1RRGA

Non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, dimeric crystal form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
177
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords RAT ADP-RIBOSYLATION FACTOR-1
total genus 53
structure length 177
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrgA00
2W2VA 1Z3IX 2WIBA 4C0LA 1XEXB 4GBMA 4CEHB 2DFKB 4RD1A 1Q1ZA 1QHXA 1Q0UA 2NG1A 2CHGA 4AG5A 2VHCA 4JLDA 1CJTC 4LYHA 2GAAA 2P0EA 2UZIR 3SZRA 5CDFE 2FSIA 3DZDA 3VR2A 2OFOA 2Z6VA 2UZ3A 4HLQB 1ZM3A 1GIAA 1E98A 1P73A 4YXWA 2OUKA 4I1UA 1OFIA 4DEXA 1FMLA 1ZJ6A 4HEJA 1DO0A 3D8BA 3QKSA 4K8OA 3OAAA 4PZYA 1K6MA 1CU1A 3AM1A 1E99A 4PQYA 1HT1E 1X3SA 4KAXA 1KSJA 3WMEA 2VP9A 4TL7A 1MRNA 3AVYA 2QP3A 4JVSB 4N0EA 3ICQB 2P65A 3HU1A 2DR3A 5AJZA 1P9RA 1DELA 5TXGA 2ZI9A 3B85A 1G19A 1S3GA 2KB0A 4B73A 2XSZD 721PA 1N6IA 1QRAA 1OYYA 3KUDA 2AFHE 3HYRA 1Z08A 2GJKA 1R10A 5HPYB 3QBVA 5F9HA 2H57A 3IHLA 1HV8A 5BXQC 4XWAA 1J8YF 2GAOA 2HLDD 2ZI4A 3H84A 2C2HA 3DOEA 2YC2C 4NU0A 4NL4H 1B23P 1G8FA 2QMHA 4Q1FA 2IYLD 2GRJA 3BXZA 2OM2A 2XSZA 2ZE6A 3C7KA 4TL6A 3TUIC 3E1SA 1IAQA 4B3DA 4W7SA 4C30A 4HATA 5DYGA 2OCPA 1E2MA 4AKGA 1MR3F 5DO9A 1NNEA 1WMSA 1IN5A 3WRYC 1DOAA 5B30A 3DMDA 3V4FA 1QDEA 2QI9C 3T5DA 1E2DA 3U7EB 1WDTA 3AUYA 1TEVA 4PC3A 4WA7A 1GKYA 1G8YA 3P20A 2WJGA 4GDFA 1N6LA 3RC3A 4M9SA 1E2LA 3VR5A 2F1HA 4KXFB 4IRUB 1YR8A 5HE8A 2HT6A 4NYMR 1G5RA 3PEWA 3ZS8A 1X8LA 2W0MA 4RFSA 3ZLJA 2XZLA 4Z8YA 3RHFA 1E9AA 2WHXA 2VYFA 2GJ8A 4OQLA 1U90A 1TTTA 3F5FA 1AS0A 3GJ5A 4L9SA 1AIPA 1WA5A 1VMAA 2O0JA 3GJ8A 4F93B 2CK3A 4TWZA 4E5UA 3U44B 3GFTA 1MABA 2ODBA 1W0JD 5JEDA 1RRCA 4OQFA 1TU4A 4G1UC 3TIFA 1UFQA 4RKEA 4B3GA 3VU9B 2VSFA 1EX6A 2P2LA 2WKRA 2GK6A 4YQFA 4E09A 4MYUA 1SHKA 2QSYA 4JZKA 3U6KA 2O8CB 1AGPA 4B43A 3M6AA 1WXQA 3EIEA 2VEDA 4LHYA 2QM8A 4M22A 3PEUA 2IA5A 1G5TA 4IDNA 2WJJA 2GXAA 1E9RA 4JVMA 4EDHA 2JGNA 4WXRA 1JR6A 3CWZA 3VHXA 2VHQA 4LZZA 4C0JA 5L3VA 2WWIA 4PPNA 4IHQA 1G20E 1FX0B 3OFNA 4N3NA 3T35A 3BFKA 4L4UA 1M7GA 1CJUC 4FI3C 3PVSA 4MA4A 1E2KA 3CRW1 2GZAA 1IM2A 1NY6A 3BBPA 2EWVA 2H18A 3QXXA 5CITA 1GL7A 4D4KA 3AKEA 4CZ2A 2ZRBA 3FKSD 1GL9B 2R65A 2H5EA 4AURA 1KTVA 4HYYA 3F3YA 4QJ5A 3W8RA 1BS1A 2PZEA 4PAQA 1OLOA 2WPDA 3T15A 421PA 5AJXA 4MKFA 3DPUA 4MRNA 1R5BA 2D74A 4LJ5A 1G3MA 2OCYC 1ZCAA 3WMGA 4OHWA 4CIDA 2O8FB 3G82C 1W1WA 4IFBA 1KKMA 3W6NA 4A0HA 4BLPA 1NVVR 1S9DA 3SJCA 1QF9A 2ORVA 2AK3A 2XJ9A 1XMVA 1SVWA 4Z51A 1G7CA 2P3SA 2QE7D 2BMFA 3MJHA 4I1OA 2WJHA 3QKSB 4QOSA 2EYQA 5HTKA 2KSQA 2ZYTX 1L4YA 2A2ZA 1DTSA 5BYKA 4TMZA 5JECA 4OHZA 3KFVA 4Z1MD 3ZYCA 3BB4A 3PUZA 1Z6AA 3C4JA 1BH2A 1M2OB 3PUXA 4YMTA 2WJYA 1E9BA 3CM0A 1JEDA 1FUKA 1VCMA 5SZHB 4GNKA 3RS0A 4URUR 5K8LA 2QORA 4KSBA 5FOWA 5AUOB 5F3WB 2O8BA 3IPYA 6Q21A 2W0SA 4V0LA 4DJTA 3CH4B 4GSYA 2NZ8A 5EE3A 2CCGA 4PC2A 4DWJA 2GETA 1TPZA 2O0HA 5EE1A 2C99A 4PPFA 2V7QA 4TL8A 3SBEA 3SNHA 1G18A 1TF2A 3Q9LA 5JBQA 1N0VC 3K8YA 3LX8A 3C41J 2RHDA 4FMCF 4IVQA 1DBSA 3LWNA 3UG7A 5FI1B 2BC9A 4M21A 2QU8A 2CMKA 1CR2A 2XTZA 2MSDB 3OZXA 1DE0A 1YJ5A 5CB6A 5L3QA 4HDOB 1QHSA 2GTPA 1QG2A 5A5GA 2ZU0C 4RCZA 2OLJA 5M04A 2OXCA 4QG7A 2V6JA 2KWIA 3X1XA 2JJ8A 4KSCA 4XSHA 3FE2A 1W48A 1TQ6A 2VHUA 1OB2A 5FH9A 1GG2A 2NO6A 3AEZA 2AD1A 5FPTA 5ELXA 4RZ2A 4EAQA 4JLVA 3PUVA 2QAGA 2WIAA 2BJVA 3BB3A 4NHOA 2RH5A 3AF1A 4YMWA 5EE5B 5HCIA 1E0AA 4NYIR 3MWLA 5B58C 5FOSA 2YZ2A 5DSZA 3PENA 3GMTA 2DHRA 1KGDA 1W4CA 1C4OA 2OCBA 2FFBA 4PC6A 3SDZA 1T4GA 1IN7A 3TSWA 4RSGA 3BH6A 4R2HA 2A3RA 1O87A 5EXPA 5C4MA 1U0JA 2IYVA 5E95A 2GBLA 1DARA 2QPOA 3NH9A 2AWOA 2IYQA 4NONA 2GNOA 4E03A 2K5UA 2Q9BA 1W0JA 1JPNA 4QRHA 1Z8FA 3CO5A 2QAGB 4QNMA 1D2EA 1DAIA 4DCSA 1CRQA 2REXB 3NG1A 4FD2A 1T8UA 4DC9A 3M4YA 1XX6A 1P9NA 2V7QD 4P33A 2J0UA 1NJFA 1YZUA 4XH9B 2JATA 1N6NA 1KNXA 3GJ6A 5JCZA 5DI3A 1M74A 2KI5A 5FPKA 2A5JA 1ZNZA 1P62B 1Z6GA 4B6EA 1UBEA 2F6RA 3MLEA 2CDNA 3GP8A 2JLYA 1A2KC 3SN6A 1RZ3A 2J0UB 1UKVY 5FL7D 2VRWA 1XMSA 1OV4A 2QTHA 4O0MA 4R98A 4A8JC 3H86A 4QJ4A 1ZU5A 2D62A 3I72A 3TQCA 1LY1A 1Q57A 4BECA 2XXAB 3ZVLA 4NBSA 1G21E 2YWFA 1PUJA 5EUQB 4QM7A 2ZUBA 1JAHA 1RRFA 3FKQA 4DLUA 4MITA 2IYYA 3DKVA 1NVUQ 1FQKA 3IBGA 1II0A 2FF7A 2PT7A 3ETLA 4JL5A 3HDTA 3UXMA 2O0KA 1JXMA 2IYWA 1Z0IA 2CLSA 5J4VA 1A2BA 4XTCS 4LUCA 5AUQA 4EPYA 2BOVA 1KI4A 1KMHA 1R0YA 1RRPA 1FQJA 2RMKA 4DXAA 1OH7A 3EPKA 1NVVQ 3CX7A 1Q1BA 3U3MA 1IXZA 1S9HA 4D4LA 2H7VA 1G9XA 3RS4A 3CB4A 4GOJA 2CHQA 2VHJA 3K09A 121PA 4JJZA 5DI9A 1IOZA 5EZ6B 4EIWA 4YMUA 3RC8A 1P7CA 2IYSA 4MUBA 4EJSC 2VTKA 2IYRA 4RZ3A 2ZE5A 2VLIA 4Q01A 2G77B 2WICA 4BLQA 2ZAMA 1FP6A 3BB1A 1Q20A 1MOZA 1R0WA 4L5BA 3LW8A 5CYOA 1DADA 2QMEA 1U8AA 2LKCA 3ECCA 3FDIA 2HDNB 4A6PA 4D0GA 2GK7A 5JI2E 1NRJB 2RKOA 1SVOA 1S3SA 4TSFD 1Z07A 2QAJA 4RZXA 3RRMA 1QHNA 4BZPA 2JJ1D 5KNBA 1W44A 1XMJA 3DOFA 4R71A 4Q4LA 4ABYA 3PV0A 4TZ0A 2YV5A 2O8EA 1HT2E 5TVKA 3VX3A 4TYPA 1Y3AA 1GKIA 4B3XA 1DAMA 2NGRA 3AKYA 2QTVB 1EXMA 1RRGA 4WW0A 1LTQA 1PLKA 2ZR9A 3KQHA 1J2JA 1ZC4A 2H92A 1GAJA 2R2AA 1W2HA 3K9HA 2F9LA 3K1JA 3TMKA 2RGXA 1NJGA 4JVNA 1R0XA 4BLSA 1F2TA 4PHFA 4C0BA 5LD2B 1SKYB 3AVQA 3NKVA 4RD2A 2EFEB 2A5YB 4PTLA 2PJZA 1VIYA 3K9GA 1NKSA 2JEOA 2HT1A 4PQFA 4Q7KA 3GLHA 2ZROA 2AD5A 4WAUA 4R7ZA 2RGNC 3IKJA 2IW3A 3TR5A 2ZRKA 4Q4HA 4W5HA 1VYUA 3EZ7A 5EXXA 1XD8A 3WYAA 4A0GA 1II9A 1XD2B 3FWYA 5BN4A 5KHOC 4JBYA 2DWOA 1UM8A 3X2SA 4PANA 5KPJA 3AP3A 5GJBA 1JJ7A 3I32A 1E9SA 4V0ME 1GM5A 3EX7C 5CK5A 1WF3A 1XU4A 2REBA 2VL7A 1BYIA 3CH5A 2G1KA 2QAGC 1AS3A 1GKUB 1XXHA 2IWHA 1YE8A 2JLWA 3OIYA 4UJ5A 4F91B 4KYUA 2R6DA 2D3WA 4TLCA 1O3YA 2YOHA 3KL4A 4BFSA 5KTYA 1UBCA 4D4MA 4C0HA 2VP2A 2FX3A 3Q72A 3TRFA 2J0VA 1JECA 1CBUA 4IJMA 1XEWY 5EZ5A 2HV8A 3NC1C 1NSFA 3I73A 2QN6A 3IIKA 4LSGA 4Q19A 3W6OA 2CNWA 3AGPA 3LXRA 4TMKA 2RGCA 3FFBA 3M0EA 2YYZA 4I81A 1OKKD 4IOKA 2E87A 2IUTA 4KLNA 1NL3A 4TQAA 4MDEA 1W2GA 3NHBA 4CEIA 4HAWA 1S1CA 2OG2A 3LQRA 3D7MA 1F6BA 3K0CC 4TN1A 3QSYA 4KU4A 3WYGA 1E2GA 3OE7A 5CJ2A 2F1IA 1MO3A 3KFXA 3H0KA 3QPWA 5DI3B 3AKDA 4NP6A 4JKYA 3NHAA 2ZYVX 4IVPA 4B32A 2NZJA 1G7TA 2G0NA 4QHYA 2FN4A 3ICEA 5HR5A 2XTNA 2NOAA 2R62A 4PC7A 1CR1A 1J8MF 2KBEA 2ZS8A 1YVDA 4TMVA 4EPRA 3SJZA 1KDTA 2ZRFA 2QMUA 1Z6YA 1UBFA 2O52A 1R5NA 5E7MA 1XD2A 2OAQ1 3W5JA 2GXSA 5CIWA 3CRRA 1COWA 1L4UA 2QA5A 1K5DA 3OESA 4KODA 4HUTA 2VSXA 2WJVA 1H8EA 4EFNA 5L8VA 3VR6A 5BN3A 1QVRA 1ODFA 1R5OA 3BRWD 821PA 1B0UA 1XWIA 4LOAA 4DUGA 3GLGE 4LC1A 1N5IA 3WHLA 2I4IA 1E2FA 2IYZA 5JMTA 3ASYA 1DG3A 4BLOA 2VPPA 5C4GB 2IYUA 5KDDA 4CT5A 1OFTA 4DLZA 4HB2A 1KO1A 2BMEA 3X1DA 1ANKA 3AV0B 2RB4A 2OBMA 3CNLA 3T61A 2ZXUA 2FPKA 4NYJQ 1X6VA 2CNWD 2QGZA 4FWTA 4UNNA 4MKHA 3AVVA 3B7GA 1LFDB 1KO4A 4NYMQ 1XZQA 1NVXQ 4JSTA 5EP4A 2MSEB 2ZSFA 4LHWA 2C95A 4Q9HA 3VU9A 1E1RA 3GFOA 3NXSA 5CIQA 3AVWA 1GSIA 2BHRA 2A30A 3EG5A 4Q4HB 2MSCB 4GMXA 2VO1A 5JLJA 1ZD8A 2F9MA 3HR7A 3KXLA 2C78A 4XD7D 4XWKA 3I5YA 1J7KA 2WSSA 3TE6A 1KK3A 3Q5DA 5E7IA 1KSHA 3V9PA 2GHIA 1T5LA 1DAHA 1P3JA 4YDSA 1G5PA 1R4AA 1W49A 4DDVA 4HZUA 1J90A 4JLBA 4ZKEA 1US8B 5JRJA 1AGRA 4MYTA 2KBFA 4RFSB 3BIFA 3B9PA 5E3HA 2YWGA 1XCGB 4TQUS 1CIPA 1SZPA 3KJHA 3N5CA 3BD9A 3IDQA 3GQBA 3I5XA 1KKLA 1OHHD 3P32A 2ZR7A 4S35A 4XVRA 1N6OA 1LF0A 4EFLA 4M1TA 5BQ5A 1RJ9A 1VG8A 1XD9A 2J46A 2OAP1 4YMVA 4MRSA 3U2QA 3PFIA 1CJMA 1G3IA 2Q3FA 4XIGS 2WJIA 3RNLA 4US1R 4Q1DA 4LI0A 1ZM2A 1DG1G 4OKSA 3ND9A 2P6UA 1SVSA 1JQJC 4HZUB 3Q7QA 4I99A 2D2EA 2HEIA 2ZEJA 4TLBA 1XTRA 2BMDA 3O8RA 4ZCMA 3O8CA 2F1JA 1YZGA 2A7QA 4TQ9A 5DHFA 5FFMA 3P1JA 1D2NA 3EIHA 3QKRB 2W00A 1GILA 3L0PA 4MRRA 4UNSA 3TNFA 5L3SB 1OB5A 1GNRA 2C9OA 2CJWA 4B76A 2ZTSA 2XNDA 1CJKC 4Q4AB 2N1BA 3EW9A 3U3KA 1XPRA 3WP1B 3KKQA 2OHFA 1EFRD 1NIPA 1HE8B 1YZLA 2RAPA 1P4SA 2GWHA 4QJ3A 4B44A 2ZR0A 4QBHA 1JALA 1YRBA 4H1VA 1MABB 4BE7B 1KHTA 3A4MA 3QEJA 1DAGA 4HAXA 2ZJ8A 4PPQA 4XVQA 3C15C 2HXYA 3UK6A 3WHKA 1RC8A 2O8BB 3AQ4A 3VKHA 3LVRE 2VF7A 3A1VA 2JDIA 3BE4A 1XJ0A 4LV5B 4NCKA 3N2IA 1T3SA 3NWJA 4K81B 1T3HA 2D4HA 2N42A 2YC4C 5BW8A 1U8YA 1ZYUA 4DIDA 5A0FA 2QROA 4ERNA 2FPMA 2YNMA 4RD4A 1AKEA 1G7SA 3NBXX 2W6ID 4AI6A 3WBKA 5CM8B 1W5SA 4V0OA 3QPUA 3I3SR 5KYKA 2IK8A 3RSOA 2IC5A 1T8TA 4CEHA 2FEMA 4P4TA 5UKDA 1TAGA 1DS6A 4NCHA 2VA8A 2J41A 4QGHA 4BASA 5TDHA 3MWJA 3AVUA 1AZTA 2PCLA 5FOTA 3SR0A 1FMJA 2R6FA 2X77A 3PQCA 5FL7A 3EC1A 1E4YA 4K46A 2RGEA 3OEHA 1QHHB 3CR8A 4B71A 4TZ6A 3BERA 2IF0A 4L16A 2IUUA 4V0KA 3RS2A 4GP7A 1I2DA 1WE2A 4HDCA 4JLOA 4F38A 4PXAA 1E4VA 5EP2A 3SJAA 1E2IA 1AKYA 4FIDA 4DSOA 1RJ9B 1T91A 2ZJYA 3LVQE 1A82A 1BIFA 5JS8A 3TBKA 2OO7A 1KY2A 1ZVQA 4XWOA 1HTWA 3TUZC 1U8ZA 1KJYA 2F3RA 1XNJA 2A78A 2FSHA 5LDDC 4TMTA 2ZRCA 5BN5A 4DIEA 3DL0A 3QI2A 5D3MA 2EYUA 2WKQA 2W6JD 3W9YA 3QF7A 3GLGB 4BFUA 1NLYA 3CNNA 2ZQ5A 4HAVA 4Q1EA 4X8OA 3EZ9A 5CJPA 1BMFD 3UPUA 3SU8A 2ZI7A 2I1VB 2Z83A 5DISB 1IN8A 2GESA 4BEBA 2ZU6A 1Z0JA 1A7JA 1E32A 4ZV4A 4NDZA 4D0LB 2MMGA 1IXRC 2DFLA 1EWQA 4LJ9A 4S2EA 2YOFA 3SOPA 1KI6B 1TF5A 2QNRA 2FFHA 4JIMA 1XPUA 4NCJA 1TQDA 1ZINA 1U0HC 4DUGD 3A6PC 1TX4B 3IIJA 2AHOA 3I8XA 4PSAA 4EFMA 4DCTA 2G3YA 3GPLA 4Q21A 1XF9A 1W0KA 2ZSEA 4BGDA 4EQ6A 3THYA 1ZD9A 4XD7A 4ACBA 4RVCA 2EU8A 5FI0B 4C0AC 3CPJB 1QHYA 4GZLA 3EPLA 8OHMA 3P26A 1S4QA 3PITA 4PX9A 5G40A 2QBYB 1AJEA 2RGNA 4CEJB 4XJXA 4HSEA 4RCYA 2X2EA 1M8PA 5JEEA 3BAFA 1N5JA 1MO4A 3R9WA 3THOA 4H9GA 1UKZA 3LBIA 3NBFA 3A4NA 4IKEA 4Q9IA 2GBLC 4Q7LA 3U44A 1OHHA 2AXPA 2E9SA 4GP6A 2JA1A 1C1YA 4KHZA 4AK9A 1KDOA 2PX0A 3I61A 4QM6A 2QUZA 1OF1A 2LCFA 1NG9A 2WSMA 3FHTA 5CB8A 1D9XA 4LY6A 2HUPA 4GT1A 1Z63A 1XTJA 4RY2A 1E2PA 1AZSC 1Q3TA 3C5HA 4AKEA 1IJEA 4E22A 1KK2A 4EPVA 3IPXA 1HUQA 4EPWA 5DN6D 1SGWA 1PLLA 2X1VA 4LBZA 3TVTA 5GJCA 2ZPTX 4M1YA 4CDGA 3RANA 3LY5A 4II7A 4PAMA 3VR3A 5KOYA 1LF5A 1ZIOA 1IBRA 4YONB 5FOUA 2B8TA 2C96A 4MYCA 3Q5EA 4F4IA 4M9XA 4RFVA 2BVNA 1CEEA 4QGFA 2WSSD 1VYTA 1UDXA 3L8YA 4QKQA 3KTAA 4KBGA 1EFRA 4N1AA 2B6HA 1I4DD 2BBWA 1VECA 2QQEA 3GCGA 3MUFA 3V00A 4DDUA 3MCAA 4A36A 4AYTA 2D7DA 4YLGA 2FG5A 2J59A 4V0NA 5C2JB 2OBLA 2G0TA 4A82A 5HKKA 4M1MA 1AN0A 4CT4B 2ZRAA 2A5GA 4C0QC 4Q48A 4TMXA 3QG1A 1Q12A 3B6EA 3UG6A 1OIXA 1SQ5A 3EASA 1J99A 3J81k 1XRJA 1Z83A 2PL3A 3A58B 3BJIC 3Q7PA 4B48A 4DCNA 1ZCBA 5EUMA 1U9IC 3B1XA 5FOXA 1CP2A 1KDPA 4F4JA 2AK2A 2O8EB 1SULA 1WQ1R 1G291 1FL9A 3A37A 3C16C 5G3YA 3DM5A 3NBZC 3C14C 1EESA 5KSZA 1KI3A 2W58A 3KKNA 1G4AE 3MMPA 2W6IA 2TMKA 4A8JA 1J70A 4G5SA 3D6TB 4GMDA 4URVR 3NH6A 2ONKA 2GXUA 1IY0A 1GTVA 1TQ4A 4JJKA 4OI0A 1SVKA 1TU3A 3TQFA 3NDPA 2DFTA 3A36A 4ZIRA 3MWKA 3NIBA 5G41A 4F4CA 3H4MA 1VYVA 3V4RA 2ANCA 4P31A 5HKKD 1XPOA 2IS6A 1G6OA 3T1TA 2H17A 1G3UA 3ZGXA 3K0FB 2I1QA 3LBHA 3R20A 4BPBA 2NO0A 3MFYA 2PH1A 4BFYA 3CBQA 1U99A 2WPDD 2WWWA 3THXB 2Q21A 2ZVQX 1ZRHA 4ZI2A 4DRZA 2WWXA 1MO5A 3SQXA 5EXSA 5EE9A 2PEYA 4B2IA 3C8UA 2QZ4A 1P6XA 1YQTA 5CLQA 4D81A 3U4QA 4NE2A 1ZUHA 2BKUA 2F7SA 4KCGA 3K09C 4KFUA 4Q66C 1QHHA 1T0JB 3I92A 2CL0X 1VPLA 4B35A 5FUWA 3HR8A 4GL2A 1NVWQ 2WWGA 3NEJA 2VP0A 3MRSA 621PA 2XB2A 2VP5A 4ZO4A 3TJZA 3CLVA 4FN5A 3B78A 4PC1A 1YZQA 2Z5FA 1KJZA 2DCUA 5DLQC 4W9MC 3I1FA 1EGAA 3U5ZB 4HB4A 3B1YA 4AWXA 3SYKA 3FGNA 3UMRA 1ELOA 4LRWA 4DKXA 3OIVA 2V54A 2GA8A 3GJ3A 2WKPA 1Z22A 2WVJA 4O2LA 4TMWA 5DGXA 1H8HD 1A1VA 5JWHA 2F43B 1ZM9A 1BO6A 3IILA 4XVUA 3KQLA 2JLQA 2DYKA 1Q44A 1C9KA 2C03A 1HQCA 1TUIA 3AF3A 5AR1A 5JFGA 4G5QA 1GNPA 2IEZA 4BFVA 1HYQA 2PZFA 4GPTA 2QP4A 3BFVA 1N0WA 3QXSA 1KIMA 1HE1C 3HU3A 4RD0A 4B3FX 3A1TA 2BMJA 3PG5A 1TQ2A 3QPVA 1N6HA 3GEHA 1MO6A 4HLUA 5FUVA 2O8CA 4XOIA 4DB2A 4FCWA 4IVRA 1SXJE 1L2TA 4W5WA 2V8OA 2I3BA 5B2ZA 4QHSA 3REFA 2QGNA 4G0NA 3TW4A 4IDOA 1P5ZB 3UWOA 3WXMA 1OFHA 2AWNA 5EXTA 4PHHA 1XCPA 3I4LA 2CHVA 3RRZA 4Q00A 2QT1A 4OI4A 5FPYA 3R8CA 3AP1A 4WBSA 1DPFA 2QQ0A 3KJGA 5KNDA 2ZI5A 2D2FA 2NPFA 4NYIQ 2GJ9A 2FWRA 3E2IA 3QF4B 5AJWA 1V43A 5H68A 4HLUC 2V3CC 3OEED 4IDHA 2CL6X 4A2WA 4RD3A 2RGGA 3ADCA 3VR1A 3IHWA 5D3QA 4W5JA 4BLTA 1D2MA 2Q3HA 4M1OA 4CGZA 4KLZA 3CPEA 2ZRHA 2CK3D 2VH5R 4TSFA 5TMPA 3B8HA 2VQSA 3KXKA 2NQ2C 1OH6A 4ZDKA 2EFDB 4PQRA 5IK2A 1E0KA 2BBSA 1G4UR 1YKSA 2XNSA 3RABA 2V6IA 2YVUA 1XJCA 2JDID 3K0FA 4D82A 1D8TA 4U5XA 4JYBA 1PJRA 3RDPA 1EFHA 4MGIR 4J0QA 2ECKA 1E1QA 2X8AA 3LW7A 1XP8A 3ZZ0A 3WNBA 3EA5A 3FKSA 4Q18A 4L15A 4BFWA 4G5OA 2QT0A 5JS7A 5JCPA 3CF0A 5BWMA 4OK5A 3U6BA 3MWYW 2HYDA 1KJWA 2B7CA 2QPTA 4WVFA 3KKOA 4B47A 3LH5A 4MH0R 4BLRA 4C9BA 3BK7A 3GJ4A 1DVRA 1KAGA 4LBVA 2J45A 1XEWX 3LQQA 4TYQA 3VQTA 5KSYA 2WWYA 3SJBA 4DSUA 2ZI3A 3RS5A 4POAA 2RGDA 1TEXA 2EVWX 3THWB 1V5WA 2FFAA 2HJGA 2BKEA 4PFSA 4MDFA 3F0TA 1GRNA 4ZI3A 1R6BX 4GFDA 2ORWA 3SC3A 4Q4AA 1DAEA 2J7PA 1FUUA 3IGFA 1ZW6A 3LO5A 3AF4A 2ZRIA 3EC2A 3TVDA 1JI0A 4KVGA 1N25A 4Z8XA 4KFSA 2VIIA 1IY1A 2GZDA 4JYCA 4HUQA 3QXCA 3C5CA 4ZDIA 1LS1A 2IS1A 1W36D 4UQOA 1COWD 2SHKA 1W0KD 1F2TB 2BCGY 1CR0A 2ZANA 4CW7A 2IHYA 4PZZA 2BIFA 5AUPB 2B21A 1OJLA 2N46A 4QGAA 1E79D 1AQUA 3KX2A 5LBIA 4HDQB 1GZSA 1NN1A 4C0KA 2OV2A 5H8WA 3IO3A 4WZBE 1R8SA 3ZIAA 4DBLC 2Q9AA 4YDHB 1TUEA 4O25A 2PZGA 1CJVC 2WZQA 3HWSA 3JZMA 5HE9A 2JLUA 1UBGA 2CLCX 2GEVA 2ZREA 5AWFC 3IEUA 4PO8A 2ZS7A 3EWSA 1ZP6A 2OFWA 3QF4A 4BFTA 1S8FA 1YR6A 4U02A 4UNPA 1BMFA 1NY5A 5JJLA 2C9YA 3SQWA 4A2PA 4QFMA 4DT1B 5E7JA 5KU1A 3GLFB 1RFLA 1RW4A 4B2LA 1OIWA 1UKYA 2EWWA 2XJ4A 2B7BA 3K70C 4DDTA 2OFXA 1K8RA 4NYJR 2R9VA 2Z4SA 2ZSBA 4AYXA 2CJWB 1Z06A 1OW3B 3M1IA 4Q02A 4F7WA 2YWHA 5FBQB 3CRMA 4URWR 3LXXA 5IK2D 5JRZA 5DH9A 1X1RA 5GJVC 2UVQA 1XZPA 3LBNA 4ESVA 1H8ED 2FSFA 2ZJ5A 2HF8A 4JT4A 1SVMA 2IYTA 4HZIA 1E94E 1U2RA 1KI8A 4Q4JA 1Z29A 3L82B 3BFXA 5IDVA 3W34A 5HZKA 3UANA 3LNCA 1XXHB 1Z0FA 2XEXA 3NC0C 4BFXA 2WV9A 4HLDA 1F3OA 4DSTA 3EPJA 2C5LA 2IXGA 1XEXA 2DY1A 2J5XA 3DVLA 5LD2C 2O8DA 2QENA 2IXEA 3GEEA 1DEKA 3H1TA 5ANRB 5FTKA 4DVGA 4GZMA 4AC9A 4A15A 5CDFA 3WNCA 5GVSA 3L8ZA 4JS0A 1E2NA 3QVVA 2AL7A 1NG1A 2ZJBA 3TR0A 3MG9A 4JL8A 5SZJA 3U3OA 4A9AA 1ZM7A 3TSZA 4FMCB 4P4UA 2JLZA 4G5GA 5CK4A 2HCBA 2ZYUX 1E9CA 4B2PA 1OKKA 1TMKA 5DHAA 3A1SA 1P61B 2JASA 1L7VC 4P32A 3QIAA 5KPDA 1GVNB 5KO2A 4PZLA 1UADA 4IFEA 4L8GA 3TK1A 2WOOA 2HXSA 1SKYE 1U9IA 1MH1A 2ATVA 3CR7A 2ZSAA 3FMFA 2YWEA 3A4LA 3AP2A 3KJIA 5EQTA 4BQSA 4JMPA 5F9FA 1VCOA 1M6NA 1ZMXA 2XOKA 1HY3A 2BEKA 3TH5A 2ZE8A 1OYWA 3RVBA 2CE7A 4A92A 2ONJA 3EXAA 2ZRNA 3EWAA 2DPXA 4NH0A 5FPSA 3A8TA 4G5RA 1ZAKA 3T12A 2FE4A 3E5HA 3EIQA 1K5GA 3AVTA 3T1QA 2ZJAA 4CF7A 1KI9A 1NBMD 2CCKA 2G83A 2AR7A 5IRCD 2J3EA 2O8DB 1UDWA 1Z6XA 5KDLA 2F55A 2ZJZA 3ZJYA 4UKDA 4BRUA 2GXQA 1ESNA 1GRQA 1QVAA 1XFAA 1XXHE 2G88A 2NO9A 5L3SA 3LV8A 4JT2A 1ZUIA 4X8LA 3CRQA 2REOA 4US0R 2D7CA 3QXJA 4PO1A 2R6GA 4X8MA 4BWYA 4I1SA 3SHWA 4ASUD 3NDBB 4Z54A 1NN3A 4KBFA 2IX3A 4D6PA 4JKIA 2BWJA 2WMOB 1NMYA 2F1RA 2ZETA 2JLXA 2FSGA 2Z43A 2R8RA 1OH5A 3CF2A 4MGZR 4QC2A 1EFUA 2YINC 3QG5A 1SVIA 4NTZA 3WMFA 3S1AB 1NMZA 1M7HA 221PA 2Q6TA 2GCOB 3QENA 5JHGB 4OJKA 2JJ1A 2NO7A 4B33A 3HJNA 5J4YA 3T5GA 5H1YA 1G1MA 1JJVA 2CBZA 2PCJA 1RE0A 4EJSB 3A1WA 3MAAC 1P60A 4OK3A 1XTIA 2VBCA 3VHLB 1XTQA 4NZYA 5KSPA 4DLYA 2GEDA 3TAHA 4FINA 2FPLA 2QRZA 4L9WA 2AN9A 5C18A 3K0EA 1E6CA 4C7OB 1R8QA 5AUNB 4TLEA 1E2EA 4NMMA 3NEYA 5P21A 1UPTA 2XTMA 4DB4A 4LJAA 4BZQA 3B9QA 4BRWA 4B3BA 1F5NA 4Q1CA 1EK0A 1Z0DA 5C1BA 2IXFA 4JLPA 1AQYA 1N6RA 1E69A 2O5VA 2ORIA 2CVFA 1KSGA 4LYAA 2RGAA 1W5TA 1VCNA 3DZ8A 3CZQA 3WNDA 4WXPA 4DEYA 3IBYA 4IEIA 5FPHA 1I4TD 1L8QA 2WAXA 2AKAB 3SYNA 1FOEB 1FTSA 3GJXC 1G8GA 1G8HA 1KO5A 1EFCA 3L43A 3QOFA 1E0JA 1HH4A 5JZVA 1T6NA 3FHCB 3U7FB 4C2TA 3GEIA 4BFZA 3TKLA 5F98A 5IF9A 2PLFA 1OPXA 2FJUA 1RIFA 3SI7A 1G3QA 4FMDB 1LB1B 1JAIA 1CULC 2B8WA 1N6PA 5SZKB 3FHOA 1TNDA 3MGCA 4WZ6A 3A1UA 2H1LA 5AJVB 5KUTA 1MKYA 4UNRA 4AD8A 2OESA 4Q9LA 4PSVA 2GF0A 4LPKA 1RYFA 1P2TA 4MGKR 2X2FA 4LJYA 2P5TB 1VTKA 4U00A 3K70B 1P2UA 3I62A 3KQKA 3BWDD 1E1RD 4LYFA 3G0HA 2CLDX 3GLIB 1S2MA 3ND8A 4DLTA 1KY3A 4IOLA 1UKEA 1G41A 3ZDQA 1JR3A 3U4QB 3R9XA 1ONBA 4M9QA 1E3MA 4IXMA 2ZSDA 3U3JA 2IT1A 4Q03A 4ON9A 3W8NA 1LW7A 2JJ2A 2CE2X 2ZJ2A 4MKGA 2QTFA 5FUXA 2BM0A 1AA9A 1RYHA 2EQBA 2Q9CA 1T3LA 2GF9A 4TYNA 4NCIA 2GCNA 3EARA 4ZDWA 3SEAA 1UAAA 2DFNA 2XZOA 4TT3A 1DAKA 1Q1EA 3K53A 2OBNA 1NI3A 2IBMA 3IIMA 1XJQA 3WY9A 5GVRA 3KQUA 1HURA 3EAQA 2ZUDA 1HQYE 3ADKA 3EPHA 3L2OB 4XSGA 4M9ZA 2A9KA 5KSOA 1FTNA 2Z0MA 1QHGA 1MRSA 1DO2A 1E9EA 1MV5A 1NBME 3CONA 3KKMA 1ZC3A 3U7HB 2YOGA 4OBEA 2JIZD 2XB4A 3KKPA 3OEHD 4R2IA 4Y0VA 3Q3JB 3VNVA 2J7KA 3VFDA 2GEUA 3MSXA 3CZPA 2QMOA 2NO1A 3LAWA 3RWOA 2IEYA 4M4SA 3FMIA 4OK6A 5FL3A 3HYTA 3MJRA 3ZD7A 4M2LA 4WZAE 1KI6A 3THWA 4PR0A 2D06A 2XAUA 3HPRA 3OF5A 1R7RA 3B13B 4C4PA 4AKIA 3PIRA 4Q9JA 1GL6A 1LNZA 5AK0A 3AUXA 2YHSA 4ARZB 3OFND 5JI3E 2FGKA 2ZITA 2HCJB 1LV7A 3KQNA 4M1SA 1WRBA 2AX4A 2CL7X 3B5JA 5JJIA 3FPAA 1UEIA 2GCOA 2WMNB 1EG7A 3QJYA 1G7RA 1JB1A 4NPHA 2BV3A 3L0IB 4ZCLA 1Z2AA 4B6FA 1E79A 2IUSA 4DHEA 2F43A 2CVHA 2J87A 1OE0A 3CUEF 1F2UB 1SXJD 2C9CA 1CRPA 2OZEA 1QBKC 3KTAB 4MRVA 4ESHA 3VNUA 2Q3MA 4BEJA 1H65A 1XEFA 521PA 2OLKA 4JLKA 4FCTA 1FPMA 2C98A 4V03A 4WOPA 2FFQA 4GOKA 4DLXA 3IQWA 4YC7A 3LLUA 3JVVA 3QKUA 3UKDA 3REGA 1W36B 4LJ4A 2OE2A 1T9HA 3KXIA 3QKTA 4HAUA 1P9WA 2UKDA 1GFIA 1CF4A 1KMQA 1SHZA 1WB9A 4QBIA 1VG9B 2WWHA 3T06B 2ERXA 4DDWA 3W6PA 1KK0A 1VDZA 2FGJA 3SYLA 3RS3A 4C3ZA 4DSNA 4RZUA 4ASUA 2NPIA 2JLRA 1Z5ZA 4JLJA 4JVLA 3RSLA 1I2MA 2ZE7A 3GJ7A 3GJ0A 1GP2A 4ACAA 1TADA 3RLFA 2PBRA 2J9RA 4KYIB 2XGJA 3WRXC 2FV8A 5DNYB 5BYJA 3NTUA 4KVAA 2RCNA 1U0LA 2VSOA 1G17A 2FDCA 5K8IA 3AGQA 1ZIPA 3O8DA 4A1FA 1CLUA 2QBYA 4MQBA 5GJWC 2FZLA 1JR3D 2WWFA 2ERYA 3EA0A 3SFVA 3DMNA 3SE0A 2ZI6A 4JLNA 2W6JA 4DLWA 4EJSA 4KITB 4QBGB 1T0HB 1Q22A 4MRPA 5IHPA 1HA3A 1FX0A 1X86B 5DE3A 2CEAA 3ZQJA 1E9FA 2VP6A 4CYMA 4ZDJA 5FBVB 3KDSE 5JSZA 3ADDA 5FBRB 1IN6A 3CWQA 3W5IA 2J0QA 1OT3A 2ZM5A 2A5FA 1OSNA 4HAZA 1RPZA 1W7AA 1GITA 3SBDA 3ZZTA 4TLDA 5D3MB 1ZUNB 3FOZA 4LGMA 5FTJA 3UIEA 4A2QA 3UWKA 4Q47A 2NTYC 3AB3A 4I1VA 1KZGB 4OQNA 4EKDA 3CKLA 1XB2A 1P72A 1IQPA 1JEEA 5JJKA 5H70A 3SHFA 2QRNA 2IWRA 4DLVA 2GJAA 2DBYA 3D31A 5TB5A 4LX0A 2FA9A 4DT1A 1R0ZA 1NLFA 3NBYC 2EFGA 4R9UC 2IS4A 2GCPA 4M1KA 5CYPA 3K9LA 4ZIRB 4LC0A 1E0SA 2ASEA 3Q8XB 1KDRA 3N2EA 4EUNA 4V02A 2FEOA 2OEPA 2ZIAA 4OHVA 2BM1A 2EFHB 1I4LD 3RWMB 1ZNXA 4IDQA 2PT5A 2B92A 4D4JA 4URXR 5CLLA 5IT5A 4JSYA 1W36C 4YMSA 4JBWA 3U7GA 1F48A 5DYIA 2X19A 4CEJA 1NIJA 2AXNA 4TTRA 4B74A 1VIAA 4OYHA 4HB0A 1YR9A 3AVOA 3W3ZB 1S1MA 5JWOA 5KNCA 3L0SA 4JLAA 5TV2A 3F8TA 3VR4A 3X1YA 2W2XA 4IOJA 4QBFA 1M1YE 4XTRA 3R9IA 3U60B 1KSFX 1IHUA 4P4SA 2FNAA 2HLDA 4AYWA 1U94A 4DCVA 1US8A 2A5DA 2E1RA 2NIPA 1T5IA 3QVUA 5EP3A 4KFRA 5G3ZA 3WYFA 3ZZUA 1W47A 3IQXA 2O8FA 2OILA 3IEVA 5LPNA 1WCV1 4LV8B 2H16A 2WOJA 3RRNA 2W2TA 1AS2A 1F60A 4CVNA 2JJ2D 5K8TA 1Y63A 2V1XA 4P4SB 2DB3A 4ARZA 1KI7A 3GFPA 3JZAA 3P4XA 1RKBA 2FU5C 2XX3A 2LWIA 2YJTD 2EFCB 3G5UA 4M8NE 3OEEA 4GOXA 4MKIA 3ZQ6A 1YR7A 1YZNA 1OIVA 3PEVA 4DZZA 4HLCA 1N6KA 3ZVMA 4Q7MB 2QL6A 3NVAA 3SFZA 1F2UA 1G3RA 4D26A 1PUIA 2PX3A 2ZVPX 2IS2A 3OAAD 3WP0A 1S0UA 4IXNA 5FTMA 3UMFA 3MD0A 2VP4A 1KNQA 4EPXA 3BGWA 3O8BA 4UNQA 1W4AA 3AH8A 1QHIA 1U98A 1X8JA 2QY9A 1NKTA 3ZD6A 4JL6A 4QHTA 2DWQA 1YHNA 1Z6TA 2FH5B 5FTLA 3QEOA 4JLMA 4LV6A 5A4JA 3LDAA 2XXAA 1CR4A 4FMBB 2JCSA 4Z1MA 4A0RA 3OE7D 1NSTA 2FOLA 3GLIE 5DIFA 4WIAA 1W46A 4A4DA 2QE7A 1SXJB 3FMPB 4AKHA 1KAOA 2ODEA 2GZHA 2V9PA 3FMOB 1JNYA 5CM9C 2AFIE 1IXSB 1NN5A 4AG6A 4LYJA 3N70A 2PEZA 4P3YA 1M7BA 4G3XA 2ZRJA 3EZ2A 3VKGA 1GUAA 2P6RA 4EQ6B 3THYB 4IDPA 4OJQA 2FMXA 4Q7JB 4TT3D 4OQXA 3DO6A 3TLXA 4CEIB 2Y8EA 3DKPA 3JVUA 1E2JA 3TSOA 5B57C 3B60A 1NN0A 2BJWA 1G64A 1X1SA 3AVXA 1D5CA 2KJQA 2P6NA 4D80A 4O3MA 4MUAA 5DN6A 5FBWB 1CTQA 2G1JA 3X1WA 5E4FA 1IY2A 1JBKA 2H8KA 1VHTA 4A0FA 1GWNA 4AY2A 2JLVA 3EZFA 4LHZA 4N0DA 3QY0A 1Q3HA 1G16A 1PZNA 2AKYA 4X8HA 3U3RA 3B1VA 4LBWA 3PXGA 2BDTA 3B1WA 3RYTC 1X8KA 4LDJA 2P67A 3BH0A 4JBXA 2R44A 5SZIA 1KMHB 3R8FA 3PJRA 1DAFA 2KE5A 3QQ5A 2JLSA 3TUJC 5HZHA 3K0AB 3QXHA 4Q5IA 1ZU4A 3ONWA 5EP1A 3CNOA 4LK2A 2C8VA 5LB2A 1P2VA 1OXVA 2C04A 2ODWA 2ANBA 4KO8A 1JR3E 1SXJA 1LS6A 3OHMA 5EE0A 5J4LA 2ATXA 1RVDA 3K0CA 2R6AA 4Q9KA 1NLZA 2C77A 2QEQA 2QP9X 2J7PD 3PCRB 3E70C 4FW9A 4OL0A 3CX8A 5KDOA 3AF0A 4GRAA 2WAYA 4E07A 3EZ6A 1EWRA 1PLJA 1TF7A 4TL9A 3ZVNA 2HYIC 5TARA 4CRWB 4IW3B 4OI1A 4DCUA 1YU9A 2BEJA 3KUCA 4U7DA 4TTQA 4PO9A 1UF9A 3AVPA 4OHYA 3VX4A 3BC1A 1D9ZA 2JAQA 2VF8A 3FVQA 5G53C 3UMSA 1II8B 2BCJQ 3BORA 4C0SA 3GLGA 2GVDC 3K0AA 4MGYR 4DLSA 1UEJA 1SVLA 5GADl 1ETUA 1OXTA 2WM9B 2Q0HA 4PPGA 1KYIA 4C7OA 3H2YA 1ZM4A 2V1UA 2IYXA 1NBMA 4Q1BA 2PMDA 2J1LA 1XCMA 4LBYA 1IN4A 1JXOA 4HI0E 5L3QB 5C46F 2GDJA 2XOKD 4EPTA 1JQLB 4Q1AA 4RJLA 1HEIA 3GLFA 1Q21A 1XTKA 4TTPA 5LB4A 3T1OA 1EFTA 1A4RA 1JPJA 3K0SA 4D25A 2WBLC 1VCIA 3GLHB 3KB2A 1E1QD 3KB1A 2J0SA 4A8JB 2MMCA 2PJRA 4AIIA 3LA6A 4ZCIA 4KFTA 3CX6A 3QBTA 4M53A 3AF2A 5FOVA 5J47A 4US2R 1SKQA 3TGPA 2Z4RA 4PHTA 5J4KA 3CRVA 1OXSC 2ZRLA 1KZ7B 3PR1A 4ZPXA 4B3CA 3AKCA 1N5LA 2QPAA 4BZXA 4DLRA 1KO7A 2BBOA 2IHBA 1KOFA 4KJZA 3LLMA 2DWPA 3RAPR 3RRYA 1Z0AA 3THXA 1GOTA 5JHHB 4PHGA 2ZS9A 2L0XA 3OIUA 1G6HA 3LFUA 3X1ZA 1VG1A 3TW8B 2XZPA 1ZD1A 1KI2A 5FR1A 1II8A 2G9NA 5HCNA 4TYWA 3BH7A 3ADBA 3LD9A 1W4BA 3B1ZA 4OQMA 1UJ2A 2G6BA 3IO5A 3VMFA 4PAOA 4I4LA 1GRRA 1XDBA 2JIZA 2XITA 1CS4C 4RD6A 5EJEA 1M34E 3BS4A 2QG6A 3VTKA 1AM4D 3LRPA 4C2UA 2GILA 1D6JA 2CXXA 1N0UA 3GLHE 1BOFA 1N3BA 3R7WA 4LHVA 4B34A 2V4ZA 2HJVA 3QE0A 3KZ1E 1BKDR 1QZXA 4QL3A 3ZIAD 4B75A 1KI1A 1IONA 2PMKA 1H8HA 2ZUCA 4OI2A 3CPHA 3B82A 3O47A 4GI7A 3UATA 1MT0A 1FZQA 3W3AA 3HU2A 2ZJOA 1P2SA 4URZR 1E96A 1OXXK 4IOMA 3QKRA 1PV4A 3BOSA 2ZRDA 4LJ8A 1BYUA 5J5CA 1VKJA 3FYHA 3P4YA 2GVZC 5L3RA 4F92B 3GLIA 4LPSA 4H1UA 4A6XA 4O2RA 3L0OA 4QGGA 3OIWA 4M0LA 2RGBA 5F2EA 2XNDD 1CKEA 3WBJA 4UXHA 1WBBA 3R7WB 1P75A 4LHXA 1OXUA 1KO8A 2ZRMA 3FTQA 4QNRA 3FB4A 2QM7A 2EW1A 3PUYA 3GLFE 1N5KA 1FW6A 4ZKDA 2ZYWX 4YXWD 2OXRA 3DHWC 1NF3A 5JWRA 1AK2A 2RHMA 4BUJA 5FBLB 1VHLA 3K9NA 3CW2A 1E9DA 3B2EA 1OH8A 4KI0A 3VKWA 2P5SA 4TYYA 1Q1QA 1FP7A 3P27A 4UXIA 2GKSA 1E2HA 1SXJC 1GDDA 3RS7A 3PEYA 4HAYA 4HB3A 3W90A 4FXPA 4IEEA 5B64A 1QG4A 1YRAA 4FCVA 3QUSA 3ASZA 4ILEA 3SS8A 3IUYA 1YZKA 2LKDA 3DM9B 2GJSA 1U81A 3CF6R 1XMIA 2ZRPA 3GD7A 2BBTA 4FWIB 5AJYA 5FTNA 4LWZA 3TAUA 2R6CA 3T34A 3ZVRA 4MYHA 1ZNWA 1FNMA 1G8PA 3PUWA 1ESMA 1NP6A 2QSZA 1GNQA 1A5TA 2HF9A 1TL7C 3QNUA 2W83A 4Q4JB 1YZTA 2WTUA 2CCJA 3KJEA 2OT3B 4V0MA 2OCAA 4URYR 3LX5A 1OFUX 2IL1A 1CXZA 2ZRGA 3HPQA 4Y0AA 4PSKA 4M1WA 3FFAA 3VAAA 2ODNA 5K8UA 1VG0B 4QXAA 4RKFA 1FFHA 2IF2A 1WBDA 1ZNYA 1W4RA 4FMDF 4P0TA 5FUYA 3ZH9B 5JSZB 4LJ6A 3I8SA 2YKGA 2V55B 2OSBA 4ITRC 1Z0KA 4D2IA 2FZ4A 1N2CE 1R2QA 1XBTA 4NKRA 4UXJA 1WP9A 3K70D 2NMVA 4G01B 1PVOA 1NMXA 3ZS9A 4OHXA 2PLRA 1LVGA 1IJFA 1KK1A 1XTSA 3DEFA 1S96A 2VHTA 3Q85A 3CIOA 1EX7A 4LJ7A 5FR2A 1E2QA 4KV9A 5J40A 2F3TA 3S1AA 4D0NA 3U61B 1Z47A 2ZAOA 1Z2CA 3D3QA 3HP1A 5TY0A 3T1VA 1Z28A 4NCNA 4UJ3A 5J4HA 1ZBDA 4LCBA 1FNNA 3DDCA 4HUQB 4TLAA
chains in the Genus database with same CATH superfamily
2C7PA 1Z3IX 2WIBA 2XRMA 1GD1O 4K6FA 4UCQA 1ZK2A 1PHPA 1LBQA 4BMXA 1Q1ZA 1VLZA 1Q0UA 4ND8B 2H63A 4PFJA 3S2IA 4BE4A 5JAZA 3WB9A 1KJQA 2B30A 5K3FA 4Z9AA 1IIRA 4LYHA 1CY7A 2GAAA 2UZIR 1ZXBA 3MTAA 2FSIA 3DZDA 4OMFG 4Q3BA 5EJFA 2Z6VA 3HUTA 4HLQB 1X7YB 3E05A 2V98A 3ZWAA 1GIAA 1JIQA 1Y1QA 4YXWA 3ZGNA 3DLIA 4QKQA 3PC8A 2V8BA 4DEXA 2ZJ4A 3I39X 5JYCA 3NORA 3D8BA 5K3FB 5BWLA 4JK3A 1CU1A 4YAJA 1M33A 1U6IA 3RU3A 4F5WA 1KSJA 2I7VA 1G1AA 1GCAA 2VP9A 4TL7A 4WHMA 3P52A 3VGJA 4YK7A 4MP8A 3WHPA 4UVEA 4EY5A 2M6RA 4I19A 3HVKA 1QG6A 3IKMB 4KQGA 3EEIA 3KG2A 4B6OA 2C2KA 2DR3A 1EPUA 3ZZ1A 3NHKA 1MZVA 1PEYA 3D6MA 3HNRA 4IFIA 1JEYA 2Q2WA 4EA6A 4X1IA 2WG2A 2VBGA 1PNTA 4QFCA 5G4KA 3B85A 2BSQA 4XCQA 7ABPA 2I4MA 2KB0A 1A8IA 2XB8A 3QNMA 2AG6A 5BV8A 3LO8A 2G5TA 2SICE 4J7AA 1PYOA 3IOEA 3RSGA 5H5JA 4L51A 1FMFA 2VXCA 2VJCA 1EZZA 2Y1DA 4OY3A 3AR4A 3SY8A 5HPYB 1ZGCA 5I3ZA 5F9HA 1MCZA 2OO5C 2Z30A 1W93A 3WIBA 3WYNA 2H5LA 4J07A 4NU0A 3WMWA 3DOEA 2YC2C 4EDFA 4YX9A 2KQUA 2JB9A 3CVWA 3IMKA 3CVXA 4EX7A 1CY1A 4TWBA 2XQJA 1Z13A 3ZJ5A 3VA7A 2FEWB 3D5EA 2NNLD 1T35A 4X9XA 4TOIA 3TUIC 1Q7CA 2W5UA 3L06A 2I6TA 4B3DA 3C45A 2P9BA 3CUWA 5C4IA 5DYGA 2OCPA 2MWMA 3RW9A 5LCXA 1GQ2A 4QA9A 1WMSA 2EEZA 4CLOB 1AN9A 4G0ZA 3WRYC 1PWYE 2I1WA 2Q29A 3IPRA 3DMDA 2ZZNA 4L4ZA 2PIDA 2QI9C 5FUBA 4UEWA 1RCTE 1KYTA 5BQFA 1PV2A 1PK7A 2PU7A 1TEVA 4QT0A 1IB0A 2ADOA 3OJWA 1G8YA 3RQSA 1JQAA 4UUMA 3RC3A 2B3TA 3K20A 4M9SA 1LPMA 4OVKA 3T54A 4NPAA 4FR2A 3TFQA 1E2LA 3T3OA 4FP9A 4LXHA 3WICA 2IH4A 2F1HA 4OHMA 2ONZA 2YN4A 1I2ZA 4YHBA 2HT6A 4NYMR 3L1KA 4OB8A 5SICE 3ZS8A 5J2UF 2CMDA 1NRIA 3ZLJA 1J9ZA 3EQ7A 3K9WA 4Z8YA 3PCTA 3I52A 2VYFA 3FWZA 4OQLA 4YCSA 4ES6A 1NJ2A 4E3ZA 4P4LA 5K51A 3PNMA 5JZSA 4ZQBA 1OQAA 3AOGA 3S8MA 1VMAA 3KPUA 1NV8A 2OQIA 2LR0A 1DKRA 1W0JD 2GN4A 1ADGA 3FAKA 4L72A 3PDIB 4G1UC 5DRTA 4RKEA 5KAMA 4EG1A 4B3GA 2VSFA 2WKRA 2GK6A 3G2HA 1Z8HA 4FDMA 4MMYB 4MVWA 4E09A 4HS4A 3MD9A 4JZKA 1JF8A 3GVCA 3M6AA 3SR3A 3EVZA 2HU8A 3F7OA 3K05A 1PDWA 4PVDA 3EBLA 3PP8A 4AXBA 1YXMA 3C3YA 2WJJA 3I34X 1Y6FA 2HTFA 4JD5A 4QELA 4C7VA 4ZICA 5B1EA 1ML3A 3ZXYA 4UUPA 4Q7EA 3TQTA 1QQBA 3NETA 2VHQA 3JAWB 3WYCA 2RJNA 2DPHA 2N9UA 3CLUC 4C0JA 2WWIA 1FX0B 4O8CA 4RJKA 5BURA 2ZUVA 3B12A 2C4TA 2BMWA 3BFKA 3IUNA 1U3TA 3GA5A 1C8BA 4L4UA 4FI3C 3PVSA 2X0RA 2H1CA 3Q3GE 3AEQB 2P9QA 4UM9D 2FCRA 1Z8NA 1NY6A 3WGGA 1NVGA 3RIHA 4BEVA 1Y42X 1TYCA 3NHYA 2P8JA 4EGCB 4BXOA 1QOZA 2BELA 3AR9A 2EHDA 1PK9A 2WWVD 2ZRBA 1ORDA 2C92A 3CFYA 4AURA 1UC9A 3O91A 2ZXEA 2EKPA 4HYYA 3Q10A 3W8RA 3T7SA 1V7QA 3FPFA 4FDTA 4CLRB 1EIZA 3QNWA 1BA2A 1SBNE 2CNDA 1XLTC 4E5MA 1NT4A 4MWZA 5A5DA 1R5BA 1X1CA 2D74A 3HEAA 2JKYA 4CIDA 4MVYA 1MJFA 2OGWA 5HX7A 4OAQA 1T1JA 2VZEA 4CNQA 1J20A 1ZCAA 3QBDA 4LRUA 1ACLA 2O06A 2QG9A 3ORSA 1B74A 4MV1A 1J0CA 4U63A 3VC2A 1YE5A 1KKMA 2XWQA 2GNAA 4LZNA 3WGJA 1NVVR 3DE5X 3T52A 3SJCA 4IFTA 4C7BA 3GFBA 4EY7A 2O2YA 2XJ9A 5JXGA 5DBOA 4W82A 4C1NA 1L1FA 3MJHA 3BK1A 4IX9A 3E2MA 2PWBA 2EYQA 2IHUA 1UJ5A 3GNLA 4FNGA 2ZYTX 4XWYA 5DGTA 1DTSA 5HTKA 3VKUA 3GZJA 4TMZA 5BO5A 3V1LA 5JECA 4U7TB 3KFVA 4Z1MD 3VUEA 3Q8MA 2BN4A 3O2JA 3R7AA 3JQ7A 1LSUA 4EJ0A 1TPYA 1BH2A 2IU4A 1JHDA 2HO4A 4RLHA 2O2DA 3C5EA 3MINA 3I9V6 1E9BA 1UJ4A 3GUHA 4RZQA 5DXJA 2C1XA 3T7IA 3KP1A 4GNKA 16PKA 1JKJB 1XRLA 2F62A 4DILA 4URUR 4ZPJA 2CXHA 2QORA 5NULA 3UV3A 5K8LA 3N8GA 3BWCA 6Q21A 4MW0A 3CTPA 4J2TA 1H2YA 1L4GA 1U0GA 2W0SA 3G88A 3CH4B 2NZ8A 5IP5A 1L8XA 5EE3A 3TTYA 1AHHA 2CF5A 1NJ8A 2GETA 4QGBA 2EBFX 3KEOA 1BJTA 4EB0A 5IJWA 2Z2IA 4HUJA 5JG7A 3IUQA 5CFOA 3M8KA 2PN1A 2Z2ZA 1B8NA 1M6HA 1WVGA 4PPFA 1YL6A 4CXMA 3SBEA 3SNHA 1TF2A 1UJNA 1Q1GA 2RONA 3D1LA 1U3UA 5KYWA 1QKJA 1N0VC 4MJLA 1AKUA 3C41J 1F1JA 2RHDA 3JQ7B 3JYNA 4ZGBA 3D6JA 3LWNA 2IH5A 3HJFA 2QU8A 3ZHXA 3TD9A 3MERA 1CR2A 2XTZA 1TIBA 3D4PA 1DE0A 1E5TA 3OZXA 5AO9A 3P9RA 5EYPA 4B09A 3KEFA 2C7RA 2G1PA 3MTEA 5T41A 5A5GA 3OFSA 4RCZA 1RWKA 4P5DA 5M04A 1TJPB 1KBOA 1WPRA 2IEIA 3HN6A 1FXSA 4LHSA 4AJ2A 4KSCA 3VDQA 4J9VA 1L7NA 3C3JA 3PWTA 2PL5A 4O08A 2VHUA 5FH9A 2ASVA 2AD1A 5ELXA 4RZ2A 4C76A 3WKDA 2HA0A 4IIBA 4JLVA 3SM9A 4Q82A 2QV7A 1QLWA 3JAKB 3U4MA 5JAOA 3ZWCA 2FN3A 3PEEA 5EE5B 4CV2A 1P29A 4D92A 2QXTA 5IS2A 4G5XA 4CM1A 2JGLA 2OAEA 1DO8A 1RAGA 3DE7X 1H9CA 4WKGA 2C7VA 4MS1A 3FKJA 1X39A 1IHOA 3DMFA 4KRGA 2IQ5A 1VP9A 2LPMA 5EIHA 1KJ8A 1UOQA 2YZ2A 4H7DA 3PENA 3GMTA 2DHRA 1EE9A 1IXKA 1C4OA 1UXGA 1NOJA 5D84A 3FTCA 5I5GA 2OK7A 3OZIA 5K0BA 4NDNE 3BHIA 1QGZA 5CT8A 2FTKE 4RSGA 1LKZA 4R2HA 2A3RA 2EP8A 3C1OA 4GR4A 4X95A 3RIEA 3MT0A 3PGKA 2X5NA 1OXBB 2EGGA 2IYVA 1O6FA 4B80A 3NV9A 5BR1A 3KHUA 1BCSB 1PYGA 1NM5C 2GBLA 1PBNA 1RWXA 3OBIA 3U39A 2MSNA 3H8SA 3L6CA 2IYQA 2RB5A 4NONA 3IBCA 2GNOA 5F3DA 2K5UA 3TPZA 1W0JA 2QLNA 4QRHA 4A8TA 3CO5A 1DAIA 1QDLB 5DBHX 5SY6A 1OU4A 1ZH4A 2I4TA 1PG5A 4KR3A 2VS1A 4YT8A 4ZZ1A 3BAZA 4E2XA 3M4YA 3M6MD 1D4AA 2CB9A 4P33A 4OSPA 7YASA 5K2MA 4TWIA 1N6NA 3HSYA 3K5WA 5G2OA 5JCZA 3JQDA 1Y0BA 5DI3A 5HUQA 3KQPA 1P33A 3E3MA 1M74A 2KI5A 3RK0A 2DH5A 2D5BA 3MTBA 5LNK6 1UBEA 2PL9A 1B26A 3WK7A 3IE1A 1J00A 3IMFA 2CDNA 3HFRA 1E1DA 2JLYA 1F4PA 1A2KC 2P9GA 2CB0A 1RZ3A 4G9GA 4BJHB 5FL7D 3SM3A 3H86A 1RKVA 1ZU5A 4JVOA 3JZFA 4QULA 1CZOA 1LY1A 3TQCA 5H3CA 4P58A 2GA9A 3AFMA 3VH2A 3ZVLA 3KVRA 4CBVA 1CQJB 4I1IA 4QM7A 4R1QA 4D99A 2ZUBA 2ZUFA 1QIJA 1RRFA 5TMBA 2IUYA 2IYYA 1VE7A 1K98A 1NVUQ 2CUNA 3C98A 1SC3A 3GVHA 4JL5A 4YUVA 1U65A 2PX2A 4DG8A 3F6BX 5HUHA 4B8WA 4DADA 2IYWA 3T5CA 1YS7A 1XQXA 3IEIA 1GA1A 1GCUA 3OU7A 3BTVA 3G1UA 4RA9A 4EPYA 2YZNA 1KMHA 1FQJA 1TO2E 4DXAA 1TCCA 2CL5A 1EKXA 2RI0A 2B8NA 2XA1A 1OH7A 3V3TA 4A27A 1NVVQ 2I0FA 2X58A 4NAVA 4HH3C 1K92A 1M66A 1Y98A 3WI7A 5HYVA 2DQZA 3G7SA 3D0OA 4YFVA 3C3PA 2R5NA 3CB4A 2H2IA 3FUVA 5HBGA 4G84A 3B6IA 5ALWA 3IQEA 4JJZA 1L7PA 3PWZA 5EZ6B 3W8EA 4D9EA 2Q5EA 2F9FA 1BE1A 3LYLA 3B9RA 4Z9YA 4ND2A 1SN7A 3G13A 3MRTA 4F9EA 1GPKA 4BBPA 1QZUA 1RAIA 2HADA 2G77B 2JCXA 3GO4A 2PBZA 4RCVA 1I94B 1GQYA 3EGVA 3K1ZA 2VN8A 3IHTA 1J8QA 2AOWA 4RJ2A 1T9GR 1W2WB 3I9V1 3QLTA 1GDHA 1I4WA 1U8AA 2CUKA 3AB8A 2IPXA 1YIDA 3G2MA 3OOHA 3ECCA 2WJ6A 3TTTA 3NJRA 4UUAA 4G8CA 1ZI9A 4A6PA 5JH7F 5JI2E 3F73A 3OURA 4JEHA 3UUGA 2QAJA 3RRMA 1QHNA 4BZPA 1OYVA 2JJ1D 1W44A 3DOFA 4ABYA 2I2FA 3MQ4A 1E7WA 4JSRA 5HP4A 1Q7BA 3HLYA 1SUBA 5AHKA 1VA5A 2BT4A 2P2SA 3DVRX 4LE1A 5LIRA 3IEMA 3VX3A 2QG4A 2ZAGA 4F4DA 5CW2A 4B3XA 1PT7A 2FR8A 1DAMA 4I8IA 5JCXA 1HDOA 4G0YA 4MNTA 4WW0A 4KQHA 2ZR9A 3M6IA 4FGKA 2GLTA 2G9QA 3A6LA 1W2HA 4L8LA 4R31A 1WAMA 2Q4OA 3NXKA 4KPGA 1BWQA 2VT7A 1R0XA 4QTZA 3A0RB 5AHXA 4ARBA 4C0BA 4YUAA 5FJJA 1WUIS 1FP4B 1ECJA 1QTIA 1SKYB 1YA8A 4YUYA 3QJGA 3AVQA 4RD2A 2EFEB 4LVNA 2CFIA 3ZE2B 1STOA 1V2HE 5HEKA 3WK9A 1VIYA 5BNIA 3K9GA 1NKSA 4MV8A 2HA5A 5CX1B 2R1UA 2VNHA 4KKXB 1EM8B 4MWBA 1BJRE 4DM4A 1BS2A 2AD5A 4YP7A 4AKTA 4LG1A 2BM9A 4R7ZA 3ZV7A 1R4NA 1D1SA 4W5HA 1CSEE 3ZU2A 5JFOA 4WVLA 1RI4A 4A0GA 3EZ7A 4A2CA 4DIUA 1E3WA 2C82A 1XD2B 1C3JA 1BTOA 5DW3A 5P8WA 4JBYA 5BN4A 1V39A 4R51A 4V0ME 3W2EA 2XHEA 1PR1A 1WF3A 2REBA 2VL7A 3RU2A 4YMLA 3HVHA 3GZNB 5LA6B 3E8SA 4DPLA 1U6KA 3DZIA 5L4LA 2G1KA 4TKUB 1NE7A 3HUFA 1YE8A 3DFMA 3HRIA 5AIBA 2XQIA 2ZWPA 5H4GA 1LSOA 1O89A 2R6DA 4RXMA 4ID9A 3IDZA 4RABA 3KL4A 4YP1A 5AYVA 4D4MA 1H2AS 3G0BA 1F38A 4NHEA 3Q72A 1FIUA 4QDJA 1JECA 2EQ5A 4MPRA 1VHJA 4JP8A 1XRPA 1H2BA 2VDLB 2R87A 3WNVA 1XEWY 2XUPA 4KN5A 3NEPX 1V7ZA 5EZ5A 3OX3A 3EODA 1LBSA 6AT1A 2YV4A 4Q19A 1UM9B 2CNWA 5ESWA 5DKFA 3KYCB 4X60A 3Q8WA 3J7AC 3M0EA 2YYZA 2ABWA 3EVGA 1OKKD 3PDWA 3X2FA 3UMMA 2BH2A 2J0EA 3SS7X 4KLNA 1NNLA 4MDEA 4TRJA 1W2GA 1UMKA 1ULBA 4MV6A 2OG2A 5F5XA 4OQEA 5HZMA 5TEVA 3AEYA 1K0UA 3BM5A 1RQGA 4JDUA 4P22A 4FYYA 3EPRA 3FG9A 3HXTA 2HU2A 5JVDB 2W11A 4JI3B 3JALA 1I24A 3CINA 3WYGA 3KYJB 1VMKA 2AUMA 3OLVA 2F1IA 1MO3A 4JB0A 2EP7A 4M7WA 2FPRA 1ZLXA 1F0KA 1BEUB 1QFJA 4JKYA 1Z75A 2CLFB 2QUAA 5KAPA 4B32A 1N1GA 5DCYA 1CW2B 1HZZA 2WHPB 4QRDA 4QHYA 2G0NA 1ABEA 2FN4A 3EGDA 4K6MA 3WGLA 1PR5A 4H60A 2C97A 3T95A 2QTTA 3TI9A 2KBEA 2XBLA 4YPVA 1YVDA 4EPRA 4LS3A 1LI7A 5JARA 1M8FA 1KDTA 2PQ2A 2QMUA 2ZRFA 3KBBA 4OXNA 1I3NA 1Z6YA 4TS4A 3I2JA 4EMUA 5CGZA 1RWOA 1TIPA 5A9SB 1XD2A 1C4KA 1KQOA 4R9SA 1KJNA 1P39A 5AM2A 4O5OA 3A25A 1ONPA 3DO5A 3WSWA 4Z53A 4GOND 4DIFA 2WJVA 2X8LA 5I9TA 2K87A 5KJFA 1TYBE 4EFNA 5DWVA 1OX4A 1TMYA 4R2MA 1DHRA 4RTRA 3DT6A 1ODFA 1S2IA 3PVCA 3GFSA 3GLGE 3M2PA 3LQYA 1C4XA 2IYZA 4RJTA 3C3EA 2YY6A 1SVUA 3ASYA 1DG3A 4GPAA 4CKWA 5KDDA 1NR7A 1MB2A 3ON5A 4CMAA 2XQVA 3GJRA 1PGJA 4INPA 4ETNA 1CF9A 1OFTA 1M34A 1BVHA 3CJTA 1X2EA 2B1IA 2CMHA 3P0IA 4HB2A 1IM8A 4XUEA 2BMEA 1IEVA 3S6JA 3AV0B 2RB4A 3T61A 1ACMA 3EBPA 4NYJQ 2EL7A 4DV4B 1B15A 1KH3A 4LZJA 4MKHA 4UNNA 1LFDB 2P9JA 4K1XA 1KO4A 4LMRA 1VMDA 3AR6A 4OLHA 4JSTA 4Q9HA 4YRQA 5CTAA 2C0QA 2I87A 3GFOA 1UINA 5CIQA 1GSIA 4YWHA 2O5EA 1RACA 4CHGA 2JAWA 4ZD6A 1GQFA 4GMXA 1C1HA 2P75A 2VO1A 1S7GA 1SBTA 4RDHA 3VR4D 1R4ZA 1ESCA 3HR7A 1UJMA 2CXQA 1SOVA 3KXLA 2AOXA 4XWKA 5EHXA 4HDMA 4S0ZA 1Z15A 1J7KA 4UAVA 1JSRA 3STWA 3WTCA 3WZ2A 1AA6A 3ND5A 4FDAA 3HN7A 1GAWA 1KSHA 2YN0A 5JZOA 1MDBA 3V80A 5JOQA 1E1NA 2GHIA 1T5LA 1DAHA 1P3JA 1FS6A 1YU6A 5KIAA 3QE2A 4P81A 3WR5A 3D6HA 3LC0A 5JAMA 3KWFA 8MHTA 3DR3A 1AGRA 1QAMA 4R1LA 2ST1A 5LNK1 3L84A 3U26A 1Q2UA 2VSYA 4TQUS 4HRYA 4A3SA 4XYLA 4WLOA 1EVYA 3KJHA 4LMAA 5K0ZA 3IDQA 2NSDA 3KETA 3ESYA 3I5XA 2YX1A 1OHHD 4PRLA 1V8DA 5TQVA 3QX7A 3FGPA 3IB6A 1N6OA 1UR5A 1LF0A 4YAEA 4M1TA 3FSGA 3UM9A 1G6Q1 3QA3E 3D0RA 4PONA 1T4CA 4WZBA 1HDEA 2QM3A 4M55A 4NF2A 3REQB 3IAXA 3U2QA 2HMAA 4OU5A 3DKIA 4UC0A 2EXXA 2PR7A 3AUAA 3W5BA 2HH9A 3EMVA 1MAAA 2HBQA 2R97A 3LC2O 4FQ8A 3JQBA 1CHDA 5AK3A 3HE3A 3ND9A 3VPHA 4B85A 3ZE1B 4EVIA 1JQJC 3TDNA 1JRLA 4KR6A 4QTYA 5A5EA 4HZUB 3AR8A 4YWJA 3FJ1A 3ONEA 4ZU3A 1FSGA 2ZEJA 5HMMA 4KPYA 4L3VA 4Y67A 5HS4A 2PMBA 4ZCMA 2ZAYA 4MQUA 1PT9A 1U6JA 2C58A 4FVTA 1DEHA 2O48X 2EWMA 2IYFA 1GILA 3QKRB 3TNFA 3ZCSA 5A2GA 1OB5A 5LXTF 1QF6A 3MRXA 2CJWA 3COJA 3TLBA 1YS6A 3W9BA 2XNDA 3BMQB 3LWDA 2X0DA 2XQGA 4KQKA 1YB5A 3MLBA 5TQ2B 3EW9A 3OZDA 2J4DA 3UA4A 1T4CB 5JY1A 3V8QA 3VYTB 5A5VA 1EFRD 2RAPA 3T41A 3IQHX 4Z4GA 3ENNA 4E6PA 3KLOA 1AXEA 2R25B 3D2BA 4C88A 1K7SN 4JX9A 5L4SA 5EPUA 3GJSA 1MABB 4BE7B 1E59A 1B00A 1LLCA 3IR6A 3FTNA 3T94A 2F2TA 3Q8KA 4N8EA 1RC8A 1L4KA 3DNPA 4C4SA 3AQ4A 3LXMA 2PD3A 2XUHA 4Y9RA 3SSMA 2A67A 4B9EA 3H8VA 1N5RA 2SNIE 3LVRE 5AKLA 3A1VA 4JQYA 5CGQB 2QRVA 4ED9A 4LV5B 1ULHA 1Z4JA 2XUAA 1GG9A 3LCRA 3AX6A 3KYDB 2EJTA 5JQGF 3P4UA 2FPOA 1A4IA 1UT8A 1ZNQO 3EWNA 4PPYA 3RSSA 4BNYA 1U8YA 1N33B 1QGAA 4DDKA 3F5QA 1Z8DA 3ZXSA 2FPMA 3QFFA 5AICA 2YNMA 3FVWA 3QVOA 1AKEA 3AI7A 2ODPA 2W6ID 3PFWO 4IIHA 2PPLA 3WBKA 1I7QB 1I1QB 3MJTA 4BMCA 2UVDA 4P83A 1Z7EA 3D8HA 2AI3A 3QPUA 2VDMB 5GZ3A 5KYKA 5MN4A 3WGIA 3K6JA 1T8TA 3C0KA 1M5RA 1UWVA 1C41A 3VPSA 3S2FA 4YO7A 2NUAA 3TTWA 5IZCC 1DS6A 1ZOSA 4BZWA 1V9LA 3KAQA 4RV5A 5TEWA 5JEDA 4BU0A 1C7FA 1CG6A 2GM9A 2H4HA 2XNCA 4N6NA 4BASA 1UXJA 1XTZA 1AZTA 2B83A 4E5DA 3SQOA 1KDYA 1QE3A 1FMJA 2VYCA 5AKIA 2R6FA 2K6GA 3INRA 3PQCA 5HJ7A 1QFYA 3EIOA 1E4YA 3W78A 2VNKA 1EDDA 4K46A 1L4EA 5LLTA 3D5QA 4HWOA 4M76B 2PYZA 1C9NA 2ZBVA 1GN9A 1HNXB 5EY5B 1QCZA 3KCQA 2IUUA 5F9MA 4U7FA 4H6XA 1M75A 2BH9A 2Q1UA 4DV5B 5JNWA 1PJ2A 3A1EA 4ARAA 1E1MA 3B1JA 1A9PA 1E4VA 4IIDA 4YCDA 5EP2A 2O3SA 3CU5A 1RABA 3JATA 3V8MA 2E48A 4DSOA 4FIDA 5F78A 1BRMA 2PKRA 3ZY4A 4OV6B 1A82A 2I7CA 3PJFA 5L51A 4KREA 3GLTA 1N2JA 3QU4A 3TBKA 4Z2YA 3RGWS 2J3KA 1ISHA 1YS2X 4XWOA 1HTWA 3AJDA 2F3RA 1Q16A 2VUUA 2QW8A 1NYQA 3GIDA 2UDPA 4TMTA 2ZRCA 1S2LA 4N01A 4K9KA 3WWYA 3BK2A 2G4VA 3O2NA 3OOEA 4PGGA 4Q3CA 3TGWA 4DIEA 3QI2A 4DLBA 1TAQA 5D3MA 5BN5A 2WKQA 3NI2A 3RU9A 5IDYA 3W9YA 3L02A 4X8OA 2ZQ5A 1NTOA 4Q1EA 3EZ9A 5CJPA 3BILA 3UPUA 4NIMA 3IP9A 1OC2A 2I33A 3SBXA 3TIGA 3W79A 2PZBA 2WDPA 5B2FA 1IU9A 2Z83A 2XUJA 4I1YA 2GESA 1MQ9A 3HWWA 1Z0JA 1A7JA 4UDNA 4NDZA 1NWCA 1B14A 1T2DA 3KZOA 1NASA 2OBYA 2QVBA 4ZVQA 3PRKE 2AKEA 2D1RA 5H9VA 3BJMA 5TR9A 3ENWA 3MIIA 1Y5RA 3CEJA 1Z73A 1NDUA 2ZATA 4BHTA 1YD7A 3LUCA 5SYNA 1JFFA 1UAGA 1CUYA 4NESA 5EFZA 4LJKA 3O9MA 3A6PC 2VPQA 4RNDB 2CBXA 3OZFA 4HT3B 1BMTA 3I8XA 2VJMA 1DCKA 2ZBGA 1JQ5A 1JV2B 3HXLA 3DLBA 2O57A 2ZSEA 3KWJA 4OKIA 4BGDA 4I4IA 3THYA 1KYXA 5DK6A 3ZHOA 1UOEA 2JVJA 1PJLA 1U1CA 3OCWA 4XDZA 1QHYA 4GZLA 4C43A 2ATCA 2GX6A 1DOZA 1S4QA 1SC6A 3QEBZ 1HDZA 2RGNA 3F5SA 3O1IC 5JDCC 1U0NA 2J3MA 5EPOA 2SECE 3OM8A 5ELMA 3IODA 3D1JA 3W4KA 1O4WA 4LSWA 4C7XA 4O0LA 2X2EA 5JEEA 3I6MA 3BAFA 3IKVA 2I3GA 4LJSA 3T4XA 3UTCA 4R2JA 4KAAA 3IAS1 3ZU5A 3Q11A 1CUSA 1Y9JA 2Z2JA 3U44A 5AVVA 1T3TA 1H6AA 4O4JF 2OHGA 1PJQA 2DX7A 5CA0A 1Q0SA 2C59A 1GAEO 1RXUA 1ODSA 2LCFA 2YNMD 3PXCX 3IKLA 4I55F 3WKCA 1NG9A 4LY6A 2ZCJA 4OGGA 1Z63A 2Q6KA 2BFOA 3GPIA 2I1LA 4PZAA 1KOLA 2YQ5A 1DIOB 4YCNA 1E2PA 1AZSC 1P74A 3C7AA 3KR9A 3ZGLA 1LFAA 1ULAA 4DGSA 3MBOA 4YRIA 3IVRA 2RC6A 2MJLA 1XVTA 1HUQA 1LBEA 2C4HA 5DN6D 2XT0A 1T24A 2X1VA 3EGOA 3K0HA 4LBZA 3DTVD 1SCKA 5J58A 3H2HA 2ZPTX 1QIEA 5GJCA 2HX1A 5C8YF 2H3HA 5K4AA 1HLFA 1ZIOA 3CNBA 5FOUA 1H2HA 3LY9A 3BHMA 3Q5EA 5DEOA 1Z6PA 4IKPA 2NTJA 3PX3A 4ECAA 5KQSA 1OWNA 4MIYA 1UDXA 3CMMA 1KZ1A 3QPBA 3CSUA 4ZVNA 5LR6A 4BKPA 4ZALA 1V16B 3KTAA 1N77A 3HB9A 1EFRA 4N1AA 2JGDB 4AJEA 1EEXB 2UUCB 1AH2A 1I4DD 2H2WA 3WGHA 2G4LA 1RJEA 3NDJA 4QO7A 3GCGA 3SHVA 4DDUA 4GG1A 2NQTA 2AQKA 4FFMA 4AROA 2FKNA 5THQA 2AHRA 2J59A 3AT1A 4PYOA 3SF0A 5L40A 4JZYA 1A04A 1TTPB 4FUQA 3TM4A 1E8DA 3UJCA 4M1MA 4TM7A 4EBFA 4CT4B 4M0DA 3TTVA 2XWSA 4ANFA 1K0FA 4OPMA 2YWDA 3SIXA 3EY9A 1BCRB 2E4VA 1K66A 2WA2A 3QLVC 4FKBA 4JOCA 5ALMA 3UG6A 5I48A 3UHAA 5BNTA 2HA3A 4B48A 2PL3A 3QBEA 2PZ8A 3EBOA 5HIKA 1W1IA 4RY9A 1L4HA 2GUGA 1CP2A 1YRWA 2YNMC 4F4JA 1G291 4QARA 1DEAA 1XZDA 3SHQA 4CF6A 4NMWA 3F90A 4NZNA 3ABSB 3DM5A 1GG5A 2FI1A 2XDYA 4GKBA 3U31A 1S01A 2Z5LA 3BVPA 3U80A 4MMXB 3LCVB 4M8IA 4JJGA 2VNSA 4O33A 4X1OA 2ZGVA 4RTLA 1URPA 4P7GA 1J70A 4GMDA 3GYGA 3NH6A 1FNCA 1PYDA 4GWGA 1JQEA 1RM3A 1U9CA 4RYLA 1SVKA 2YTZA 2ZFUA 1T6BY 2IUEA 3A36A 1BOOA 3MINB 3PE3A 4LHEA 4ZIRA 3T1YB 5IKXA 2QRGA 1ZL2A 1XHEA 5G41A 2AG0A 4CCYA 4LWQA 4RNCA 2ANCA 1L5WA 2QYSA 5HKKD 5HOQA 4JI4B 2IS6A 2EERA 1G6OA 3T1TA 4G36A 4MV0A 5TMEA 2IGTA 3B2NA 2NO0A 2PWAA 3OTQA 1SY7A 2IYAA 2PH1A 1L6IA 2DECA 1B7GO 1U99A 3HS3A 2AE1A 1HFKA 3HI6A 1ZRHA 4RK6A 3NCTA 2WWXA 5BPHA 1SA0B 4IICA 3SQXA 4GOMD 5FBHA 2JGKA 1XRRA 4NE2A 4BBZA 4KCGA 4KFUA 1T4BA 4MS4B 1T0JB 3NM5A 2CL0X 1VPLA 4IIEA 5B3JA 5TRTA 1QO9A 3A11A 2X13A 3VVBA 4GL2A 3DLHA 1C2YA 2VP0A 2XBMA 3UKJA 1PQUA 2OZLA 5A62A 5F1OA 3T4UA 2HQ1A 3B6MA 4ZYVA 4FN5A 3EXHC 4JELA 4NCXA 4RM2A 1KJZA 1OPRA 1XZJA 1IJBA 2BP7A 2P5YA 2ZYAA 3EY4A 3H1AA 4KQWA 4HB4A 3U5ZB 5AH0A 1SR8A 3B1YA 1FCJA 4XR9A 3VM6A 4AWXA 4BAUA 1HT0A 5AOVA 2GHQA 4RKQA 2G25A 5LLDA 1V6SA 4WCVA 1CPYA 4PG5A 3ASVA 3I5UA 5ALSA 1Z22A 1SZJG 3M9XA 4ZK2A 3ROGA 3JD4A 3ENKA 3E9RA 5AMXA 1EVQA 4BV3A 5T4HA 2JLQA 3H18A 4X85A 1ZZGA 2IKSA 4DGQA 4Q05A 4KH1A 3CRNA 3WLOA 4HGPA 5DP2A 1F7VA 4Q6BA 3W06A 4Z4EA 3BFVA 3VTFA 3B38A 3RFCA 2YZGA 3R0ZA 2D1TA 3RSZA 1P8JA 3WOVA 4AY4A 1HT3A 1HE1C 1G2IA 4AZSA 2NACA 3NT5A 4CIVA 3A1TA 4DC1A 2QN7A 1FYWA 3PXEA 4I9NA 3QEMA 3H65A 4LY0A 3A2LA 4BX3A 4W5RA 2HHHB 3JQ9A 3GEHA 3OC0A 1K89A 4MUMA 4XQEA 2O8CA 3W0LB 4DB2A 2OHOA 2V9ZA 2FWIA 3H4VA 1A76A 3P0EA 3TIVA 1YQ9A 1L2TA 4ZJYA 1LX6A 3UWOA 4BY9E 3KKEA 4QHSA 2QGNA 4AMVA 1MF7A 1P5ZB 4PSCA 1PNQA 4AMUA 1WM1A 2RG1A 1XCPA 3WWEA 3I9MA 3GDFA 1QGUA 2IEBA 3I4LA 5KTSA 2QIOA 4Q00A 5ADUS 3F1LA 3OE5A 2EP5A 4WBSA 3S8YA 2Q6IA 3HVUA 2ZI5A 2YMPA 1L9KA 3C43A 2D2FA 5EWMA 3BJZA 3BFPA 1XRNA 1N4DA 1NBWB 1NAHA 5AJWA 3G89A 4C6TB 3DJFA 2MR5A 3FI0A 1T4MA 2HBYA 1W4LA 2KMLA 3BE6A 2CL6X 2JKVA 4HLUC 1IL0A 4IDHA 4K6KA 1I7LA 1I4OA 1KDVA 3VR1A 2RHRA 3J81A 1NQXA 4B3SB 2ZBEA 1Q0LA 4M1OA 4TUYB 4CGZA 1XKQA 3VU8A 3WHIA 3U40A 3FYSA 2DTXA 2NXNA 4I50B 4G1MB 2C61A 4MQFB 1QRUA 1BNCA 2NQ2C 5E7QA 2NZYA 3LUAA 5HDQA 1UK8A 5IK2A 3ZDZB 4FZJA 1EVLA 1LK5A 1NUHA 1SQFA 4DA7A 1G4UR 1BX1A 1LVUA 1EE1A 4DWWA 3OO0A 5DMHA 1F8XA 2AOTB 1XJCA 3NDIA 5HF8A 1J4AA 3GLQA 3OOSA 1N32B 3O8QA 4MJ7A 4ZANA 3O95A 3RDPA 3SEQA 2DXIA 4LF4B 3O1JC 4ISCA 4Z4HA 3RQIA 1XTVA 4ZV7A 3ZTTA 4S04A 4LF6B 1N9KA 2IGBA 3B1FA 2B9VA 2Y2VA 4HADA 4FSHA 4WBNF 2XAAA 1FP2A 2OP1A 4UOEA 2B3DA 4RH0A 4BFWA 2LXNA 4BAGA 3QHPA 1A71A 3QX8A 1LPNA 3GRRA 1GNTA 1FYFA 4HZGA 3L0DA 3UWPA 3MWYW 4WVFA 2NP7A 4S1WA 5A7FA 5K3BA 3KKOA 3HXQA 5JNSA 1NBOA 3D0KA 3N0RA 3C3MA 1KFBB 2GBPA 4HRVA 1IZZA 1MV8A 3B6ZA 3BK7A 1MG5A 4MH0R 4DV2B 2MINA 1ECLA 2C3OA 4LBVA 4KR0A 4P3OA 1XEWX 2IPMA 1JJIA 3DZHA 2XCLA 4ZMRA 5K0TA 4DSUA 4JMLA 3RS5A 3SZLA 4PGAA 1E89A 4PFSA 2HJGA 1PN3A 2PBFA 1O7JA 3SC3A 3BIXA 1ULZA 2QM0A 3WLIA 3M3PA 2FSVA 5JD3A 4BP3A 1GGKA 1FSSA 4ZP1A 4JYMA 1MJNA 1ZW6A 1IXYA 4JODA 4JYAB 3NRCA 1RLMA 3D81A 3EC2A 1J6UA 2VC2B 3P0RA 3LBAA 2H0QA 5BT9A 1JI0A 2Q3DA 4Z8XA 1GUZA 1ZH0A 2OZVA 2ZYSA 5GJBA 3UA3A 3DBRA 4E2WA 3WSTA 3DVQX 4ZMSA 4ZDIA 1LS1A 3FN4A 4MSUA 3OQ6A 1DC8A 4EZEA 1WWKA 1W36D 1B0ZA 2XMSA 3OMLA 2QUKA 2SHKA 3P9XA 1BQ4A 1VI2A 2VH2A 4R8LA 4XEUA 4D9IA 1E3JA 2ZANA 2NAFA 1GTJ1 4FX5A 3G2OA 1H66A 2IHYA 4PZZA 4F97A 3U4GA 4G0OA 4G5YA 2J6IA 1H1LA 1TFUA 2VOJA 2N46A 3LPNA 3CUTA 3FBGA 2HW8A 1X13A 2LUOA 1GCOA 1SH7A 4FZVA 1LZLA 3LHKA 4DBLC 1TUEA 2PZGA 1PSDA 1ICEA 3ILHA 1PFYA 1TCBA 1UBGA 2CLCX 3QK7A 1RKQA 4TMFA 1IEQA 5EJAA 2C3UA 2Q3CA 1RQ2A 1QAOA 2IBTA 1TZBA 3IEUA 3EWSA 3KHTA 4P82A 4PO8A 3A9WA 3EQ9A 4GOOD 2OFWA 1A9QA 1K2WA 2X2PA 5COQA 1S8FA 3PNOA 1CYEA 2WF6A 3NATA 3GUVA 2IP1A 3KYBA 3LLVA 4GYKA 1AOXA 2YVLA 4UNPA 1Q11A 1UJBA 5JJLA 4D7AA 3SQWA 4W1QA 4QFMA 4QFBA 1XRSB 4R1MA 1E7SA 1TGVA 4DT1B 4EUFA 2B1JA 3GLFB 1RFLA 1RW4A 4B2LA 1G20B 2EWWA 4LWPA 3D3KA 4Y2YA 4EG6A 2XJ4A 2Q2NA 2MT9A 1IVNA 3K70C 3KSUA 3KOXA 4DYHA 1WLSA 3OQOA 1DKUA 3RFFA 2C2ZA 3GP5A 1VJ1A 3HMKA 2C0CA 1L7QA 5CW1A 4GGPA 2ZSBA 3GJQA 1KQNA 3TNYA 2XKJE 4CCWA 4NV3A 4F1JA 1OW3B 5CFNA 4L4YA 3M1IA 1O94D 5IKOA 5KREA 1WOYA 1YL5A 1Y1LA 3OT5A 5E6SA 5HKLA 1A1SA 2X9NA 3AF5A 3U3ZA 5BMVF <