4HA 2WWRA 2CNLA 1KY5A 3SMQA 4NG4A 1ZWKA 2FOXA 1FS6A 2AC4A 3C39A 1GA4A 4IQ0A 5EERA 2XZLA 4JQSA 1NBOA 1ZH0A 2Q3FA 2GAOA 1RAGA 2NV6A 3GO4A 1IJEA 2ZVDA 3FKJA 3INNA 2DZDA 3KOMA 3NANA 4OUKX 4YXWA 5HR5A 2E3JA 2E4ZA 2G82A 1N8SA 3EDRA 2XUAA 4Y9RA 1I6LA 4Q9JA 5IKMA 1ISPA 5EJ8A 3PQFA 4FNMA 3R8XA 2XW6A 4A8TA 4B3GA 1MCZA 5JAPA 2ON6A 3LHFA 2RHHA 1SHLA 4K26A 3RT9A 4EI8A 1G5PA 1G7RA 1O9HA 3MIZA 5IXJA 1E58A 4XRGA 4CM8A 5AVUA 4DA4A 5L3SB 1S3FA 1UFRA 3B1XA 4OP1A 3ESAA 3A11A 3UKJA 3WHIA 1U9CA 2YWCA 1Q1NA 2O0KA 3OQMA 4RVDA 4INAA 1RLUA 5IC4A 1KO5A 1XWIA 2BIFA 4EPRA 2YJNA 4DHWA 3IX7A 2C5HA 3FOBA 1X7HA 1Z08A 2OGSA 3AETB 1NZDA 1RAHA 5AK6A 3TUJC 4C76A 1WF3A 3FSRA 4CUKA 4IRXA 9ABPA 2PD4A 3I9V6 2WQ6A 1XSEA 1AUXA 1C5KA 4LBWA 3ZDAA 2I3BA 1GVHA 5E4FA 3WK4A 1J8YF 2XTMA 2CYBA 4Q34A 2QG4A 3CSDA 1JHYA 3AKCA 2CVOA 4YRDA 4NFYA 3LDHA 4CODB 1FA9A 3QG1A 4U7JA 1EM8A 4BQFA 1FJXA 2Q6LA 4JVOA 1Y8CA 2BEVB 3KQYA 4NAUA 3SXPA 2Q28A 2RGEA 1M6YA 3IB3A 1BXGA 3K0KA 1IOWA 3ZIAD 4RY0A 5K8IA 3G5MA 1V43A 2JFVA 4DADA 1RWBA 3D7LA 3L9XA 4JSRA 2QL9A 1DPGA 1L7OA 2VSXA 2QJTA 1U8YA 2C0PA 2YFYA 3NJ4A 4PHGA 3WYEA 5JCJD 5A02A 2OHOA 2RGNA 5J1SB 3VO1A 4PGHA 4UNRA 3QVGB 3ZHSA 3MTEA 4LXHA 4QUGA 3PRJA 4WHMA 3X1YA 1KQNA 4G1BA 4FT4A 3KWFA 3OOHA 4O2AF 3MYRA 4RKFA 3Q8KA 4UVIA 2GVDC 3HYRA 2A0WA 1VLJA 2AG8A 3VVMA 1DMSA 4YT4A 4YUAA 3GLKA 5FPQA 1EXDA 3T5TA 1LBSA 3E23A 1UWCA 2H3EA 3ZV4A 5EZQA 2DLDA 3ZQKA 4KQMA 4LXGA 2DUNA 4CIWA 2XTJA 2WJJA 1ZUIA 2V5VA 4UQPA 1L4KA 5IVIA 1KP2A 1Q0SA 1FMLA 3HZHA 2FXVA 4TKUA 4RSRA 3M7IA 4J4HA 1ZGGA 4U0JA 2ZUSA 3G6KA 4KXWA 3E15A 3E70C 4ENTA 3MWLA 2PBLA 5JSHA 4OX9Y 3VNVA 2PX2A 3TSYA 3AXTA 4Q6WA 1E9AA 4HDKB 3L40A 4LNAA 4JA0A 2RIRA 2ZRBA 1V3UA 1L7RA 2I3DA 4GICA 1BQEA 3Q9NA 4QTZA 4RJLA 4HH3C 4QKQA 5E1MA 3ZI0A 3W8EA 4G9GA 1L3IA 3JPYA 1MTOA 4CCYA 2HA3A 1I8TA 1Y5IA 1UEIA 5AT1A 5FYQA 3IURA 2QNBA 3NAMA 4O4HB 5B1SA 3WMWA 2HQ1A 3EQ7A 1QHXA 5ALKA 1ZP6A 2NW6A 4IDNA 1OHHA 2IRWA 4I8IA 4IMRA 4LOIA 3O90A 3DAYA 4XEHA 3E22A 5EEGA 1WL8A 3K4HA 5C51B 4O25A 1ZVMA 4KQ1A 4ENRA 2JK1A 4TZ6A 3GMIA 4C1NA 3CZAA 3BXZA 1FLVA 1PX2A 1U7UA 2IHVA 2ZPAA 3BH7A 3HYTA 1D5CA 4FJ1A 1MIHA 4OXKA 2I2CA 1Y1RA 2WKPA 3BH6A 2XDYA 4J2TA 3FJ1A 5HTKA 2FHSA 1VLMA 2NQ2C 3B20A 4H0FA 4WGFA 5LJLA 3T3HA 3KJZA 1T6ZA 2P6RA 1HEUA 2GZRA 3WNBA 1A2BA 5BSVA 2IZOA 4X1IB 1Q84A 3E84A 2RH5A 2PZKA 1FVXA 2P5SA 2YOGA 3K15A 3DHNA 4NBWA 4O29A 1NPDA 2POQX 5SY6A 4GR5A 3URMA 3I5XA 3DD5A 1IK6A 1EH5A 2LDBA 2XE4A 3LY7A 1G66A 4NJOA 4R7GA 4HEHA 3HB4X 2PMKA 3CCFA 3PDWA 1U0HC 4B6QA 2QVYX 4NCHA 5AJXA 1CLUA 1YZVA 1R0KA 1PJRA 1U0JA 5DT9A 4EP1A 5IJ0B 4MA0A 3VH4A 1P39A 3L0DA 4J4BA 2BGJA 1RLJA 2HIAA 3C41J 3HBLA 3K0BA 2NU7B 1Z5UA 2OB1A 2CW5A 5HNKA 4MHOA 2N42A 4GI5A 3UK0A 2DT8A 2YN2A 4OAPA 4F1WA 4BC1A 3KYDA 3WL5A 3BZWA 2WU3A 4MGHA 2PH3A 3I61A 3CLTC 4E2WA 4OVKA 4OI0A 3LFUA 1U2ZA 4ZU6X 3L8ZA 3MGAA 3QMMA 4OH7A 4EPXA 1TIPA 2J41A 3PUYA 4G63A 3BE8A 5EE9A 4ZAWA 2GHRA 3AWDA 1NHWA 2J0SA 5ARBA 3GBSA 4Q3NA 1JEEA 2LRHA 4A16A 3QEMB 4ZYUA 2IXEA 2VCYA 1W1UA 1ZIYA 2GJSA 2IPNA 4L4ZA 4MVJH 5A9TA 2XY4A 2FFRA 3JWIA 4EFKA 3L84A 1YCHA 4L9WA 4X94A 4QTUB 1KS9A 2YQ5A 1H2EA 4R3WA 3V6MA 3TRIA 1AKTA 4PYRA 4D42A 1SCBA 3KQKA 1WAMA 1MJ5A 2OECA 3T94A 2IS4A 4BJ3A 1BDMA 1QYXA 4JUBA 4B84A 5A3QA 1F8YA 4EKYA 1A8QA 1IY0A 4RVFA 4BDSA 1ODIA 1RKUA 1A76A 1M1YA 2ZJ1A 3DEIA 3UK6A 2HLHA 1Q3HA 2JATA 3E8SA 3F71A 1IB0A 5DEOA 2HQOA 1BX1A 1QDUA 4E5UA 2NZUG 2VRCA 3VOAA 1ZX1A 1H5QA 4WKCA 3RYFA 5HW0A 4TWZA 4JH0A 3FMPB 3C5CA 5TY0A 3E22B 5IN4A 3VR6D 3T3DA 3R7WB 2FZ4A 3OG9A 1QZTA 3SQMA 2FGKA 2FW9A 3D8NA 3PPXA 4LFCB 4AWXA 4Q4CA 1H8HA 3UJPA 3VSBA 4YV2A 3PEVA 1SB8A 2XUHA 3URKA 3IULA 4EYQA 4XCXA 2NUTA 1C4KA 4RO0A 1QUFA 1OTYA 4B8ZA 3WIOA 4C7OB 1DQSA 1N6RA 4Q4HA 3SF0A 3USZA 6GPBA 1BSVA 1AURA 5GIOE 4DJJA 2CHEA 2HRQA 3H2SA 4KG7A 5IT4A 4RJTA 3IPLA 2DTEA 4KZPA 2GTIA 4OYRA 1QG2A 1EGVB 3KEFA 4JX8A 3NMUF 3LQ4A 4KOEC 3LJKA 2GO1A 3A6DA 3NP7A 4IV0A 4M76B 1A0OA 1XL0A 1KP3A 2F64A 4ITUA 1SVOA 1XDDA 1GPNA 1QFZA 2POCA 3ICWA 2OPHA 3H1EA 4AF6A 3HVRA 5JSKA 3WJ1A 5TEVA 1HE1C 5BYBA 5I4KA 1QWOA 1Y7IA 5IN5A 3RLIA 2UUAB 1U0BB 3BGDA 3IDAA 4MWTA 4IIJF 1WEHA 2R6ZA 3IMKA 3P9KA 2HA6A 4MIEA 4I4CA 2RK6A 3SZUA 1ISIA 3AV3A 1JFFA 1HYGA 2HBZA 4O8ZA 1N6PA 1TFUA 2OORC 1XYYA 3DZHA 4IDEA 4DCOA 5TB5A 3BOSA 1JR3A 2GCNA 5DM60 2XGJA 3U7QA 2F9LA 2J3LA 2OV1A 2R65A 3E05A 2ZIEA 3KPUA 4HFNA 5JFOA 3JVIA 3VSDA 2GCOA 3UANA 1PT7A 1QIIA 4P3KA 4BKRA 3P8ZA 4JBHA 2GD2A 5E95A 4F5WA 1ZCAA 3G8DA 4Z4FA 3EHDA 3BWYA 2OZLA 4F12A 3EF3A 1YNOA 1VCMA 4QQRA 4QUJA 2ZJ2A 2J3MA 3EY4A 4U2KA 1EAMA 3PSHA 1BKSB 4CR8A 5LPNA 3OTQA 3JWPA 2QDKA 2HF9A 4UEKA 3OHMA 4JOBA 1HQCA 3TSZA 3G85A 1OLXA 3JQ9A 1ZEJA 1LS6A 3EEQA 3AQIA 3VU9B 1TUIA 3GLFA 3GOQA 4YRRA 4C30A 1JG6A 2PX6A 5AJZA 3OPYI 4EG3A 2R6HA 1TQ2A 3GROA 4MR9B 3RSOA 3W7VA 1BXZA 3ELWA 3O7WA 4O4LB 3OO0A 3Q6IA 3HJBA 4G25A 3W78A 1E1CB 1QNLA 2B30A 2Z8YM 2COEA 2HHAA 4CLHA 1CS0A 4RESA 4LZWA 4P80A 4NI5A 3C5VA 1PW5A 1L5MA 2BGKA 2IP2A 3F47A 4FEEA 1I2DA 5JZBA 1YL7A 1R9MA 4AUMA 2VSQA 2OXCA 3I09A 2NG1A 1I33A 3H0KA 5JQGF 3W77A 1P3DA 2C4WA 4X6UA 2WU0A 1UMDA 2IA5A 3BD9A 1ZIXA 4DPLA 2ZYSA 3TNLA 6REQA 3WFZA 2V7UA 3RUAA 4TSFA 3X3HA 2PKYX 2FSVA 2O2XA 4TLAA 3D6MA 3GCWA 2CMKA 1L7DA 5H83A 5IXYA 1XVAA 2FCRA 2W58A 5K7SA 1OGJA 2AMFA 2O1EA 4JKIA 3RANA 2NP6A 4Y2JA 2YV5A 4Y1RB 2X3UA 1QCCA 1ZNWA 2C59A 3PLRA 4CZ2A 1PYOA 4QNRA 2QM8A 4DOMA 3KHTA 2IHZA 3OBBA 1QOZA 4KITB 5DYNA 2BKUA 1IPHA 1FYDA 1YVRA 5CX1A 1JIQA 7REQA 1MF7A 1LPMA 2XLCA 5K6TA 1KQPA 3I2GA 3CNOA 1WXGA 1JWBB 3GHYA 4J9UE 1O0CA 1UBCA 4N6GA 4D79A 4WX2B 1DAMA 1B2LA 1SVNA 3DWGA 4EW6A 1T8RA 2ZR9A 1QAOA 1XOIA 3BFXA 4KGVA 5F3DA 4BUCA 4CTKA 5ALWA 1QO0A 4NEHB 1T4DA 2ZBEA 1KZ9A 4MPTA 1UBUS 2QNIA 2R1VB 1L7NA 2OHIA 3LQ2A 3EVFA 4YJ3B 4ZAGA 3WYAA 4EHNA 5KYUB 1H2HA 3U19A 1Z68A 3KHSA 4Q1DA 3EGOA 2HYDA 3IDZA 4FPXA 4M0KA 3GVHA 4PX3A 4R6WA 2HWWA 3CJTA 1WA5A 2G5CA 2I6TA 3GJZA 5DNAA 1EA5A 5IFLA 3SF8A 4NIMA 2ZR7A 4DJFC 3ASZA 3L0OA 3NHPA 2IXTA 2ZE5A 4DHEA 3U49A 1AUOA 3WFJA 5K09A 2HTFA 4MVJA 5JSUA 4CKXA 2AEMA 4BDTA 4KFTA 1GZ5A 1AGRA 1TKCA 4UM5A 1XTVA 2A5LA 1UK7A 2Z09A 1CUDA 1T4BA 4H1UA 3STTA 3DF9A 2WV7A 3EFOB 5GOZA 1H9AA 3UFBA 1AF7A 1H42A 1ZCBA 1ZVJA 2ACEA 3FVWA 3GA0A 3Q1LA 5DBGA 1XRJA 2QPTA 4ZK6A 2HBRA 2A9JA 2JFOA 1FIUA 1M7BA 1TXGA 1WPGA 2Y1OA 3NS7A 3QVVA 4IP0A 1WSDA 5L7TA 2PD3A 2ZUFA 4EHLA 2PH5A 3JD4A 2G1AA 4DBVO 4UFPA 5KTTA 1VCOA 2UUCB 1QGUA 1JVSA 4FILA 3TSWA 3ACBA 3L7JA 5E6SA 2EHDA 1H2ZA 3NH9A 2HFJA 3O8BA 5K0BA 5GIPE 3FB4A 4UTRA 5K8UA 2V58A 4GPEA 2Q5JA 4CN8A 2P69A 1RP7A 3O4HA 2GAIA 3B5EA 2KX7A 2QXYA 4J7AA 3VKHA 1MRSA 1YFKA 2J4FA 3FBTA 3OOWA 2QLLA 5KZMB 1JSZA 4GI7A 2C4VA 2IH5A 1WUHS 2G70A 3UCXA 4DDWA 5HJ2A 3EYWA 1L4YA 4ZI3A 2EJUA 6PFKA 3IBCA 2C00A 1GAJA 2F55A 3HQ4O 3FBWA 4RABA 2Y2VA 3K0AA 1NRXA 2HMSA 3CH7A 3D3KA 3GEBA 4JL6A 5AFSA 8ATCA 1EK1A 3OJWA 3JQGA 1WZNA 3L6RA 4B3IA 2FLKA 3P9RA 5LU9A 5CM9C 4TGLA 4UEOA 1PJ2A 1KJ9A 3ZIAA 3FX2A 2RBEA 2B37A 3WAJA 2O8DB 4GS5A 3Q3GE 2V9CA 3I92A 3H8VA 3HVIA 2PLRA 3IOEA 1C8KA 4DA7A 1GPWB 3WGMA 1L8LA 2QBYB 1KFBB 1TMGE 2QVGA 2RAFA 1U5BA 3CNHA 3LC0A 3Q41A 4FX2A 1YS2X 1SHUX 2PVCA 2BHRA 4MV3A 4NENB 4CTMA 5I4CA 4HDMA 1KO8A 5EXPA 1CUUA 1QZZA 2P30A 3EN0A 3PXUA 2FX5A 4ZJZA 4BFXA 5K3OA 1ZD3A 4JJAA 1GFZA 1M2EA 1YKSA 2OZLB 3IC5A 3SR0A 4GOJA 1VBKA 5CCBA 2WSIA 2ZBRA 3O73A 4J3FA 5BRAA 5CP8A 3EZGA 1YC2A 4CNQA 5EMKA 1L5YA 2VJMA 2F8TA 3OIGA 3PUHA 1W0JD 2C5BA 3L6BA 4FD2A 1MD9A 4B3HA 5EJ2A 1ZG3A 2EG5A 3OCVA 4BMDA 3AIKA 5M04A 5AVOA 5AI9A 1XD8A 1Z5NA 1AK1A 3HS3A 1TC2A 2AZ4A 3AF0A 1F2VA 4NYJQ 3RC1A 2EX0A 2WYVA 4D74A 1ZU5A 2G72A 2DH5A 3D7RA 4OXQA 3FHOA 3F98A 1JE1A 5HG0A 3T7TA 4D0LB 2FFAA 4J8PA 5C9ZA 3WWZA 5C8VA 1VLLA 1OBHA 1REQB 1CEXA 1YJ5A 2UZIR 4KQIA 1UAYA 4PZUA 2ZR0A 1GA6A 4K6OA 4R16A 3TAUA 5AW1A 3TQIA 1OF1A 1EUCB 1BD4A 3AVPA 2FDCA 3AF4A 1V5EA 3KZ1E 3WGLA 3NETA 3PT5A 2NOAA 3QKIA 1KO1A 4AAYA 4Q01A 3PNMA 4Q48A 3ZU2A 2BFNA 2IJGX 3DV2A 4JSTA 1RM0A 3HCBA 4DIUA 4O3FA 3NHRA 1BG6A 4P7FA 5TSDA 4EBBA 4EGSA 3CINA 3DO6A 4Z1MA 4YMLA 1GUBA 1Q77A 2FOIA 5FOSA 4BO7A 4DAOA 3B2EA 4GMDA 4NNJA 3KVOA 3OTWA 4TWIA 5KQLA 3VUEA 2FQQA 2VNKA 3GZNA 4R0NA 3S44A 3VNBA 2B2CA 3EHEA 1Z47A 4EPTA 4EUNA 3KQHA 4L16A 4Z4GA 3SFVA 3JD0A 4IDPA 3CRVA 1IOZA 3DBHA 4WEQA 5JOQA 1LLQA 2RHCA 1N4DA 4GPAA 4MIOA 3I9LA 3TBHA 1AMUA 1SK8A 3DLAA 2X9QA 4BO3A 1WO8A 2AFIB 2GDZA 2EZ8A 3F2IA 2H2IA 3GJTA 1XTJA 4KVAA 4IV8A 3B1ZA 3U60B 5CURA 3DDZX 4YQYA 2CFOA 3A36A 1YASA 2H5IA 4RULA 3ODPA 2VOEA 2C8LA 3P2JA 3T3EA 4FTWA 5DBIA 3ICVA 1NX6A 2ZUBA 2QZJA 4MUYA 3JY6A 2YN0A 3OIUA 2GDJA 3A1UA 2JH3A 3VC1A 5HDQA 1SVIA 4OB8A 4RA6A 1J49A 1ZD8A 5DW3A 3VHXA 4JQZA 5IH3A 3W79A 1PJ3A 3WYBA 4C87A 3L6EA 5NULA 2IOFK 4PRLA 4PZDA 5KPJA 1LUAA 1X19A 4MV1A 3CNEA 3I30X 4J0EA 1YJCA 3VPFA 4E33A 3R9KA 8AT1A 3ZJTA 5FL7A 5LZ7A 5DLDA 5IT0A 3F7TA 3FWPA 4N39A 2JFWA 5TPZA 3BXPA 2X5NA 2PBZA 4OJYA 4TKVB 3OCJA 1Z6YA 4KVZA 4XD7D 1LK0A 2BGWA 3K0CC 1C0KA 3ZLJA 1Y3AA 5KAPA 1IQ0A 5IEJA 1EGAA 2W2VA 3DB1A 1FU4A 4G86A 2IPLA 1STOA 5F52A 1W36D 1DTWA 2BFEA 3LC2O 4YO7A 1AUPA 5HIKA 1LNZA 1WLYA 4URVR 2AMJA 3D81A 4DVJA 3L9WA 4LJYA 4Y9DA 2B3DA 1CJBA 1P60A 2CZCA 1X6VA 2D2VA 3CNLA 4LJRA 3L1KA 3C3MA 4LXYA 3T6KA 4ARZA 5TEWA 4AZ0A 2TMDA 4JVSB 3GARA 4O33A 3AXSA 5E6RA 5E1DA 1AV7A 2X1LA 4R2IA 1FQOA 5HF5A 4URFA 3DKPA 3FPGA 3QE4A 3VBEA 4DNXA 2XDAA 3L1IA 1NI3A 3H1TA 2JRLA 4BQOA 5A2GA 1VSUA 1C81A 2AE1A 3N1UA 5F1OA 4LCBA 1EXVA 3VPCA 2WTBA 3K31A 2VP2A 4ND5A 3RRYA 1WOYA 2FVYA 3HCDA 2BGRA 3G1WA 2ODTX 3A1EA 2CB9A 1FYFA 5KYUA 3UUGA 1A7AA 3X2EA 3U6KA 3AEKA 4GEGA 1JTFA 1SO8A 3T4XA 2Z6QA 3FTFA 3VUFA 1NN5A 2DFKB 2O3TA 3GDGA 2WAYA 1C0IA 4B40A 1YB7A 1K92A 1JE0A 4X1OA 1DTEA 2X6QA 5DBEX 3HNPA 3AFHA 4H15A 1X8KA 2ZCVA 1NMZA 1NVVR 1NSFA 3LL7A 1N1DA 4UZEA 2QE7D 4IIEA 3SLKA 1P1IA 4PO3X 4BVHA 2QBYA 1DGQA 5CBKA 3RF6A 1X8LA 3B13B 2CV1A 4P84A 1NVKA 1HGXA 1XQ9A 2EJTA 4Q9IA 3UMSA 3K4QA 1XCOA 1GKLA 1SD1A 4ZTBA 3K70C 3NDIA 4W8GA 2J9XB 3I2HA 5EJAA 1FP1D 1V8ZA 3OZCA 1MJGA 1U7XA 4TS3A 4FCTA 1ZOPA 3BJIC 1K75A 1NNUA 1RZ3A 1Y4DE 3NH6A 4MR8A 4R5MA 3RADC 3FWZA 3JCZA 4N5IX 5BR7A 1MKYA 2GNAA 4EY8A 2HOQA 3B5IA 3QVOA 4CM3A 3TTSA 2GLXA 4HDSB 2WG2A 3IR7A 1G4HA 3OY2A 4O4JB 1OW3B 4QDZA 2HWXA 1JLRA 2Q7XA 4UHHA 4DV6B 1RMTA 1B73A 3DKVA 4MICA 5EWMA 3TAXA 3FGOA 2W6JA 4NMXB 1XTUA 2G3YA 3PWTA 2H54A 4OK5A 4RD1A 1HDZA 4MVJM 3QSGA 2OGTA 5AKLA 3OIYA 2FZCA 3NOXA 3TOVA 1M9NA 3CLSC 4I14A 4FQ8A 2XYHA 1NONA 2C20A 2FVXA 1C0EA 1IXYA 2P67A 3D9QX 1KI2A 1PG2A 1G1AA 5UKDA 3FGPA 3AV0B 1R4MB 3HB7A 2EFDB 1XHFA 4PQRA 4L5YA 3KB2A 4ZHQB 1BS1A 2F1RA 5H9VA 2TECE 3CH4B 4LJAA 4XOIA 1P0FA 2JIDA 4DSUA 1CJSA 4DIBA 1AKMA 2QZ9A 3UXYA 1IZYA 2QLJA 3R7BA 1CF9A 2A92A 4MQUA 5E38A 4O1IA 3SHQA 3V8EA 4D4LA 3GLQA 5HKAA 4R1QA 2WHYA 3BWDD 2C29D 2XKJE 3CXUA 2A5DA 3FSGD 1CS4C 1Y1LA 5AM5A 1DS6A 1SU4A 2PZBA 3INGA 2WWIA 4I5IA 3OSZA 1YIAA 4ILEA 4ZZ3A 2OBMA 4LGVA 3ZY5A 1OI2A 2VPTA 4QNNA 3BQ9A 1BDIA 1OZGA 3ECCA 2I3GA 1KYZA 1MDFA 4U2EA 4YRPA 3GRKA 3DVAA 3GXBA 1K2WA 1WE2A 3BTUA 2V4ZA 4B5KA 2M2IA 4RD0A 5JLJA 2E87A 1KY4A 3GLIA 1QHSA 2K2WA 3CF4G 3WV4A 3WIEA 2RGRA 1LSUA 2JFBA 1NBAA 3IJ5A 1GQOA 3A7DA 1ULSA 2BW0A 3AHCA 4XIGS 3GDOA 4HDRB 4FB5A 1T1RA 3JQAD 3CCCA 3K1YA 3CE9A 1IN6A 4MS1A 4PEVA 3QBJA 3BWBA 4Z8XA 1GXSA 1QHNA 1RYNA 2I99A 2JJ1D 2MSCB 3AEQB 3I23A 4CV0A 4KHPB 3E03A 1XFDA 3S29A 2IX3A 1G3QA 4L5CA 4QUDA 5EE1A 3OE4A 3CH5A 4RXMA 3PHIA 4A1OA 3D6VA 1BS2A 2WUGA 3BWCA 4W7SA 3DV0B 2BFBB 2PJRA 4NU0A 1NW5A 1WB5A 3BL6A 5DM1A 3LY5A 3UGKA 4C06A 1XZJA 3LWBA 2XCRB 2GB4A 3BILA 5JAHA 3GVPA 1UXGA 3AGQA 2DKFA 1AQNA 4WOJA 3GVIA 5IJXA 5BSTA 2WILA 3SOPA 1E61A 3HRKA 1ZJJA 2J9GA 3MTGA 2YY7A 3PFBA 3ICPA 3H5IA 2PZMA 2DEUA 3AFIA 4MQFB 1DCTA 1SXHA 2GJ4A 3GJ5A 3SZ3A 3TJMA 4KLRA 5FB3A 1D1QA 5BPHA 1TNDA 3ETCA 5LKAA 3CZQA 2OV8A 1F0PA 1JS1X 1PFYA 4ZZ2A 5LA6F 1C1YA 1YZYA 2PKQP 2YHUA 5K2MA 3HKEB 3VTKA 6YASA 3I28A 2ZSEA 3SZOA 4CEJA 3UT5B 3G9UA 3PQ2A 1SBIA 1T9ZA 1BKDR 1YQUA 3OE7A 3AJRA 4J0IA 2GN6A 5U4QA 5JUWA 4NK4A 1F51E 4OHVA 3WNCA 5JH7B 3GJSA 3HXLA 4FT2A 2Q46A 4DQUA 2OVFA 2HJRA 2PANA 3A3YA 5C8ZA 1Q83A 1BDJA 2BVNA 1CXZA 1E9DA 4R41A 5LQSA 2HHHB 4YWHA 3KE9A 2XRYA 2IGTA 3KJIA 3Q2IA 5MHTA 1UDCA 2E2WA 2PKEA 5ALUA 3EPHA 2VRNA 1FX0A 4N6OA 3N76A 3ZKWB 4GO1A 4EOGA 3LIPA 1TVKA 3QPUA 4ETMA 4H6XA 4TTVA 1Z5PA 4JX9A 3LKDA 3EK2A 1E1QD 1N2JA 1GOTA 1I30A 1MV5A 4X6LA 3NVDA 4GW3A 1OY1A 1Z0ZA 5A0TA 1EG7A 1XJCA 3M4YA 3HBJA 4K6KA 2XMZA 5EZSA 4F2DA 1Y4SA 1MOPA 1Q7RA 3N0WA 4KPGA 4TQGA 3WSTA 3FRJA 2G4LA 4PSDA 1N36B 2VDOB 1UAGA 4B7AA 5I9TA 2E6KA 1AE1A 5T5QA 3UWDA 4Z51A 1KH3A 4F9FA 5HK8A 4EWLA 3UJ6A 2FEKA 1FEZA 4R4JA 4U9IS 1I2CA 1TX4B 3L1JA 3OCXA 4GKKB 1CBUA 3BEDA 3TL3A 1PK9A 1VHWA 5ELXA 1SBCA 2WYUA 3D8UA 3L6UA 1RJEA 3IAUA 4OXXA 5JWRA 2XRMA 1XVIA 3K71B 1IM8A 2PV7A 4DC0A 3QUAA 1M7HA 1JG1A 1DC3A 1OREA 1Y5MA 4Q7LA 4ZQBA 2GVZC 2IS6A 1Z6AA 3KB8A 4KN8A 5EOVA 5BV8A 2JLCA 4RLFA 5T3YA 2QVZX 1YWGO 3OZDA 2P68A 1NY6A 3FYCA 3P4YA 4HN9A 2PX4A 4JT9A 4ISBA 3NYIA 2ERCA 1Y5LA 2W6NA 2X2PA 1N7IA 4I9UA 4D9CA 3R9WA 4QM6A 1I4WA 5LYYA 2JF0A 3OH8A 2Y68A 2WWWA 2YWGA 4HDOB 3KC2A 2YFHA 4QLOA 2PAAA 2FMXA 2SNIE 1EX9A 3QLVC 1DKNA 5FPSA 2BMVA 1ODJA 2N75A 4WNIA 4CKBA 3U7GA 4M9UA 5E7JA 1CP2A 4GGPA 2JLAA 3W5VA 1RYYA 4HPXB 4QFBA 2HWUA 5HZKA 1PJTA 3TMYA 2Z6UA 4GM1A 4ENPA 5TMDA 1OYWA 3JSXA 2ES4A 3DR3A 3N8NA 3TEFA 8OHMA 4X9XA 3DDHA 1CUSA 3RSSA 3N2GA 3TZLA 4IY1A 4ES6A 1E66A 2EF1A 1YTLA 5HK9A 1KMIY 2FUG6 4JBLA 4JUDX 4ZYVA 4JFRA 1YOVA 4BBAA 1JEYA 4ML3A 2PUGA 3BSYA 2I1QA 1FJ2A 1UDXA 4H7KA 4J0JA 1CRWG 4U2GA 4W63A 2PGNA 5FI1B 2EFJA 3FVRA 3CONA 3A1VA 4PV7A 2PUJA 4FWIB 2RHGB 4B81A 2DQZA 2ET6A 3P94A 4N54A 3IPXA 3BXGA 2BHSA 5AM2A 4JWKA 3DBLB 4OX9B 5EA2A 5FBQB 1MABB 1TC1A 3SJUA 4BUZA 2ZSJA 1W0KD 2EWVA 2ZRFA 4WVFA 3EX7C 2OK8A 3WSWA 3F3KA 4O3MA 1DO0A 4IIJA 5BN3B 1AKYA 4JXJA 1WBJB 4OQDA 1M75A 1R8JA 2H16A 4QOIA 4TRRA 3DOOA 4O08A 3KYBA 3HU2A 3WKBA 1TMYA 3ITDA 5FI5A 4GG1A 1I9GA 4M1SA 4NOMA 2Z5LA 1KR5A 4F8YA 4WZAA 1KK0A 1MHPA 1Z35A 2PVPA 2ZIXB 1DCMA 2WYWA 3GLIE 4QYIB 5IKXA 3ENZA 4L6IA 1C9KA 2H65A 4LPSA 4QFMA 3SYKA 2ECPA 2VDPB 1NWCA 3K30A 4S3MA 5B1YA 4TRJA 1HA3A 2C88A 1IYZA 1EFPA 3LLUA 1IL0A 2BFDA 2ZU6A 3MUFA 4IZOA 1PQWA 4KHZA 2ID8A 2D54A 4KDFA 4PO9A 2FFBA 3I4FA 3TVDA 1B6RA 5F77A 3VSAA 5KWIA 4UEQA 1FFWA 4L4XA 2EBFX 3GWGA 5I01A 2VPPA 2Q1WA 3EEBA 3W2EA 1RLOA 4EKNB 1KPGA 3PD1A 1IWOA 1USGA 1XQXA 5HF9A 3LLCA 1MG0A 1S4QA 2WMOB 1Q74A 1JFLA 5J3JA 3U5ZB 3E7DA 5CFMA 4IDQA 2PA0A 4UNNA 3MUNA 5EPUA 1A71A 2NZ2A 3LLMA 2X42A 1T9BA 5JCOC 4GRDA 3M70A 4P4NA 2OCGA 3O4JA 2IPAB 1U8EA 4YRTA 2R25B 4NZZA 1MA0A 2H08A 1Q0PA 3L8HA 3C3CA 5BWCA 4FDUA 2PNJA 3OHSX 1U8CB 4UBNA 4CMIB 4ZXPA 2ZE8A 3QIAA 3OEWA 4EB6B 1TF7A 2GPBA 2Q0SA 1ZA1A 2WD8A 5IF3A 4FP9A 3UWPA 3HY3A 2WTUA 1TIKA 2ATIA 2FMIA 2IXBA 3D2LA 4GXQA 4NH4A 1VP9A 3A0UA 2YC2C 3E3MA 4OJNA 1VIYA 3TLEA 3BICA 4N12A 1RACA 1XZGA 3TLGA 2XYQA 3FOCA 1C4WA 1DCKA 1NW3A 4ZRNA 1JYSA 1WXIA 3IOMA 4YRCA 3B7WA 3H99A 1KS2A 5B3AA 3HJFA 4CTOA 1ABFA 3T5MA 4N3NA 1UJCA 1HF3A 1RYHA 1GUFA 1B0AA 3PHLA 4PYJA 2JJ2A 4ETWA 2IYQA 3S8EA 4G1CA 4AUEA 1WB4A 1N5RA 3N75A 1DC5A 3BYZA 1SXJA 3LV8A 1PWYE 2IVFA 3CZMA 3K9FC 1K3TA 2NNLD 2QI9C 3S2YA 4B3RB 2NAPA 3TFOA 2O5VA 4G6ZA 1RRPA 1F8FA 2JIOA 2VLBA 3RFUA 2O7QA 3MTDA 3WVNA 1HQDA 4Q3EA 3D7SA 3UN1A 2P3LA 1P2SA 3PIDA 3C48A 3HY4A 2OM2A 4PS1A 1X9HA 1W8IA 2AW5A 5D85A 5EHNA 1RRCA 1VSQA 3KK0A 4RKWA 1EX1A 4BKQA 2XUGA 1ZSYA 2UXDB 1PZEA 2WD7A 3C16C 3NHKA 3R3YA 5TF4A 1JSLA 1FUYB 2UVPA 1VE3A 2X22A 1JVBA 3JSAA 1MO3A 1XAIA 5EJFA 4DMLA 2FPWA 5FLKA 4EM6A 1W5EA 4BVLA 3GJRA 4Q3DA 1RTKA 4DSZA 2A0XA 2VHZA 3QTTA 1N5MA 2C99A 4DZZA 4NDNE 3IQHX 5JROA 3CRQA 1U2GC 4WD3A 2NO4A 2FMFA 3PS9A 5AJUA 3T5DA 1NBMD 4WSOA 1Z62A 5J23A 1KJWA 1DBWA 1HT1E 2OORA 4JR1A 4CDGA 3QOYA 4CE6A 1CEYA 3KWMA 3RF7A 3FM9A 3H3JA 3WIDA 4XX0A 4AJIA 5JZMA 4AZVA 3Q8LA 3B1YA 3JAWA 1PG5A 2A1TR 2P2ZA 1VG8A 2B36A 2EFYA 1THZA 4HQ0A 4EMSA 1II9A 4YYZA 5DI3B 4ALNA 3QFFA 5JALA 5AOCA 1D6SA 5IAEA 3UAXA 4N3CA 2NSLA 4A5OA 5D1NA 1PL6A 2XE8A 4DLPA 3CISA 5EMNA 1TQ4A 2INGX 4DR5B 3FMGA 4PQYA 1Y9EA 4AS2A 3RARA 3RVOA 4EX7A 4HQRA 5CBPA 2HCRA 1T26A 3Q3JB 4KC0A 3H0CA 5J2UB 3M0EA 2DFLA 4WNYA 4IGFA 3H5VA 5EIBD 4RDIA 2H92A 1Q22A 4AKGA 1UQUA 2ODAA 3IUEA 4HZUB 4ID9A 4P58A 1GAQA 4OHZA 2UKDA 4E5KA 2JLBA 1XHEA 2WNSA 1QF9A 4BASA 4RORA 1J39A 2W42A 5IS2A 1V11B 5THQA 1MTZA 1Y1TA 2QTWB 1YO6A 3VR5H 1GIAA 4KRXA 5CA0B 4L22A 4BE7B 5ICEA 4NYMR 4B3MB 1ZISA 1EVZA 3KQOA 1KI4A 1I5OA 1ULBA 3KSDO 3N5KA 3U0BA 5JJKA 1DINA 1ANKA 1H6CA 4JP2A 3VO2A 4D0NA 3ZR4B 1K2VN 1UBGA 1QIHA 3HUDA 4XSGA 1BO6A 3TBKA 4XDGA 2I7DA 1NKVA 5IAKA 3UFXB 3HEAA 2YICA 1M8JA 2VQEB 4P4SB 1JA1A 4R6XA 3BMNB