1RRZA

Solution structure of glgs protein from e. coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'MDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQARELELEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthesis protein glgS
publication title Structure of GlgS from Escherichia coli suggests a role in protein-protein interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics,biosynthetic protein
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08971 GlgS Glycogen synthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.20 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Glycogen synthesis protein GlgS 1rrzA00
1RRZA
chains in the Genus database with same CATH superfamily
4YYYA 3R6CA 2BPQA 4GKMA 2WK6A 4IJ1A 1ZYKA 1ZXYA 1O17A 4X5BA 4MUOA 4HKMA 4GTNA 3QS8A 5EY3A 2TPTA 3UU1A 4N8QA 1GXBA 4YI7A 4LHMA 5BYTA 5C7SA 4GIUA 2J0FA 1V8GA 2DSJA 1ZVWA 3QQSA 4OWNA 3R88A 4OWQA 4XR5A 1KGZA 3GBRA 4F3FC 2WK5A 1RF8B 5C1RA 4X5CA 5C2LA 1RRZA 4ZOFA 1OTPA 4ZOKA 4ZOJA 3QSAA 3H5QA 4ZTVA 4X59A 4OWUA 1KHDA 4N5VA 4YEKA 4OWOA 4OWSA 4EAFA 2GVQA 4X46A 1BRWA 4GA4A 3TWPA 4OWVA 1UOUA 5BO2A 4N93A 4GA5A 1VQUA 5EP8A 4OWMA 4M0RA 4EADA 5BNEA 3QR9A 2ELCA 1AZYA 4GA6A 4X5AA 4X58A 5BO3A 4X5EA 4X5DA
chains in the Genus database with same CATH topology
1RRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRZ A; 
#chains in the Genus database with same CATH topology
 4YYY A;  3R6C A;  2BPQ A;  4GKM A;  2WK6 A;  4IJ1 A;  1ZYK A;  1ZXY A;  1O17 A;  4X5B A;  4MUO A;  4HKM A;  4GTN A;  3QS8 A;  5EY3 A;  2TPT A;  3UU1 A;  4N8Q A;  1GXB A;  4YI7 A;  4LHM A;  5BYT A;  5C7S A;  4GIU A;  2J0F A;  1V8G A;  2DSJ A;  1ZVW A;  3QQS A;  4OWN A;  3R88 A;  4OWQ A;  4XR5 A;  1KGZ A;  3GBR A;  4F3F C;  2WK5 A;  1RF8 B;  5C1R A;  4X5C A;  5C2L A;  1RRZ A;  4ZOF A;  1OTP A;  4ZOK A;  4ZOJ A;  3QSA A;  3H5Q A;  4ZTV A;  4X59 A;  4OWU A;  1KHD A;  4N5V A;  4YEK A;  4OWO A;  4OWS A;  4EAF A;  2GVQ A;  4X46 A;  1BRW A;  4GA4 A;  3TWP A;  4OWV A;  1UOU A;  5BO2 A;  4N93 A;  4GA5 A;  1VQU A;  5EP8 A;  4OWM A;  4M0R A;  4EAD A;  5BNE A;  3QR9 A;  2ELC A;  1AZY A;  4GA6 A;  4X5A A;  4X58 A;  5BO3 A;  4X5E A;  4X5D A; 
#chains in the Genus database with same CATH homology
 1RRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...