1RRPA

Structure of the ran-gppnhp-ranbd1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
204
structure length
204
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Ran-binding domain complexed with Ran bound to a GTP analogue: implications for nuclear transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (small gtpase/nuclear protein)
molecule keywords RAN
total genus 53
structure length 204
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rrpA00
4BLTA 5JWRA 5DHFA 1N6LA 2ORVA 3U7GA 1AZTA 1OIWA 4HLCA 1F5NA 3A1WA 1L8QA 2OSBA 3K0CC 4TQAA 5EZ6B 3DMNA 1ZM3A 1DAIA 4LWZA 4TT3A 3QXXA 3NKVA 2ZREA 3Q5DA 2ZSEA 3F5FA 2D06A 3K70D 4CT4B 2DR3A 4A15A 2GVZC 1JB1A 5SZJA 2WSSD 2W6JA 5DE3A 1SKYB 2IC5A 3U6BA 1EG7A 4GI7A 4OI2A 3ZVLA 3EA5A 5EXPA 3U61B 2QUZA 1P72A 4H9GA 3QF4A 1IONA 3HP1A 2OESA 2PZGA 2FE4A 3SEAA 3TUIC 4EPYA 1KO1A 1DOAA 4NH0A 3P4XA 2B8TA 2C9YA 2FFQA 3AP1A 4OK3A 1VHTA 4OHXA 3EPJA 1SQ5A 4AG6A 3KQLA 4POAA 1T3LA 4BRWA 3AQ4A 2ZE6A 2O52A 2ZRLA 2EYQA 4NBSA 1ZNXA 3HU3A 1K6MA 4B32A 2O8BB 2XOKA 2CJWB 4KHZA 3NH6A 3TLXA 1ZD8A 3W3ZB 4G3XA 2FH5B 2LKDA 2OE2A 3KKOA 2DWQA 3R7WB 1F2UA 4EPTA 2AFIE 3V00A 2O5VA 3N5CA 4PC7A 1ZD9A 2H8KA 2QG6A 1NI3A 1CJKC 5SZKB 4RFSA 2H92A 5C4MA 4P4SB 1M34E 1A2BA 3JVVA 1GILA 1FFHA 1GSIA 2RGXA 3BH7A 2H1LA 2WKRA 1ELOA 4Q9KA 3K0CA 3GLHA 1MOZA 3CX8A 1G291 3PEUA 1HT1E 4C3ZA 3BAFA 3HU1A 2BVNA 4C2TA 3DOFA 3LY5A 1D6JA 5EP3A 5JEEA 1Q1EA 5FI0B 4Q7MB 2CE7A 5FTNA 2CVFA 3EZ9A 3K1JA 1D2NA 2VPPA 4DT1A 1E94E 4B6EA 3BRWD 3NEYA 3QENA 4Q1BA 3PEWA 3A1SA 1NBME 3NDPA 5EQTA 2R6AA 1XMSA 3K0FB 2BBWA 2W6ID 3U60B 2BMFA 4ESHA 1ODFA 3LDAA 4CGZA 2PLFA 3LBHA 4MKHA 5EE0A 4BLOA 3VNVA 2QENA 1OXVA 3LBIA 1R10A 3IO3A 5CDFE 2RGCA 3TAUA 1CJUC 2IHYA 5JECA 1H8HD 1WF3A 1NF3A 3CF0A 1AKYA 2JLXA 3W6NA 2VSOA 1VPLA 4ZIRA 1G6OA 5AJWA 3X1DA 2W0MA 3AKCA 4LBWA 1GZSA 1CEEA 4LI0A 1E2JA 4LJ6A 5TMPA 3PUVA 3WMEA 3EZ2A 1GVNB 4MA4A 4YMWA 3CH5A 3IKJA 1FP7A 3IPYA 2GJ9A 4YC7A 1N5LA 3GD7A 4MRNA 1CP2A 1P9WA 2WTUA 1F3OA 1JQJC 1X6VA 3X1WA 1JXMA 1N0VC 3UXMA 1TQ2A 1EX6A 1HT2E 3KXIA 1NN5A 5KUTA 1CULC 1E9SA 2GEUA 1DBSA 1KI1A 3C4JA 3TJZA 4EUNA 4PZZA 2R6GA 2WWWA 4Q9IA 4XD7A 1XD2A 4MGZR 2RH5A 4WA7A 4KITB 1XJ0A 3QKRB 2ZPTX 5TXGA 4UNPA 2C8VA 5DIFA 1IN7A 3T35A 4A36A 4YMTA 5FUWA 1HA3A 4L15A 2ZRNA 2ZXUA 2PMKA 5HCIA 2Z83A 4YDHB 1NLFA 4G01B 1N0UA 4QHTA 3VR2A 3WP0A 1ZM2A 2GTPA 4JZKA 4OHZA 1E99A 2GA8A 3SQXA 5LDDC 5KSOA 1RFLA 1Q1QA 2VHJA 5BQ5A 2J41A 4HZUA 1QHSA 1FTNA 3TSZA 2ZRDA 5FTMA 2OUKA 3V9PA 1KJWA 2QPAA 4HATA 1XU4A 1U0LA 4KV9A 2N1BA 5FUXA 3U7FB 4OHWA 1IOZA 4LY6A 3AVUA 4YMVA 4E22A 3Q85A 5FOUA 2ZI9A 3TNFA 2R65A 3E5HA 4OQMA 2QM8A 2VF8A 1SVIA 3VAAA 3UMRA 3MWJA 3MAAC 4JMPA 4Q01A 5BXQC 1JR3A 1HQYE 1PLJA 2JJ2D 4F4IA 2GKSA 1PJRA 4Q4JB 3FHOA 2ZR0A 1JR6A 4FMDB 4QHYA 2FSFA 5FOVA 3RYTC 3L0IB 3B7GA 2BEKA 2BCGY 1S4QA 3DM9B 4G1UC 5JEDA 1NL3A 1WXQA 4BGDA 5E95A 3GJ4A 1HUQA 3T1OA 4IDPA 1KK2A 3VU9A 5BN4A 2BDTA 1US8A 4KODA 2ZRIA 1P6XA 3AUXA 3RABA 3QNUA 2V8OA 2RKOA 3B9PA 3IHLA 1YR7A 2CL7X 4JLKA 3GLIE 3KX2A 4GMXA 3AF0A 2AL7A 2OCYC 2ZRKA 3DEFA 4M22A 3CM0A 5CDFA 1KO7A 1WP9A 4I1VA 2V54A 4GZLA 4BQSA 4TTPA 1N6HA 1G4AE 4LJ5A 2WVJA 4P4UA 3B1XA 4YLGA 1RRGA 3LVRE 1K5GA 1R6BX 3NHBA 2ZAOA 3SC3A 1FX0B 1Q22A 3OFND 2ANCA 2ZUBA 3VQTA 5JHGB 4HLDA 1PUJA 1G20E 3KJHA 2Q0HA 3B1ZA 4QGGA 3LX5A 4H1VA 4A9AA 2R62A 4C30A 1CRPA 4C0HA 5F2EA 1XF9A 1N5IA 1BKDR 1J2JA 2VHQA 3RC3A 3QSYA 1CXZA 1JEDA 1YU9A 5DYIA 2CEAA 3QG1A 4XTRA 5IF9A 2IEYA 1KNXA 1ZD1A 2J9RA 3QIAA 2OBLA 3NDBB 1S1MA 1UKZA 3REGA 1TF5A 2JLVA 3KXLA 1AM4D 2QQEA 2B7BA 4ZDWA 1TMKA 1M1YE 3T1TA 2WJIA 4GMDA 2A5YB 4FMCB 3GJ3A 1NSFA 3ZYCA 2O8EB 1IJFA 4IDQA 2IYTA 4IVPA 1BS1A 2I1VB 3QKTA 3WBKA 5FL7D 1GL9B 2BBTA 1RJ9B 3LVQE 4KFRA 3OIWA 3TR5A 3GEHA 1E0JA 2P6RA 4PO1A 2AFHE 3CWQA 4WAUA 4DDWA 2WWIA 1HH4A 1KMHA 1OPXA 1YRBA 2WMOB 2CXXA 3BWDD 5FFMA 1XPUA 4ZCIA 1QZXA 3DZDA 4XVQA 3VR1A 5L3QA 1P5ZB 4JBWA 5J47A 2VP6A 5DH9A 2GXAA 1TTTA 5EP1A 2J0VA 1SVWA 3GJ8A 1V5WA 4FD2A 1OXSC 4Q1AA 3DPUA 3K0EA 4FINA 2FZ4A 2V3CC 4TTQA 5KO2A 1OH5A 2O8DB 4FXPA 2QMUA 1L4UA 2NGRA 4U00A 3UATA 2QTFA 1XD9A 4JL5A 5D3QA 3W90A 1OT3A 1ZMXA 2ZYVX 2A5GA 1KMQA 4TWZA 3LH5A 5SZHB 1W4RA 1ZNYA 1YZLA 1KAOA 1GAJA 1Z0JA 2V9PA 5LPNA 3IQXA 2A78A 2ZETA 1QHGA 3D31A 4UXJA 3FGNA 2AKAB 1L7VC 3U4QB 4AG5A 1D9XA 1DARA 4L9SA 4Q48A 4XWOA 4MH0R 1SKYE 2ZRCA 3HDTA 5DN6A 1E2HA 1G4UR 4Q02A 3K0AA 2ZJAA 4V0LA 4DLXA 1J8YF 3IEVA 2UKDA 4NCKA 2IWHA 4EJSA 1E96A 1G18A 4QNRA 1KSHA 1AQUA 1S9DA 4DRZA 2IHBA 1U8AA 1E2PA 4Q4JA 3AF1A 5LBIA 3L8YA 4URXR 3CNNA 2ASEA 2P2LA 5TV2A 2XNDD 1JEEA 4TMKA 2WJJA 2CLCX 1S9HA 5BW8A 5M04A 3I62A 3AF4A 3HWSA 4DIEA 3K53A 2DWPA 4BPBA 4OI1A 1G5TA 1KYIA 4HLQB 4NU0A 2FN4A 3O8RA 1J99A 3N70A 3W6OA 4K8OA 4URZR 4QGFA 2DFNA 1WDTA 1YZQA 3RS0A 2KI5A 3HR8A 3I4LA 2QPTA 3M4YA 4FCWA 4NZYA 4PXAA 2JJ8A 4A82A 1FW6A 3U5ZB 3RSOA 4AKHA 1I4DD 3Q5EA 2OHFA 3W5JA 5DI9A 3K9GA 4HDOB 1D2EA 2GDJA 2O8FB 2VP4A 2KE5A 3A4NA 2ZSDA 2OO7A 1VKJA 3C41J 2B6HA 4AKEA 2F43A 2PEZA 3NIBA 4BFZA 4M1MA 1QHYA 2CJWA 1E79A 1E2NA 3IQWA 1KI6B 5C18A 4GRAA 2ZJYA 3CO5A 5L3SB 2ERYA 2ZS7A 4M1WA 1N6PA 3BB1A 5K8LA 5FBLB 2N42A 3TMKA 5L3RA 3MUFA 2Q6TA 1ONBA 3VR3A 2GZHA 4M1YA 2G1KA 1W4BA 2ZRGA 4XWAA 4IRUB 1NNEA 2GRJA 3I3SR 4FW9A 4U02A 1XXHB 3KJIA 4Q1FA 2ATXA 5A5GA 2O8CB 3KQNA 1Z6XA 3ZZ0A 1E9EA 1AS3A 4URUR 2QT0A 1E3MA 2ZSFA 3AB3A 3WXMA 4Q7JB 4LGMA 3U3MA 3KZ1E 1Q1ZA 2HYDA 2YOGA 4M21A 2OAQ1 2VSXA 1QG4A 2ZU6A 3EPHA 3H84A 2ZTSA 3DDCA 5CB8A 3VKHA 2QQ0A 4R7ZA 2DY1A 4B3GA 1QF9A 1II8A 2NZJA 3O8BA 2J0UA 1XEWX 1Z28A 2OLKA 5UKDA 5KDOA 1E69A 4Q4HA 3CF2A 1AA9A 3RHFA 3PV0A 4GP6A 4TSFD 2DPXA 2F1JA 2REXB 4Q47A 2NO6A 4W7SA 3CF6R 4PZYA 3ZJYA 3AF3A 3BERA 4NYMQ 1I2DA 1MO5A 4TYPA 4QM7A 4JLMA 4CYMA 2ODNA 4N1AA 1E9DA 4NCNA 3SE0A 1II0A 3LQRA 4RZUA 3I72A 1G8HA 2XTZA 3K9HA 4OQNA 5K8IA 2JLUA 4R98A 3CZQA 3I8SA 4IOKA 4TTRA 2C77A 5CJPA 1KO8A 1NLYA 4NMMA 1KI6A 4WXRA 2J59A 4GZMA 1WB9A 2D62A 3CR8A 1OIXA 5DN6D 2W6IA 1ZUHA 2XJ9A 1Z0DA 4NHOA 3CNLA 4QGHA 4W5HA 4TMXA 1W36C 2YV5A 5KYKA 3KTAA 1CJVC 4DEYA 4Y0AA 3KQUA 3VMFA 4MRSA 4XJXA 3ONWA 2C95A 3GCGA 1T3HA 1N2CE 2GWHA 4NYJQ 4W5JA 5HTKA 3WYAA 4IFBA 1SULA 2PZEA 3BE4A 1P3JA 4Q1DA 2IYLD 3NXSA 4AYWA 3KKPA 2DB3A 4KBGA 4EFLA 2QN6A 2LKCA 3GPLA 3THYB 3MJRA 1H65A 4PC1A 1PV4A 5CM9C 1QDEA 3SFVA 5A4JA 1X8JA 4KYIB 1WBBA 2O8EA 4EKDA 2VP0A 2VRWA 1QHNA 5HE8A 5FPSA 1XZQA 2P3SA 2WIBA 1JPJA 5D3MA 4TZ6A 2XTMA 3K70C 3KDSE 2QAGC 1KI2A 1KMHB 4PSKA 2IX3A 2ZRAA 2B92A 2I4IA 3BS4A 5B64A 2QM7A 3NH9A 4X8HA 2EFGA 2JIZA 2MSEB 4FWTA 4LV8B 1XP8A 1KY2A 2FZLA 2AXNA 1S96A 4RD0A 2R6DA 2RHMA 2CNWD 3BORA 3VNUA 1SKQA 1OYWA 2O8FA 4C4PA 1SXJD 3DVLA 2ZJ5A 2OCAA 2Q3FA 1O3YA 1NBMA 1DTSA 5GADl 3KJGA 2X1VA 2FU5C 5L8VA 1M6NA 1GG2A 1OHHA 3C7KA 1JPNA 2DFTA 1WMSA 2QMEA 1JQLB 2FMXA 2VP9A 4V0NA 3PR1A 2XNSA 3F0TA 2GVDC 4JVMA 4QM6A 1XTQA 3ZZTA 2QAJA 1G19A 1P62B 3SR0A 4IOLA 1OFHA 3ZVMA 4P32A 3L0SA 2QMOA 4FCVA 4F7WA 2NTYC 3FTQA 4OQFA 1R5NA 2KBEA 2ZYUX 3CNOA 5AJYA 3U3KA 2JDID 5B57C 2QEQA 3RS2A 4TT3D 5KSPA 3ZGXA 4W5WA 4PR0A 5FBRB 2GESA 4MDFA 2MMGA 3QOFA 4XIGS 1A82A 4D0GA 3B2EA 421PA 2GJAA 2ZYWX 1EFRA 4TLDA 2J87A 4JKIA 3BB4A 4A4DA 4KAXA 1KI7A 2WKPA 1R2QA 4ZO4A 8OHMA 5J4LA 1DELA 3DKPA 2Z6VA 2IYWA 2C78A 4KLNA 2CL6X 4RZ2A 4TMWA 121PA 1FUKA 4ZKEA 4Q4LA 1P75A 3IBYA 1KSFX 3UANA 4HEJA 2E1RA 4OJQA 2FPMA 3B1VA 3DO6A 2D74A 4LZZA 1OHHD 3CPHA 4YXWD 4AY2A 5HKKD 5EP4A 5BN3A 3ZLJA 1MRSA 1XRJA 4KCGA 1W2HA 3WNCA 1KI4A 1MABA 4J0QA 5FR2A 2QBYA 1VYVA 1B0UA 1SHKA 3U7HB 4D81A 2VTKA 3TSWA 3SYNA 2XGJA 2AR7A 1UBGA 5AUQA 4Q4AA 2OCPA 2JIZD 4N3NA 2XZLA 1R8SA 3D6TB 3OIUA 1Y3AA 3UG6A 4DUGA 4C7OB 1NRJB 3E1SA 4O2RA 4LV5B 1Q57A 1T0HB 1ZU4A 4DCNA 3AVYA 621PA 1G8PA 1ZW6A 5DISB 1X3SA 3A1UA 3EASA 2JLYA 2QAGA 2J1LA 2FEOA 3HR7A 3IDQA 5FOWA 2W00A 1R0XA 3MSXA 4OI4A 3IGFA 4EJSC 4JT2A 1ZYUA 3GEIA 1ZC3A 2MSCB 4P3YA 4HB4A 1E0KA 3WHKA 1ZM7A 4QFMA 1RJ9A 3K09A 4Q21A 5JWOA 2J5XA 2P0EA 1N25A 2WM9B 3GJ6A 3IIMA 1G9XA 5C46F 1TADA 3WBJA 1II8B 4HAZA 4TSFA 1UDWA 2H57A 1VMAA 5LB4A 4PHHA 1VYUA 4PQRA 5FBQB 1XCMA 1FQKA 4C0LA 3QEOA 3SJAA 2V55B 1BH2A 1TEXA 3TQCA 4XTCS 4IVRA 1TEVA 1ZC4A 2P6NA 2BBSA 4ZI3A 1EGAA 3KKMA 1DAHA 1KO5A 3Q7PA 4LSGA 4RFSB 1UKYA 3AVTA 1CS4C 3L0OA 4EQ6A 2A3RA 1IM2A 2DWOA 1ZRHA 1D8TA 3BBPA 4XD7D 4FMBB 3QKSB 3GLIA 1E1QD 2ZIAA 2Q9CA 3SYLA 4TYNA 3BB3A 1NLZA 3EIHA 2ZU0C 4MRPA 2ZI6A 2ECKA 4ZIRB 1Q3HA 3U44B 1OKKD 2G3YA 2J0SA 3L82B 1LS1A 3BFVA 2JJ1A 2FA9A 3BIFA 2IBMA 1G41A 3C5HA 3A58B 3VX4A 1TX4B 2GJSA 4B75A 1RRCA 3EW9A 3QPUA 1RC8A 4E07A 3H86A 4MKGA 5DO9A 1RZ3A 3AVPA 1UF9A 2JJ2A 4GSYA 4MKIA 2VQSA 5E7JA 1AIPA 4AIIA 2E9SA 1M74A 4HAYA 1P7CA 1KKLA 1DAFA 3BH6A 5DSZA 3PCRB 2HLDA 2OCBA 1JAIA 1GL6A 1GUAA 5CYOA 2QMHA 4EAQA 2FWRA 2ATVA 1YZNA 1UFQA 2KJQA 3BK7A 3B85A 4M2LA 4TL6A 5CK4A 2GK7A 2YWFA 2R6CA 2IK8A 5JMTA 1W0KD 5L3QB 1XTKA 1M7BA 3ZQ6A 4HAVA 2A7QA 4F4JA 4RD6A 4DLYA 4BFSA 3W8NA 4LPSA 1XEXB 1GFIA 3WNDA 3Q3JB 4EIWA 5JI2E 5G41A 4ACBA 4BRUA 2D2FA 2XZPA 4LYFA 1N6RA 2F7SA 1OB5A 4ITRC 1ZJ6A 4LYHA 1P9RA 4RD3A 3GLGA 1XWIA 5BYKA 1NG9A 2HT6A 1LNZA 3SU8A 4U7DA 2ORWA 4M8NE 3U6KA 3CRMA 4Q5IA 4IKEA 1A1VA 4Q03A 3TRFA 3OZXA 3OEEA 3PITA 1N5KA 3ND8A 1XTRA 1EFUA 4HAWA 2RCNA 2VL7A 4P31A 2WHXA 4MKFA 1BOFA 3H2YA 2IS4A 4LYAA 2Z4SA 1X8LA 5B30A 2HXSA 1Z3IX 3X1XA 1MH1A 4JLNA 3GQBA 4JVSB 2IWRA 2EYUA 1W2GA 4MUAA 4WBSA 5FPYA 3ZIAA 2C98A 2P5SA 1JAHA 3LLMA 5CK5A 2ZI7A 5AJXA 4IJMA 3AP2A 2KWIA 2DBYA 4DLRA 2IXGA 1F6BA 2QI9C 3SFZA 3RWMB 5GVRA 4I4LA 4Z1MD 2VHUA 3TW8B 5JBQA 3SI7A 1EX7A 2VEDA 3LXXA 1GRRA 1KI3A 3NG1A 4TYYA 1KZGB 2R6FA 3QKSA 5IRCD 2VHCA 4C0AC 1T91A 1E2IA 4ARZB 2YWHA 4B47A 2CCJA 2P65A 5JSZA 3J81k 1KY3A 3CIOA 5J5CA 5KDDA 4MRVA 3GLFE 4HUQB 4URWR 2ZITA 5FUYA 1MRNA 2OBNA 4DLUA 4DLWA 1H8HA 3LW8A 4G5RA 1AGPA 1IY1A 5AWFC 2J7KA 1KDOA 2O0HA 1IBRA 1AQYA 5J4KA 1GRNA 1TPZA 1EK0A 5JCZA 5G3ZA 3HPRA 2G88A 4AK9A 3AVWA 2WPDD 1COWA 3RS4A 1WBDA 1E6CA 1KI9A 2MSDB 3QBTA 4ABYA 1NY6A 2QORA 4EJSB 2AK3A 3NTUA 2WAXA 5HR5A 5DLQC 1ZM4A 3TH5A 4L16A 1G7RA 3FMOB 3PUXA 1OSNA 1HV8A 1E1RA 2ZVPX 3Q7QA 5DGXA 4DLZA 1TU3A 2RGNC 3LW7A 3TSOA 3WP1B 2D7CA 1GKYA 3TIFA 4CEHB 3AGQA 1W47A 1E1RD 3ETLA 1NMXA 1QHXA 1SVKA 3QVUA 4PZLA 4QL3A 4DWJA 2RGGA 1U0JA 4HAUA 2IUTA 1G5PA 4US0R 5FTKA 2FJUA 2L0XA 1TQDA 3TUJC 3EWAA 1G64A 5G40A 5TVKA 1W36D 1IXZA 1PLLA 1R5BA 2D2EA 2Z5FA 4L4UA 4V0KA 3VHXA 3SZRA 5LB2A 2D3WA 4NDZA 2Q3MA 1W36B 4N0EA 4DB2A 3G5UA 1HE1C 4LJAA 4B44A 3K0FA 2KSQA 4NYIR 4ZPXA 4NP6A 1EFHA 1OB2A 1HQCA 1RYHA 3MGCA 3RS5A 3G0HA 3R8FA 1XBTA 4HLUC 3ZD6A 5KHOC 1Z0IA 4EPWA 4OQLA 2O0KA 4AKIA 3K0AB 2GK6A 5F98A 4LRWA 3SNHA 2ZR7A 5KPDA 1E9FA 2CHVA 2CK3A 5ANRB 1V43A 3SJZA 3PXGA 2F9MA 2PCLA 3EAQA 4B74A 2XSZD 2W6JD 1DS6A 1RIFA 3P26A 4FN5A 3TGPA 2OV2A 4DC9A 3CKLA 5CYPA 2V1XA 1F2TA 2CHQA 3P20A 1T5LA 1L4YA 2K5UA 4QOSA 4G5SA 5FBWB 5JFGA 4F38A 5FTLA 2QTVB 4G5OA 2BKEA 2DYKA 3L43A 4V0OA 4M1SA 1EFRD 4MGIR 4TQ9A 3D3QA 1ZIPA 3DOEA 5KOYA 4D0LB 4C0SA 2BEJA 1QBKC 3CONA 2QPOA 4A8JA 3U7EB 4DCVA 1S3GA 2F55A 5EUQB 2GNOA 3A6PC 1GOTA 1IJEA 4DJTA 2XOKD 2Z43A 1COWD 2EQBA 2KB0A 4PC6A 2OT3B 2VA8A 3CBQA 1YVDA 4URYR 1G3IA 3JZMA 3OEED 1C4OA 2DHRA 4KBFA 3VTKA 5JJIA 1XMVA 2Q9AA 3GLFA 1BO6A 4UNSA 2YC2C 1DPFA 2A2ZA 3GFPA 1KDTA 2CK3D 2WOJA 4LHXA 1N3BA 3K8YA 1Q21A 5AJVB 4JVLA 6Q21A 1A7JA 4P4TA 5E7IA 4DLVA 2W2VA 2HXYA 2MMCA 3PJRA 4B71A 1LFDB 1LVGA 2EW1A 3THWA 3GFOA 2GCPA 2UVQA 5K8UA 2OLJA 2WIAA 4NL4H 2GAAA 4A1FA 2HT1A 2JASA 1JR3E 1XCPA 821PA 2I1QA 5FH9A 1CR4A 4B2IA 2VF7A 3C8UA 3IPXA 4DCSA 5JLJA 1N5JA 1GRQA 1JR3D 2O0JA 3B60A 4YDSA 4PO9A 3T5GA 2OXCA 4LHYA 4D4MA 1KKMA 1W49A 2AD1A 2PT7A 4I99A 5KSYA 4DCUA 2CLSA 1GNPA 2P6UA 5B58C 4B48A 3LAWA 4PHFA 3FHCB 1SVMA 3HJNA 4KU4A 4I1UA 3I5YA 3GFTA 3K9NA 2A5FA 5CLLA 4XH9B 2IYRA 2XB4A 2X2EA 3QKUA 5A0FA 1R0YA 3CWZA 3T06B 5HE9A 3HYRA 1XPOA 3QG5A 1KK0A 1P4SA 2QROA 2QZ4A 3T1VA 1UBFA 5FBVB 1ESMA 3SHWA 1MV5A 4Z51A 3U44A 4TLBA 1E1QA 2PMDA 1J90A 1KZ7B 2CVHA 1FMJA 3BH0A 1NBMD 1VDZA 2WICA 2DCUA 3T34A 2ZE8A 2ZE7A 3FVQA 3RWOA 3C14C 4LBYA 5KNCA 5TY0A 3BXZA 1R5OA 4KVAA 1DE0A 1VIYA 4O3MA 4Q1EA 2JATA 4JLBA 4UKDA 3WHLA 4OQXA 2ZVQX 3PIRA 3QBVA 3KQKA 4JJZA 2V7QD 2UZIR 4A0HA 4H1UA 1P2VA 2GZAA 3D7MA 4LC0A 4QJ4A 3GLGE 2BM0A 3KFXA 3IUYA 5EE1A 4WXPA 3GLGB 2BC9A 3BFKA 1NVWQ 4EQ6B 3WRXC 2AWNA 2OXRA 2XZOA 1TAGA 2CHGA 4TLAA 4QC2A 4V0ME 5EE5B 5C4GB 3TE6A 3RAPR 3IIJA 1A2KC 3EARA 3FFAA 2BCJQ 2YWEA 5DHAA 4WVFA 2FSHA 3QF7A 4BASA 4OYHA 3THYA 4LJ4A 2QNRA 2QGZA 1N0WA 1TF2A 2HCBA 4B73A 2HEIA 2ZE5A 4CZ2A 5CLQA 3AP3A 2R44A 1W46A 4LJ9A 1W7AA 3O8DA 1G7SA 5EP2A 1Z47A 2BM1A 4UJ3A 2QRNA 1OYYA 2GILA 2HJVA 3ICQB 1SVSA 1UADA 4GFDA 3NVAA 4S2EA 5J40A 3CRRA 5KNBA 1R8QA 1G1MA 3R9IA 1J8MF 1NKSA 2HCJB 3LV8A 4NYJR 4BEJA 2BWJA 1C9KA 3DL0A 3ADDA 4AURA 4X8OA 3SDZA 2ZUCA 4MYCA 4A0RA 1GNQA 1E2DA 3CH4B 4E5UA 4GNKA 2OBMA 1Z0KA 3QKRA 2R2AA 1MABB 1KI8A 1Z8FA 4TZ0A 1QRAA 2F1IA 4KSCA 3RRYA 4DLTA 3RRNA 4ESVA 3U3JA 4X8LA 4TMTA 3D8BA 2VYFA 5EXSA 1NKTA 3EZFA 1E2GA 4Q4AB 3RLFA 1FL9A 1BYUA 1B23P 1S8FA 4HLUA 3FWYA 3RRMA 3SQWA 1Z22A 3EZ6A 2QE7A 3DM5A 3VKGA 3VFDA 1XTJA 4KVGA 2D4HA 2REOA 4R2HA 5H8WA 3QXJA 4HB3A 2X77A 2FNAA 1G8GA 1YZKA 1S3SA 5AJZA 2YNMA 2GBLA 1T0JB 2ZR9A 2QU8A 1MKYA 2GJ8A 1IAQA 1XTIA 2G1JA 4B33A 1NSTA 3KUDA 2IA5A 4D6PA 1AJEA 5E4FA 1RRPA 3LNCA 4RSGA 3X2SA 2IYYA 1OFTA 3IEUA 1W4CA 4JLJA 1RKBA 1TL7C 4BLPA 2WSMA 3KB2A 3RS3A 2P67A 3B13B 1X8KA 3ZS8A 4MITA 2IXFA 1OKKA 2XNDA 2QA5A 1MO3A 3FMIA 4B76A 1UM8A 3B1YA 1D5CA 1HTWA 1OV4A 4DLSA 2UZ3A 3GLFB 1KHTA 1DAGA 4HDCA 4BZQA 2PCJA 2RGNA 2GEDA 2ZJBA 3K09C 4XVRA 2IS6A 1U99A 4D25A 4RKFA 3B5JA 1EESA 1AN0A 3FHTA 4QJ5A 1YQTA 3X1YA 4PHTA 5FOTA 4O25A 2IS2A 1CR0A 2RGAA 2J7PD 1W48A 5L3VA 1E2EA 2HYIC 1VCNA 3VR6A 5JJLA 2O8CA 4IDHA 1SVOA 4BLSA 2XB2A 2V6JA 1ESNA 3GLIB 2NMVA 4CIDA 1CJMA 3CB4A 2ODBA 4PPGA 5AUNB 4GP7A 4BZXA 1F60A 4MYTA 3T12A 1JI0A 1F2TB 2RGDA 3CX6A 4WZAE 1YR9A 3K0SA 1LF0A 1P2TA 3A37A 1FMLA 1Z6YA 3AVXA 2OEPA 1ZAKA 2ZSAA 2EFCB 4A8JC 2B7CA 2ZRMA 5B2ZA 3A1TA 1U94A 4JL8A 4G5QA 4KXFB 4OK5A 1CR1A 1W0JA 3Q9LA 4PX9A 5H70A 2YOHA 4II7A 4OBEA 2AK2A 4Q9HA 4PAQA 1XNJA 3F8TA 1E2QA 1C1YA 4C9BA 3DZ8A 3PG5A 4D4KA 2CDNA 3KKQA 3M0EA 5H1YA 2WAYA 3GMTA 5HCNA 5CB6A 5AUPB 2WWHA 4B43A 4L8GA 4C0JA 3QXHA 3P1JA 4LBVA 3WMFA 2TMKA 4CDGA 2DFLA 4I1OA 3CPJB 2PX0A 4HSEA 5JRZA 5GJCA 5KU1A 1OFUX 1YR8A 4CW7A 4JLAA 1T4GA 1YHNA 1WA5A 4KO8A 4ON9A 3QPVA 2CLDX 1U98A 4IEIA 3UMSA 4TYWA 4GT1A 3QUSA 1F48A 4JLDA 4FMCF 4Q9LA 2IXEA 2YINC 2OFOA 3RNLA 4EFMA 3WRYC 3PUZA 1NMYA 4YXWA 4GOKA 2ZS8A 3MD0A 4HAXA 4AYXA 3EC2A 1W0JD 3MJHA 3SN6A 4XWKA 4TYQA 3I73A 4FIDA 4Z1MA 4BECA 4ZKDA 1UEIA 3H4MA 4DBLC 2NQ2C 2FSGA 2QSYA 4LPKA 5JZVA 3UWKA 4LK2A 3W5IA 4M9XA 2H7VA 2CCKA 4PO8A 4I1SA 2IYQA 2P5TB 4ASUA 3U2QA 4WIAA 4UXHA 1ZU5A 4FWIB 1DAMA 2R9VA 3OEHA 4MYUA 1X86B 3TAHA 2EU8A 2JDIA 2VBCA 2WWXA 2WPDA 1Q20A 2PL3A 1KJZA 3THOA 2R8RA 2FPKA 5LD2B 3H1TA 1KSJA 5AUOB 2QP3A 1RYFA 2GXUA 3QVVA 3EC1A 5E3HA 5FL7A 4US2R 2C03A 3CRQA 4PTLA 1JECA 4Q00A 2PH1A 1G8YA 1FQJA 3WMGA 4BZPA 1KTVA 3FPAA 3SJBA 4CVNA 4BFUA 1N6IA 2ZI3A 4A6PA 5F3WB 3THXB 2ODEA 1ZVQA 1GTVA 5HPYB 2CNWA 1KIMA 3AUYA 1SVLA 4UNNA 3T5DA 4QBHA 1G3RA 1EXMA 5HZHA 4V0MA 2VHTA 3ND9A 3QQ5A 4XSGA 4QKQA 3AVOA 3G82C 4I81A 1JALA 2CE2X 1IXRC 2O8DA 3ZD7A 2QSZA 2QY9A 1VYTA 1SXJB 2PT5A 4ACAA 4PSVA 2X2FA 2EWVA 1H8EA 5L3SA 1E4YA 1CBUA 1R0ZA 2YVUA 1M8PA 3QEJA 4TLEA 1TQ6A 5JS8A 2Q21A 1VTKA 1LW7A 3AM1A 1PUIA 2PLRA 2ZJOA 4QJ3A 3I8XA 2W83A 4A92A 4BFWA 3GJ0A 4HB2A 2ZEJA 1XZPA 3UK6A 1QG2A 2VIIA 3OAAD 2V4ZA 1G3MA 2F6RA 3OAAA 4UXIA 5JS7A 1Z63A 2F1HA 2AX4A 2NZ8A 1U9IC 5FPTA 1XDBA 1NJGA 2QGNA 4NYIQ 5SZIA 1XXHE 1QHHB 2OFWA 5KDLA 1E79D 2FFAA 2ZQ5A 1D9ZA 1ZBDA 3MWKA 1IXSB 1Z83A 2JCSA 2ANBA 5FTJA 3UMFA 5HZKA 3CRVA 3EWSA 1CJTC 1CRQA 4CEIA 4UNRA 3NBFA 2HLDD 4LC1A 4D4LA 4QNMA 3WNBA 1KO4A 2NOAA 1UPTA 2GHIA 4Q18A 2V1UA 4MDEA 2Q9BA 4TLCA 4DSTA 3VR4A 3ZVNA 1Y63A 2QRZA 3LX8A 4LDJA 3AV0B 3R7WA 1UAAA 2FFBA 4M0LA 5CM8B 3RC8A 2XSZA 4JIMA 1WRBA 4JYBA 4RZXA 1J7KA 3EIQA 3SBEA 1XTSA 3B6EA 4RD4A 4MYHA 3SBDA 3W6PA 3FB4A 1WE2A 2PJRA 2AKYA 2NG1A 2ZJZA 3NC0C 3PQCA 4OHYA 1RVDA 1G16A 2IUSA 5P21A 2NO0A 4BLQA 2V7QA 2WMNB 5CIQA 1XMJA 4TL9A 1VG0B 2ODWA 2Z0MA 3TVTA 5JJKA 2EFEB 4IW3B 3L8ZA 2PX3A 1U81A 3A4LA 5TB5A 5FL3A 2GEVA 3KKNA 4URVR 1GKUB 4PQYA 4EPXA 3A8TA 4Q9JA 4C2UA 1U8ZA 3TUZC 2J3EA 4P0TA 2WKQA 4LJYA 1GDDA 1FOEB 4RZ3A 4HZUB 5K8TA 4DIDA 1SZPA 3IO5A 5FR1A 3LO5A 4UQOA 4GDFA 2ZM5A 1FX0A 1OFIA 2QAGB 1K5DA 1HEIA 1AKEA 2EFHB 2YZ2A 4X8MA 4B3BA 221PA 1Z06A 1RW4A 1ZUIA 3FDIA 3KTAB 3C16C 4XOIA 4B3DA 1N6KA 1O87A 1XJCA 3W3AA 1T3SA 3ZDQA 2NPFA 4BFYA 4G5GA 3T15A 2ONKA 4BEBA 4PAOA 1DG1G 1E2KA 2Y8EA 3OIYA 4FCTA 4LUCA 1US8B 1NY5A 3FMPB 3AH8A 1Z6AA 3RDPA 3ECCA 1NJFA 3ASZA 4LV6A 1OXTA 2ONJA 1CKEA 4FI3C 1UEJA 1NVXQ 3EPKA 4JKYA 5FI1B 4BE7B 1ZNWA 4TQUS 1SGWA 3R20A 2G9NA 5FPHA 5JHHB 4ZCLA 4LYJA 4L5BA 1G17A 2HF8A 3NBZC 3QY0A 4JLOA 4LX0A 2IF0A 4RKEA 1VHLA 3GP8A 4D0NA 4DZZA 4JS0A 1K8RA 1KDRA 1UBCA 4TL7A 4TN1A 2GJKA 3B82A 2GCOA 1E32A 1LY1A 5FUVA 4KFTA 4ZI2A 4A0GA 3UKDA 5F9HA 2C5LA 2RGEA 3H0KA 4JLVA 3ZS9A 1IHUA 2XITA 4KFUA 2E87A 1Z6GA 4WZ6A 4RY2A 2ZJ8A 1Z29A 4MGYR 1KK1A 3LA6A 4Z8XA 1OH6A 1CTQA 3TBKA 2YHSA 3M1IA 1NP6A 2XEXA 3B8HA 4D2IA 1RRFA 1G3UA 2QE7D 2BMJA 3NBXX 1M7GA 1E9RA 2BJWA 4UNQA 2VP2A 4YQFA 3V4FA 1IQPA 4NE2A 2F3TA 1A4RA 2W2TA 3OE7A 2YJTD 2JLRA 5GJBA 4AKGA 2J7PA 1R0WA 1FNNA 1TUIA 2BMDA 3UPUA 1OE0A 5GJWC 3L0PA 5KTYA 1KNQA 2ZRPA 3R9WA 1ANKA 1FUUA 4GBMA 3A1VA 4IHQA 1P2SA 1NIPA 1AK2A 2EFDB 3B1WA 2J45A 1SXJA 4HI0E 2SHKA 4DT1B 2FFHA 1EWQA 1KOFA 3V4RA 3UIEA 1BYIA 1QVAA 3A4MA 3VU9B 5G53C 1LB1B 1OF1A 2CBZA 1LF5A 3FKSD 3LD9A 2ZI4A 1TUEA 2WSSA 5JSZB 2C9OA 3BFXA 2C2HA 1UBEA 1OJLA 2WJGA 1DAEA 3CZPA 4IFEA 4F93B 4Q1CA 3E2IA 1XEXA 1OIVA 2EWWA 2BJVA 1KK3A 2RGBA 4RFVA 5EE3A 4M1OA 4CEHA 1JXOA 2Q3HA 2ZANA 3MRSA 4BFVA 2VP5A 1E2LA 4Q19A 1BMFD 2X8AA 1UDXA 4AYTA 3HU2A 3TKLA 5IDVA 1XFAA 4W9MC 3I5XA 2JLWA 2XAUA 3P27A 1EFCA 1XJQA 1E9BA 3LWNA 721PA 3MLEA 1G3QA 4B3FX 1BIFA 3EZ7A 2C99A 4LOAA 1Z5ZA 1LTQA 3AVQA 4ZDJA 2J46A 5BYJA 1Z2AA 1OH8A 2YKGA 5J4VA 3U4QA 1NVVQ 1ZINA 2F1RA 2YOFA 2ZRJA 3GEEA 2XXAB 1CLUA 1YKSA 1IN6A 1YRAA 5FOXA 3Q8XB 2ORIA 4JT4A 1NVVR 3GJ5A 2WWYA 4D26A 2J0QA 3NC1C 2WWFA 2BKUA 5KNDA 2C96A 2ZRFA 1J70A 2F3RA 4KFSA 4LBZA 4HUQA 4KI0A 3EIEA 1FP6A 2QL6A 5FOSA 4B2PA 4V02A 4KJZA 4E09A 5GJVC 4M53A 3CR7A 1DVRA 1N6NA 4C0BA 3M6AA 1XD8A 1NN3A 3LXRA 1LV7A 4PAMA 4G0NA 5EUMA 3R9XA 4QRHA 3W8RA 4OI0A 4RCZA 3FMFA 3GJXC 1AS0A 2H5EA 3NWJA 4IXMA 3OIVA 1XPRA 4CEJB 3BJIC 2YYZA 3PEVA 3KB1A 3I1FA 1T6NA 1ZM9A 2GCOB 3CX7A 4R2IA 3AVVA 4RCYA 1KDPA 1RE0A 4KSBA 2HUPA 4QBFA 5EXXA 5IK2D 4BFXA 2FSIA 3EXAA 4Z8YA 4XVUA 3VKWA 4EFNA 4RD2A 3B9QA 5C1BA 4CEIB 4OHVA 4PANA 1UJ2A 4S35A 4WW0A 3IIKA 2ZAMA 4L9WA 4LHZA 2H18A 2OILA 3L2OB 5LD2C 1RPZA 1KSGA 2ZRBA 2HJGA 4DUGD 1QHHA 2RHDA 1P61B 4AWXA 3ADBA 2V6IA 1SXJE 3C5CA 2D7DA 3OHMA 2A5DA 3VX3A 3ZQJA 4F92B 1M2OB 1YZTA 3EG5A 1ZCBA 4DVGA 4NYMR 2GXQA 4NPHA 1SXJC 5EXTA 3Q72A 2ERXA 1TNDA 3QE0A 4RD1A 1W1WA 2QTHA 3PUYA 1PZNA 3FFBA 5HKKA 4NCIA 4OJKA 2Z4RA 2QP4A 4UJ5A 3KFVA 3SHFA 4TL8A 2BBOA 3HYTA 3T1QA 1E0AA 4DSNA 4NTZA 4M1TA 3WYGA 4JBXA 3S1AA 1G5RA 5DNYB 4PFSA 5FPKA 2EVWX 1KJYA 2B8WA 3K9LA 3CUEF 4N0DA 1JJ7A 3ICEA 1CR2A 4O2LA 1UKVY 2G83A 2PJZA 3RRZA 1FZQA 5JRJA 1Z0AA 3REFA 1GITA 4A6XA 2AN9A 2GXSA 1IY0A 3BD9A 1NN1A 1VECA 2RMKA 3OESA 2JLZA 2G0TA 2CCGA 3KL4A 2NPIA 2FPLA 2ZJ2A 3QF4B 5JI3E 1IN8A 3GLHE 3GLHB 1I2MA 2OAP1 3ASYA 4K46A 5IT5A 4B6FA 4Z54A 3MG9A 4CF7A 1GP2A 1G21E 4C0QC 4CT5A 1Z6TA 4AC9A 4ERNA 1DG3A 4A0FA 4MRRA 1U2RA 3T61A 2WJVA 1Q12A 1YZUA 1G8FA 1YE8A 4GPTA 1T8UA 2LWIA 1OH7A 4ZCMA 1CU1A 1T5IA 4V03A 4US1R 2XX3A 1OLOA 3WY9A 4BUJA 4GL2A 1OXUA 1E0SA 1G7TA 3MMPA 2IUUA 5DI3A 1E9CA 3NHAA 3QI2A 1E9AA 5AK0A 1GM5A 1YR6A 1AZSC 3LLUA 4B3XA 2HV8A 1HY3A 2IW3A 4MUBA 3A36A 4JBYA 2IF2A 1PLKA 2WV9A 1ETUA 1DAKA 2WJHA 4XSHA 2PEYA 3THWB 4PPFA 5BN5A 2AWOA 2REBA 3RSLA 1Z2CA 2YWGA 3I32A 1HE8B 2AHOA 3OEHD 4QHSA 2WOOA 1A5TA 3B78A 1X1RA 4GOJA 2YC4C 3EPLA 1Z08A 1II9A 4ASUD 5JCPA 2OM2A 1E4VA 3AF2A 2JAQA 1FPMA 4PPQA 4AD8A 3PEYA 3VR5A 5C2JB 3KJEA 521PA 3U3RA 4K81B 2VLIA 4C0KA 2BOVA 4DHEA 5TDHA 1AS2A 2W58A 1R7RA 4Q7KA 4JSYA 4QGAA 1S0UA 1R4AA 4D82A 3OFNA 2JLQA 1XD2B 5CITA 1GKIA 4NCJA 4CEJA 3ZVRA 3W34A 4HDQB 2IT1A 3HPQA 5AR1A 3FKQA 4KYUA 4WZBE 3TQFA 3S1AB 3I92A 2IYUA 1P2UA 5KPJA 1WQ1R 1KAGA 2ZRHA 1T8TA 5KSZA 4P33A 5CJ2A 1EWRA 1I4LD 2H17A 2OG2A 3AKDA 4HYYA 4P4SA 4DDVA 3PUWA 4IEEA 1CF4A 1JJVA 3F3YA 2OZEA 3OF5A 2ZUDA 2G77B 1VG9B 1XX6A 1IN5A 5EZ5A 4JVNA 1JBKA 4R71A 4AI6A 2O8BA 1X1SA 2FEMA 3WYFA 1VIAA 4JYCA 1E2FA 4ILEA 2PBRA 2DFKB 2ZROA 3NEJA 4ZDKA 4DSUA 1ZUNB 1FNMA 2F43B 2H16A 4A2QA 4BLRA 2VO1A 3C15C 3IHWA 1IY2A 2C9CA 4Q4HB 4DCTA 3FOZA 2B21A 2HDNB 2XXAA 3UG7A 4D4JA 2QP9X 4PC2A 1H8ED 4YMSA 5D3MB 3THXA 1ZIOA 1NN0A 4QBIA 5CIWA 2IEZA 2ZI5A 3W9YA 4E03A 3I61A 3N2EA 5IHPA 1GL7A 2NO7A 4O0MA 2IYXA 4LHVA 2G6BA 4DDTA 3CPEA 1EFTA 2FGKA 2GZDA 3N2IA 2XTNA 4M9SA 2WBLC 4KLZA 4B3CA 4M9QA 1Q0UA 3E70C 4NKRA 3CW2A 1XXHA 4FMDF 1HURA 3RS7A 4ARZA 1XCGB 2GETA 1TQ4A 2JGNA 1P9NA 1U90A 5H68A 1XEFA 1I4TD 2FOLA 2GF9A 5JWHA 2N46A 1DO2A 1OXXK 4EPVA 2W0SA 4A8JB 1U9IA 3SS8A 3FE2A 3KUCA 1Q44A 1E98A 4OKSA 1E2MA 1XEWY 1F2UB 2A30A 1TF7A 4LCBA 3ADKA 4YMUA 4TMVA 2WJYA 2BHRA 2JEOA 1CIPA 2RB4A 5G3YA 3MWYW 3DKVA 3K70B 2IYZA 1Q1BA 4IVQA 2FV8A 2HF9A 4TMZA 3TVDA 3U3OA 1U8YA 1UKEA 3LQQA 3LBNA 5EJEA 3TW4A 1M7HA 3AKEA 3QPWA 4IDOA 4D80A 4LJ8A 1LS6A 1ZCAA 1QHIA 3NBYC 4DSOA 3DHWC 1YJ5A 2AD5A 3FYHA 1S2MA 1N6OA 3PFIA 2WWGA 4JSTA 4PSAA 5DI3B 3ZIAD 3O47A 1XMIA 1VG8A 2IL1A 5F9FA 4OL0A 3CRW1 1W44A 2NO9A 1JNYA 1W5TA 4DB4A 2FG5A 4A2WA 1NMZA 3SYKA 1L2TA 1GNRA 3AGPA 2GBLC 3PENA 4M1KA 4YONB 4MQBA 4DKXA 5ELXA 2KBFA 3BOSA 4WOPA 3O8CA 4QBGB 1VG1A 2JJ1D 2CL0X 2ZS9A 2NIPA 3R8CA 3JVUA 1Z0FA 2W2XA 4PC3A 1FTSA 4F91B 1G6HA 1YZGA 2VH5R 5GVSA 4RJLA 2AXPA 3LFUA 1OW3B 2JA1A 4HZIA 4BFTA 1NG1A 1P60A 4GOXA 3ADCA 4JL6A 2QT1A 4BWYA 3SJCA 2F9LA 3QJYA 3BC1A 2IYSA 2FDCA 1U0HC 1PVOA 1MO6A 4NONA 3MFYA 2NO1A 1TU4A 1W0KA 4MGKR 1MT0A 2IYVA 2ZSBA 5TARA 4Q7LA 1W5SA 3TK1A 2FF7A 2FGJA 4NCHA 3EA0A 4PQFA 2ZYTX 4JJKA 1W4AA 4QG7A 3IBGA 1MR3F 4LJ7A 1ZP6A 2BV3A 2CMKA 3X1ZA 4HUTA 1IN4A 1VCOA 3LRPA 5E7MA 3UWOA 4B35A 4DDUA 3DMDA 3P4YA 1G7CA 2PZFA 4DXAA 4ZDIA 5IK2A 1GIAA 4U5XA 1DEKA 4PHGA 2WZQA 5EE9A 3AEZA 4M4SA 2GAOA 4JLPA 2I3BA 1D2MA 1DADA 3VHLB 1GWNA 1ZNZA 2OFXA 1BMFA 1Z07A 4Y0VA 2LCFA 4DEXA 4EPRA 1VCIA 4IOMA 2FX3A 2IS1A 1XB2A 1P73A 1SHZA 3SOPA 4IXNA 4HB0A 1WCV1 3EX7C 2QBYB 1Q3TA 4B34A 3GJ7A 3QXSA 4IOJA 4M9ZA 5BWMA 5J4HA 3KXKA 2C04A 3PVSA 4R9UC 3BGWA 4EDHA 4F4CA 2XJ4A 2A5JA 1KGDA 2A9KA 2G0NA 3FKSA 3ZZUA 3MCAA 4C7OA 1MO4A 3IILA 4Q66C 1S1CA 3MWLA 1AGRA 4A2PA 5J4YA 4LHWA 2RAPA 5DYGA 1NIJA 4OK6A 3TR0A 2J0UB 4CRWB 4PPNA 1QVRA 2VSFA 4QXAA 1VCMA 1HYQA 1DO0A 2BIFA 2GCNA 1T9HA 1NVUQ 4B2LA 2BMEA 2GF0A 3P32A 3QXCA 4RVCA 3CLVA 2X19A 3AKYA 2JLSA 3RANA 3ZH9B 4IDNA 3KQHA 3JZAA 3RVBA 3OE7D 4ZV4A
chains in the Genus database with same CATH superfamily
5JWRA 3E8XA 2JVKA 5DHFA 1FS6A 1N6LA 2ORVA 3LNTA 3E15A 4KL8S 3OWHA 5DTEA 1P19A 1AZTA 2GO7A 3LYAA 1YBVA 2PS0A 5J9FA 1F5NA 3LRXA 3MELA 3CKMA 1MW8X 4YP9A 4B6QA 1ZSVA 5C0OE 4YGYA 2OHGA 1D3AA 2PR2A 1VBMA 5EIFA 3QXXA 3QELA 4LCJA 3RHSA 1LX6A 4P98A 4QAJA 1RM5A 4I5EA 4ROTA 1U5CA 2ECOA 4JAVC 2FRDA 2D06A 2V96A 3WLEA 1QR2A 2J3KA 4HZGA 3RU9A 3T8YA 3WLRA 4CT4B 3K70D 2DR3A 4IFIA 1YS7A 3CUYA 1MB4A 3V33A 5EJ9A 2GVZC 3CUUA 3FR7A 3DNPA 3GDFA 4IWXA 4MP3A 4UHBA 4R54A 3W79A 5B3JA 5DE3A 2I6XA 2IC5A 1ETHA 1U6IA 4BNJA 3ZVLA 1SCDA 4BNVA 1J1IA 1RXIA 3EXEB 1EYZA 3FUUA 5E38A 2QRQA 3W05A 4CN9A 5H59A 4QWMA 1GDTA 1RHUA 3VNSA 2BEVB 2OESA 3JAKB 2FE4A 2Y9PB 4K3VA 1Q0HA 1VM6A 1DOAA 3CLHA 4WVLA 5HIMA 3TUIC 1F8UA 2WJWA 1SC6A 3KJZA 5EG5A 1MH9A 4J9UE 5G02A 5JH7B 1NM5A 2V5VA 5BMVB 1KU6A 1N2BA 2CVQA 2QLJA 2PTGA 3KJXA 2ZRLA 1U2PA 2JGJA 2O52A 3PRHA 1EVLA 3VJKA 1QU3A 3HU3A 1QYIA 3EODA 1Q6ZA 1K6MA 1PGQA 4CMHA 3P2JA 4B32A 4TLMB 5ADHA 2OLEA 3D0KA 5CPFA 2R751 2ZT5A 3EHDA 3HVHA 1U7ZA 5AW2A 1ZD8A 4W6ZA 8ATCA 1LBQA 3KKOA 1F2UA 3I9V6 3TI7A 2Q3JA 2B7LA 4XKJA 2O5VA 4U6QA 1O95C 2QGFA 5IJXA 5I7HA 3N8GA 1ZR2A 3HTXA 2QG6A 2NUAA 1KR2A 2OZLA 4V0RA 1UZMA 1ZJYA 3NTVA 4GO1A 4HDRA 4PGGA 2HU2A 4P4SB 2Y99A 2ZFUA 3JVVA 1A2BA 1GILA 1GSIA 2R3SA 2P4QA 1RAFA 2H1LA 4ND4A 1QZUA 4M9UA 4UUNA 3ICCA 4Q9KA 1U3UA 3K0CA 3EYWA 4MVCA 1H5QA 1YT5A 3GLHA 1EJ0A 5ARCA 1G291 4GX1A 4E2ZA 3VOTA 1HT1E 2HHJA 2WYOA 4C2TA 3C3CA 5EQJB 5KKAA 3WR5A 1U8UA 4M46A 5JEEA 5EP3A 3FGZA 1PKEA 5FTNA 1G5IA 3EZ9A 3NGLA 3HFJA 3L02A 4IYRA 4V39A 1PQUA 3OU7A 2BFWA 5DGCA 3MQ2A 2CFOA 4B6EA 3LO8A 1XCBA 3NEYA 4IG4A 4I4TA 1NBME 5EQTA 1J8VA 4CQNA 1B0PA 3K0FB 3C5EA 4YJHB 3C1TA 3PDIB 5SICE 1SCQA 4AO7A 1VB5A 1I9GA 2JARA 2FP4B 2BFDA 3CXUA 2WMYA 1XR3A 3LDAA 4P3XA 5JSQA 2C7BA 3LBHA 3PNSA 2HU7A 1OXVA 2PH3A 3WLPA 1CJUC 2IHYA 4KIJA 1H8HD 1SR8A 4YJFB 4WKCA 1FVFA 1NF3A 1WW3A 3QVXA 1Z25A 3SZOA 3LPDA 1QGUA 2UU9B 5DHQA 1J0DA 1EVJA 2VSOA 2R84A 4G2NA 3URKA 4ZRDA 4ZIRA 5AVYA 2BFPA 5AJWA 3Q40A 2HRRA 3EGWA 1JFFB 4NQZA 4UU7A 1GZSA 3SZGA 2VDKB 5DIZA 1E2JA 1K89A 1JQDA 5FORA 1GVNB 3NTXA 5KYXA 1KFKB 1WUIS 3IKJA 3IPYA 3KHKA 3ANXA 1UMBB 4K6FA 1D0IA 1U7WA 1LKZA 1KYVA 3GD7A 4G5YA 3ZI0A 1HFJA 1F3OA 1RBZA 3KLOA 3CLTD 3STYA 4UVHA 3HH8A 3KZNA 1AD2A 3U9TA 4D74A 1GJRA 2BGTA 5CTJA 5LMUB 1A8QA 2PANA 3EAGA 1VFPA 4BCBA 3UXMA 1TQ2A 1EX6A 1ZH0A 3E0QA 4JC0A 4CM7A 2J3DA 5KUTA 1HDGO 2GEUA 1A8IA 1HT0A 1RI5A 1DBSA 2C8KA 1KI1A 3C4JA 4D0RA 3JRWA 4XD7A 1EP3B 1JYFA 2ZJ6A 4KQXA 4QTTB 5FFFA 5I7UA 1I8TA 4V3BA 4U1RA 1JFVA 1IY8A 4L4RA 4EA6A 1CSEE 2ZPTX 3RT9A 5LWQA 1EXVA 4G0WA 2YQ4A 2YQ5A 4HK4A 4WGGA 2FWJA 3LPNA 4TTTS 2JKYA 5CB0A 1JRLA 1LI7A 5HIIA 4AZTA 3GPBA 3OT5A 3T35A 3TF5A 4JX8A 5IJZA 3RTCA 3TLJA 3LLCA 2XBUA 5B4VA 1U3WA 4L15A 3CKKA 5AHKA 5H4HA 5EZYB 2W6QA 4XM0A 2ZXUA 2YS7A 1DB3A 2PMKA 2Z83A 5BURA 4KQ6A 4G01B 1EUZA 3VR2A 1ZM2A 4P3PA 1E99A 3NQ41 4NBKA 5DJ5A 1DPGA 3GP3A 3QZUA 4F84A 5KSOA 4S1VA 1RVV1 2XWBF 4FHEA 5BQ5A 1V0JA 3FPFA 3AI3A 1QGYA 4HZUA 1UODA 2P0AA 2ZRDA 4RKRA 5IJAA 3GJZA 3SE7A 1N57A 3TSZA 2ALJA 1DJPA 4U6SA 1OLSB 3M5WA 4YP1A 3QFRA 4K88A 1SEVA 3IOCA 1NXSA 3EXIB 4LY6A 1RWQA 4OU4A 4E22A 4B8WA 3KSRA 4MVWA 2A5LA 3HFGA 4COOA 1K7FB 1Y1RA 2PO5A 1H5UA 3R5FA 2R65A 3CLTC 3GCWA 4QUGA 2AEEA 3OQNA 4MWGA 1H22A 3UHAA 1PLJA 4ZRNA 2JJ2D 1IEXA 2P2GA 3OLCX 2PJDA 5CTAA 4IS2A 3FHOA 1EE2A 3TRDA 3G8DA 4UU8A 3SBXA 4FMDB 5D3ZA 4QHYA 2FSFA 2CKMA 3KEFA 1OI4A 3NEAA 3L0IB 3U4AA 1E66A 3COJA 1UEXC 1XP5A 2BEKA 5CNJA 3H6KA 5LXTF 3C6BA 3CS3A 5JADA 4BGDA 2CB9A 3COPA 5GTDA 5E95A 4RWZA 1S4MA 1LC3A 4UCWA 2R7LA 1IVYA 1HUQA 3GJ4A 3L5KA 3SPXA 3T1OA 3OFVA 1NA5A 1R9MA 1LI5A 3Q8WA 3HM9A 1VE7A 2B4QA 3KIPA 4G0PA 1NSYA 3Q4GA 2NTNA 2BDTA 1Z5VA 4KODA 1J49A 3KXDA 3UPTA 2HSWA 4F9GA 3RABA 5JROA 3QNUA 2V8OA 3VAYA 2PUGA 4GEGA 4CUZA 2AOWA 3NR2A 3U4IA 2XRFA 1MV8A 3ROFA 4MQFA 4DIFA 1IMJA 3IR6A 4M22A 2OCYC 1TJNA 2ZRKA 4WZBA 3L7AA 1RD4A 4DM4A 4I1VA 3STVA 3NTRA 1SUSA 1G4AE 1H6AA 3C1AA 1WO8A 1WUYA 3LLSA 1LBIA 3DNMA 5CA1A 2C7OA 4L73A 3E6AA 3DFUA 3NDRA 3W5AA 2OCLA 3NHBA 3SC3A 2ZAOA 2YHUA 1QIGA 1QGDA 5DXFA 1YJBA 2ZUBA 5JPDA 4UPDA 1EUCB 3H18A 1Y6RA 5KMGA 1LWOA 1NVKA 2L2QA 2O6LA 1HDXA 3LYUA 3KJHA 4GE3A 5F35A 3B1ZA 4QGGA 3LX5A 1U2SA 4C30A 3NOQA 2XUOA 3HO8A 1K92A 2IZZA 3EMBA 3QFSA 4C0HA 2A8YA 1YB7A 1QR6A 4XFJA 1J2JA 1KF0A 2VHQA 4JHXA 4AMUA 5KOJA 1FBNA 3QSYA 2W70A 3R7NA 4UM9B 1JEDA 1YU9A 2WV7A 4YB8A 4HS9A 4ZFNA 3QG1A 5B7NA 3U1VA 5K6AC 1ENZA 1GZUA 3B1KA 3QOXA 1GTSA 4E5PA 2J9RA 1FRNA 1UKZA 3FCEA 4KMMA 2P30A 4CKWB 5IS2A 2AFHA 3IEPA 4OSPA 3DLIA 1T4CA 3G7UA 4YS6A 1OA1A 3WJ7A 1OILA 4YGXB 2BFNA 5DHSA 3ZYCA 3HO1A 1NI4A 4PPYA 4KR2A 4HMPA 3WA7A 4BCDA 1BS1A 3QKTA 5KAPA 3TRIA 2C4MA 3LVQE 4QNNA 1RJ9B 4AF8A 4KFRA 3OIWA 4MQEA 1C0KA 3ORRA 1E0JA 4MARA 4NNJA 4DDWA 5HX7A 2WWIA 3T7EA 4J6EA 1CUEA 1HH4A 1PNTA 3NO4A 4RF2A 5C7OO 2H3HA 1KMHA 1OPXA 1YRBA 3DE3X 3IYLW 5I9SA 3HB9A 4RLFA 1QZXA 2M6SA 3B9RA 4XVQA 1D8AA 3VR1A 1P5ZB 5J47A 2ZCJA 1L7AA 2VP6A 2Q4BA 1CVLA 5DH9A 3INGA 4KIWA 3UXEA 1UWCA 3GJ8A 4WJKB 2C61A 4FD2A 2B83A 3IT2A 5DM70 2FUEA 1HKUA 3K0EA 2FZ4A 3NDJA 4TTQA 1U6KA 4E5YA 1KH3A 2QPLA 4FXPA 4ZK6A 2R8BA 3SGLA 3KPVA 4V2UA 1XD9A 5D3QA 2ILTA 1CY0A 3V8BA 3WRVA 1JV2B 1OT3A 5EMKA 2DF8A 5MN6A 1HL7A 3AONB 3N86A 4YT2A 1V5FA 2ZIXA 3FPGA 4MJXA 5I9BA 5SZHB 2AYZA 4J8PA 1ZNYA 5HZGA 5JNLA 1YZLA 2ST1A 4TRRA 4DYDA 1CIJA 1KAOA 1FTGA 3DA8A 2PXAA 1B6GA 2ZETA 2NZUG 3VTAA 1QHGA 1VOTA 3HDYA 4MJLA 2ZVJA 3FGNA 4NDNE 4J07A 3NV7A 3U4QB 2E3JA 3RC9A 2WFLB 4EDFA 1D9XA 5CT5A 5KNCH 4XYGA 4L9SA 3WNVA 2ORED 4P4LA 1C41A 3HVIA 3RS8A 2IEGA 3V1UA 4A0SA 2ZJAA 4V0LA 4DLXA 2UKDA 3QFTA 4AL4A 4EJSA 1QIFA 2GZSA 4H7KA 4JSRA 5TE9A 3ZIDA 5IASA 1DQZA 1K3FA 3HJCA 1PFYA 3C3BA 4Q4JA 3WIVA 4C4RA 4KGZA 3ZGOA 4OHFA 1Q0TA 5LBIA 1AT1A 3L8YA 1Z13A 4Y1EA 3HCWA 4I55F 2XNDD 2AR0A 2WYIA 3AUFA 2WJJA 3MWFA 5TPZA 2VR1A 2YUIA 2PL1A 1GTMA 1W88B 5M04A 3ZZMA 3ZGZA 3HWSA 1MX3A 4RL4A 2YCBA 3E9CA 1KYIA 4NU0A 1LBSA 1Z17A 3PU6A 4J2OA 4JR2A 4EI8A 1Q7BA 3S81A 4OM8A 1P74A 2QQGA 1A5ZA 2DFNA 1V4BA 2QN9A 3RS0A 3ZEIA 1EXDA 2QPTA 4NZYA 1FW6A 1J09A 4PXAA 2FPGA 2FE1A 3U5ZB 3RSOA 3I0MA 1WP4A 1AHHA 2OHFA 4KXLA 5DI9A 3SG0A 5K20A 4MCJA 4RA9B 3RBVA 1D2EA 3FNGA 3CUKA 1C8BA 3TEFA 3AY3A 2KE5A 2VT7A 2O8VA 4R0VA 4KQ1A 1MBZA 4FS8A 3UB4A 2ZWOA 3KVNA 3HMKA 2R8OA 1QP7A 1QHYA 5DULA 1E79A 3O1JC 3MSCA 1Z35A 3IQWA 4NJOA 4GRAA 3W8FA 1R6DA 5DMXA 5L3SB 1VGRA 2JA2A 3P9SA 1YJAA 3G2KA 4M1WA 4E5MA 1N6PA 3BB1A 3OCYA 4NVRA 3VGPA 3S1SA 3ICPA 3AFNA 5K8LA 1DRVA 1FF9A 3TMKA 5L3RA 3VV3A 2R79A 1ONBA 4L2IA 4OLBA 4BN0A 1U1CA 4YMGA 3VR3A 3H1GA 1C7RA 2EJBA 2BGNA 1PDWA 2HDHA 3QXGA 2ZRGA 4D9GA 4KKVA 4C22A 2Y71A 5T67A 3V3KA 3I3SR 1RAGA 1CQZA 3UCFA 5A7HA 1JWAB 1XAJA 2DHDA 2GO1A 4DY4A 3L6CA 1Z6XA 1E9EA 2B3TA 3BMNB 1AS3A 4MR7B 3HRHA 3N8KA 3AHDA 2CNNA 4HC4A 2C92A 1E3MA 3S8EA 1WDMA 1D1QA 4RO0A 3IPLA 3U3MA 4YUAA 3RSSA 2HYDA 4ARBA 1QG4A 4UMDA 1VLMA 3H84A 1NXQA 4NDAA 3UK7A 1V3TA 3DDCA 5CB8A 2YIDA 2O3RA 2QQ0A 3B5IA 3VNRA 2PUEA 5ESWA 1QF9A 3W4JA 3NPMA 3F8SA 1II8A 3UHPA 3W7VA 1V71A 1KS9A 1XEWX 2GYYA 2OQ2A 3FZQA 3MEQA 1E69A 2A1UA 3CUSA 3CF2A 3KZXA 1G2OA 4OXRA 2QUHA 3V55A 3RHFA 3ZWQA 3PV0A 4GP6A 2DPXA 4W7SA 4HWKA 4PZYA 4DWOA 4MV3A 3AF3A 1F4PA 1SG6A 2M9MA 2XA9A 3BERA 4XM1A 5GY7A 4KOEC 1MO5A 4J9VA 4TYPA 3NWBA 1YD7A 4WY2A 1E5QA 3AM3A 3UV7A 4ZOLB 2ZIFA 4FS3A 4DZTA 3FZGA 3MCVA 3QX7A 1II0A 2GBIA 3DZFA 4P3KA 4PZCA 1SQ6A 3CCFA 3HLKA 3I72A 4RA9A 1G8HA 1R4MB 4XWGA 2PS9A 1CF2O 1T3ZA 4R98A 1FSGA 5B3KA 2JFNA 4TTRA 4MW1A 4YROA 2M6KA 3M33A 2LXNA 1NLYA 3KDAA 4FFPA 4JGGA 4E7OA 2J59A 2JIQA 5IM5A 1GPKA 4HBGA 2JEZA 1ZUHA 3OQIA 1CE8A 2FW7A 3JQ8B 4KGDA 4O0LA 4D5GA 1J23A 5KYKA 3KVYA 4MB2A 4L2IB 5ES4B 1YL5A 5BVHB 3ROQA 3NI2A 5FWXA 4MTCA 5EUBA 3VR3D 5EUCA 4DMHA 1FDUA 3GLTA 2IOYA 4W82A 3TGLA 3X2EA 2PKQP 7REQB 4BAGA 4HPXB 4W5JA 3WYAA 2VPXA 1GG5A 3BE4A 4FI3F 4M0FA 3RU7A 1P3JA 2DFPA 2FKAA 3NXSA 2I2AA 4XGQA 3RVPA 4NEGA 3QM1A 2IYEA 3OVMA 2J6HA 4RJJA 2BE9A 4G9BA 4CTNA 2LKCA 1XL1A 3VU3A 1EVIA 3PQ7A 4WQMA 2OECA 3MJRA 5DYYA 3SC4A 1PV4A 2VXCA 4FR0A 5CM9C 4I6GA 3SFVA 5A4AA 3DAPA 3MJTA 4CTJA 2D1SA 2ZTVA 1BHO1 3CGWA 1NRXA 3D5EA 1WPRA 2RAVA 3AUAA 1B6TA 3ESCA 6LDHA 1XZQA 2P3SA 4KGXA 1JLRA 1JPJA 3CVJA 5E4JA 3UUFA 4EGSA 3JYNA 5JD3A 1GSHA 2F90A 3W5BA 3K70C 3IESA 3PD7A 1LCIA 4PSKA 5KKNB 3K0HA 2ZRAA 4EYQA 4F7DA 4HFRA 2BL4A 4JT8A 1IK6A 5B64A 3U13A 2QM7A 2NSLA 4X8HA 3IVAA 4IH1A 1VL5A 5H16A 2JIZA 4CFZA 2WQ7A 4FWTA 5F2NA 1XP8A 1Q0ZA 2FZLA 1S96A 1YE5A 3KEQA 4IQ8A 1XCJA 4RD0A 3MXOA 3E8SA 1T8YA 4UAGA 5HQJA 1VL0A 1MUUA 3KT6A 3SSAA 4HVCA 1NQOA 5IF3A 2HA7A 4CU2A 3FUTA 1SXJD 3RJ9A 5JFOA 2OCAA 5JLAA 2QLTA 3ZKAA 2I4NA 4TV9A 5GADl 3KJGA 2X1VA 5L8VA 2P2DA 1M6NA 1T13A 3E9RA 1VXOA 3ANMA 3C7KA 4BNYA 4PZ0A 3ROKA 5JR3A 4ILKA 4UZFA 2FMXA 1W87A 2IYNA 1KBZA 4QQRA 1XFDA 3F0TA 3JZIA 2HSZA 4N49A 5FUBA 3WLOA 4AKTA 5JMWA 3ENKA 1XTQA 3H2KA 4QM6A 3ZZTA 1P62B 3FCCA 4IOLA 1K9VF 2GS9A 2QMOA 3L0SA 4P32A 3BCHA 2ODPA 4FEEA 5EN4A 3FTQA 3NHZA 1R5NA 2QKYA 2FP4A 3UWSA 3U3KA 3HJBA 1GU1A 2JDID 5B57C 1EQAA 3HP7A 3DP7A 4H3HB 4Q93A 1RU3A 4FGSA 4B4DA 1YONA 4P1ZA 2GESA 1DV1A 2O06A 3GXBA 1AXRA 4L4XA 3QOFA 2AFRA 2FXVA 4O4IA 1A82A 5CR9A 4D0GA 2OHJA 2HLPA 5CDTA 5CLGA 2GJAA 2ZYWX 1FUIA 1T1RA 2D1YA 2J87A 2LZ0A 4HRVA 4JKIA 3GUHA 3P94A 3R5KA 3Q3IA 2WKPA 5FNVA 1YDEA 1KZ9A 5K99A 3MTEA 3DHEA 1DKLA 2C78A 2IYWA 4TMWA 4LNUB 5JTUA 4Q4LA 4WDQA 5CCBA 2CFTA 1VRCA 1GPNA 3DPIA 1Y8QB 2FPMA 3B1VA 5DTMA 3DMYA 2R8YA 1M1YB 2CVPA 2D74A 2ETXA 3CPHA 3Q3HA 1E4EA 4KK3A 4LZZA 5EP4A 3ZLJA 1XRJA 4AY2A 2GQ0A 4AN1A 1MABA 3TQHA 4R1MA 2IP1A 4DGQA 1B0UA 4FFBB 1HXHA 4FLMA 3F4LA 5LQKA 2W2LA 3WGJA 1ZEMA 1O9BA 4ER6A 1G21B 2NACA 3TSWA 1N7GA 1TT5A 2I7TA 3KO8A 4O29A 3VBCA 4MLPA 2ROQA 2AR7A 1UBGA 1J56A 3I6YA 4PQEA 4CQLA 3ZY3A 4N3NA 1NXTA 4CMGA 3T5AA 2UYCA 1C8LA 1Q57A 2IIPA 3UY4A 5ETJA 1G8PA 1ZW6A 4EB0A 4QVIA 1WB5A 3PFWO 5JPIA 2JLYA 2QAGA 3BF8A 2NYVA 2J1LA 3HR7A 3IDQA 3KV3O 3OFJA 2VDQB 4MW7A 5FOWA 4CLRA 1NNI1 2IVFA 2R00A 3IEIA 4MKRA 4ZO6A 3I76A 2ZUVA 2ZIEA 4JT2A 4Y2SA 4EJSC 1PVDA 3GEIA 2BFAA 2MSCB 5DM2A 5A4KA 1ZM7A 3ANLA 1R0KA 3GDHA 1I3LA 4QFMA 4EYOA 5JWOA 3GJ6A 3RRXA 1OLUB 1E8MA 1G9XA 1ID1A 1XCLA 2WTXA 4LISA 5KWEA 5MFPA 4OMFG 4BP3A 3LFTA 1A2QA 1DMRA 1UDWA 1T0IA 4FMPA 2HX1A 3GLVA 3HKDB 2C2KA 2R6R1 5AM0A 5LB4A 1WJGA 1GUBA 4FQ7A 4I4NA 1XCMA 1FQKA 2FETA 1BGWA 3N8IA 2QN1A 1J20A 1FYFA 1EA7A 3FNIA 2QV7A 3GZTB 3QEOA 3KR1A 2HU5A 1FYDA 2ZBEA 5EWMB 4HRXA 4XTCS 3BK1A 2HEGA 2C1ZA 2R5NA 3GMSA 3MCWA 1LEHA 1FRQA 3IXMA 5CW1A 4AUKA 4EHNA 2WK1A 4RK1A 2UZ1A 3ERCA 2OOSA 1DAHA 1IVNA 2EBHX 2JIOA 3VU1A 3Q7PA 4KDFA 4LSGA 4RFSB 1GG9A 2PUVA 4J0IA 3ULKA 3IP1A 2RCYA 4YPOA 5KNDD 3EISA 3NAMA 2Y0BA 1LBHA 4H6XA 1NASA 4MYDA 1L7MA 2YTZA 1T8WA 1JAZA 2CMFA 2DSTA 3QLUC 4JFAA 4XD7D 3GLIA 2ZIAA 2WJ3A 3WDKA 2CKDA 4BVBA 4FYXA 4G1EB 4BJ6A 3EIHA 2AI3A 2C84A 2I3ZA 4FZ3A 4EMTA 3U44B 3ADPA 4C78A 3TOZA 3I2GA 4PG4A 1KYZA 4TKUA 4EB3A 4LXTA 4C6RA 1LTHR 4QA9A 1KS2A 2YRFA 4ESEA 2J0SA 5AVXA 3ENVA 3BFVA 5ENDA 1U28C 2P11A 4GXTA 1UAYA 2IBMA 2ZIWB 4D57A 3C5HA 5I7OA 3VKUA 5LU9A 3SWWA 3RLIA 4B75A 4HYTA 4E2YA 5JQWA 4E07A 5HUQA 5AVJA 2DRIA 4DZRA 5ALLA 3NT5A 3WG9A 3AVPA 1UF9A 4IGAA 4NG5A 2JJ2A 1W9MA 4MKIA 3AHEA 2O2DA 2NT4A 1LVUA 3NFRA 2OO3A 1ISPA 2P0YA 3FY4A 1VCHA 3LFHA 1ZH2A 4AIIA 5I7VA 3FF4A 2QRMA 3NWOA 3HUUA 4F3TA 1NVTA 1IJKA 1G2QA 1GL6A 3AR9A 3H0EA 1YZNA 3ZX4A 3ZCQA 4N9QA 3OPXA 4LE1A 3H2ZA 2ATIA 2EV9A 3KR0A 4UMFA 2GK7A 1V5GA 1Y4SA 2XZDA 4KE8A 1FS4A 4FBGA 2JK1A 1W0KD 2V7PA 3I4CA 3SZMA 3ZQ6A 4HAVA 4O1HA 5ECDA 3AB7A 1QFYA 3NHMA 1FVXA 1T9GR 1RNLA 3PFHA 4LPSA 3W8NA 4AIRA 2FPRA 4BFSA 1WHTB 1H0HA 4R2XA 5JI2E 1EFVB 1IU9A 3HBNA 3DXYA 3N2GA 1N6RA 5DDIP 3LPAA 1BXZA 4CJXA 2F7SA 1ST2A 4J43A 3UPDA 2R6HA 2VEOA 1DCKA 3I34X 4IQGA 5JPCA 4RD3A 4BX0A 1XZNA 1WD7A 4DIKA 1CQJA 3SU8A 2A0UA 4J94A 4M8NE 4ZCSA 3U6KA 3LY8A 4UTXA 3T7TA 5HGXA 3C98A 4KLRA 1U8XX 3IKVA 1ZKDA 2VN8A 1ZN9A 4Z99A 2XMPA 2LV8A 3S29A 1TAHA 3L7MA 3V1LA 4QU0A 3ND8A 1I7NA 1L4LA 2W6NA 2X15A 2Z1MA 4LE2A 1KWKA 2VL7A 1D03A 3MS2A 1B8VA 4AY5A 4DNFA 1KQGA 3JR7A 1E3LA 4O4IF 5E8RA 1ORWA 5DM1A 3ZXXA 2XMSA 4LYAA 5U9CA 2QLLA 1S89A 4DR3B 1X8LA 1F8YA 2IS4A 3PXCX 1MW9X 3NXKA 1CUYA 1ILEA 1MH1A 3M9LA 1PSWA 3PDCA 1L9XA 4LVOA 4Y0NA 3RYIA 1QKIA 3P9QA 1M66A 1EVKA 1U1GA 3MT8A 4DLYA 1QGZA 1JAHA 3LLMA 3NKLA 1ECCA 5CK5A 2ET6A 2YJ6A 2EFYA 2KWIA 2QF7A 5AJXA 1X7HA 4LXYA 2GB4A 2X8JB 3SFZA 1E4OA 2G9ZA 3RWMB 1XN4A 1DTWB 4CCAA 2HIGA 4MCAA 2VKQA 3IBFA 3KSZO 3HL4A 5IUJC 2XD9A 1EJ2A 1KI3A 5JAHA 1V9LA 1IHDA 1RXCA 3BA6A 3MBIA 5IRCD 3WNQA 3HO6A 4KYTA 1EP9A 4L5JA 3RO7A 3VR4H 5GQSA 5K5EA 4YUVA 4B47A 4NZZA 2W8BB 5FTWA 3OTOB 1XZFA 3CIOA 1EK1A 3ITKA 3OOJA 2I6UA 4MRVA 4D9EA 2ZIXB 3AIOA 4G97A 3GLFE 1Q1NA 3W1WA 2OBNA 2XDYA 4ZC1A 4DLWA 1H8HA 2H1WA 1LDMA 4AT1A 1OWLA 1N4AA 1L8AA 2VH1A 1AUVA 2J7KA 1KDOA 1JG7A 4OA8A 3IODA 4QG3A 3A6DA 3D7LA 3IOEA 4OXXA 2G88A 5G3ZA 3AVWA 4DANA 1B8UA 2WPDD 1COWA 1JDNA 2PZMA 3MJCA 4R6WA 3RS4A 4EEZA 4HJRA 1U0FA 3MT0A 4ND5A 4EJSB 3KAQA 2PUBA 4BU0A 2AK3A 1PYGA 2F17A 4IDBA 2WAXA 3ZN2A 1L5ZA 2ZBVA 1ZM4A 2YV3A 1F6WA 5DLQC 2EZ4A 4ZEVA 1U2QA 4EW1A 5B55A 3H2SA 3Q7QA 3RFXA 4WHMA 3WYNA 3CSSA 3C7AA 4CLOA 3T3EA 2D7CA 1RWBA 1WXHA 2L19A 1S2NA 1UJMA 3TIFA 3UT5A 3VH1A 4R3UC 1WHTA 1ZMBA 1E1RD 4NEHB 1RQRA 3ETLA 5F2KA 2X5JO 3CZ5A 1HT3A 1QHXA 1XGKA 3L7IA 3QVUA 4QL3A 2RGGA 1GLGA 3ZDCA 5GONF 2GBPA 3LT5A 2PDAA 5K3FA 4P5PA 2L0XA 3A26A 5TVKA 1IXZA 2D2EA 2QD5A 4L4UA 4V0KA 2D0DA 3IUPA 2X42A 2ZW9A 4ZQBA 3SZRA 1KH1A 2D3WA 1D4FA 3ZDRA 4G8BA 4NDZA 4OSOA 5AKXA 5JDIC 2VUSA 3LCCA 4EGCB 2LTAA 5HM8A 1E6WA 3Q7SA 5ICFA 4B44A 2KSQA 2VDMB 1OB2A 3DW1X 4NP6A 4WZAA 2JHFA 3R8FA 1XBTA 3BQMB 3OI7A 1EM6A 5BNWA 4ND1A 1Z0IA 3Q15C 3EXEA 3IV9A 3K0AB 3EUWA 5F98A 4J1TA 3JALB 3UYLA 3U44A 3SJZA 2PCLA 1FPQA 3EAQA 3OJLA 4M7OA 2VNIA 1BU8A 1U2GA 3ILXA 3TSAA 3IQIX 5EWMA 1RIFA 3P26A 4FN5A 5BMVA 4KPYA 4C04A 3EBOA 3S8YA 3E61A 1DWQA 1NU8A 1I6MA 1MJFA 1UZUA 2NTJA 1B6SA 4ATNA 1QLJA 4ZO8A 4WKBA 2GOYA 1T5LA 1V9SA 3PDHA 1THTA 3RBAA 1NUQA 2A9QA 3ZK9A 1P0PA 4F38A 1TK2A 2FN8A 3O82A 2DYKA 2ZTHA 1D1PA 5J1SB 3RARA 1UJCA 4TQ9A 4MGIR 4RH3A 5FJJA 4A26A 4FJ2A 3Q0EA 1A9OA 2O2HA 4G0VA 3O26A 3B3FA 4ZQHA 5KOYA 1OQAA 1EAYA 3I04M 2BEJA 1QBKC 3E9MA 4JGBA 5J2TF 3D0QA 1TAQA 2Q2WA 2X6RA 5AVUA 2GH1A 2QAIA 4G4SP 1M33A 4DMRA 2IPMA 3DEIA 3E3AA 2BFFB 3QVOA 3A6PC 1IJEA 3QITA 2XOKD 1QF6A 1SMKA 2Y68A 4CF6A 4QGBA 2QJWA 2HIHA 4URYR 1YVDA 3ESAA 3DAOA 3G8CA 3EPRA 4RDIA 4RPJA 3OEED 4RQTA 1QHFA 1ORHA 2PD4A 1PRYA 1MAVA 3PPWA 4W9NA 5DNVA 5GONB 1VA5A 4FBMA 1QE0A 3G6WA 1DPFA 1JGTA 1UQUA 1A76A 3GFPA 1QC5A 4HAOA 2FUCA 4UUBA 5E9QA 4ZOQI 2BR3A 2BZSA 2CK3D 2WOJA 3O4JA 2FHSA 3U31A 3K8YA 1ZR4A 4LJSA 1Q21A 5AJVB 3F7NA 2VHWA 2YJZA 1IIBA 4AJNA 5KYUA 5E7IA 3A9WA 3JW8A 2XNJA 3RODA 5T6MA 1LVGA 5EESA 5M7EA 1GG8A 5K8UA 2AG8A 1EGMB 2GAAA 2PSSA 1BX0A 2BHNA 3JRNA 3BGIA 3GA7A 5FH9A 3L77A 1U2TA 3TEMA 4ZTUB 2B1IA 4ZXFA 1PS8A 4O6VA 3QV2A 1JR3D 1JIUA 1G5HA 2O0JA 2QL7A 4XGRA 2BSXA 4C6SA 4FLEA 4PO9A 2OXCA 4MW4A 5AMXA 4AXBA 1KKMA 3UOAB 1E5TA 1XOIA 10MHA 1XZLA 2R7MA 4RUKA 1QOPB 5KSYA 1IRIA 1HOXA 4N3CA 2CLSA 1GNPA 2P6UA 3DEZA 4DCUA 3DJFA 5BW5A 3FHCB 3HJNA 3IPRA 5DBOA 4N3BA 3GFTA 4FXOA 4POOA 5JC1A 2YR0A 3E81A 4BV9A 5CVUA 2XB4A 2X2EA 3QKUA 3T06B 1EINA 3OE5A 1WX1A 3AV3A 3SLRA 5ALJA 3BKXA 4XB2A 4AMYA 3EIUA 2FZVA 1RADA 3BIOA 1Z3CA 3NB0A 4TLBA 3CVUA 2PMDA 3WMXA 5G4LA 2HIMA 3ZE8A 3RYIB 1FMJA 3L3BA 1NBMD 4D98A 1A5AB 1KAHA 4ZVQA 3CN9A 2CJFA 5FLEX 3JSXA 1EGHA 2ZE8A 3SHOA 1JJBA 1NJ1A 4G86A 3RWOA 1RS0A 1XZAA 4LRQA 1KJIA 4OHCA 3WGNA 5TY0A 2IU6A 3WGHA 1P81A 4W5TA 5ICSA 3PSHA 3U3XA 2VNHA 4HNAA 5IJ0A 1Y9JA 2JATA 1A7KA 1EB8A 2IOQA 5T8KC 3EJWA 3SX0A 1BJKA 4OQXA 2Q5IA 2TRSB 2ZVQX 3IS3A 3LKVA 3PIRA 3QBVA 5TQJA 5DW3A 2V7QD 3FDZA 2UZIR 3ES9A 3WB1A 2CD7A 3VZBA 2PX4A 3IHKA 4LC0A 1RT9A 4QJ4A 1B3RA 1J0AA 1UR5A 1PQYA 2BM0A 3KFXA 4IS3A 4KQIA 2BC9A 1NVWQ 3I30X 4NAHA 4QOGA 4QEZA 4O4JF 4HDAA 5HKAA 1K1EA 3T9FA 3BQ9A 3RAPR 3D6HA 3IIJA 3DFKA 3IP3A 3OEYA 4IRMA 2EG5A 2GFQA 3RVJA 2YWEA 2IELA 5AI5A 5LP1A 1DP4A 1BHQ1 1T2FA 1VSTA 3TS1A 4DXHA 3WLQA 1O5OA 2WDZA 1G63A 4L8FA 4B73A 4F1WA 2VYND 2ZE5A 4FU0A 2PXXA 4Z2YA 3X0DA 4C6HA 2P40A 4LMBA 5FP0A 3CVVA 4CT0A 4ZREA 3G0BA 1W46A 3G9TA 3SC2A 4YCBA 1T5HX 4K9KA 4GH5A 2DJIA 3FG9A 2QRNA 3BZUA 3LUAA 2HJVA 3ICQB 4GGMX 1QG0A 1SVSA 1P8AA 1U7UA 4WGFA 1E6UA 1IBLB 2UYGA 3SBOA 1R8QA 3RAEC 1RWPA 3TMAA 3KR2A 1F1BA 4EB8A 3T3MB 2W22A 4X84A 2IX9A 3AMVA 4KNYA 3Q41A 4L7VA 5CDGA 2SICE 3TLBA 3PJGA 3MGBA 3O9MA 3SDZA 2ZUCA 3HCCA 1XVVA 2VP3A 4MYCA 3VSDA 4A0RA 5AW6A 1YFJA 4NJMB 1FP4A 4R7TA 5I7RA 2I4OA 1Z0KA 1ZLXA 4Q3KA 4EG7A 4H59A 4EG1A 1I1HA 1MABB 3LKBA 5ER9A 5A06A 4DC0A 1K8QA 3SD7A 4TZ0A 4KSCA 3EY9A 5K0GA 1YRHA 3DTNA 3RRNA 4ESVA 2B37A 2DULA 2P9HA 5H3LA 1KDYA 2F3QA 4QIHA 1O58A 4X8LA 1PIWA 3Q8KA 1Z0UA 3GYGA 3QYAA 4XRRA 5TNXA 3EZFA 2C07A 4RTNA 1C4XA 2NZWA 3RLFA 1FL9A 4RIIA 2VZ9A 4QU8A 1NXVA 3JD2A 3ZHRA 1S8FA 4QU5A 5AKLA 4XYLA 3SQWA 3RRMA 4M8KA 4TTSA 5AHOA 3AK4A 5FO1A 1MC1A 5CA1F 2O48X 2NZXA 4WESB 4RAOA 1ZGZA 3LU1A 1XTJA 3PUHA 3V2UA 2XZTA 5AW0A 4GVPA 2WM3A 3QXJA 3VR6D 3KQTA 2XI4A 3A9SA 2X77A 3FH0A 1QQ5A 4IXWA 1C7EA 4MOWA 3LOUA 2YNMA 3AFOA 2UYOA 1J9EA 2HQOA 4FJ1A 1YQXA 2XUPA 4DTIA 4EGJA 1MKYA 4RS4A 4U2FA 2G1JA 1WCWA 3AI1A 1Y1TA 2OUIA 3MUNA 4B33A 5EKTA 3KUDA 5K2MA 1T8RA 3ORQA 4IFTA 5LUAA 5E4FA 4ZOLA 1K08A 2WIKA 4JLJA 1OFTA 2PL5A 3E9DA 3F4BA 3IEUA 3M6XA 5AVTA 2WIGA 3LP8A 3HVUA 1RKBA 2COEA 4GQAA 3D2AA 5JAQA 3U7QB 1LJ8A 1XNGA 4BLPA 4CG1A 4CMBA 2P67A 3B13B 3IQZA 1QK4A 3ZG6A 1PV1A 3CCCA 2XNDA 4YO8A 4ZICA 3ZH2A 2VS1A 4YJHA 4P93A 4QOJA 5AVVA 1ONNA 2ECFA 2UZ3A 3O6VA 4KWHA 1DAGA 1FUYB 2NZVG 3IDFA 5D00A 3W5CA 4LF8B 2RGNA 2QTNA 4GICA 4XVRA 3SHTA 2IS6A 5IBCA 4II3A 4I1IA 3B5JA 3UEOA 1RYEA 3WDMA 2EZUA 1AGYA 4PHTA 1UMCB 1CR0A 4A91A 3C6XA 4AS1A 1VHWA 1VJ0A 1BVYF 2J7PD 2RHLA 3FWPA 4RF4A 3PB3A 4YN3A 3UBTA 3EDYA 4DV3B 4BEWA 1FP4B 3LUCA 4L85A 2QTAA 3T5CA