1RRGA

Non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, dimeric crystal form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
177
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords RAT ADP-RIBOSYLATION FACTOR-1
total genus 53
structure length 177
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrgA00
1XTIA 8OHMA 1R0ZA 4U02A 4Q21A 2VBCA 4D6PA 3TUIC 1II0A 2Q9AA 2ZS7A 1HV8A 3B7GA 4A2WA 2ZYWX 1E4YA 3T12A 2ATXA 3G82C 1UEJA 3BERA 1ZM9A 4HLUA 2ZTSA 4WIAA 3CPHA 4OQFA 4EPRA 3RHFA 2J59A 3GFOA 1Q57A 2YV5A 3B5JA 4Y0AA 3OHMA 2O0HA 1N0VC 1KY2A 2C99A 2OCBA 4LDJA 3U3JA 3A1SA 2WPDA 2GHIA 3G5UA 3OIWA 1Z63A 4TYYA 1CRPA 2IT1A 4DT1B 5CJ2A 3HPRA 1KDRA 2IYQA 3CPEA 1I4TD 1NBME 3SYNA 4M9XA 4B33A 1C4OA 2WJHA 4FIDA 4QBGB 2CMKA 3NBFA 1JR3A 4P4UA 5K8TA 2ZI6A 5JZVA 1TL7C 4OHXA 1WCV1 4JIMA 5BN4A 1F2UB 1E0SA 3O8DA 2VYFA 3IIKA 4CYMA 1NL3A 2QPAA 4PAOA 4QBHA 3AQ4A 3SOPA 4EFLA 1W4AA 2OBLA 2GXQA 1S2MA 3BRWD 4DEYA 2QMHA 3I5XA 3G0HA 2EWVA 4LBZA 2A7QA 4LYHA 1A4RA 1XCMA 3IILA 1YR6A 4XSGA 2EU8A 3KJIA 1YR8A 3H0KA 4FMBB 1DVRA 2PMDA 2H18A 1X1SA 4YMUA 1WP9A 3O47A 4HZIA 5L3VA 1OB2A 3KFVA 3LXRA 1DOAA 3LVRE 1AKYA 1LVGA 1GSIA 4A8JC 2V1UA 2XNSA 4HDQB 4B43A 5JI3E 3OFNA 4IRUB 3B82A 3BORA 4V0NA 4LHVA 4Q4JB 4EPWA 5FI1B 3WP0A 4V0KA 1CP2A 3VX3A 3LY5A 3PUVA 4NU0A 2VF7A 5FBVB 4D4JA 1L2TA 3ZD6A 4TL6A 4NZYA 2O52A 3K09A 4V03A 5JECA 3U44A 5GJBA 3RWOA 1U8YA 3HP1A 1TTTA 2VO1A 3JZMA 3K70C 3UG6A 3QKRA 1YZTA 1HT1E 1XWIA 2J0UA 4ARZA 1YZNA 2PT7A 4LV8B 1ZNYA 2JATA 5J4YA 5DH9A 5IK2A 3TW4A 1A7JA 2ZSBA 4L8GA 2RKOA 2ZEJA 2QL6A 4Q18A 4M9ZA 1BMFD 3HR7A 3P32A 1WE2A 1CXZA 1KK3A 1DAMA 2OFXA 4JJKA 5JBQA 2OUKA 4AWXA 2IC5A 3A1UA 4BFZA 1NLZA 1FUUA 2A2ZA 4LJ5A 1GKIA 2QORA 1EK0A 3K0SA 4DIEA 2Z43A 5DI3B 1CR2A 4IDNA 4BFWA 1CRQA 4AK9A 1YRAA 4BPBA 2A9KA 3FKQA 1JXMA 3L8ZA 3U4QA 4G3XA 4DLSA 2JLUA 4XTCS 4WXPA 5HE8A 5DISB 2F1HA 2EFEB 4OBEA 1XMIA 1T9HA 3NXSA 3ZS8A 1TF7A 2FU5C 2A5FA 4NDZA 3KQHA 2BVNA 4WBSA 1SVWA 2AFIE 4Q4HA 4GT1A 3WY9A 1RFLA 4B2PA 1MV5A 2WOJA 5AR1A 2ZRPA 4DIDA 4AKGA 2EFCB 3IO3A 1ZM7A 2P5SA 3K9LA 4DLTA 2J1LA 1I2DA 1U8ZA 1XX6A 2JIZA 3P27A 4TL7A 1G17A 1E9SA 3VTKA 5JEDA 3VHLB 1Z0DA 4LBYA 1E1RD 4NYMQ 5HR5A 2FDCA 4MKGA 3RABA 2X8AA 4HUTA 3WXMA 1E9EA 3E2IA 3L0SA 5E3HA 5FBRB 2MMGA 3FWYA 4D0LB 3N2EA 2C95A 3A4LA 3ZVNA 1ZC3A 1JB1A 2RAPA 4MRVA 1JQLB 4DEXA 2QE7D 1UBCA 2GCOA 4JLNA 2WBLC 4EUNA 3EIHA 2V8OA 3E70C 1KIMA 2IW3A 1LS6A 2WWXA 3QF4A 2FMXA 3KB1A 4US0R 4PO8A 2QMOA 4KBGA 4MA4A 1AGRA 2BBSA 4JYCA 5JJKA 2OV2A 4ZCMA 1FZQA 4DDVA 4TQUS 4DB2A 5FOXA 1KI9A 4KO8A 3PCRB 4A6XA 1NIJA 3QKRB 4L4UA 2BBOA 4QKQA 1W2GA 2PMKA 1ZC4A 4PC1A 4FINA 3UWKA 1M74A 4P3YA 1OKKD 4JLMA 1NNEA 3QPVA 1D2MA 2AKAB 4XWOA 4I99A 2JJ2A 1J7KA 3SS8A 3UKDA 2ZYTX 1E96A 1GL9B 4EFNA 5KNBA 3T5GA 4CEHA 3KJHA 3R8FA 1W4CA 4X8OA 1HE1C 2CCKA 2YOFA 3VR1A 5FR2A 2QAGA 1FUKA 3EA5A 5JHGB 1QVRA 3HPQA 3ZVMA 1G6HA 3C5CA 3A36A 1T5LA 3EZ9A 3TR5A 1PLKA 2CCJA 1DAIA 3IEUA 5SZIA 3A58B 2AD5A 4HAWA 1XP8A 2ZI7A 3LA6A 1KMQA 3PUXA 3BB3A 4G5RA 2ZJYA 5FPTA 3AB3A 3OAAA 3QOFA 5TB5A 1ZUNB 1W46A 4RZ2A 1KI3A 1R5BA 4C4PA 3LQRA 4FD2A 3X1ZA 4B3BA 3CM0A 2XGJA 2BC9A 4PQRA 2JDIA 3M1IA 5F98A 4IVRA 1NP6A 2MSDB 2OO7A 2RGCA 3TIFA 3K0AA 2VTKA 3EW9A 2D7DA 3OIUA 1E1RA 5AJVB 4QNMA 2REOA 3F3YA 1IONA 2R8RA 4W7SA 3SHFA 5FH9A 3P4YA 1UADA 5HPYB 4DLZA 1XD8A 3ADDA 2ZRCA 1S0UA 4L9SA 2FG5A 5K8IA 3K70D 1KZ7B 3RSLA 1AZTA 3UMSA 5J4KA 4LJ8A 1P3JA 3IPYA 1IHUA 3P4XA 3S1AA 1AA9A 5DHAA 3ZZTA 5DN6A 4FCVA 3W3ZB 1E2GA 1TADA 1XPUA 4JVNA 4M4SA 4IEIA 4Z8XA 1N5IA 2BCJQ 2NPIA 3LFUA 4EFMA 5JSZA 2D3WA 2GEVA 4J0QA 1R10A 1TAGA 1N6KA 4R9UC 5HKKA 2B6HA 3ETLA 3SBDA 1ELOA 2ZS8A 4I1UA 2P2LA 3J81k 3T1OA 1RRFA 3MLEA 3PV0A 1YVDA 3VMFA 3ZVRA 2GCNA 1OIXA 3CR7A 1G18A 2QSYA 2WWWA 4OI1A 3I61A 4RFSA 2PZFA 4EQ6A 4NCJA 2LWIA 3AP3A 4TT3A 4B73A 3I73A 4ZI2A 5KYKA 5AWFC 2DY1A 5ELXA 2J0UB 2QPOA 1VG0B 2EFHB 2BV3A 2WJYA 5JWHA 2VP6A 3GLIE 4FWIB 1TEVA 2QY9A 3D3QA 2RCNA 3SFVA 4MRSA 4HUQB 4JBWA 2OFWA 4HLDA 4EIWA 1F3OA 3UMRA 4URYR 3GEIA 4OQLA 1OLOA 4TT3D 5KSOA 3IBYA 1KO4A 1ZRHA 1SXJE 1X3SA 3W8NA 2Y8EA 2GJSA 3W6OA 4B2IA 1NMZA 4TZ6A 5DSZA 5B58C 3FKSD 1X8LA 1M2OB 1P2UA 2FSFA 2BKUA 2G1JA 2DFTA 1BYIA 4GMXA 4PHTA 5TXGA 4PO9A 2ORVA 3QG5A 2G3YA 1E0JA 1JR3E 3AKDA 2QMUA 2V7QD 3AUYA 1UAAA 3O8RA 4TSFA 3TNFA 4ESVA 1OH7A 1N0WA 3C41J 4LHXA 5DN6D 4D2IA 2D74A 3SR0A 4U5XA 2CE2X 1NI3A 4TTPA 4LJ6A 4E22A 1OHHA 2JGNA 3L82B 1QF9A 3MWYW 1JALA 1S1MA 2EFDB 2G0NA 4L15A 2Z83A 3RAPR 5GJCA 4BZXA 1SQ5A 4EJSC 1IBRA 4Q4JA 2HJGA 2BEJA 1MKYA 2F3RA 4HZUB 2C9YA 1OH5A 1QHSA 2WIBA 2YZ2A 2FV8A 3BFVA 4LHZA 4ABYA 4YMSA 4QHTA 1WDTA 2FX3A 4P32A 3JZAA 5G53C 2JDID 1T4GA 5TV2A 4H1UA 5CLLA 1E99A 1Q3HA 3L0IB 2FF7A 4QGFA 3AF2A 3X1XA 1CU1A 1DBSA 3AF3A 2GDJA 1HEIA 4DLXA 2FZLA 5K8LA 1ZM4A 3KXIA 4U7DA 1IXRC 4B2LA 2X1VA 1VCNA 1EX7A 3NVAA 4TMKA 3IHWA 4JBYA 5DI3A 2Q21A 1YRBA 2XJ4A 3M0EA 1N6RA 1W4BA 1JXOA 2FEMA 1XD2B 4O0MA 5DYIA 4A2QA 1SKQA 1F6BA 3WHLA 1ZW6A 3IIMA 5JRZA 1RYHA 2R9VA 2QRZA 3KZ1E 1MH1A 2ECKA 421PA 2ZRAA 4C0SA 5FPKA 3LRPA 4MYUA 4NYJQ 3B6EA 3LW8A 4JVSB 4MDEA 2UKDA 2CL7X 3LAWA 3I92A 2IF2A 2VIIA 3LD9A 2MSCB 5BYJA 2WIAA 3QG1A 3TW8B 2JJ1D 1LNZA 2OXCA 3ADCA 4XVQA 3U3RA 1IY1A 4DRZA 3O8CA 2J0SA 4LPSA 3WYGA 3EAQA 2J7PD 2ZSEA 4GZMA 2KBEA 2XJ9A 3PG5A 2HDNB 4OI2A 4TLBA 5FL7D 1AK2A 2ZJ2A 1XMJA 3NHAA 1G4UR 2CJWB 1QHYA 1Z2CA 2NZ8A 2V7QA 3B9QA 3AGQA 4KBFA 4YDHB 2IF0A 2O0KA 4BASA 2IYZA 5FBLB 2LCFA 1RJ9A 3X2SA 5EZ6B 3K0CA 3RRYA 3EPHA 1A1VA 1IOZA 4JL5A 1KSGA 2GCPA 4A8JB 1QZXA 2VF8A 4FMCB 1FNNA 1TUEA 4C3ZA 4EJSA 2CNWA 3THWA 4ON9A 2C2HA 2SHKA 3IHLA 4BFXA 5BXQC 2GAAA 2RGDA 3MG9A 1VKJA 5FL7A 2VP9A 3C8UA 2GILA 3GPLA 3SDZA 1VG9B 1U94A 5FPSA 2XNDA 3SHWA 1ZINA 4C7OB 2EVWX 1QHHB 1PV4A 3AVPA 4TMXA 3CX8A 1MO3A 4LJYA 4LWZA 1DO2A 1XFAA 1EFHA 2A5JA 3QXJA 4S35A 1Q20A 2ZJ5A 3CRW1 5BWMA 3SEAA 3SYLA 2IS2A 2NO6A 2WMOB 2ZRBA 2QG6A 2OCPA 4C2UA 2PCLA 1Z3IX 1JECA 3ZJYA 4HLCA 1KJWA 3TKLA 2ZE8A 4IFEA 1M6NA 1N0UA 4GOKA 2AN9A 4MH0R 4MYTA 4N0EA 4PFSA 3KKQA 4JZKA 5C18A 1KDTA 1E2IA 2G1KA 2HEIA 1KI7A 3PR1A 3THOA 1G5RA 3ZZUA 1G5PA 3U60B 1AN0A 3KQUA 1T5IA 1W36C 2V54A 1IM2A 1IXSB 2C78A 1SKYB 3E1SA 3KX2A 3MCAA 4TLCA 4Q4AA 3TGPA 1KMHB 1ZCBA 2C98A 5KNCA 4BUJA 1EXMA 2J0VA 1F2TA 3FHCB 2GETA 3DMNA 3Q5DA 2IXEA 2NGRA 2GZAA 4Q03A 5CIWA 4TYNA 1XTSA 1OV4A 1KK1A 3DZ8A 5LD2B 2BJWA 2KBFA 5FI0B 1Q1ZA 3I8XA 2JLZA 4YLGA 2V9PA 3OFND 4A0RA 4LYAA 4Q01A 3SQWA 3GLGA 3RC8A 3CKLA 2LKCA 3KKOA 2IYRA 3FTQA 5C4GB 2VHCA 3WNBA 2A5YB 2IUSA 2WWFA 4HZUA 2GCOB 1AS0A 4HEJA 3MWLA 3K0AB 4IW3B 3OAAD 1DAFA 3GJ8A 4LHYA 2OBMA 1SVKA 3H86A 2QI9C 4AD8A 4PANA 1SVSA 3AP1A 4G5GA 2IYTA 1M7GA 4N3NA 1COWD 2FFQA 3LX8A 3B1XA 4NONA 4OHZA 4I1OA 3SN6A 6Q21A 4LC1A 1TU3A 3KUCA 1WF3A 1CULC 3SFZA 2WJJA 2ZITA 2WPDD 5DE3A 4P0TA 3KKMA 5EUMA 4Q9IA 4BRWA 1W48A 2JJ2D 3OIVA 1VECA 1EFCA 4JBXA 3WRXC 4RZ3A 1F5NA 5SZJA 2WJVA 2HT1A 1AQUA 1S3GA 4PZLA 2FFAA 2QP4A 3ECCA 5CLQA 4JSYA 2AWOA 3K0FB 1T6NA 3GD7A 2NO0A 4BEBA 4Z54A 4ZIRB 4RD3A 3EPLA 5AUOB 1E9DA 1MABA 4D82A 2RGEA 1EFRD 2R44A 1DTSA 1G19A 4HAXA 2GWHA 4JT2A 1F2UA 3P20A 3TQFA 2NMVA 3UWOA 4RCZA 4G5SA 4EPYA 1G1MA 1W1WA 1XEXB 2QN6A 5JWOA 2WV9A 2IYVA 3CZPA 3UATA 5IT5A 2WSSA 4LOAA 4Q1BA 3CUEF 2REBA 4BLSA 1HURA 2HJVA 1GITA 3Q5EA 4O2LA 2P67A 4A92A 3REGA 4A82A 1Z6GA 4TMZA 5CK5A 3BB4A 3SJBA 4ACAA 5J4HA 3QPWA 3CF0A 2QP9X 4HAYA 2GBLC 4DLWA 1NG9A 3GLHB 5CYPA 2DWQA 1HTWA 2GRJA 1XMSA 4Q9HA 1SXJA 4NKRA 2WJIA 1ZM3A 4K81B 1OH8A 4M1YA 1R7RA 3CZQA 1KNQA 1VHLA 2H7VA 4LUCA 2J5XA 1TX4B 2IYXA 4O3MA 2C03A 3IIJA 4Q7JB 2IA5A 3THWB 4OQMA 1KO1A 2ZRKA 2OCYC 4D25A 1NSFA 2VQSA 3TUZC 3VR5A 3QEOA 1JNYA 1R0YA 1FX0B 3GMTA 4HSEA 1E9RA 3RWMB 3U5ZB 1G21E 1KYIA 3DL0A 3RRMA 3DEFA 1OXVA 4MYHA 2ODWA 2QUZA 3EPJA 2WSMA 4UXJA 3TJZA 4KFSA 4JLAA 3TBKA 5H8WA 3CB4A 2IYSA 4Q5IA 2DR3A 5JI2E 2F55A 4Z8YA 5F9HA 1GTVA 3CW2A 3RS2A 2NQ2C 4GZLA 2ZUBA 2G9NA 1Z29A 2F1RA 1DG1G 1LW7A 1U9IC 1DEKA 3IPXA 1SHKA 4Q9JA 2GA8A 3C16C 1AIPA 3BS4A 1KK0A 2WAYA 2ZRHA 4R2HA 5P21A 1T3SA 1L7VC 1TPZA 2I1VB 4RY2A 1W0JA 4HDOB 4AG5A 4D26A 2AK2A 3U2QA 2JLXA 4QXAA 1G41A 4V0LA 3FPAA 5M04A 1EG7A 1G3RA 4Q1AA 4JSTA 4DHEA 2WZQA 2ZPTX 2FFHA 4WW0A 5B57C 3GJXC 1OYYA 4Q9KA 2GEUA 1KK2A 3W5IA 3R8CA 2JJ8A 3W6NA 3EIEA 2F9MA 4ZPXA 1RIFA 5EXXA 1UF9A 2RGAA 4AIIA 2QP3A 4JLBA 4O25A 3LDAA 1Z6XA 4ZDWA 4DSOA 2C9CA 4ZIRA 3T35A 2B8TA 4XH9B 1F60A 3FFBA 4AKHA 5G3YA 2BMFA 1FOEB 2UZIR 5EZ5A 4NYIR 1ZNZA 3W34A 4CEIB 1UJ2A 1YKSA 2XTMA 1W49A 4V02A 2WOOA 1RJ9B 2HF9A 2I3BA 2ZJBA 1KNXA 4PPGA 1CJUC 5LB4A 2YJTD 4RD4A 3HYTA 2RGGA 3GLGE 1U90A 3BH7A 2AK3A 3VR6A 1OFUX 1L4UA 2ZYUX 4PQFA 4MITA 5BW8A 1MT0A 1Z6AA 4Q19A 1US8A 1BO6A 3HU2A 3T5DA 2O8BB 3C15C 4OK6A 4HYYA 3ONWA 4Q00A 1ZIOA 1MO4A 2OXRA 1Z06A 3FMFA 1Q22A 1P9WA 2HYIC 3FHTA 1EFUA 5EP4A 3ZQ6A 1QHXA 2E9SA 1IN5A 4LJ4A 1GNRA 2H5EA 4KFTA 2FPKA 3IBGA 4UKDA 1KSJA 3QJYA 2CCGA 1SZPA 4XIGS 1GNPA 3LH5A 1Q0UA 5TDHA 1OB5A 2PX3A 1R5NA 3SQXA 2XSZD 1Z07A 4BFTA 4MGYR 3UMFA 5JMTA 4BFSA 2IS4A 1QHIA 1XEXA 2H1LA 4B3XA 2RHDA 1XXHA 2I4IA 3QPUA 1J8MF 1MR3F 2ZE6A 2XTNA 4XD7D 1E98A 4M1OA 5CM9C 2QGNA 4AYWA 4KV9A 4DBLC 4TWZA 2XEXA 2V1XA 3BFXA 5L3SB 1CR4A 1TNDA 1U0HC 1IJEA 3PUYA 3SC3A 3W8RA 4RKFA 1YE8A 4AYXA 4M0LA 4LGMA 4GP6A 3TH5A 3QNUA 3D6TB 2NO9A 1RW4A 2AKYA 2PBRA 4GDFA 1PVOA 4CF7A 3ZLJA 1T0JB 2P5TB 1TUIA 4P4SB 4ZDIA 2ANCA 3DDCA 4PC2A 4YMVA 1RKBA 4KHZA 1KO5A 2FZ4A 5DI9A 4DLRA 4E09A 4IOLA 1WMSA 3TQCA 3ND8A 3LXXA 4KVAA 5AJYA 1UDWA 3DKVA 4Y0VA 3RS0A 1OIVA 3BJIC 2ZJOA 4ZDKA 2ZSFA 4BQSA 3HR8A 4GOJA 3H84A 2OM2A 1ZAKA 2ZM5A 1GRQA 1H8EA 4RKEA 3THYB 1QRAA 1R4AA 3QF7A 1ZBDA 4KSBA 5DIFA 3EPKA 1EESA 1CBUA 1T3LA 4M1KA 2VP5A 2C77A 2NTYC 5CIQA 3LBNA 5HTKA 1OFTA 1JAIA 1S1CA 2X2FA 5KDOA 5DYGA 3B13B 1N5KA 1NVVQ 4IOJA 3EG5A 3K0FA 4IHQA 5TVKA 4DCSA 1KI2A 1CIPA 4JLJA 5G3ZA 3N5CA 4Q7LA 4I81A 4OQNA 4QRHA 4XVRA 3AKCA 2V4ZA 3UANA 1ZU5A 3QVUA 5CK4A 5EXTA 2VP0A 4D0NA 1E6CA 2WWHA 3QF4B 3Q9LA 2VL7A 4WZAE 4X8HA 1G7RA 2XB2A 2K5UA 2ANBA 2ZS9A 3CRQA 4P4SA 4TLDA 5AUNB 1QVAA 2QAGC 4F93B 2PEZA 2XXAB 3GLIB 3X1WA 3NC1C 1P2VA 4FI3C 3QBVA 2IYUA 1G7SA 1DE0A 1BOFA 2RHMA 4URWR 4DSTA 1R0WA 4MRNA 4M9QA 4C0QC 5FUVA 1U8AA 2DYKA 4JVLA 1H8HA 4UJ5A 1ZD8A 1GNQA 3KB2A 1P9NA 1HH4A 4G01B 1IQPA 2WVJA 4QHSA 1GG2A 2P6UA 4I1VA 4PSVA 4TYPA 2WMNB 4L5BA 5CJPA 2H92A 1MO5A 1RZ3A 2W00A 3VNUA 1FW6A 4DCUA 4NP6A 2Q3HA 1N6PA 3LX5A 3WYFA 4EPVA 4JLKA 4OJQA 1G3UA 4Q4HB 1XMVA 3K0CC 4PC3A 4NE2A 1R6BX 5TARA 4BLQA 1TMKA 3U7GA 3MRSA 5DHFA 4MKIA 2PLRA 5C4MA 3V9PA 5EUQB 2DFKB 1SVIA 5KDDA 3L8YA 2AWNA 4ZCIA 1H8HD 3MSXA 4OL0A 4M1MA 2G6BA 1XCGB 4ZV4A 1N6HA 1G3MA 1N5JA 2CLDX 1NG1A 4LRWA 1AJEA 1YU9A 1P5ZB 2PT5A 2E1RA 4D4KA 2C5LA 1XXHB 1GFIA 3D8BA 4V0ME 1VYTA 4GOXA 4HDCA 4NYJR 1LF0A 4B71A 1IN7A 2FPLA 2QQ0A 4IEEA 1E2MA 2KI5A 5JLJA 1W36D 3VKHA 1K8RA 3LO5A 4NCHA 3R9XA 3GEEA 1ZNWA 2Z6VA 3CPJB 1NKTA 1KHTA 3CBQA 4GRAA 2NOAA 3KQLA 5B64A 1OYWA 3KJEA 1NVWQ 1FP6A 3T06B 4QC2A 4JS0A 4OHWA 2XZLA 1NN0A 1M7BA 2OILA 2O8FB 3VU9A 1KSHA 4DUGA 3IKJA 1YZUA 1VCMA 4UQOA 2IL1A 1UBFA 1CS4C 3HJNA 1YR9A 2VSFA 4RVCA 4KYUA 4UXHA 5DLQC 3OEED 2GF0A 4ZCLA 4Z51A 1Z2AA 2D2EA 4D4MA 5EE3A 2L0XA 3KTAA 3W3AA 4GP7A 3BXZA 4F92B 4US2R 2YWFA 4MRRA 4GNKA 1NJGA 1JR3D 1O3YA 3RS5A 3WMFA 1UKYA 2CK3A 4C0KA 5JRJA 1SXJC 2ZR7A 2GAOA 1Z28A 3EWAA 5SZHB 3SE0A 5CB8A 2CE7A 1X8KA 3KKNA 3NH6A 3PJRA 4AKEA 2J0QA 4LX0A 3W5JA 2F1IA 4M8NE 1E2FA 3I4LA 4HLQB 4WOPA 1IY0A 1LTQA 4RJLA 5H68A 3RS7A 4XD7A 2BIFA 3AF0A 1XTKA 2HYDA 2XAUA 1TQ4A 2FGJA 4HI0E 2PZGA 4WA7A 4MDFA 1RC8A 1W0KA 4CZ2A 3GP8A 4TLAA 3CF6R 4Q9LA 1D9XA 2ZVQX 3KDSE 4DLVA 1OPXA 1E2QA 1J70A 2AXNA 1SKYE 1XU4A 3GJ3A 4OHVA 2IYYA 4RSGA 2YC2C 4A0GA 2WICA 2ZRMA 4LV6A 4A9AA 3BWDD 2D7CA 4LCBA 2FEOA 2W2TA 2ZJZA 5BN3A 1N6IA 3UPUA 1OSNA 2QT0A 4HB3A 4OKSA 3DO6A 5AJZA 4QJ5A 1HA3A 1QHGA 3GJ6A 2VP4A 3L0OA 3FE2A 1MRSA 1PLLA 2BDTA 2JCSA 3KJGA 4CEJB 4PPQA 2NO1A 4EDHA 2F7SA 2ZU0C 1T91A 2WAXA 4MGIR 1FPMA 2W6ID 2XOKD 5IDVA 2IK8A 2IS6A 3RLFA 1AM4D 2FOLA 2W2XA 2EWWA 2OFOA 2W83A 2QA5A 3D31A 3QXXA 1D2NA 1ZJ6A 4KCGA 2OESA 3PXGA 5JWRA 2B92A 2BCGY 2ZRNA 4IXNA 4R71A 2A5DA 1Y63A 3KXKA 2BMEA 1TQ6A 2C04A 4MUBA 2EYQA 4DLUA 3EC1A 4GMDA 4PSAA 1XF9A 5LPNA 3QKSA 2D62A 1CJTC 1Z6YA 4FXPA 4M1SA 3KQNA 3AVYA 1CKEA 2NIPA 1RRCA 3AKYA 2OT3B 1HY3A 3UK6A 3JVUA 2W6JA 3FHOA 3B2EA 1KSFX 1RVDA 2IEYA 2QTFA 4P4TA 1N5LA 1NBMD 4PZZA 2GJ8A 2JAQA 1G3IA 1KI1A 4LJ7A 2FJUA 1ETUA 3A1WA 4Q4AB 1VCIA 4GL2A 2FE4A 4C7OA 2ODEA 2VHUA 2YC4C 1ZP6A 1ZMXA 1NMXA 2VSOA 3QEJA 5DO9A 1VYUA 2BOVA 2D2FA 2ZREA 3GFTA 4N0DA 3Q7PA 3CO5A 821PA 2AR7A 2ZSDA 2NPFA 3MJHA 2ZI4A 3N2IA 4NCIA 3PENA 4R2IA 2ZROA 3B85A 2E87A 3LBIA 5KPJA 2IXGA 2XSZA 1JEDA 2ONJA 1XNJA 1P72A 4Q1DA 5B2ZA 2IS1A 3AUXA 2BWJA 3RSOA 1GM5A 4URZR 2A78A 3A4MA 1WBBA 2ORWA 4TL9A 1G8HA 3MGCA 3R7WA 3DM9B 4UNNA 3B78A 1D5CA 1NN1A 3MAAC 3T1TA 2YWHA 2EQBA 1WA5A 3BOSA 2GVZC 2IXFA 2GVDC 1SHZA 4QBFA 1LV7A 3QXCA 4V0MA 1N3BA 1FQKA 2WM9B 5GJWC 1GAJA 4HAVA 5JFGA 4F91B 1ODFA 5FOSA 4ITRC 3VR4A 4HB2A 4UJ3A 1P73A 1Z8FA 5EE9A 4BRUA 2WWGA 1UBGA 2IUTA 2GXUA 1W36B 4Z1MD 2VP2A 5C46F 4WXRA 1XJCA 3GJ0A 3K9GA 5L3RA 2I1QA 3K9NA 3V4RA 2A30A 2HXYA 1KZGB 4EAQA 4GPTA 2H57A 2GNOA 3WHKA 1L8QA 1RE0A 4BFYA 3PUZA 3NBZC 4QNRA 4AKIA 2PL3A 1C9KA 4Q7KA 2CL6X 1II9A 4G1UC 4E03A 1HQYE 3FB4A 1JQJC 2DB3A 3FDIA 1EWQA 3U7HB 4DKXA 3L0PA 1Q12A 1DADA 4LC0A 3DM5A 1HQCA 2GZHA 3A1VA 4NYMR 5F9FA 2ZUCA 3QENA 1XTQA 2QGZA 2OEPA 5BN5A 3GLHA 3T15A 1VYVA 1GVNB 2AXPA 4KVGA 2C96A 2H17A 1SXJB 2GJ9A 1K6MA 2HCJB 4LHWA 5FBQB 3ZD7A 4PC6A 1EFRA 1P7CA 1XRJA 4MUAA 4JLOA 4NMMA 4POAA 1R0XA 4QM6A 4BECA 4AI6A 4JLDA 4OYHA 3RS4A 1II8A 1TQ2A 5L8VA 4PPNA 3C4JA 1NKSA 4CT4B 1XZPA 1BIFA 5KOYA 2CBZA 3MWJA 3R9IA 3HU3A 3SNHA 1GUAA 3C7KA 4YDSA 3K9HA 4ILEA 5CM8B 4BLRA 2R6GA 1RPZA 1Z83A 1W2HA 3HU1A 3U3KA 4UNSA 1VTKA 2RGXA 4YMTA 1DARA 1P60A 4B6FA 3GQBA 5IK2D 2WHXA 5KPDA 5FUYA 2BM1A 2YWGA 4S2EA 4C0HA 4B44A 3DOFA 5CITA 3ZQJA 1WXQA 4N1AA 1XBTA 4DCTA 2ZI9A 5A0FA 5SZKB 3THYA 1DG3A 3I3SR 4Q1EA 3NEYA 1EX6A 3OE7D 4IVPA 3I72A 4RD0A 5GJVC 4F4CA 4Z1MA 3OIYA 2G0TA 1UDXA 1GL6A 2TMKA 3NEJA 2JLSA 4DT1A 3QIAA 3BH6A 1UKVY 5E7JA 1IAQA 2GJAA 1KAOA 2F6RA 4JLVA 4DWJA 3CWZA 2O8CB 2ZRLA 3CH5A 2CHGA 2R62A 2KSQA 1G8YA 2XZPA 5DNYB 2R6FA 3AEZA 1XEFA 3QI2A 5FOTA 2V6JA 4Q66C 1N6NA 1XJ0A 3H1TA 3S1AB 4HUQA 4BE7B 4TN1A 3LV8A 1G3QA 1G4AE 2XXAA 3RNLA 4A0FA 5CB6A 3VNVA 1OFIA 3R20A 1T3HA 4JJZA 3UXMA 3VX4A 2O8CA 4HATA 1VIAA 1LB1B 1E9BA 4CVNA 1G64A 3QXSA 1U0JA 3SJCA 2MSEB 2Q0HA 2FN4A 2IBMA 4H9GA 4CEIA 1FX0A 2XITA 2NO7A 4JYBA 2Q3MA 4YXWD 4PSKA 3AH8A 4W5JA 2JLVA 3AVUA 1G5TA 1R2QA 3CRRA 5KHOC 2FSHA 4QM7A 5EE0A 3ADBA 2O8DB 1CF4A 4B47A 1S4QA 5EQTA 3U44B 3QE0A 2QBYB 1ZD1A 2CHQA 4WVFA 3O8BA 2G77B 4DXAA 2GJKA 2O8EA 2N42A 4BFVA 2J45A 3U4QB 5EXPA 1DAKA 2ZU6A 3F8TA 3ZH9B 1Q1BA 3B60A 4FMCF 1FFHA 5FTLA 4AYTA 3NH9A 2UZ3A 2AX4A 3B9PA 1FNMA 1I4LD 4P31A 4C30A 1G8FA 1E1QD 1E32A 2QM8A 1NN3A 2ZRGA 2AFHE 2VPPA 4URUR 4YQFA 1TQDA 4A15A 1NVXQ 4X8LA 3WMGA 3A1TA 4BFUA 2IYWA 1XEWX 1E0KA 1W4RA 2GZDA 3NKVA 4B76A 3KTAB 2QE7A 1GP2A 1TU4A 3W90A 1G9XA 2B8WA 2QTVB 3TLXA 4KITB 2JLWA 5HCIA 5E4FA 3K70B 3EIQA 3PFIA 4LY6A 3A4NA 1IJFA 4BLOA 5G40A 1XDBA 2YOHA 2RH5A 1J90A 1VHTA 3FMPB 3MUFA 1EWRA 2PCJA 2QU8A 5LD2C 2PJZA 1FTNA 5KDLA 2QRNA 2W2VA 3LVQE 4YXWA 1S3SA 5ANRB 4PC7A 2P6RA 1GWNA 1OXXK 4M1TA 1LFDB 3K53A 3CONA 1KTVA 3EZ7A 1E4VA 4LK2A 5F2EA 1UKEA 2FWRA 3T61A 1ZUIA 2JA1A 3AKEA 4OQXA 4TQ9A 1XPOA 3GLGB 2JIZD 2ZIAA 1Q3TA 3F5FA 2ATVA 1MOZA 1I4DD 4TMWA 2R6AA 4LJ9A 2IX3A 4PXAA 2RGNA 3DPUA 1GRNA 3OF5A 4JT4A 1MRNA 5JEEA 4UNRA 3SJAA 1ZVQA 2ZI5A 221PA 3C5HA 3M6AA 3RC3A 1KMHA 3LW7A 3BE4A 2YNMA 3V00A 2ZJAA 2LKDA 3P1JA 3U3OA 3NBYC 4YMWA 1U2RA 1J2JA 3QXHA 4CEJA 2O8DA 3AGPA 4XVUA 5JJIA 3Q85A 4TL8A 4FN5A 2BBWA 3VR3A 3B1YA 1HE8B 4B3CA 1ZIPA 2KWIA 1A2KC 3T1QA 2ORIA 1EGAA 1Q1QA 1E2EA 2GK6A 4NTZA 4URXR 1TEXA 1ZCAA 3IO5A 4MGZR 1KAGA 4US1R 4F38A 721PA 4C9BA 2DCUA 3ZIAA 4ASUD 4URVR 2FSGA 2X2EA 1DPFA 1NJFA 1CLUA 1N6LA 4PAQA 5JCPA 5KNDA 3TSZA 3CIOA 4KJZA 2P3SA 3TSOA 1U98A 1GKUB 1G7TA 3NBXX 3X1DA 1A5TA 5AUQA 3DVLA 3ZS9A 1U9IA 2JLRA 2R2AA 3CNNA 2CXXA 2ZAMA 3WP1B 4B34A 2PLFA 3PQCA 2N46A 1ZNXA 3GLFE 2JEOA 4A4DA 1NVUQ 2EYUA 1BS1A 2J9RA 5KUTA 5HCNA 4BWYA 1P6XA 3AVTA 4UNQA 2QMEA 3TUJC 1NY6A 1GILA 2FH5B 1WQ1R 2P6NA 1XPRA 5C2JB 3TE6A 4MQBA 3THXA 2PJRA 2R65A 3IUYA 1M1YE 1B23P 4K8OA 4H1VA 4BZPA 4HAZA 4OJKA 5CDFE 1QHHA 3VKGA 1E9CA 3NWJA 4XJXA 2ZE5A 4BZQA 1X6VA 4RD6A 5EP1A 2GF9A 2OLKA 2GKSA 3DMDA 4PHFA 4E07A 4ESHA 4QG7A 1XD9A 5G41A 1P2TA 2J7PA 2IYLD 4RD1A 3U7FB 3W6PA 4B3GA 2FA9A 4TMTA 3VHXA 4A8JA 1AQYA 1EFTA 1FP7A 1E79D 4RZXA 4JKIA 3WYAA 4ERNA 4XWKA 4QGAA 1KO8A 1AS2A 4GBMA 1G20E 2QM7A 4KI0A 2IWHA 621PA 2OHFA 2MMCA 1IY2A 1OKKA 3A8TA 2QPTA 1ONBA 1G16A 4D0GA 1B0UA 1XTJA 4M21A 2Z0MA 5A4JA 2D4HA 1W44A 3FFAA 2RGBA 4KODA 3BIFA 3RRNA 1LY1A 1E2NA 5EJEA 3HYRA 5AK0A 2P65A 3EZFA 4MKFA 2YHSA 4V0OA 1G6OA 5CYOA 1SVLA 4F4IA 2NZJA 3CLVA 3A37A 4CT5A 2Z5FA 1DS6A 5FTMA 3K0EA 4WAUA 1XEWY 1LS1A 2YKGA 3AVVA 1KDOA 2A3RA 4F7WA 1FL9A 2OBNA 2DPXA 3WNDA 1OT3A 4M1WA 2ODBA 4C0LA 1W7AA 4FMDF 4CEHB 2HF8A 2CL0X 2JLYA 1L4YA 4PZYA 4AG6A 4IDQA 1NMYA 4LYJA 4DCVA 1XJQA 4A6PA 5A5GA 1F48A 1E9FA 3PUWA 3GEHA 2HLDD 1RRGA 1IN6A 1YZGA 2W0MA 4PR0A 1N25A 4FW9A 2ZANA 4PHGA 1JEEA 1Z5ZA 3SZRA 2CVHA 4Q02A 4Q7MB 5D3MA 1JBKA 1JPJA 1H8ED 2CLSA 2VLIA 3SBEA 4EPXA 1MABB 3KKPA 2ASEA 3GLIA 5C1BA 3WMEA 1VG8A 4PO1A 1CR0A 2B21A 2DBYA 3PITA 3RANA 4ASUA 1Z6TA 3BD9A 2GK7A 3QY0A 4DDWA 1ZUHA 2F9LA 1KJYA 2QBYA 1OE0A 2O8EB 1OHHD 3NTUA 4NL4H 1E2JA 4DVGA 4UNPA 521PA 4BEJA 1X1RA 5FUXA 5LBIA 5FOVA 1S9HA 4B75A 3U6KA 2Z4RA 3EXAA 1P4SA 2V3CC 4JVMA 3PIRA 3ICQB 2DWPA 4A0HA 4OK5A 3V4FA 4YC7A 3D7MA 3KQKA 1PUIA 1HT2E 1NF3A 1SGWA 1QG4A 4LI0A 5FUWA 5BYKA 3OEHA 4A2PA 4PX9A 4B3DA 3I8SA 3M4YA 2O8BA 4DSUA 4BLPA 4TLEA 2WKQA 1QBKC 2BBTA 4X8MA 3ZYCA 5TY0A 2BMJA 1OXSC 2CK3D 5J40A 2H8KA 3EZ6A 4M2LA 4QGHA 5FTJA 1YZQA 2ZVPX 1A82A 4PTLA 1J8YF 3FGNA 3QQ5A 5AJWA 3TVDA 1P61B 3ZGXA 3QVVA 3CX7A 3EX7C 1Z08A 2EFGA 4LYFA 1KDPA 3EARA 3T1VA 2DFNA 1X8JA 4C0BA 3LBHA 3RVBA 5BQ5A 1X86B 4L9WA 1O87A 1E69A 1E2LA 3AVXA 2WWIA 1YHNA 2ZAOA 3AVWA 4KU4A 5K8UA 5KSZA 1FMJA 1JJ7A 5L3SA 3PEYA 1E0AA 1CTQA 4B3FX 2RMKA 2KB0A 3K8YA 4LBWA 3JVVA 3LLUA 4CRWB 3VU9B 4IVQA 4MKHA 3THXB 1T0HB 3LQQA 3REFA 2Z4SA 4PHHA 3AVQA 2IHYA 4FMDB 4G5QA 2F43B 5FTNA 1Z47A 2FSIA 4OI4A 2HUPA 2OE2A 2ZETA 3W9YA 1ANKA 1ZD9A 5JJLA 2OAP1 2VH5R 5DGXA 4Q48A 1VPLA 1D2EA 5FBWB 2AHOA 3WBJA 3MWKA 3OESA 5FPHA 1E2DA 5J4LA 2V55B 4FCTA 3FMOB 1CEEA 4RCYA 2ZI3A 4DJTA 3GLFA 2ZYVX 2OAQ1 2RB4A 2OLJA 3ADKA 3CF2A 3GJ5A 5EP3A 4ZDJA 1US8B 1VG1A 2XB4A 3P26A 5H1YA 1KGDA 1BH2A 1U99A 1OF1A 2DFLA 1OH6A 1OJLA 4Q1FA 4QJ3A 2VHJA 1OXUA 5JS7A 1PZNA 3LLMA 4IOMA 4HB4A 1FTSA 1KI4A 3TMKA 4M9SA 2QEQA 2QZ4A 3NDPA 4IOKA 1Z0IA 4PPFA 4KAXA 2R6CA 3WRYC 5FPYA 2ZRFA 4ACBA 5D3QA 5B30A 1DAHA 5JCZA 1UFQA 2GESA 1M7HA 2ERYA 1YZLA 1M8PA 2BJVA 3ASYA 1OXTA 4TYWA 2P0EA 3U61B 3TK1A 4GI7A 1Z22A 3ZVLA 1NLFA 3U3MA 1XCPA 2IEZA 3UIEA 4CDGA 4BGDA 2QENA 1G8PA 4M53A 2Q9CA 1J99A 4XOIA 5FTKA 3FVQA 1GZSA 2ZXUA 1NN5A 5J47A 3CX6A 1NIPA 1W5TA 1DO0A 4KFRA 4KFUA 4LBVA 4B6EA 2XNDD 3I1FA 4EPTA 5EP2A 4LPKA 2VA8A 2GEDA 2QAGB 1S9DA 2YWEA 3QKTA 1XXHE 3B1WA 2HLDA 2D06A 3NDBB 4R7ZA 4QBIA 1VMAA 1D8TA 4AY2A 2CLCX 3I5YA 3AVOA 2H16A 1KI8A 1KKLA 4RZUA 2FNAA 2F43A 1G7CA 2EW1A 3CR8A 3C14C 4KSCA 2VHTA 1CJKC 4F4JA 2IHBA 2UVQA 2N1BA 1Z0FA 1XB2A 4IDOA 1XZQA 1E1QA 3TVTA 5JHHB 3RYTC 3MD0A 4NPHA 4B74A 4DDTA 2FFBA 1SXJD 1OIWA 1KJZA 1RYFA 4TZ0A 4B48A 1E9AA 5IHPA 2HT6A 1SULA 2ZR0A 1VDZA 2WKRA 3N70A 1P9RA 4XSHA 2ONKA 3KFXA 3MJRA 4DSNA 5F3WB 4W5HA 1GOTA 2FGKA 4II7A 4LSGA 2GTPA 4JL8A 4Q1CA 3U7EB 2JJ1A 1RRPA 1HYQA 1PLJA 2X77A 1TF2A 3BC1A 2V6IA 5JSZB 3LNCA 1NSTA 2ZRJA 1E2HA 2JLQA 2WKPA 1E94E 4JL6A 4QFMA 4QL3A 1NVVR 2O5VA 3FOZA 1QDEA 3GFPA 1U0LA 2BMDA 2KJQA 2J46A 3ICEA 3GCGA 4DCNA 1CJMA 2HV8A 2ZUDA 1UPTA 4GFDA 3GLFB 5FOWA 3TAHA 4CGZA 1D9ZA 3GJ7A 4PAMA 5E95A 4RFSB 4TTRA 2YINC 3PEVA 3CNOA 4FCWA 4JLPA 3I32A 4NBSA 4ZI3A 3CNLA 5KTYA 3H2YA 1KY3A 1UKZA 2ODNA 4K46A 5FFMA 3TR0A 1BMFA 4ZO4A 4A1FA 4KLZA 3MFYA 5AJXA 5HKKD 2B7CA 2VSXA 4CIDA 5TMPA 3QSYA 1Y3AA 3BBPA 2QAJA 1F2TB 1W5SA 1T8UA 3CWQA 2HXSA 3Q72A 1NRJB 5GVRA 1P62B 3SJZA 2NG1A 2O8FA 3UG7A 1N6OA 1SVMA 1Z0KA 2C9OA 2RGNC 2QT1A 2KE5A 4IXMA 5E7MA 5KU1A 2GXSA 3F0TA 2Q6TA 3TRFA 4MGKR 4PQYA 2W58A 3PVSA 2J7KA 4IDPA 4XTRA 3IQXA 2YYZA 3A6PC 3LWNA 1S8FA 1Q1EA 4DUGD 2CHVA 2BEKA 4W5WA 2ZSAA 1BKDR 2VHQA 5FL3A 5FR1A 5HE9A 1V5WA 4NH0A 4TQAA 2CEAA 3FYHA 3L43A 3ZIAD 3VAAA 1W0KD 2QSZA 4KYIB 2XOKA 1DELA 3B1ZA 1ESNA 2PEYA 4TSFD 4B35A 1N2CE 2X19A 3B1VA 1IXZA 4WZBE 2VRWA 2WJGA 3TSWA 2WTUA 4C0AC 3WBKA 2Q9BA 4W9MC 4G5OA 3SI7A 4M22A 2HCBA 3ZDQA 5KSYA 121PA 3R7WB 4O2RA 1T8TA 1JR6A 3NIBA 5EE1A 5HZKA 1SVOA 1W0JD 3IQWA 4QJ4A 4E5UA 2ZRIA 4NHOA 1MO6A 4YONB 4CW7A 1NY5A 4NCKA 4BLTA 1VCOA 3R9WA 2YOGA 1PUJA 3TAUA 1IN4A 2BM0A 4LZZA 1CJVC 2XX3A 1UBEA 5E7IA 1E3MA 1YR7A 1W47A 4L16A 5LDDC 2VEDA 2DWOA 3BB1A 5GADl 2ZRDA 3ASZA 4JKYA 1BYUA 4NYIQ 4QOSA 1K5DA 1K5GA 1ESMA 2CVFA 1FQJA 1KI6A 2B7BA 2J87A 5H70A 1AZSC 1NBMA 2F1JA 3BFKA 4TYQA 4HAUA 4Q47A 4ZKEA 2C8VA 4WZ6A 1R8QA 4IFBA 2FPMA 2G83A 2W6JD 1HUQA 1AKEA 5D3MB 2BHRA 1GL7A 5IF9A 1WBDA 1G8GA 2JASA 4G0NA 4HLUC 1R5OA 1WRBA 4OI0A 3AM1A 1D6JA 4GSYA 1XTRA 2QTHA 3CH4B 3BH0A 2AL7A 5JS8A 3SYKA 2CNWD 4I1SA 3CRVA 3CRMA 1FMLA 3Q8XB 1G291 2W0SA 4XWAA 4HB0A 4OK3A 2ZE7A 4R98A 1Z0AA 1IN8A 2WWYA 3AF4A 3SU8A 3EZ2A 1DAEA 4Q4LA 3L2OB 3NHBA 4A36A 2ERXA 3QUSA 5J4VA 3PEWA 3IEVA 4P33A 4KXFB 3WNCA 1AGPA 1WB9A 5LB2A 4D81A 1GDDA 3AV0B 1I2MA 1QG2A 3B8HA 3PEUA 2YVUA 2F3TA 3VR2A 3X1YA 1E79A 1JPNA 4MYCA 4DLYA 1JI0A 2GBLA 3IGFA 3DOEA 5KSPA 3RS3A 3I62A 3FKSA 3H4MA 5KO2A 2WSSD 3E5HA 3AF1A 1YZKA 2PH1A 2GXAA 4OHYA 4QHYA 1ZU4A 1GIAA 1TF5A 3KL4A 3Q3JB 4DZZA 4AURA 2QROA 5J5CA 1Q44A 3EWSA 2OCAA 3DHWC 3IDQA 1A2BA 1H65A 2O0JA 2DHRA 4JMPA 1JJVA 4ARZB 5L3QB 2R6DA 2CJWA 4LV5B 4UXIA 1ZM2A 2ZJ8A 3T34A 1JAHA 4TTQA 1QHNA 4RD2A 3OZXA 2ZQ5A 1AS3A 3VQTA 2BKEA 4DB4A 3KXLA 1R8SA 2REXB 1S96A 5UKDA 1OW3B 4EKDA 2OZEA 4KLNA 3RRZA 3BAFA 1P2SA 3DKPA 2IWRA 4D80A 3EA0A 4DDUA 4C2TA 1KI6B 3U6BA 1YJ5A 1DAGA 1GRRA 1Z0JA 4C0JA 4MRPA 4ZKDA 5FOUA 3HDTA 3KUDA 3OEHD 4EQ6B 4EJSB 4B32A 1CR1A 1E2PA 2Q3FA 1KO7A 1P75A 4QGGA 2OSBA 2XTZA 4AC9A 4DC9A 2IUUA 5EXSA 3OE7A 4NCNA 1COWA 5GVSA 3RDPA 2ZR9A 3QBTA 1GKYA 1OFHA 1V43A 4FWTA 2G88A 5CDFA 3Q7QA 3K1JA 4LJAA 4TMVA 5HZHA 1UEIA 3GLHE 3DZDA 1Q21A 2PX0A 4IDHA 4RFVA 2QQEA 1YQTA 2OG2A 3VFDA 1XD2A 3OEEA 1C1YA 4IJMA 2J41A 3MMPA 1PJRA 1M34E 3NG1A 3ND9A 5AUPB 4D4LA 2J3EA 1KOFA 3HWSA 2XZOA 1ZYUA 1KKMA 1U81A 2QNRA 3AP2A 2CDNA 5L3QA 2PZEA 2W6IA 3FMIA 5IRCD 5EE5B 3NC0C 3EC2A 4I4LA 1LF5A 3K09C 1NLYA 3QKUA 1VIYA 3BGWA 3BK7A 3EASA 4U00A 3ZZ0A 4IKEA 3VKWA 2AD1A 1E2KA 1UM8A 3QKSB 3GJ4A 1II8B 2A5GA
chains in the Genus database with same CATH superfamily
5EC8A 3G49A 1AZLA 1R0ZA 4WPGA 2Q1YA 4U02A 1X7YA 2AMFA 2EDAA 3SJUA 4OO3A 3TUIC 1II0A 1T5BA 3PKJA 4DR1B 1DSSG 3AXTA 5DOZA 5CG1A 3B7GA 3L7JA 4QVIA 4YJKA 2FMIA 3MAGA 4FNOA 4MCAA 5EGNA 1D6NA 3HKDB 4QXQA 3RVMA 1SU6A 3DAYA 2ATXA 1QO9A 3G82C 4LWPA 5HJ2A 5L3ZA 1ZM9A 1L5LA 3I4CA 3IT2A 4COOA 5TGZA 3H17A 3D0OA 1Q7CA 2R1TA 4NBNA 4PU0A 5EIBC 3FPBA 4IEFB 3RT1A 2JIQA 2XZTA 3KAJA 3OHMA 1N0VC 1DMSA 1KY2A 1YO6A 5HF5A 1R27A 3G5UA 2GHIA 3EVZA 2R00C 3PNKA 3QITA 4DM7A 1CRPA 1MMFB 5CJ2A 4ZOEA 3I58A 3M6XA 2EIHA 5E6UA 3R9XB 4AXXA 2CN1A 2L2QA 3VRHA 5F2OA 8AT1A 4M9XA 1FU4A 3D3WA 2A9VA 3P4UA 4FIDA 4OREX 1DC4A 1FNSA 2CMKA 1JR3A 3NBFA 4QBGB 4D42A 5BQFA 5JDIA 3SHVA 1HFJA 1QTQA 1OY1A 3EMDA 1WAMA 1IMOA 1TL7C 4H3KB 3AG5A 1YGPA 3MD9A 2QAIA 3UHFA 2FR0A 4UTNA 4Y0NA 4ISCA 4IO1A 1VE5A 3P52A 2FQ1A 2RCYA 4I9HA 4CYMA 4BS9A 2BE9A 5U9CA 4OUKX 5E8RA 4PAOA 1E1CA 4EFLA 2OSVA 3ZE7A 1SM4A 2C5EA 3L9XA 1IN1A 3I83A 3KYBA 1S2MA 3NI2A 3OEWA 4QQ8A 5IM4F 2A7QA 1PS8A 3RVLA 1A4RA 2ORYA 3SDBA 3ZBQA 1J0CA 1YR6A 3T99A 4KO4S 3A70A 3LA8A 3H0KA 1FZTA 1DVRA 2PMDA 1Q0ZA 4IP0A 1XKQA 2MT9A 2G9RA 4YMUA 1WP9A 1N1GA 5DNCA 3HXTA 4RQUA 1NRIA 1PL7A 1XRLA 1UUFA 5BORA 4LFBB 3KFVA 3L1KA 3L8MA 4BVJA 3LXRA 1DOAA 1GSIA 4HDQB 1LJUA 4B43A 1J5EB 3UXEA 4BX9A 3BORA 3KWLA 4IHJA 2ZP1A 4N5LA 3HCCA 4V0NA 4YUXA 1K06A 5FI1B 4E88A 5DIZA 4N7JA 5F5LA 3WLAA 1YDEA 1IUKA 3LY5A 3PUVA 3VH2A 2QUAA 4QT0A 1L2TA 2A4MA 1CQJA 1XQ9A 4TL6A 3SBXA 3FB1A 1X14A 4NZYA 3ZTWA 3TTVA 3DTYA 2QS9A 4NCAA 2M1ZA 3U44A 1OBVA 4TWRA 1KARA 1U8YA 1NM5A 2Q7DA 2PUJA 2VO1A 3UAYA 3NT4A 2HCRA 4PYIA 5MFPA 3UG6A 1GPH1 1L4NA 4E15A 4LRQA 1RZRD 1T2VA 2CBXA 2PT7A 2P35A 3RVJA 1ZNYA 2QL7A 3IP6A 5DH9A 3DLBA 3KZXA 2X4GA 4UFPA 3PTLA 3D5TA 3BIJA 1N1DA 3OFSA 2C4UA 2RKOA 4LDRA 3OTQA 4Q18A 4Z2YA 5ER6A 2BKVA 3EQ8A 3P32A 1WE2A 3EC7A 4UUAA 1AGNA 4I4NA 1N7GA 2B7LA 5JDCC 4YRQA 4MKZA 2IC5A 3HCFA 5JSHA 3N8DA 5DGDA 2Q4EA 1FUUA 2HY7A 2VJMA 3HWX1 4O8ZA 4LJ5A 3KE9A 4J7AA 2MR6A 4R8KA 2ATCA 1XVIA 3JAWA 3K0SA 4DIEA 4DR3B 1CR2A 4GXQA 5F9MA 4BFWA 3CZRA 3GUYA 1RPNA 4JB3A 3HJGA 4YJGA 3RU9A 4CR8A 3UBTA 3WA7A 4BPBA 2PRZA 4RF3A 1A9YA 4XTCS 4WXPA 3GWZA 3IFSA 5DISB 1EFPB 3QQPA 5JCOC 4G9EA 4IUCS 4GM1A 4MUHA 2VNJA 3VPSA 3PLNA 2IYEA 3ESYA 1XZEA 4L4RA 1HE5A 1SVUA 2FU5C 3K8QA 1MQ8B 4BNJA 1SVWA 2AFIE 4NV3A 2VZEA 2VUSA 5ITZB 3I6IA 3H5VA 2WHPB 4B2PA 4DIFA 2ZRPA 4DILA 4EMTA 3VNQA 1ND6A 1QMPA 1N2EA 1YC2A 5HM8A 4TWIA 1XX6A 2DCMA 2R4TA 1GPBA 3KUXA 2CXRA 3M1YA 4ONEA 1G17A 3ZE1B 3AV3A 5TT0A 5GM2A 1JFLA 5ICGA 3WGOA 3QPDA 5AHKA 3EF0A 5AVJA 4A0SA 2KMLA 4BATA 3T3DA 1MRZA 1W34A 1E1RD 2RHRA 3OLZA 2FDCA 1YZFA 3W5AA 3CVJA 4HY3A 4UDOA 1EGQA 1TZKA 2X8AA 3AETB 3E2IA 2A0UA 3ZWKA 1HDOA 2MMGA 2W11A 2XODA 3FWYA 3UGQA 5BV2P 1JU9A 4DEXA 3PXBA 3Q6NA 4LQCA 5I7RA 3ORHA 3TX6A 1NW6A 2GCOA 2JFYA 2PKYX 1KQNA 4EUNA 2PE5A 1CY6A 2O48X 5K3AA 3KOWA 3WL8A 1Z4JA 3AUSA 5TQ2A 1KIMA 1SXQA 3N87A 1B42A 1Y42X 1QORA 2FMXA 1GD1O 1U2EA 4PYKA 3OZ7A 4UHCA 13PKA 4M0MA 4PO8A 1WHTA 1JDUA 1B6TA 1RM0A 3RG8A 3HNRA 4CM4B 4KMRA 1GGEA 3HCBA 1FZQA 2PL9A 4TQUS 1ZLXA 1ZJJA 3N59A 3WDSA 1KI9A 2Z5VA 4R0NA 4UZEA 1DDIA 4X1OA 2HCTA 3TZQA 1NIJA 1NXPA 2HJRA 2JAUA 2Z2JA 2PRSA 2XUZA 4QKQA 4IO0A 1X2BA 2CXHA 5TQ0B 1RP7A 2PXAA 4P3YA 2HTFA 5IYZA 5HG0A 5HMLA 5IEJA 2CF6A 1QIGA 2AKAB 2PX8A 3I64A 2IEDA 2ATIA 4LYGA 1WUJS 4XEUA 1J7KA 2YNMC 3NTQA 1H1DA 4M0PA 4P36A 5LP6C 4QARA 4B3MB 2I7DA 3BMOA 1MJHA 4DA8A 4YUVA 4EFNA 3ZU4A 2JLCA 3NOQA 4FEEA 2D4AA 5CFLA 4G1MB 2PIAA 3MERA 5JAIA 4EG8A 4EYGA 3DEYX 2A1IA 5I7EA 2AFHA 3ZE9A 4UOEA 1K0UA 1G6HA 1YZHA 1T5LA 1IC6A 3TR5A 1PLKA 2CCJA 1DAIA 3K4QA 3ZCSA 1I10A 2FQWA 1J9ZA 2CNBA 3LA6A 4Y18A 3OX4A 4GU5A 1XZKA 2ZJYA 1SBIA 2V65A 3TAXA 3EVAA 4UEJA 1J97A 4Y1FA 5TB5A 5ADHA 2OQ2A 4MI1A 5GV7A 1UAYA 2P11A 4FD2A 4Q4CA 2BFCB 3IMEA 1F6WA 1TCCA 3LP5A 2XGJA 1D5WA 2BC9A 3NYQA 1GTMA 4G4IA 2J9GA 4PQRA 1T1GA 1BW9A 4F3RA 4NFYA 2C61A 1DB3A 4YAGA 5CXQA 1NP6A 2MSDB 2B61A 2J0EA 2OO7A 2RGCA 3GG2A 3NEPX 1NURA 1PHPA 3EW9A 1DKLA 1XDUA 1YB6A 5IUJC 4TVOA 3FM9A 3SF8B 2ZLBA 3I34X 3R3XA 4MV6A 4P98A 4QNMA 2Y76A 1O2DA 3ZGYA 3OU6A 2R8RA 2W6QA 1TQ8A 5FI5A 3DLHA 1PFGA 4RPKA 5BP7A 1XC7A 2L18A 3AKZA 1IU9A 4DLZA 3PJGA 2AOXA 1ZO8A 3K70D 2Q1TA 3JR7A 4XDZA 4HN2A 3KSUA 5CG2A 5HIIA 4MLDA 3DOHA 1BQ4A 3L40A 1SOUA 1UPFA 3UMSA 4C3UA 1V5FA 3D43A 1PJ2A 1V3TA 4LJ8A 5J5AA 2PNJA 5KQGA 1TAHA 1RP1A 1FVOA 4I9UA 5ALQA 4QLOA 3IPYA 5B7GA 5C8DA 3TWOA 2W6OA 1GGVA 4U39A 5DN6A 5B1SA 4DLSA 1E2GA 3ASUA 3E9EA 3FYCA 2XIJA 4LI3X 4UDNA 4IEIA 1N5IA 5SY4A 2G8LA 3SIWA 1JJFA 2WMDA 3GHHA 3IAM6 4YMLA 4QFCA 3UHPA 3BWMA 1C81A 2HA0A 4I1UA 1RZUA 4JI5B 5A2GA 1NUHA 3TW6A 1RRFA 4JWTA 3IB6A 1GG5A 5EJGA 3IUQA 3GOHA 2QSYA 4OI1A 4ZC1A 1LBHA 4RFSA 3K9FC 4DTIA 3RYHA 3E3MA 2RHGB 3AHJA 5HUJA 3RKSA 4CKEB 4NI5A 1JDZA 2BZ1A 2IGTA 1QQAA 4B31A 1UPXA 3ZI0A 1CEQA 3DT6A 4JQSA 4FWIB 3UXHA 2QY9A 5A71A 5EXEA 1CERA 4LNUB 4MRSA 1DXYA 3GQVA 4HTFB 5BT9A 3SFVA 2QRVA 4FBGA 3UV3A 4BVAA 1QV7A 3PE4A 4F56A 3RIYA 2OFWA 3CX3A 4YMHA 3UMRA 2PMEA 3BQMB 3GCZA 4URYR 3GEIA 4OQLA 1OLOA 5BNZA 2GHTA 3TCXB 2Y8EA 2Z2KA 2DAPA 2HBYA 2QX6A 3QA9A 4TZ6A 3M6UA 5DSZA 1UKCA 2WHEA 3FWZA 4EUEA 4R9VA 1HTBA 3EJ6A 3R6GA 4NV0A 1X8LA 1GUDA 1M2OB 2NT3A 4E94A 1U2TA 2IZZA 3TNJA 4I55F 3KEOA 2DFTA 4HGQA 1GGMA 1E0JA 3TDMA 1G5HA 1KU6A 1V1MA 2FKNA 2ZOSA 4QFDA 4X9XA 4EUHA 1XLWA 2ZULA 3AUYA 4IJ6A 1M2VA 2ZKLA 4MVWA 1Q0QA 4QO7A 4WVLA 3W8EA 3AFGA 3O8RA 3PQFA 4LHXA 5DN6D 1LDBA 1AXRA 1E1YA 2WJWA 4D6YA 1D3AA 4C88A 2D74A 4U5XA 4FSXA 2CE2X 1B41A 1CUSA 4PS0A 3QNWA 4WI1A 4AP5A 5KYXB 2O5EA 4TTPA 1MAWA 5HQ3A 3CISA 3OX3A 4C6RA 1T2FA 2VH1A 4E22A 1OHHA 2XCRB 3L82B 4YP7A 2AJDA 3MWYW 2Q29A 5ALIA 4X7RA 2ILTA 2GO1A 3EMVA 5HKLA 1UM9A 4EJ2A 5GONB 4NBRA 2QN1A 3CY6A 4ZU1X 2P91A 3T8YA 2Z83A 2J6BA 2QD4A 4UBKA 1SQ5A 3RAPR 3SX2A 2L42A 2CKMA 1MKYA 5KAPA 3ZLTA 3OMXA 2C9YA 1LDNA 5C7LO 3OFKA 4X41A 5BQOA 5CLHA 4MTLA 4QYIA 4QGBA 2WIBA 5ECYA 3BFVA 3NGMA 4LHZA 1A50B 3U37A 3QY9A 2V74B 2FX3A 5TPZA 3K1AA 1T4GA 5D84A 3IXLA 4H1UA 2E18A 2BFAA 1PJ8A 3GU3A 1XZNA 3E8SA 3DEZA 5TIIA 1D0SA 4QGFA 1B76A 3VDQA 2I55A 3TZCA 2CJYA 2ST1A 1Q0HA 3AF3A 2EARA 3ZEIA 1PJQA 3QK7A 4PBRA 1BVHA 2FVYA 4WXHA 5LYJF 4TLMB 1PR6A 4F5EA 1IL0A 5DI3A 4ZYWA 3IOCA 3DHNA 1E5LA 2GN8A 1F6BA 1W2WB 1ZW6A 4TX1A 5JRZA 3PFGA 1MH1A 1OU0A 1XZJA 2ZRAA 2GB4A 2GF2A 3SC2A 2WEKA 4CKBA 5CVTA 5FPKA 4W1PA 1MVOA 5AO9A 4G0ZA 3U4HA 4OH1A 1BVYF 1OX4B 3LRPA 4NYJQ 3LW8A 3R7SA 4JP5A 4MDEA 1Y6JA 1N36B 4KQHA 4OCZA 3LAWA 3I92A 3UTCA 1W8IA 1BGXT 3QG1A 4R2WA 2O6HA 4BEWA 1BNCA 3A1EA 3FVWA 2E0IA 4EW6A 1QH8A 3CT4A 1UIMA 4JWKA 1A5SB 1LQUA 3GGDA 2YWRA 3RM3A 4EKYA 4BMDA 1IG3A 1W1UA 2J0SA 1J8DA 3JQ9A 1XNRB 4GZMA 5J59A 3DDZX 1ADBA 3NWEA 3ZE8A 3D1VA 1EUDB 2JVJA 4OI2A 3F6BX 5LNK1 3I5AA 3C3XA 3OCZA 4YDHB 1NYRA 2HAEA 3ZGVA 4RF2A 4QTYA 3RIXA 5DOVA 1FDVA 4ZMRA 1JDSA 1REQA 5FBLB 1T4BA 1VDMA 3V34A 1K97A 5LQSA 1USUA 4YCCA 4KNWA 4K9MA 4YRZA 1QTRA 2O3RA 3EPHA 1A1VA 5AHWA 4D9IA 3KALA 1IOZA 4QYWA 1KSGA 1QZXA 4F9FA 4BIIA 2AG0A 2QOEA 3N39C 4EJSA 4DARA 3HUFA 4OSPA 2H5IA 3H1PA 2V9ZA 3BJRA 3M82A 4ICIA 3IJRA 4KPUB 1DDOA 4N49A 2GAAA 1CEXA 1ZKDA 2X0KA 3MG9A 5FL7A 4LF5B 3RVPA 1V2HE 4W4TA 3GPLA 5JADA 2ZUTA 1U94A 2J5BA 3SHWA 2VNIA 2B30A 1JHMA 3GA7A 3CLTC 2O05A 3GR6A 3ME5A 1T4CA 5T67A 5CIYA 1PV4A 4TMXA 5I01A 1ID8A 1SIWA 4LWZA 1NFFA 1ZOIA 1XFAA 2F48A 4LJYA 1CNFA 3UICA 3W77A 1Q20A 3FIUA 1GCUA 2VQ3A 4ZANA 2QTAA 2IS2A 4CTMA 1ZDMA 3K6SB 1FRFS 2OCPA 3IJPA 5M2QA 1YIDA 2PX6A 2RSLA 4PGGA 3ZJYA 2RGUA 2PDAA 2ZE8A 3PPXA 1UOEA 4R8LA 5KMGB 5D3ZA 4HWPA 3EPPA 3BN3A 2Q3EA 2GAJA 4JZKA 1DKOA 2G1KA 3DMGA 1EK1A 1VE6A 3PR1A 5NLLA 3THOA 1WMBA 5I4IA 3CTPA 2WAOA 3ZZUA 1PJAA 2K4MA 5CXUA 2A0WA 1WZNA 1AN0A 3HB7A 1T9KA 2BE7A 4Y30A 4WINA 4LMPA 5DRTA 5EPUA 3UB2A 1HR0B 4XPIA 1VFPA 4Q4AA 1SURA 1HQKA 2ADMA 3H9EO 4LWOA 1MX9A 1IBLB 1XV5A 3A6KA 3G2QA 3OJWA 2J0VA 5CTAA 1DZ3A 1JEQA 3JAWB 4P7BA 3H1AA 3T1NA 4F8JA 3EMBA 4IIHA 3ZWQA 3Q5DA 4ZAVA 4A8TA 4AJJA 1XTVA 2NGRA 3H19A 2ZYSA 4UU0A 1SHTX 2EHDA 4UMDA 2L69A 4ZV9A 1X1TA 2KBFA 4KI7A 3I8XA 3GH1A 3QFFA 2E1PA 1Y9EA 2V9PA 2JLZA 1G1AA 3NR2A 1IWBB 1NRXA 4JGIA 4M6WB 4XQEA 2R66A 4MW6A 3MLAA 3P9QA 3CKLA 4QD3A 2AOTB 3KKOA 2IYRA 1VJ0A 3FTQA 3K9QO 2VHCA 5C4GB 2IUSA 3WNBA 4DCPA 5KNDH 3ITKA 1AS0A 4R2MA 4YASA 2K6GA 4MO9A 4MUIA 1E3SA 4NNOA 4QTXA 4R6XA 4J0HA 1E4OA 1KZ1A 2KW5A 4QOHA 2ZQYA 1RXSA 3N9IA 1SVKA 4YAFA 2HHLA 2LE0A 2JFQA 1H1LA 1SVSA 1UDAA 4Y2YA 3Q8KA 2Q46A 4AZ0A 1E59A 1COWD 2PO7A 2OAEA 4XLTA 4XYMA 3FWPA 3B1XA 1XZCA 3DKIA 3SG0A 4DG9A 5B7NA 6Q21A 4EB6B 3N3AC 4QEZA 2BGRA 2B3DA 5AVSA 1KC1A 1L3CA 3LCVB 1JLSA 3HJHA 1CULC 3PDCA 1DRKA 1XPJA 5DE3A 3RWBA 4RMIA 4Q9IA 2IKSA 1DFGA 1P9LA 2H2HA 3TZEA 3UFBA 2JJ2D 3V2GA 1ZEJA 2OTCA 2X42A 1D2RA 2P9BA 1EFCA 2HCFA 2O5CA 3LYLA 3L6DA 5BWBA 3RS8A 2WJVA 1MEJA 2A6PA 5EWMB 4DRXB 1GA4A 4NU5A 4ZT6A 1OGIA 2HDHA 1MZPA 1N9KA 4UE2A 5FWNA 2XTAA 3KWFA 5EWJB 3MYYA 1E9DA 1F5SA 1F4VA 1NBIA 2D1QA 3RUEA 1J09A 3WLMA 2RGEA 4B17A 1HGXA 1RJGA 1MD9A 4ZZ2A 4OHFA 1Y4ZA 3UWOA 4MW1A 4RCZA 5AHOA 4RIIA 4DANA 1W1WA 3LOUA 2IYVA 2W22A 4NMWA 1V71A 3LP8A 3PHLA 2WSSA 3RJMA 4F06A 1XKXA 4YIHA 3OFJA 1K7SN 3TL3A 2R00A 4S1VA 3RVDA 2YXLA 1AH2A 1T6XA 3CUEF 2REBA 2WU4A 1G8AA 1HURA 3MCZA 1QYVA 2I5PO 3NVMB 2HIHA 4OB7A 2C84A 1GITA 2MINA 4Z53A 4YX9A 2GM9A 1C9JA 4IYRA 3REGA 1G20B 3SJBA 4CKBB 3E9ZA 3ENWA 1GL3A 1CY7A 4DMRA 1IE3A 4RMNA 3P9CA 4HH1A 3LKVA 2Y1OA 1ZXXA 2R8OA 1NG9A 1FS6A 4NMXB 4H6WA 4LVCA 1UJCA 1GU0A 5CYPA 5ADVA 5A9SB 1DG9A 1HTWA 1E60A 3CHYA 4Q3AA 1SXJA 1R66A 1Z74A 2B1JA 4NKRA 4RY0A 2YBEA 4M1YA 2OHXA 4YR9A 3FTEA 3K5HA 9LDBA 1U3VA 2NQ8A 2AI1A 4EZEA 4RVGA 4X44A 4ZCSA 4OQMA 4UD6A 3HA2A 3MVEA 3PRJA 4FR0A 1CUGA 4ER6A 1M33A 5CBPB 3RE1A 1WW3A 2VQSA 4Z7NB 1TIPA 3LWZA 1LWOA 1F3LA 5CU7A 2XKAA 4MK4A 2CSXA 4XFDA 1TZCA 2UYOA 1EJ2A 3Q6MA 1SG0A 1GLGA 5A4IS 4W6ZA 2J85A 1KA9H 4JEIA 1Q11A 3R0JA 4G5HA 1OXVA 3FBTA 1GZ5A 3IT3A 2HB6A 3FG9A 4I3HA 3I2JA 3NCHA 2XBLA 4U6SA 3WIDA 3JPWA 4UXJA 4RK7A 4BNVA 3TJZA 4NXNB 1QU2A 2EBWA 3CB4A 2WY2D 4Z0TA 2FSPA 1YK1A 2DR3A 4QUIA 4Z8YA 2XQJA 4LXYA 1H42A 5A5VA 2WTXA 2ZR8A 2NQ2C 3PVCA 3X1JA 1L7XA 1Z39A 1DG1G 1HLFA 2Q6VA 4KPUA 4RSMA 3IPXA 2D00A 2NTVA 1LSUA 2KLBA 1XQVA 1M34A 4FDMA 3A31A 2OCDA 4IDFA 3BS4A 4KWIA 4FKZA 3DT8A 2C5BA 1WMAA 3F5SA 3MELA 4CTJA 1MGPA 3P9XA 1W4ZA 1FRQA 1TPZA 1OZHA 1RZVA 3OICA 4MV8A 1LPAB 4RY2A 5FA6A 1RAFA 2PH5A 4K3VA 1BU8A 3PUHA 3NHJA 3LKDA 1Y8RB 5ESDA 1FEZA 1M2OA 4I1YA 4QU8A 1BE8A 1LPBB 2V6BA 3EFEA 3FPAA 4II2A 3SF8A 1EG7A 4Q1AA 3WI7A 1RHKA 3AL0C 1QQ6A 4FHGA 3FOBA 1UZUA 2WZQA 4LF4B 3RADC 4L6IA 1GAEO 1OYYA 2JANA 2G82A 4YPOA 3UJAA 5HIKA 4YT2A 1UOOA 5IU6A 3W5IA 3DZIA 5JZOA 4R69A 2W9XA 5JNRA 4J91A 1V5GA 1J2EA 1YQQA 1QQTA 1UF9A 4M9UA 4ZXPA 2QP3A 5HA5A 2M6LA 4AIIA 4D6XA 5AVYA 5LFAA 1U1FA 3G0IA 3GOQA 3WMRA 3GPBA 3LYUA 2OZPA 2PXCA 1XQXA 2IXBA 1SKAA 3RFFA 5IC6A 3O9VA 3DBHB 1CUAA 4L5JA 5EZ5A 4NYIR 4YRBA 5KNCH 1QU3A 4IDEA 3CZAA 2CUNA 4LDPA 1D09A 4W5RA 3LBAA 3IP1A 3OCCA 5H16A 2WOOA 2YFHA 1MZVA 2C83A 4GI3A 3D8SA 3KOUA 1XNGA 4IV5A 4QTTB 1YS7A 2RGRA 3HYTA 1WEKA 1NPYA 2RGGA 1K7EB 2HWKA 3LGSA 3R41A 2AK3A 2OBXA 4ESOA 1JWLA 4ARUA 2ZYUX 4H7IA 4H0NA 3ESAA 3TI7A 4PQFA 5BW8A 1MT0A 1LCIA 2I2DA 1CFZA 2FF5A 2XWBF 3T5DA 3C15C 2JFHA 2WE8A 3DNMA 3RF7A 2WYOA 2NZXA 5ALZA 4AKTA 4UHDA 1YXMA 3R3ZA 3IUNA 3EYAA 3HKEB 1TZBA 4BVLA 1R8JA 5FUQA 5F78A 1QAQA 4NICA 1KYYA 5DI3B 2FLKA 2XVZA 3GVCA 3S68A 1EFUA 1QIEA 2ZJ3A 3M70A 1OVMA 3Q41A 2UVDA 5SYAA 4FEGA 5EIXA 2WNSA 2E9SA 5KTNA 1IN5A 3C0KA 3HDVA 2IHUA 4KFTA 2FPKA 1JHAA 3IBGA 1EGVB 1FE8A 3MM4A 4J2TA 3B1FA 4E21A 2Q4DA 3GNSA 5HKBA 1UFOA 1OB5A 1ECPA 2PX3A 3BK2A 1R5NA 4C05A 8ABPA 4IRMA 1O57A 2FZEA 4MGYR 5JMTA 2JC3A 4C5BA 2HHJA 2WFLB 1XEXA 1U0NA 1BN7A 2R5WA 2XTNA 5B3LA 3AI2A 4M1OA 5CM9C 2A1UB 1QYXA 2GN4A 5L7YA 2JGDA 5THQA 1IJEA 2XMZA 4XW2A 1NP7A 3SGLA 5JJ5A 5DNYB 4LGMA 4GP6A 3G1WA 2G07A 4DIKA 4YCAA 1RW4A 3DL4A 1PAUA 3G8DA 3MQ2A 2G63A 1GN8A 3FVTA 4P3OA 1JQ3A 1I24A 4TRJA 1TUIA 3S2FA 2ANCA 3AEQA 3DDCA 1RKBA 2P75A 3HL4A 2X6TA 1A2OA 1ZGHA 4PYNA 4DUYB 1T36B 1LDYA 4IOLA 1FIUA 1BDMA 2C97A 2WU3A 2FPGB 1GUYA 2V3VA 2XCUA 1UDWA 3L6BA 5AJYA 1QKJA 4FGWA 5EMNA 3TCNA 3TIVA 5ABPA 5KB3A 4F2HA 1E8NA 2ZJOA 1MX5A 2FWAA 4UVIA 1HI9A 1VSQA 2EEPA 2J48A 3HR8A 3RKRA 4BQSA 4YRKA 2I4RA 2BLNA 2SBTA 3KJQA 5DHTA 2OORA 4DA9A 4RKEA 2C4MA 4PBTA 1IIBA 1X1BA 1R4AA 5U4XA 1IHDA 2QN8A 2YZKA 1K89A 5AOCA 1H4TA 4M1KA 2RBKA 3WLFA 1ECLA 2D1TA 4K03A 3D7SA 3UMGA 5HTKA 1RPAA 1OFTA 5KDOA 1IY8A 1S1CA 1TYDE 5DYGA 4UAGA 4IOJA 2Q7XA 4DCSA 4Q12A 3W5VA 1EZZA 4Y2HA 3ZXXA 2V8BA 1CIPA 4NAVA 3VYRB 1IBKB 5A3QA 4U3JB 3KC2A 5G3ZA 3N5CA 1BS9A 4OQNA 4QRHA 4XVRA 1GZUA 1PDVA 2V4ZA 4Q3BA 3UANA 5ALDA 3QVUA 3PJFA 2F64A 5CK4A 5EXTA 3CFYA 1P77A 2IPOA 2WW8A 3Q9LA 4FNMA 4WDQA 1M9NA 3JYQA 4WZAE 2E4XA 1G7RA 2RG1A 2XB2A 4UVGA 2XAAA 2ZS9A 2AG6A 1Q83A 3Q3GE 4H7HA 1OUMA 2I6TA 4ETNA 1NNI1 3B7WA 2QAGC 3Q7TA 4RLSA 4RVNA 5ECWA 5AUNB 5F3RA 2XXAB 3X1WA 2ZJ0A 4X6XA 4FI3C 3QBVA 4EX6A 1QIFA 1Z9BA 2P9FA 1MGOA 1G7SA 4QTUB 1DE0A 1BOFA 2RHMA 2ZSUA 4URWR 5AW7A 3HYLA 4XQGA 3PDUA 3B2QA 2BFPA 1U8AA 2YVKA 1H8HA 1GNQA 1QIIA 1RBYA 1P9NA 1A8SA 2EHJA 2YJNA 2WFLA 5I6DA 1K5HA 2F67A 3IAS6 5CGQB 2WVJA 4QHSA 3FCEA 4A16A 3M5PA 4I1VA 4PSVA 5CDTA 2WMNB 2EZUA 2OVBA 3FTDA 4L5BA 1GNTA 1MO5A 1RZ3A 1PZFA 2JHCA 2W00A 4I3FA 5IJ0A 1YZVA 5JASA 5K8VA 5LXTB 1EHYA 5GPBA 5CB0A 2INGX 3L84A 1U6KA 2OBFA 3D2BA 2ZB2A 3LX5A 4EPVA 1Q7EA 1G3UA 1SWVA 4LZLA 1XMVA 3PUKA 3QTLA 5IN4A 4PC3A 1R6BX 5SYMA 4BLQA 4JJIA 4XA8A 5F73A 1JDBC 4YJFA 2B83A 3QVOA 5JANA 1HMPA 4UOQA 5GGXA 2DFKB 1SVIA 4MXDA 3TS1A 2H00A 2AWNA 2C2GA 1EI9A 2QSUA 1Z7BA 4L6AA 5BR7A 3K5IA 4OL0A 1XCGB 5KYXA 1BS2A 3ABQB 2GHRA 1N5JA 4ND6A 1RI2A 1SCKA 2NU8A 3G5LA 1K75A 1IY9A 2PT5A 2E1RA 4A1OA 4D4KA 2YCBA 2C5LA 4Z4CA 1XXHB 3D8BA 1H2EA 3QVKA 4O2BF 4V0ME 4YCJA 2W5UA 4CMKA 2YIDA 5IXJA 4HDCA 4NYJR 4C6SA 2AS0A 3DV9A 1KDZA 2OL4A 2P41A 3AU9A 1E7QA 1XK6A 3ICCA 3NWPA 5KREA 4NJOA 4A91A 5JLJA 2DLNA 4K9NA 3IA2A 1W36D 2VTBB 2JK1A 4G85A 4FIZA 3K6JA 3OCUA 3EG9B 5C8XA 4NCHA 3R9XA 3N2YA 1YB7A 1OTHA 5T4BA 4RY9A 4YY3B 5BMVB 2Z6VA 3AHFA 1ORTA 4M87A 1WOYA 2BDEA 3NOXA 4OJTA 4QUAA 4AN0A 4DCMA 1NVWQ 1FP6A 4X62B 1X87A 1JEAA 4H6PA 3VR4H 2BMWA 5HBRA 1NN0A 1M7BA 4WASA 5BT8A 1R16A 2OILA 2P79A 3ISJA 4KGZA 4MDYA 4PTZA 3R7BA 1UIRA 3RW9A 1YIOA 2PZ8A 3IR5A 3ZCXA 3ZDEA 1U2QA 1YA4A 1YZUA 3EYWA 2HHAA 2IL1A 3HKDA 4YRMA 3DPSA 3ZBTA 2IITA 3HJNA 4YTEA 4EEXA 1J2TA 3OZWA 5BOSA 3S2ZA 1KJIA 2UDPA 1M5TA 4NK5A 3L49A 2D2EA 1TVMA 3BG5A 4ROTA 5CR9A 5A1TA 3RVSA 3GT3A 4H4DA 2H3HA 4ZOBA 3PNLA 3VISA 3FYUC 2YWFA 2C59A 4F92B 2EKZA 3FX2A 3S6JA 2JGKA 5JXGA 2CK3A 1N2BA 2ZR7A 3BCHA 3SE0A 4R1NA 5HS4A 3HUEA 1LH0A 1M2JA 3BZUA 5AI6A 4OMDA 3PJRA 4LTDA 1PWEA 2TS1A 3W5JA 5DW3A 2HW8A 2J30A 3N2GA 2X1LA 5BOVA 1ODIA 3WYEA 4CM5A 4CFSA 4N65A 1E5XA 5ILGA 1LTQA 1KE1A 2IHKA 1A4UA 4XD7A 4M8LA 5H68A 1OBCA 2XUJA 2HYDA 2XAUA 4B0PA 5KKCA 1R0BA 3W4KA 4EKNB 2ZT8A 5EKSA 4WA7A 3OQBA 4MDFA 2G06A 1BMDA 3WIOA 1RYDA 4TV8A 2HNBA 1E5VA 1C8VB 4Q9LA 1D9XA 2ZVQX 2G7MC 3VC7A 1E2QA 3COWA 1J70A 4UU7A 1O94A 3B9BA 3BHMA 4OHVA 5KYKA 3B2NA 2WICA 3ZI4A 1N8TA 1WP4A 5ALWA 3CW8X 4A9AA 2CLOB 2FWIA 1CQIA 2D7CA 3BWDD 3N07A 3QFTA 1QYRA 2F8LA 3MS2A 1H0KA 2ZQZA 1XVTA 3M4ZA 2IPLA 4PZEA 3UYLA 3VR2D 4OKSA 2O4CA 3DO6A 5AJZA 3GJ6A 1I7NA 2PRKA 4DPKA 2CVQA 3C3DA 4UHKA 1CUWA 1GLNA 1UH5A 4Y6QA 2JCSA 4JHLA 3O4HA 4UW9A 1QRRA 1XZAA 4JBLA 4EDHA 5JQGA 2QRKA 2K87A 3Q0IA 4IQGA 1UZAA 2NUPA 9GPBA 2WAXA 3BTOA 4H7PA 4GI1A 2VR1A 2PGLA 1MB9A 4N5MA 2IK8A 3QFHA 4GL4A 4N48A 1H1TA 1OI2A 3D31A 4KCGA 4H3HB 3RIHA 5JWRA 3PXGA 2OHHA 3OPMA 4R71A 2A5DA 1XK7A 1PEDA 3KZKA 2BMEA 1TQ6A 1P44A 4AQ7A 3ZDBA 2EYQA 3UC5A 3K6RA 5KVCA 3EC1A 3WVNA 1CUFA 1XF9A 3OZDA 3JCZA 3WICA 3NTVA 3I5UA 2VHZA 3HWWA 3IQIX 3UF0A 5LPNA 2RKWA 3NGXA 7ABPA 3CTMA 1CKEA 2Z6AA 1RRCA 1HEYA 4LJSA 2OT3B 3UK6A 1EM8B 3RUCA 3NHSA 1U65A 3EY4A 2NU7B 2IEYA 1TM2A 4JFRA 2FUKA 2QTFA 1N5LA 2R751 1BCSB 5EMJA 4ZEXA 3TIGA 1U3UA 1KY4A 3NP7A 3TRDA 4IR7A 2GJ8A 3JD0A 3L7LA 4OKIA 3UJ8A 4E12A 1KI1A 2CHFA 4IG4A 1YL5A 1CUXA 2BEVB 4Q4AB 1PCXA 5C5IA 4NK4A 4C7OA 3R40A 2VHUA 2YC4C 1QV6A 4LNUA 1D2GA 1ZP6A 1ZMXA 3O7WA 5KTTA 2PR2A 2BOVA 3BRCA 4JC0A 1O08A 2Z2ZA 4C03A 2YJZA 2JIBA 4MJXA 1KBZA 3ELYA 3EXHB 4R6WA 5I9LA 3QU9A 5LCXA 2NPFA 1V16B 4HNTA 2ZI4A 4LSMA 3PENA 1CZNA 4C1BA 1NVFA 2ZROA 1W87A 4X1IA 4XYLA 3HN2A 5CBPA 3LBIA 5KPJA 5HQJA 2IXGA 3UWDA 2XSZA 5I4CA 1XNJA 2HHCA 3LDUA 3LSYA 2MYNA 3BCSA 4LQ4A 5B2ZA 4P4NA 3T7CA 3ZG6A 4AZ3A 3OOEA 4B6GA 3GVPA 3T7RA 3A4MA 4RFLA 1G8JA 2EL9A 4LDQA 3NKFA 2ORWA 1OLUA 2XE4A 2FMFA 1EP1B 2C7BA 1LLQA 3W3AH 5FULA 3IIIA 4RM2A 3I5MA 3B78A 4UFOA 1NW3A 1D5CA 1JR4A 3JQAA 4GO1A 4LIPD 1FDSA 4EY4A 1KXZA 3T9EA 4I8XA 1NBHA 1YACA 1Y81A 3RASA 2AJ8A 3AUAA 1RWXA 1SHZA 1MQAA 4QBFA 3SM3A 3JVIA 4V0MA 5AM2A 3LO8A 1UC8A 1Z16A 5CB4F 1GAJA 2RHOA 4BMCA 4RGYA 3CA8A 5G02A 1VC2A 5IFKA 1E3IA 1WZUA 5K5EA 1I7DA 2YASA 1ODFA 1TKCA 2YHIA 4CG0A 3PX3A 1UXGA 2ZJ4A 3LXUX 1HWYA 4B7AA 1KWGA 4JBNA 1P73A 1WDMA 2VYVA 1MJ5A 1Q7RA 1UBGA 2IUTA 2GXUA 4Z1MD 5C46F 2COEA 4EGQA 2WLSA 3EXIB 2ROQA 3K9GA 5L3RA 2I1QA 1VPEA 1C9YA 4RVSA 1KZGB 3D7KA 3FCXA 1W0CA 2RDMA 4FFWA 2GNOA 3DP7A 4GPTA 2EZTA 3S2YA 3VR4D 1QCYA 4LF6B 1LPSA 2RJOA 4EHLA 4UOZA 3E05A 1EB9A 5BSGA 1UJMA 1YE5A 2LZ0A 3NHFA 5D86A 3PUZA 3VOSA 4QNRA 3DONA 4X20B 3BL6A 2PL3A 2WHPA 3IEKA 4U7TB 1GTZA 1O1YA 1EVEA 2H0QA 3B9RA 4G1UC 2NAPA 4D96A 2A14A 3F67A 3I6ZA 1JDNA 4UHBA 1EWQA 1WQ3A 2V5VA 1PQWA 3B3FA 3EWIA 2XB8A 2GZHA 2JCGA 3A1VA 4J0GA 3DF9A 1D07A 1ISGA 1VPDA 2HU5A 2VKTA 3PF8A 2WJZB 4F46A 5EKXA 1ESCA 1T0UA 1XTQA 3DOJA 4JOCA 3GLHA 4EG5A 1VYVA 3ZW9A 3QUBA 5B58T 5J1SB 1FSGA 3JX9A 4BNYA 3E1KA 4LDZA 4X00A 2PGXA 3X1MA 1H6DA 3ZXUB 1XA0A 5GM1A 1P7CA 4DNQA 3DQPA 4GX5A 4GC9A 5CDSA 3DSRA 1NE7A 4BMNA 2ACVA 2XXBA 4BECA 4JLDA 4OYHA 5CRIA 3C43A 3WXBA 1IZZA 4PPNA 3C4JA 3IUEA 4CT4B 3A0RB 1DKUA 2Q3CA 5HCUA 4ER7A 3LVFO 2CBZA 5KOYA 3T1YB 1A0OA 3HU3A 1VCHA 3SNHA 4F9TA 4LF9B 2OG1A <