1RSFA

Nmr structure of monomeric car d1 domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
126
structure length
126
Chain Sequence
b'GSSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus and adenovirus receptor
publication title Solution structure of the coxsackievirus and adenovirus receptor domain 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rsfA00
2MHAB 1NGXA 1KEMH 4ZPTA 2HKHL 5AYQA 3V0WH 1FFNB 1LWRA 2VDMH 3MLUL 3S96A 4P2QA 3P30H 4ZFOB 3BRDA 5CBEA 3LEYL 4Z7NE 5J9PB 1B6DA 5DFVD 2CR6A 2XQYG 3ARBA 4PRPE 3MCG1 4PJ9D 4QCIA 3S5LB 5T1DH 5JA9A 1BQHB 3T3ME 2Q6WA 4DEPC 5C3TA 1S7VB 1Q0XH 3QCUH 4OLZL 4P2YA 5ACMA 1EUTA 1CDBA 3NN8B 4AH2B 3QUZB 5HPMB 1RZJH 2CDEB 3REVB 1CDCA 1OAKL 2F74A 4G6JL 4WUKL 3S35L 2J88H 1KXQE 3CVIH 4HEME 2DIBA 1KB5A 2V7HA 2WBJB 4LPUA 2P24B 4YDJA 2R2EA 1KJ3H 2ERJC 4OSUH 4YDLB 3GSNL 5GJSH 1OGAB 3ZKNC 4YHMH 4ISVA 3B6SB 2XRAL 3OKEA 3NIFF 3U4EB 2ATKA 5EO1A 1B0GA 4QHLB 4ODXA 4BQ6A 1UXSA 5BS0D 4O9HL 1BF2A 1KPVA 4GW5B 3KAAA 1Q72H 4XRCA 4KXZH 1MIEH 2UYLB 3ALXA 1CD0A 2EDYA 4H1LH 5EA0L 3R1GL 1G7JB 1EA9C 1UJ3C 1CTNA 4CU8A 1FLRL 3FB7B 1K2DA 3ULVH 3UTTE 4JPKH 5LGJB 5JUEH 4Y2DC 3O2WH 2M26A 5E1AA 3QIUB 2A73B 1CU4H 5IBUB 4IMLA 1WBYA 2AV1B 4ZUWA 2IC2A 1U8NA 4OAWB 4CADB 3VDBA 2A6DA 3RNKB 2Y7QB 4XPTL 3L5XH 4JM2A 3QPXL 3AUVA 3RWHB 3AVEA 1NGWA 4R4NC 4XP4L 1BFOB 1MNUL 5CUSL 1MAJA 4KUCF 8FABA 5IIEA 1ZWIB 3TN0D 3N06B 3MRLB 3HI6H 4NBZB 2EEAA 4FQCL 2VWEE 3G6JB 5CEZD 4UQ3A 4YHKH 3RKDC 7FABL 3PL6A 1FJ1B 1XIWB 3CH1A 4XPGL 3GI9H 1RZKL 4GBXC 3BYYA 4R0LB 5TE4H 1LO2L 1WAAE 1XGYH 5FGCE 2VN4A 4JFFB 3B2VL 4M6NL 3ARED 5GSRA 4R90H 3VXUD 3S6CA 3RVUC 4LARH 3O6LL 2V5SA 3P0YH 1UVQB 3I3EA 5C0EB 1IKFL 1YMMB 1DR9A 4NYLB 5DJ0B 1KCVL 2D9QB 4U6YB 3GJFH 4PRHD 3CFDA 5GXBB 1JYNA 4Y5YB 4M5YH 5FO7A 1FH5H 4JAMA 4PJXB 3M1BB 3RDTD 1INQB 3EYVA 4LHUG 3DPBA 4PJIE 3FFCA 2C1PB 4D8PB 1KN2H 3GMQB 5HPOA 3NIDF 1UXWB 1Y18A 5EUOB 3WYRA 1IL1A 2L0DA 1BD2E 1IQDA 5FCUH 5SV4A 5J89A 1I9IL 1X4ZA 2OK0H 2AXFB 5EOTA 1S7XA 4MNQA 4FFZL 2P48B 4P2OC 5CBAA 1AQDB 4GKNB 4NQCE 4X8JA 5I1CL 5HGDA 4M48H 4LHUD 1JFQH 1TTUA 4H20L 5EULV 4HZLB 4PJBF 1RD6A 4X6FA 1CICD 4P57A 4NQDD 5SWSA 4OV6F 2WAHA 1IGIH 5ID1B 4JFOA 2Q3AA 2GJZA 1MCRA 4X80H 4WDIA 4N9OB 1T7WA 3CLEH 1MVFA 1KPUB 1XGRA 5I1LB 1IAMA 4DVBB 4YX2H 3QFDB 5H8DA 2MKWA 5T3ZH 4KHTL 5F7EL 4LSPL 3RRQA 5MEQA 3RZCD 2O61A 2NX5E 1S7RB 1WFUA 2FJHA 2XTJB 4JHBA 2JELL 4NRXB 5HGHB 2FIRT 4C4KT 3GUTB 3MLWL 1NCUA 2EDJA 4L3ED 2FLBT 5K9KA 1NAMA 2B20A 2YOCA 3P11H 4HK3N 2V2WA 4WGWB 4NRZA 2JK5A 1OSZA 2AS5M 5I8CB 2HFEB 2J6EA 2QL1A 3NPSC 3UTSD 4ZTPL 1F4WL 4QHUB 5GS0C 5EU5B 5BJTA 4ORGB 5BMFL 1DBML 2R56L 4BZ1L 4PY8I 2PW1B 1QBML 1WBZB 5I8EB 4EDWH 2AK4E 5I73C 4IS6B 1GHFH 2P5EB 4S10A 4CNIB 3T0DA 3KJ6L 3V79C 4L5FL 4PRDA 3RA7L 3GGWB 4C56D 5IB2A 2VZVA 5KS9E 1INEH 2V7NB 4XMLL 3ILQD 1FORH 5DSCB 4H1LB 4NIKB 5EU6E 2AGJH 2YPLE 5C9JA 5DD1L 5GIRA 4RISL 1FVDA 2GCYA 1KJVB 4GLRH 5HHQA 3MGTB 5E6YA 1NGQH 4L4TD 2PYEB 5HHPA 4G6KL 3OB8A 4XC3L 4ESKA 3TPUA 3NZ8B 2AERT 2BCKA 4LDLB 3SQOH 3V52L 3VGGA 1AJ7H 3I6LD 5EC2A 2HFGL 4ONFL 4YDKH 2DQEL 4MJIE 3VWKD 1CF8H 3MRBB 1ZT1B 4MXVF 1AR1C 4WU7A 4QYOB 4X4ZA 4QF1B 3ZT6A 5ADOH 2CXGA 4LHJB 3LD8C 1X7QB 3RTQC 1NLDL 1R3IH 2A1WL 1A9EA 1ZMYA 4MCZA 4ZS6D 2EZ0D 1P6AB 1YEFL 5CJ8A 3HMWH 3C8HA 3ZSSA 4Y4HD 1BHGA 1QR4A 4HX1B 3MRNB 4JG0L 1QO3B 3GB7B 1NEZA 2N7AA 4EDXB 2I9LB 4P5TC 5C0CA 1MCSA 1SY6H 1JNNL 2A83A 4W4OA 2DM3A 5JXEA 3QA3B 1RMFH 4E5XA 2VXSH 2D7TH 4KVNH 1T1XB 5J3HD 1GAFL 4N8VA 3QBTB 4X6DA 1H5BC 1A47A 1T83C 5JORA 2MOVA 5JQ6H 5IB1B 4KHXL 3DUSB 2DAVA 3WKMH 2P5WE 5K9QG 3WFEH 4Q0XL 5E8EA 5CSZA 4JO1H 2R2HB 2J1KA 3LQMA 4ODTL 2OYPA 1N3NA 4OZIF 3GJFB 4JFQA 3WJJC 1NL0H 3BIKB 3UROR 4DZBB 5DLMH 2J8UA 3PIQA 2C1OA 4HH8A 4N0CC 3OX8A 1J18A 4IRJC 5GISL 3TO2A 4RGOH 5JHDD 5D1ZC 1N4XH 2G75A 4MQXC 1R3KB 5EZOH 5I66B 2EYSB 1MFCH 5E5RB 5I1AA 1H8OA 1QA9A 5CHNA 3ZDYF 4UILH 5D1QC 5IMOB 3U46A 4RRPG 2GHWB 4UT6L 2EKJA 4E41E 2HMIC 5MEPA 2HG5A 5BV7L 3HR5B 5DEGB 2PUQT 5DD3H 4YHLH 2XWBA 4JE4B 5DJ2B 1KELH 5H35A 5A3IC 1HNGA 1BWWA 4U1MA 3EO0A 5A2FA 4KZDL 1OAYL 2OS7A 4ZAKC 2M8XA 4LPCA 2Q76B 3SCMA 3C08H 3RGHA 3F8UB 4XPAH 4DVRH 2IAMB 2Y07L 1I8KA 5EBLB 3L7EB 1DBBL 4QTHB 3RJDA 3D3VA 3PGDB 1OTSD 3LKPB 5MI0B 2IH1A 1EZVX 3VFRA 2ARJB 4ACPA 2WIIB 3FCTB 25C8L 4M4PA 3U9PL 3PQYB 3P0VH 1J88A 3P4LA 3ARDB 3PGFH 2HJLA 2YKLH 1NKOA 2HLAB 4P46A 3K8LA 1OTUD 3ECBB 2A2QT 4LHQB 2BSRB 4L3CA 1I8MB 3GSOB 4XP9L 4ELMA 2J5LC 1J1OH 1HHGA 3FB6A 2X4SA 1X6NA 1JWMA 1T3FA 3VXRD 2UY7A 4LKCB 1RZIB 5IR1A 1G6RL 2FSEA 3H7BA 3KWWB 3EJJX 4KY1L 2CGRH 3MJ6A 1T7YA 2DQHH 5JXAL 4YFEA 4WUUA 4FTVA 4U3CA 2I9TB 1ZTXL 2N7BA 2QQKH 1GC1C 3ARFB 3BWAB 3H7LA 3M07A 3PHQA 1N59A 1BFTA 2G2RB 3I6GB 4I2XA 1I1YA 4R7NB 1DN0A 4HUWB 3LZFH 4LFHG 3MOBH 4FQXC 1ONQA 2VR9A 3ARVA 3FOLB 4CVZA 4N8CL 4JRYB 1J0HA 3HZKA 3QRGL 5GGSY 5D7SL 4F7MA 2R2BB 1U8OB 1QBLL 4QT5B 5IW6A 4G9FD 1QVOB 4S0SD 1WTGT 2AJVL 5HGBB 3RX8A 3TO4C 1T2QL 2PXYC 5DURD 1EFQA 5CP3A 3MBEB 5DK3A 3ILPA 1JPGA 3BE1L 1BVKA 3IKCA 4GKZA 1WICA 2Z4QB 3BN9D 2E5EA 3FQUB 5E2VL 4C83B 3OXSA 1T22A 3RWGA 3D39B 4HKZB 2ZOLB 5I1KH 1T89A 4ZO6A 4HJGB 3VW3L 2DQCL 3WIFB 4HQQH 3O4OC 5D2NE 1U8MA 3QDJE 5C0ND 4OLVH 5FA3A 5D2LF 4TYUA 4OFVA 3QXAA 2H41A 5IBLD 1HI6B 4AENB 4N0RA 1BM3L 1K8IB 3B43A 5GGSA 1FYTD 2WLZA 2EEBA 4BUHA 4HGKC 7CGTA 4KRLB 5DZOA 3L3IB 1KULA 3OR6A 1AFVH 4F8TA 3S98A 3V6OA 1HSAB 1F6FB 5F6HJ 3OAZK 4PJEB 1VB9A 4I3RH 4JFEB 4L4VE 3TVMC 4PLJC 4QY8A 2VC2L 1OARL 3QCVH 1PX4A 4WJ5B 3WS6A 3W11C 4GG6E 4OGAD 2X10A 4P3CL 4MX7B 3DVFA 1PGRB 2R0ZH 2H32A 1INDL 4O2FA 1CYGA 4B53A 5C09B 4OF5A 4GW4A 1TJIL 3HC0B 2HT2D 4FQIL 5F3HA 5CSBA 2PO6A 5HVHC 2GT9B 1A21A 3PHOA 4GQ9L 2VKWA 3OTTA 2GTZB 5B39A 4MSWB 5F97E 3SDCA 4RGNC 4APQA 4LDOB 1J0IA 1W72L 3U36B 1FL6A 2BNQD 5HYJB 1JNHB 5F71A 1MCKA 5ITBH 1S78D 1UCTA 3K46A 1LO0H 1JZ4A 3OGCA 1A3RL 1QSED 3FZUC 3VG9C 1XCTA 3MODH 4JM4L 4OTXL 3G5ZA 1SJHB 3SY0A 2IG2H 2BVPB 4MB5A 1J5OH 4KJYA 3EYSH 4P2QE 3O9WA 3PJSB 2DICA 4J12A 1Q9KA 1DQQB 3QZWG 1GZPA 2CDGB 3KYKL 3SGKA 3KPRD 2M2DA 3KPLB 2YHGA 3FAXA 3OKDA 2C3XA 4JREB 1Q1JL 3F65A 4JHWH 4PP1D 5FUCC 5HVWA 2GUOA 4K71B 5IEHA 2OJZL 1NMCC 4G6MH 1NDMA 1D9KD 1H9VA 4D9RD 1D5ZB 4X7TA 5JDSB 3G6AA 1BX2A 3O2DL 3D5OF 1JRHH 1RUKL 4Y2DB 3VFGL 1CT8B 2I26N 5ALCL 3IDUA 3MRKA 5GRUH 2VDKL 2O5YH 4UTBL 2XZCH 1UB5A 1D7FA 2UWEF 4OZHF 4M43H 1BBJA 1HHJA 1T20B 2HT3D 2X89A 1DQLH 1IGCH 2EDEA 1C1EL 2I07B 1S7SB 2VDOH 4UOW0 1TPXB 5DGQA 3V95A 3MMEB 3UJIL 1V5JA 1MFAH 3BZEA 1U8QB 4Y19B 4R3SA 1KFAH 1YEHH 3T65A 1S7WA 3F7VB 1YNTB 4I0KA 5GPRA 4R96B 1AKJD 2KKQA 2CK2A 3C9NB 2Y06H 3VMPA 4L8SB 5L7XH 3PABA 5DJXA 5T33L 3OZ9L 4G42B 2X9XA 1LE5B 1BBDL 4MVBD 3QHFL 3U7WL 1A02N 2XTLA 3HAEB 1UACL 2XPGB 1YPZB 2IPUK 4MQ7B 4CGTA 1OLZA 5EWIL 3M45A 1RFDL 2DMKA 3DX6A 4QRPB 4HF5H 1BQHG 2BVUA 4YFLF 3IFOB 1NCBH 5DC0A 1GPOH 4G6FD 4PRBB 3V6ZB 3RVVD 1CFTB 2EC9T 1NCCL 4Q6IC 3SGEI 3WN5A 2YD1A 1RIVL 2YA0A 4LIQE 5I19H 3H9HA 1G7QB 2M1KA 1CXIA 5D7KD 4JKLA 4P5KB 1U3JA 4UTAL 2GSIB 3O3DA 3UPRB 4TPRH 4PJHF 3FQTB 3U83A 1NC4A 1D5IH 4AY0A 5JTWA 3T0BA 3TH4T 2DTSA 1HEZA 4NBYB 2V2XB 3IJHA 5E8PB 5IEKB 4CRPA 4TQEL 5JNYA 3C60C 3RHWF 1J1PL 1S5IL 3ARUA 1WJ3A 3B3IB 3QUZD 3LCYA 1A8JH 1W0VA 2ICEB 4AEFA 3RX7A 1JCKA 4XCCL 4DN3L 5JZ7D 3CFJA 3LRSA 4XX1E 1F3JA 2WBJD 5IJVB 1JUFB 5IMKA 1QYGH 1XFPA 1U92B 2YPVH 5GS1C 1OGAD 3PWUB 4UV7L 5IBUG 2FHFA 3FFCE 4X9HA 1ZSDA 4PJGF 1BEYH 5JMOC 1JWSB 4POYA 3MV7E 1FNAA 4KK6D 1IEBA 3GSWB 2HN7B 5K93A 1CK0H 3PDOB 2C26A 4YHOH 1R3JA 3LQAC 1CXLA 2QR0A 5T1KA 4NUJB 3LKQA 5GRJL 4XNUL 3VFUA 5IGXL 3IDXH 4JEGB 2XQBH 1IKNC 2B4CC 2GIYA 3MV9B 4XWGH 4Y1AA 3U48A 3HNVL 2DQJH 4MNQE 3U2SB 1ADQA 3IAGC 3QG6A 5GGVH 5FYJD 5F7DB 5CEZL 3MV01 4K2UH 4PLKD 4LPXA 4PFEA 2VQUA 2XKSA 4HIEA 2WANA 3WJLC 4F7CB 3NPSB 3WLWC 4LNVA 5JOPE 3GO1H 4HWBA 3FB5B 5DD6B 3HZYB 1A1OB 3GMNA 5SWSE 5FA4A 3EFFB 4K3GA 1OP9A 4M62H 3B9KA 3O3EB 1IGYB 2W38A 2GJJA 3CAFA 4OIBA 1IZKA 5IFAH 4HWUA 1C16A 1RULH 4I5BA 4YDVB 3DRTA 4M8QB 3HPJA 4HWEH 4M93C 3PP4L 4ZSOA 4S1DD 2GK2A 2NLJA 4Y5VA 2E7MA 4LSRH 3QQNA 1HWGB 1FLTX 4I8DA 1KV3A 1TCRA 4TTDD 4WO4A 4XBGB 3FT4B 1XIWD 1ZGLP 4BKLA 4NN7B 2DQDL 3BAEH 3CUPB 2OL3L 3L7FB 2UUDK 1EBPA 4QHNB 4L8CA 3IDJA 1UG9A 3O8XC 4PB0H 3BP4A 2VQ1B 4ZFGL 1WTLA 4JFFD 4ZPVA 5E56A 1F3DJ 1U8IB 1I7TB 5INDB 5E8DL 3VFSB 1MEXH 1YMMD 3I2CH 3L3HB 5H2BA 3LD8B 4Q9BA 4XB8A 3JTSA 5HD8C 1T66D 3IFNH 5F7UA 4P59H 4K3EH 5F8QC 2VLJB 1H3WM 3DBXA 2QQLL 3K3QA 3K2UL 4N5ED 4OZ4B 2WM0A 4KQ4L 3TBWA 5IB4A 3WFHA 4AEIH 1TFHA 1F6AB 4H8WC 3AS3A 3P77B 4XAKE 5L6YH 4HKXB 3FTGB 4N0UB 3T2PA 1AR2A 4PJAF 4YIQB 3IS1X 4D94A 4ZMAT 5D5MF 5KANI 3EUUA 4LRNL 3A6BH 3K1KC 5FYKU 1ZT4A 4PJFA 1CFQB 3THML 4R9HA 3WUZA 4HXBL 5DUBA 3F12A 1RAMA 1CCZA 4EN3A 2YK1H 5IFHH 3NFPA 4ZFFB 2VXQH 3SJVB 1T0MB 1N2RA 2DJSA 1OAUL 1CGSL 4GRMA 3MUHL 1VGKA 2XZAL 1REIA 1T0PB 2GW5A 4XHJD 1A4JB 3IDIB 1C08A 2VZUA 3CU7A 4KK8D 4TVPE 1QFWM 4HS8L 4TRPL 5EBWA 3RUGA 4MD5A 4OI7A 2WUBL 5GSVB 5EN2A 3TEUA 2RIKA 1NPUA 4POZD 1EAPA 5D1ZB 5C0CE 2AXHA 1JK8B 3GMLA 4AMKH 1MAKA 4XI5D 1U58B 4YNYB 2C7UA 4ZS7H 5DRWB 5D1QB 4X6DE 3MRJA 5MP6H 2AABL 5FXCH 3FQXA 3S8WA 2VDLH 2XTJD 1Q9LA 1FHGA 1FG9C 1FVCA 2D0FA 2IFGA 4TNWK 3CNKA 4RCAA 4H1LG 1DBAH 2QHRL 1F4XL 3B5HA 5TH2B 1AQKH 2Z91B 2NY5C 5BQ7B 3F6LA 4G7VH 4BQ9A 3RWDA 3PDDA 3KG5A 2VLKB 3LN4B 3TNMB 3FAWA 4KKAC 4O4YH 5TE7L 2J8UE 3TP4A 2NY3C 1AGEB 3EYUL 4W6YB 4MQTB 2ATPA 5EU7C 1T0NB 2P5ED 1BF8A 3H42L 4AEHH 5IVXA 1J8KA 3BVNB 4FQLL 3E8UH 1A7NL 5I30L 1K9TA 5HYQA 5FO8B 3OPZL 3TJHD 3S36X 4O51A 1FYHB 1OCWL 5C0JA 2CO6B 3WNKA 2QADC 1U91A 1A6AA 2FH6A 4EI6B 1NBZA 1U8JB 1ZHKB 3QDMB 5TF0A 3ULVD 1NGZA 1YEEH 5JPNA 2DF3A 2YXMA 4S1QL 4A6YA 5GGRA 1ZHNA 4NT6B 3DGGA 3GJEA 5J6GB 4FP8H 1Z9SA 5SWZA 4GMTH 2VQTA 2NY6C 3MGOB 5FB8A 1OD9A 4IDJH 4NO5A 2A9NL 3P4NA 2HVKB 1UB6B 3D3VE 4YGAB 2CUHA 2XWJB 2CRMA 4WFFD 4NSKA 1MRCL 5F72S 4O2EA 5IBTL 4DZ8B 1OHQA 1FIGH 1IMHC 2YZ8A 1MF2L 3MXVL 4JFDA 1IC5H 4GAGH 2DOCA 1MI5B 2H3NA 4FQXB 5ANMA 3TCLA 2X70A 3EDDA 5IQ7H 1ZVHA 3BPCA 2E6PA 1JJUA 2EO9A 5MEOA 3UTTB 4U0RB 4ELME 4U6VH 3ULUE 3TO4B 2MKLC 2NXYC 5F9WC 2PXYB 5C1MB 3GBNL 4ZTOL 1BJ1H 5C6TL 1YEIL 3BGMB 2VDRL 4TSBL 3CK0H 5FYLE 3IAPA 3QIBA 4WWKB 1UWGH 1G7HB 2EYRA 4FTVE 4WUUE 4DCQB 3MCLH 1MHPL 1RIUL 4V1DA 1I4FA 2IAND 4NC1C 3MOAH 1H0DA 3RY5A 5IROC 5EO9A 3T08A 2APXA 4XBEH 4D9QD 3UJJH 1XGQB 4I2XE 4NHUA 3DECA 5FDWB 4XH2A 1G9NC 1GH7A 4URTB 3DARA 5HHXL 1UWXK 2Z93B 4M7KL 3HKFA 1JGVL 3CXDH 3ZE2E 1KIQB 4RZCA 3MLYH 5DI8B 1P1ZB 3VGFA 5HDQL 4K94L 5FGCB 5B38A 1DVFA 4DAGH 2QSCH 4X4MA 4K8RC 1KCSH 4GKSA 3DVGB 3BESR 1TTFA 5DEZA 3BFOA 3PWJA 1BFVL 1P69B 1WZLA 4HIJB 5FM4A 4K3JH 2BP3A 3V0VA 5F9OH 4XWOC 2DI7A 3HRPA 1KTRL 3W9DB 4K3DH 2IAMD 4ODUA 2FGWL 5CGMA 3E6HA 4NNPH 1U41A 3BWUC 3HZMB 4QXWA 5CJQH 3CSYA 3RAJL 5F44A 1I85C 1MY5A 2B4CH 1BZ9A 3PL6C 4KPHL 5IB3B 1IJ9A 5J1AB 4LPYA 4XCEA 5T1MB 1CS6A 3LQZA 1D6VH 5T3ZD 2V6HA 3X3GH 3GI8L 1WUNT 4EVNA 1XH3A 2XFXA 1RZ8A 3RL2A 5J7CC 1JI2A 2R1YB 4YXKH 3V6OE 4HPOL 5DRZB 3ARDD 3VG9B 3S37X 3OKNA 2APWA 2ENSA 3R0NA 1MJUH 4QXUH 5FYKE 3OJ2C 4XAWL 1P4LB 3IU4H 4PGDA 2BDNL 2HRPH 5B4MD 2FIKA 1FNEB 3EDJA 4DQOH 5J8OA 4MS8C 1BIIB 3FQRA 4FG6C 4NQCB 3PXHA 1PQZA 2IWGA 1MOEA 3OJMB 3ZKMD 2VE6B 3VWJB 5FKPA 2ZUVA 1A6ZA 1NMCB 3MR9A 1CLOH 4Y8DC 3CCHA 4KRPB 4MLIA 3ARFD 1AXTH 2I5YH 4LAJH 4O58L 5CIPB 5HDOA 2EDTA 3NZHH 4I3GA 2ARJQ 1AY1H 1NGYB 3LSOB 1PVHA 3TM6A 1KTDB 3BSZH 4JRYD 5ENWB 1J0ZA 1IARB 4BH8A 5FGRA 5FOBA 1MFBH 5ACZA 3NACH 1DLHB 4OGXH 2Z31C 4GSDL 4Q58C 5C07B 1E0OB 1FNGA 3S9DB 2H2PC 3WIHL 4ZQKB 5KSAB 1NCNA 1AD9A 3EGSA 3C8KB 2DQIH 4Z7QE 4H8WH 3VFTB 5IOPA 3AMKA 4YGVA 5DJZB 3QUYA 1YNLH 4PRIA 4AQ1B 1JBJA 4X0KA 4FQJH 4J3WA 4YHPB 4J3TA 2F5AH 1RSFA 3EYOB 3ZKXC 3BH8B 3SEPA 1XF3A 4NZJA 3F7PC 1G7PA 2WBWB 1FV1B 4M7JH 5LG1A 2CXKA 2ZPKL 3HTLX 1GVIA 2CJUH 2YPLB 2IALB 5A2JH 1NBVL 3TT1H 1AH1A 3MPCA 2R4SH 1VFUA 3CVHL 3L3KA 5I1EL 5DD0L 4NNXB 1DSFH 4YQXH 2BSSA 4QRRA 2X9YA 1S5HB 3OF6A 4JFED 1CN4A 2GFBA 1ZLWK 3H9SA 4MJIB 5CINL 4PJ8C 1GGBL 4OFDA 5INCB 4BFIB 2VN7A 2FL5B 1I3GH 4LP4A 5GZNC 4HEPG 2VLLB 4UT9H 1X44A 5C09D 2EIEA 4K7PX 4DFIA 4GXUM 5GGTH 2GK0A 5I1JH 1EJOL 1ZEAH 3QUXC 2OJEA 3QWRA 3IXAB 1RZ7H 3RVXC 5BZWB 2NY5H 4OCYH 4BA8A 5HYJD 1CXHA 4OLZH 5EBGA 1LEIB 2AJXH 4YAQA 5FGSA 3HPLA 1D5BA 3A6OA 3NA9H 4CVWA 2D03H 3ZE1F 4G6JH 3ZKND 3GMRA 4S2SA 2XV6B 4LLQA 2AEPL 2EIBA 4GMSH 1FE8H 2QJDA 4F58H 5HI5C 4QXTA 2AJ3B 2P5WB 5K9QI 5BV7C 1P7KB 4PR5B 4ODSL 2FWOA 2P7TB 4WFEE 3KNBB 1JZ6A 5CJXC 3CFBA 3MRRA 4QKXB 1QFWL 4KTDH 4X98B 5FDYA 2CLVB 3T0WA 1U3YA 4NKMA 5CD5C 3FB8B 4F9LA 4HW6A 5I16B 2X05A 2R69L 1EO7A 3RWCB 5MENB 4HCRL 3MLRL 4BQ8A 3X11A 1IQWL 1AHWC 5MHSE 1AC6A 1L7TL 4Y2DD 3KYNB 3G5XA 3ALPA 1GGYA 2ADGB 1Z6JT 1ZLSL 1W8NA 2IBZX 4OV5A 5D7JB 1BVLB 4HKJB 3P73A 3L6FA 2PETA 4E41B 4P4KA 1QQDA 1FG2A 2ADIB 3GK8H 4XP1L 2MQ0A 4F7PA 1M1SA 4Y7MA 1ZE3C 4MHHI 3VCLA 3QNZB 3JUYA 3CZFA 1WIPA 1G7MA 4M93B 4NO0B 4BSJA 3QPXH 1XR9B 4ONOA 4XMKL 3RKDD 4JQVA 4Y19D 1HKLL 5F9JA 1ULVA 2Z9TA 1NFDA 4Y1AE 3SGDH 3T0EC 2Q7YA 3LPWA 4FQCH 3BKML 1RVFL 4GBXD 1QBAA 4K7FA 5I74C 4WTWA 4LPWA 2CRYA 3BDYH 3EW3B 3I02A 3MNZB 2WWKT 4IRSA 3NTCH 3QI9C 3ZE0E 3WIIL 3RVUD 3K74B 3OAZH 4PJ7F 5C0AE 4OIIH 4H26B 3QEHA 1HQ4A 1KB5H 1OSPL 5TDOA 1ZA3A 1I3RB 2FLRT 4AIZA 3A67L 4ZFOL 1LDPL 3O4LA 1EVUA 4D9LH 5CKGA 3MO1A 2DWDA 4ZSOE 4WHTA 1MJJA 2PW2B 1I3VA 1MAML 3RNQA 4R26H 3UTZB 4NKOA 3LAFA 4E9LA 3HHRB 2D0GA 5I1HH 1BJ8A 3PWLB 3A0OA 1G9NH 2Y23A 3WS3B 1CXKA 3WFDL 1IM3B 4F57L 3CDYA 4JZNA 4OCXL 4ODWB 5DWUL 2VUYA 3EYFA 4L8DA 2HFFB 3C6SB 2E9WA 3H0TA 3JWOC 4Y4FB 2Q8AL 4NZRH 3VXMB 3V5HA 4BSWB 5L8JB 4YHNA 1YEKL 4K8RH 3MQIA 3RPIA 1DBKH 4M5ZL 4P2RA 2RB8A 3QUKA 5AEAA 3F62A 4JHZA 3T8XA 1HH6B 3Q6GH 3D18A 5JIPA 5DTFA 4OUUA 2YWYA 2XG4A 1XT5A 4O02H 5I18H 2KDGA 4WNQA 1MIMH 2HT4C 3AXLA 1F8TL 2NZIA 5FYJL 5ICXB 3BEWA 2LABA 3DJ9A 2H26A 3HRZB 1TZHA 1VPOH 2EE2A 3W9EA 3BT2L 1QR1B 1PY4A 1OW0A 1YDPB 3NH7L 5KSUA 3MOQA 5C2UB 2VL5A 3UBXB 4PJFE 1FZMA 5HDBF 2O5ZL 2BNUB 2WZPD 5ICYA 3M17A 1JE6A 2BRRL 2OLDA 2Z8SA 2NZ9C 5D2NB 3MV9D 3QDJB 2R8SH 4NZTH 1NGPH 1Z9LA 2YA1A 1JGDB 1Y6MR 4IHOA 4ONGL 4KTEH 3LEVH 3DURA 2IPKA 1DEDA 4IBLT 4X9GA 1TJGH 5EPMA 3IDYB 4L9LB 3U1SL 3FT3B 5MERA 4C54A 2ZUTA 3RUGE 2F8XC 1QP1A 2YD6A 1PLGL 2MNUA 3HC3L 4YWGL 5FM5M 4F37F 3OXRA 2HJFB 2AJYL 2Z8RA 4JO2H 4L4VB 12E8H 2R0LL 1EO8L 4WTZA 4BZ1H 3G6JF 2H1PH 4GG6B 2VXUL 3DX9B 5J11C 3JVGC 1B2WH 4TOYL 1LO3L 1DQMH 5DMGC 4B41A 1X4YA 4EQ3A 3SGJC 1PW3A 1U6AL 4MJ2A 4RFEB 4LCCB 3K81A 3ZT7A 3FJTA 2OR9L 3GBMH 1A6WL 2D7NA 2X4OA 2N4IA 4YHYC 4J3UA 43C9B 4KROC 4QTIH 5E4EB 4FZEH 1M71A 1JHKL 5D9SB 4HGWB 5CCKH 1BFSA 4EIGB 1FNLA 4JLRA 2VAJA 3CH8A 4PJ5E 1AR1D 4G7YL 3JTTA 4CN1A 5T5FH 2SEBB 2AV7A 4LMQE 1BOGB 2D31A 2W9DH 1J8HA 5L8KB 1YEDB 4OM1H 1NC2A 4NQTA 1RZFL 5IVXE 3BRFA 1TVHA 1YECH 2EDWA 3RTQD 4HH9A 4M6MH 4LCYA 1BAFH 2VLJD 4PJXF 4P2QB 4RX4A 1GSMA 3JV0A 5CBEB 1DUZA 1BGXL 4O5LL 1KCKA 4U1GC 4LGSB 3ARBB 2AEWA 4PIRF 2X7LA 4P5TD 2C4FU 2Q6WB 5EUOF 3WHE0 3NABL 1A9BB 2J4WL 2ZCLH 1TQBB 3P3YA 3KPPA 5GGQH 3AY4C 1I9RL 3BD5A 4J2XA 3TT3H 3V0WL 4TSAH 3I9GH 1RU9L 2NXYB 5SWZE 2CKBA 4XVUC 5F9WB 3TBVA 2VDML 5A2IH 3K8MA 1KB5B 2V7HB 3TWCH 3P30L 5FV1L 3SJVD 1UJTA 4YDJB 2R2EB 3MFGB 4C55A 4JZJC 1N7ML 2EECA 4ISVB 5T1DL 2AEIT 4Z7OF 2OR8A 2ATKB 3BZFA 1Q0XL 1B0GB 1RUPH 3QCUL 4ODXB 3RFZC 5EBMA 4IMKA 4YE4H 2IH3A 1UXSB 2DYPA 4KKCC 2D2OA 1KPVB 4W4NA 4JN1H 3PWVA 4JFDE 1RZJL 3VGAB 1NLBH 4PJ9C 4XRCB 1W72A 2PYFA 2J88L 2VNCA 5D1ZD 3GMOA 3QO1A 3CVIL 5ANME 4MQXD 3CFCH 1G84A 1KJ3L 5D1QD 4OSUL 1K2DB 5IHBA 5ISZA 5GJSL 3PWPD 3OL2A 4YHML 2HMID 5DRNA 3HMXA 4TUOA 5IG7A 1RHHA 3BW9B 5E1AB 5T3XE 4IMLB 1WBYB 1CIDA 4ZUWB 1U8NB 5A3ID 3DMMC 3KPTA 2A6DB 5I8OH 1Q72L 1MIEL 4U7KA 1NGWB 4OKVA 5IQ9A 1FZKA 1ACYH 4J4PC 4ZAKD 2VLKD 4V1DE 3LV3A 1GCFA 8FABB 1K8DB 3LN5A 5IIEB 3OQ3B 2NR6C 4O2CA 1UEMA 3ULVL 4TVPH 1LO5A 4KZDH 3O2DA 4MYWB 4UQ3B 3O2WL 2DBJA 1CU4L 1U2HA 3PL6B 4M7ZC 5AG8A 1IEAA 3SDAA 4BZ2H 2UUDH 1RPQA 1Q94A 2OI9C 3CH1B 1DBBH 2BOBA 4JB9H 1NUNB 2E7LA 3QNXA 1G7IA 2FD6L 4UIMA 4LCUA 1WEJH 1LK2A 3ROOA 4U1LA 2VLME 3QDMD 3ULVF 5GSRB 2VZ1A 4X4ME 2UVEA 4RIRA 3BQUC 3HI6L 3QR2A 4YHKL 4PP2A 25C8H 4JDZA 3TN0C 4KDTC 2YEZA 3GI9L 3CFDB 3LRGA 4GRLA 4MAYC 5FO7B 4JAMB 3EFDH 2YR3A 1XGYL 3EYVB 1BIHA 2GTWA 3FFCB 4R90L 5SWQB 4ZNCD 4XXDA 2BRQA 4MWFA 4HBQA 4LARL 2XNAA 2JB6A 2YMXL 1G6RH 3P0YL 2HYMA 3VG0H 5I71C 1Y18B 5E94B 2ICWB 3D2UA 5E24E 5KBNC 1IQDB 4OZGA 3AREC 4E0RB 1P9MC 4GUPA 1MI5D 4FQXD 1MSPA 3SE3C 2EH8H 3LIZH 1C7SA 1WWAX 3QPQC 2NY4B 5EU4A 5EOTB 4M5YL 1YNKH 4MNQB 1FH5L 3QIWA 4I48A 5F1IB 2VLRB 5CS7A 3UTTD 1QACA 4NGHH 4X8JB 1KN2L 3TO4D 3EO1B 2FR4A 2PXYD 1T1WA 4X6FB 2R9HD 3JV4A 2AEQH 5SWSB 3VI3E 1F2XK 5FCUL 4WWKD 4FHBD 4UOW1 4JFOB 3DYOA 4PS4H 5F3BA 2GJZB 3ZKXB 1A1MA 4O00A 1XGRB 4MJ5A 4QOKA 3JWOH 4JGJA 1ETZA 3ARSA 2P42B 4L4JA 3OAUH 4M48L 1JFQL 1PZ5A 2DQCH 5MEQB 2O61B 5BRZA 4KGJA 4LLMA 2MSPA 1C5DA 5K9KB 3AB0C 1NAMB 1FDLH 1IGIL 2V2WB 5BO1L 4NRZB 4AL8H 2JK5B 1OSZB 1B90A 1A4KA 1ZGLA 1X5JA 3QH3A 4X80L 3CLEL 4P4RA 4X9FA 4X7SH 3MLTB 5D7LA 5BJTB 4NDMA 4YX2L 2W59A 4Y16A 1CTOA 4PRIE 3W11D 5T3ZL 3MV8A 3K0WA 5FKAA 4XBPA 3QJHA 3MJ9H 2GY7B 2O5XH 5FYLH 3C5ZC 4JKWA 3SKJH 2F5BH 2A0LC 3BPOB 4PRDB 3V7AE 3KGRA 2XIDA 3Q2CA 3P11L 1PD6A 4U1HA 3DV4A 5C9JB 4JFXA 5GIRB 1FVDB 2FO4A 2GCYB 3WDHA 1UQSA 4RGND 5HHQB 1JI1A 3BGFB 2YWZA 5HHPB 2X1XR 1HH9B 2DJUA 2WMPA 3TPUB 2W91A 2V5YA 1E28A 4XZUA 1GHFL 2OZ4H 4NM8H 3FZUD 4QRRE 2BCKB 4WFHE 1MCJA 2Y4SA 4J7RA 1NFIA 2B0SH 5EC2B 5CD3B 3H9SE 1INEL 3IFLH 3OSKA 2A9MH 2XWTA 2Q86B 3FQWA 5CP3H 4WU7B 1FORL 5TF1H 2AGJL 3NIGF 1QTYT 3LPGA 3SO3C 1DFBH 3AMLA 4NQCD 4OTXH 1NGQL 4GRWE 4PRHA 1IBGH 1A9EB 4MCZB 3HB3D 3LY6A 4X6CB 3SQOL 4D0BA 5IJKC 1NEZB 1AJ7L 5K59E 4KRPD 4YDKL 1R3HA 1H3PH 1F4AA 1M05A 4JPIA 5C0CB 1CF8L 4Q97A 2A83B 5CP7A 5IHUH 4KI1A 5D5MA 4E5XB 3X12A 4U49A 5ADOL 4N8VB 2G5RA 4X6DB 4CU7A 5JORB 4LRIC 4J1UA 3Q5TA 4NCC2 2ZWLT 5ALCH 3Q1SH 2VABA 4EN3C 2BSTA 1IRAY 3HMWL 4RMQA 3T4YA 1LHZA 1G0YR 5E8EB 4MXVE 5CSZB 4UTBH 5TE6H 4CMMA 3SKOA 3DXAA 5C07D 3LS4H 4JFQB 1SY6L 4Z0XA 4DWHA 2H32H 4R4BB 1CICA 3JBG7 4KI5E 5GJTH 3MBXL 1V3LA 2J8UB 2JJSA 5DJ6B 2C1OB 2VDPH 5F1KC 2D7TL 1V7NH 3MLVH 4KVNL 3T0EB 5DMKA 3W5NA 1UWXH 3OX8B 4BELD 1ES0B 3TO2B 2PF6A 1HDMA 4PV9B 2BHZA 2VZSA 5JQ6L 5LBSH 1U42A 3MUJA 3WFEL 4H88H 2JIXA 5GRVL 3QI9B 1QA9B 5CHNB 4NC2B 4JO1L 1YY8A 2FYYA 5H94A 3CU1A 3U46B 4HS3A 5J6HA 3L5HA 2YPLD 5MEPB 2HG5B 3RZCA 1NL0L 2XWBB 5DLML 4RDQF 1CL7I 3QHFH 1UACH 5H35B 1L0QA 5IT2H 4LKXB 3EO0B 4RGOL 5DUPL 1U8PA 4PJEF 1N4XL 3SCMB 5EZOL 3UTSA 1MFCL 1MCFA 4M02A 1X4XA 4M00A 1I8KB 3QEGH 4MJID 4UILL 1XGTA 1NFDE 5D71L 3S7GA 1R5WA 5F8RC 3S36H 3D3VB 3VDCA 5DD3L 4YHLL 2ZCKH 5BCAA 4OF6A 1KELL 5AWNH 4C56A 3RY6A 3IETA 4EI5A 2K7QA 3KPSB 4HWZA 5F89A 1X3DA 1Q0YH 3VFRB 1HK6A 1RUQH 5B3NA 3TBTA 3C08L 3O4LE 4XPAL 4DVRL 3KS0H 4L4TA 4XP5H 2JJTC 2W1NA 4M1CD 2HJLB 4ZUVA 4TQEH 5AAWA 4P46B 3IAQA 1JPSH 3OGOE 3NFNA 1JTPA 2V9TA 3O0RH 1I1AA 1Y0LA 2UZYB 1NSNH 4L3CB 4ETYA 3TNNB 4ELMB 1ORSA 3E3QC 1HHGB 4QGYA 2VOTA 4DN3H 2X4SB 1JWMB 1T3FB 2B39A 2P5WD 2FSEB 3H7BB 5LQBH 1EPFA 4K94C 3P0VL 5IWLA 5JW4R 1IAII 2OSLA 4LSSL 3CFEA 4WUUB 3PGFL 3FONB 3DNKA 1N64H 2YKLL 3SKMB 5AYUH 5M94B 5MEND 1UGNA 3PHQB 6CGTA 1N59B 2DMBA 2Z92B 4I2XB 1I1YB 4YO0A 1DN0B 5DQJB 1J1OL 4P2RE 3O41A 1CE1H 2GSGB 1ONQB 5I17A 4F9PC 2XKUA 4PBXA 1OTUC 5ETUA 3HZKB 5JW3H 5D7JD 2CGRL 5IW6B 2DQHL 4E41D 5D70H 2D7QA 5D1XA 4P48A 2QQKL 1H8NA 2G5BA 3ILPB 4FN0A 5FHBH 1JPGB 4I0PC 3L5JA 1BVKB 4GKZB 3ORJA 3FKUS 4NO0D 1CWVA 1GXEA 3OXSB 1T22B 2E7CA 3MOBL 4NQSA 3RWGB 4YZFE 3DI3B 1D5MA 1U8MB 4EQ2A 5FA3B 4IIQC 3QXAB 1I75A 3CXHJ 1VEPA 3VFVA 2Q3ZA 2XZQH 4YHYB 3IJSA 4KROB 3ZTNH 3RIFK 5ALBH 3ETBF 5DT1H 3LKNB 3WNLA 1YPZF 1IFHH 4YUEH 3HC4H 4J3VA 2DQDH 1KXVC 2OL3H 3OR6B 2R15A 1CG9B 1ZLWH 5I1KL 1WFNA 3QQ3A 4U31A 1A5FH 1CDUA 4ZFGH 1IM9A 1NCDL 4OLVL 4QY8B 3L9RA 4ZUSA 1KTLB 3MRMA 3VXTA 4HUUA 3LH2H 1U8KB 3TGXA 2Q87A 2H32B 4O2FB 5C0BD 2Z35A 3QHTC 4MCYA 4GW4B 5C0NC 2Y5EA 3I3BA 1KLGA 4NWTH 5F3HB 2PO6B 3EBAA 5D2LE 4OLXH 1DZBA 1AFVL 3PHOB 3O6FC 4RRPA 2VIRA 3P9LA 4QWWC 1I8IB 3T0VA 3BISA 1ADQH 2OQJA 4I3RL 4M03A 5B39B 3SDCB 4APQB 4Y4FD 3QCVL 1J7VR 1FL6B 3VXMD 4JCMA 2VZTA 1J11A 5GHWH 2ZKHH 4JHAH 5H37G 2MQ3A 1SJEA 3OGCB 2X4QA 4LRNH 4DK6A 2W65A 1J8HE 3B5TA 5F6IC 1M7DB 3CIQA 2DS4A 3G5ZB 4JZJB 1A7OH 3SY0B 1AGBA 4NKIH 2J8HA 4IRZH 4XC1H 3CJJA 4KJYB 1NJ9B 2R1WA 2PKDA 3O9WB 1L7IH 1U93A 3HUJA 1Q9KB 3SDDA 1GZPB 3BJ91 1KXTB 2B5IC 2HRLA 3OKDB 1H3TA 4JG1H 4LNRA 2X4PA 2UZIH 1A6TB 5ITBL 1QLEH 2ESVA 2GUOB 1LO0L 1N6QH 4P0DA 5IEHB 5EFIA 1T4KB 1FFPA 1NDMB 5D8JH 3AAZA 3MODL 4LVEA 3WFCH 5DR5H 2ADJB 1UKSA 3QDAA 4X7TB 3G6AB 1BX2B 4Q2ZA 4UV4H 1R24A 1J5OL 1S78C 3EYSL 1LP9B 3BHBA 3QDJD 3IJYA 3DROA 4OF7A 3BH9A 5I1DA 4I18C 1QG3A 1UB5B 1BBJB 1HHJB 5T1LA 4DKFH 4JHWL 3AU1A 4R8WH 4KKAD 4Y4KA 4G6ML 4MJ6A 5B8CC 4NZUL 4NP4H 1JRHL 3BZEB 5DYOA 4Y8AA 4OKDA 3HE6A 4M7ZB 2LE9A 4R3SB 4L4VD 4PD4J 3T65B 1S7WB 5GRUL 5D72H 2O5YL 1FO0A 1YQVH 3P4OA 1D9KC 1HYRC 2XZCL 1U8LA 5ISZE 2F8VA 4M43L 3MFFA 2BC4A 1DQLL 1IGCL 2QADD 3PABB 1JV5A 1WQVT 1WBXA 5DJXB 5D6CB 3IDNA 3BQUB 2VDOL 1NEUA 4QHMA 4HFUH 3PV6A 2VDNL 1MFAL 3DX6B 1N0XH 5J12C 5DMIL 1YEHL 4KUCD 4U1SA 2NY6D 5KSBA 2WP3O 3KPQA 4XCNA 3WN5B 5L7XL 4MAYB 3C6LC 3H9HB 4LDEB 1FP5A 4QRUA 1S7TA 1OF2A 4K7PH 4XP6H 4AIXA 1A0QH 3NCBB 4NKDA 3TA3C 3SOBH 2JKXA 4KK5C 1UH3A 4JGMA 4HF5L 1QEWB 1HEZB 2XQYK 1NCBL 4MVBC 1GPOL 3ARBD 1RURH 3LDBC 3IJHB 3QUMA 5CZKA 3BXNA 4HK3J 5JNYB 1XZ0A 4EUPG 4RNRA 1I7ZA 5I19L 3PWNA 3MXVH 5BVJA 1DP0A 1PSKL 5DK2A 1W0VB 3C5JA 3SE8H 1PKQA 1U2CA 2NXYD 2BNRA 5A1AA 4TPRL 3MUGA 3B9EA 4MA1B 3CFJB 3LRSB 4WWID 1F3JB 3DYMA 5IMKB 1D5IL 1HILA 3K2MC 3MUY1 4N8PA 5L0QB 2FEEL 4FQQA 3RZWA 3DVNA 1X6LA 1ZSDB 4JQXA 3ARXA 4LCIH 1K5NB 3QNYA 3G08A 1IEBB 4KJPC 4IOSD 2VISA 2VDRH 1J05A 1R3JB 1DQJA 4OZGE 2QR0B 5T1KB 2W0PA 3LKQB 2PNDA 4U2YA 5FUZH 3VFPB 3VFUB 1MHPH 1RIUH 2GAZA 3HLAA 1OQOA 4ORZC 1PG7W 2YA2A 2YD4A 3MRQA 4Y1AB 2YPVL 4PRNA 3QYCA 5ESQA 4S11A 5I0ZA 3QG6B 1NMAH 2DMCA 3D25A 4OD3H 1BEYL 4PJDB 5JZ7C 3VXOA 3QXVA 4HIEB 4RWYH 4MA3B 1A7QH 1JN6A 1RUMH 3AM8A 4K8RD 3VI4F 1CK0L 4YDLC 4U7SA 4YHOL 3GMNB 5FA4B 3BPLC 3QT2A 3GEWB 3B9KB 3U6RA 3IDXL 4KK6C 1KGCE 4PJGE 2XQBL 4HCRA 4JPVH 3QULA 1C16B 4I5BB 4XWGL 2C3GA 3DRTB 5GZOC 2DQJL 3HPJB 1YEJH 4OZFH 4QOKE 4ZSOB 1BP3B 5GGVL 2NLJB 4Y5VB 4K2UL 4JQVC 3PL6D 1TCRB 3G5YA 4WO4B 4HZAA 3GO1L 5EIQA 5BRZE 4GJTB 5C3LD 4NOFA 4X4YA 3C2SA 4KJQC 4M62L 2OTPA 5F1NA 4Z7NF 1CBVH 3QIUC 4L8CB 2EKSA 2DQFA 3CC5A 1EMTH 3T3MF 5IFAL 4ZPVB 5D7LE 4HWEL 1K3ZA 4XT1C 2IPUG 2L7UA 5T3XH 4N9GA 4LSRL 3MV8E 4HS6A 4AEEA 1L9MA 2F9BT 4MS8D 5H2BB 3VGDA 4FG6D 4FMFA 3JTSB 1R5IA 4NN5C 1E6JH 4S1DC 2W9EL 1W0WB 4HUVA 5CEZE 1O7SA 3DBXB 3TZVC 2X4TA 1JTOA 2OMNA 4TTDC 4PB0L 3TBWB 5IB4B 3WFHB 1XIWC 3FFCD 2JCCA 3T77A 4G5ZL 4I1NB 2XA8H 4YFDB 4R0LC 2H6PA 2ZP0T 1MEXL 3I2CL 1Z3GH 3ES6A 4PJFB 2FX9H 5GQBA 1BQHA 4ZOCA 3IFNL 4P59L 5DUBB 3F12B 2EDXA 4K3EL 4X4XA 1VESA 2NY4D 4BJLA 4EN3B 4JFYA 3NFPB 3NN8A 4AH2A 4MNQD 1AO7A 5ABDE 1N2RB 2BVEA 5HHNA 2VLRD 4HUXA 4GRMB 3WDJA 4AEIL 1VGKB 1JNLL 2XACC 5L6YL 1T66C 4PRHE 3D69A 4HGMA 1L6XA 2WBJA 1C08B 4Y5YC 4QNPE 1MCCA 4NJAH 5EBWB 5F1SA 4ZXBA 3RUGB 4MD5B 1WIUA 4L29A 1I8LA 5EN2B 2EDDA 2ED7A 5EU3A 3HA0A 3U4EA 1CFSB 1MCWM 4UNUA 2YK1L 5EUKA 1LEKA 2VXQL 4GW5A 4XNQA 3KR3H 5D5ME 1MHCB 5LWYH 2VKXA 4PB9H 3MRJB 2W92A 3WO4C 5E6IA 3FQXB 1WFOA 4GXUN 3MX0A 4MMXC 3D9AL 1Q9LB 1OL0A 1FVCB 3DO7A 1A14H 4PY7A 2E7BA 4NNYA 1QNZH 3DXAE 1WAAF 5JW4M 3W5MA 2A73A 3RWDB 4XHJC 4AMKL 4GO6B 4KK8C 3BJLA 3BPNC 4HG4J 4ZS7L 1WITA 1KJ2A 4V2CB 4Z78A 1H3XA 5GZND 4WW2A 5MP6L 4G80A 4POZC 1A7BA 1FC2D 5CEYB 2VDLL 1OAZH 4XI5C 2DQUH 5IVXB 5CGYC 1VERA 1DBAL 5HYQB 1AQKL 3HNSH 4GW1A 4G7VL 3ARTA 3STZA 3FO0H 5C0JB 1U91B 1A6AB 3NAAL 3SPVA 2KZ1B 1NBZB 3RVXD 2ZSVA 4O4YL 4XAKD 1RZJC 1NGZB 4YXHH 4Q7DA 5JPNB 1EH9A 5GGRB 1OP5K 1ZHNB 2ZUSA 4AEHL 2R1XA 3DGGB 1IAKA 3GJEB 3R4DA 5C0GA 3UTSE 3E8UL 2APBA 3KLSA 5SWZB 3MRPA 2ED9A 3AFLA 3N1MC 4HKBB 5FB8B 5BXFA 3U0TA 1ACZA 3P4NB 5AZEH 5IW1A 2YXFA 4C59B 3ALWA 32C2A 4C56E 5CD5D 4D0DA 4O2EB 2FX8H 4X6BA 1YEEL 1FFOB 4TVPD 3D0LA 1RZGA 3TJHC 4NCC1 1MCIA 5D6DC 1XR8A 4JFDB 1NKRA 4S1SH 1Z0MA 4FP8L 4GMTL 4L4TE 1WSST 1X5AA 2H3NB 3GMQA 5ANMB 2X70B 2X09A 5DVOA 3SDYH 4IDJL 3BPCB 4OLWH 15C8H 4YHIB 5MEOB 3CX5J 1L7TH 1OLLA 2LTQC 4GAYA 2CO7B 2AXFA 4RWHA 3T1FA 1FIGL 4HDIA 1HHKA 4I0PB 5C0FB 5E9DA 4JKPH 2WP3T 1IC5L 4GAGL 4GKNA 2PR4H 1UC6A 1A22B 4RAVB 5DC4B 2EYRB 3W2DH 1UZ8A 4V1DB 5IQ7L 3TIEA 1H0DB 4GRWH 4CN4A 5EO9B 1EHLL 3G6DH 3T0ED 1LILA 2X6MA 5CZXC 5F93C 4U6VL 4EBQH 2W60B 1Z5LA 4JJ5A 3QI9D 4DVBA 1BJ1J 3STLA 4UT7H 4RZCB 1DANU 3DUHA 2EH7L 1UWGL 5JR1H 1PDKA 1S7RA 3T2QA 1V7MH 5B38B 3MOAL 1DVFB 3WIIH 4Z7WB 2Q1EA 3UJJL 4GKSB 1C7TA 3CGTA 3PWJB 3GSUA 2HFEA 3V0VB 5IM7A 3UTPD 3SCMD 2NY7H 2PTUA 4AK1A 1J86A 4ORGA 4ODUB 3E6HB 5T5NF 4RSVA 3CXDL 4Q74A 5I8EA 3MLYL 3O6FB 4IS6A 1P4IH 1BZ9B 4RFNB 4ETQA 4BFBD 4DAGL 4S1RH 2QSCL 1KCSL 4XCEB 3IDGA 1OY3B 3LQZB 3KPSD 4UDTA 3L3JA 3X13A 4OD1H 3WFDH 4K3JL 4R2GC 5F9OL 4EVNB 1XH3B 2XFXB 1T7ZA 4OCXH 1TJHH 1ZS8A 2YN3A 4K3DL 1YA5A 1EFXD 1KT2A 3OKNB 4NNPL 4RMVA 1K4DA 4P46D 5CJQL 4PGDB 3N1FC 2B4CL 3MREB 4U3HA 2P4AB 2E8YA 2IAMC 1EGJA 4M5ZH 3FQRB 4H25A 1PQZB 3UJTH 3MRBA 2YD8A 1D6VL 1R5VA 4QYOA 3VRLF 1A6ZB 5FYLD 3MR9B 5IK3A 1A1NB 1X7QA 1F8TH 5MI0C 3CCHB 4QXUL 1MJUL 3WXWH 2XICA 3UZVB 4G8GA 1I7RA 4R7DB 3EOTH 3MRIB 4DQOL 3JWNC 4I18B 3ARDC 1E4XI 5F70A 1CGXA 1IE5A 3V8CA 1D6EA 3K7UA 3OKOA 3B5GA 1V8HA 3BKYH 3KLDA 4I9WE 4BH8B 5FOBB 4DK3A 5ACZB 1QRKA 3QIWC 5TPWH 2ZG2A 3HUJE 1CLOL 1FNGB 3ESUF 2LQRA 2KQNA 5ESVB 1AD9B 3EGSB 1AXTL 2I5YL 3V4PH 1EAJA 2NCMA 1CLCA 2ESVE 3NZHL 4Y89A 5C86A 5IOPB 1AY1L 3QXTA 3QUYB 4PRIB 1E4WH 3EKCA 4GG8B 4X0KB 5DMGD 2V5TA 5EZLB 3VFWA 1AGFA 3ARFC 3BSZL 2IANA 3ZL4H 1I1RA 1SYVB 1XF3B 5C70A 8CGTA 1G7PB 4OGXL 4RAHA 4OCRH 3ZSTA 1P7QB 4TOYH 1LO3H 1U3HC 4KROD 1VFMA 4DKAA 3VXPB 2DQIL 5J12B 4GQPH 4H8WL 4X7CC 3L3KB 1MCDA 1UADC 2NY2B 2HJKA 2OR9H 3DO3A 2DTMH 4KV5E 4Z76A 4FQJL 4WENB 3BN3B 4G8FA 4FQ2H 5B39G 2F5AL 2P8MA 3C6LB 3KLAA 3MBEC 4FOMA 2BSSB 1JMZA 3MJ7A 1X5KA 1LD9B 2NY1B 4QRRB 5CJOH 4LU5H 5E7BA 1MREH 4M7JL 1TENA 3H9SB 2AJZA 5BW7C 1LMKA 1UA6H 4Y16C 4JN2A 3BMVA 2BHUA 1IC1A 2CJUL 5F7YC 5EOCJ 3I50H 3TT1L 5J1SC 1B6UA 2R4SL 4GRWB 1LE9A 2EDBA 3LDBB 2GK0B 2PO6D 2ZZUT 5FYJU 1DSFL 2K7PA 4YQXL 2OJEB 2EYTA 2F15A 3SGEH 1ZVSA 5EIIA 3SDCD 4APQD 3EO9H 4XPBH 1N0LA 4XVUD 5KSBE 1I3GL 3EJZC 3TYFA 4YAQB 2V9QA 5L2JA 3HPLB 4QLRA 3B9AA 3ARPA 4I77H 3OJVC 1RU9H 3GMRB 4S2SB 4LLQB 1T2JA 5GGTL 2QTEA 5I1JL 1ZEAL 4QXTB 1F00I 2HFTA 4D3CH 5FAAA 3U0PA 3IU3A 2FWOB 4KKCD 1RZ7L 3CFBB 3MRRB 3SBWC 2NY5L 1N7MH 5IHZA 3X14A 2CUIA 3MA9L 3OAYK 4DTGH 3BZDA 4OCYL 5GRWA 1PJ9A 4LKCA 3WHXA 4DUVA 2AJXL 2AK1H 3CZJA 3X11B 1OOAA 3NA9L 3I75A 2D03L 3WFBH 3IT8D 2I9TA 4GMSL 1MHEA 1FE8L 3G5XB 3BWAA 1PKQE 3BMWA 4F58L 2BNRE 1UZ6E 4OV5B 3P73B 3DMMD 4R7NA 4BK4A 5J4MA 5JW5A 1F90H 4P4KB 1QQDB 4KTDL 3BPLB 3L95A 1FG2B 3LB6D 3ZE1E 3FOLA 4J4PD 4JRYA 2X89D 3BIAX 3O3AA 1KCUH 4LL9A 3VH8G 4XNYH 2NR6D 4J3SA 3VCLB 1OTTD 1X5IA 1G7MB 4JREC 3ME0A 4OFIA 1MH5A 4OF3A 4Z77B 2EXYD 3BKCH 4KMQA 3RGVA 5F9JB 4K71C 4OBSA 4GG6F 1NFDB 2Q7YB 4ZO9A 3KYOA 4C83A 4D9RE 4HKZA 2ZOLA 4M9OA 4K7FB 5EIVA 3WIFA 3GK8L 3I02B 1EK3A 5F96H 1N26A 5GRXG 3PNWA 4IRSB 5ICZA 1FFQA 4Z95L 1OP3K 3BQUD 3N85H 4WV1A 2CKBH 1HI6A 1X9QA 1T7XA 1X5FA 2FD6H 1HQ4B 3QEHB 5TDOB 4AIZB 1ZA3B 3KPOB 4JFZH 3ZO0A 3CD4A 4QEGA 1T1ZA 4NUGH 2YD5A 1G9ML 1G0DA 3C5SA 4NN5B 3MO1B 5D7IA 1TPXC 3V5KA 3MXWH 4N1EA 1MJJB 1WWBX 4U1IA 4MAYD 5F88A 3TZVB 4LCWA 1GL4B 3BDYL 4HK0B 3RNQB 3ABZA 3NTCL 4M1DH 2PN5A 5KG9A 5EOQH 4WJ5A 4K9EC 4OIIL 4L8SC 5DJDA 2VJXA 4NBXB 1KB5L 2DLGA 4WFED 5DJCA 5FK9A 3HC0A 2B7DT 3EYFB 4L8DB 4D9LL 5E2UH 5FFLA 3H0TB 1EHXA 3HMXH 1U95A 4FXGA 2YMXH 3QPQD 4YHNB 2NMSA 5E2JA 3KLHC 3B2UC 2WBKA 3F7RA 5DUMH 5KVFH 3RPIB 4R26L 4P2RB 4PG2C 3QUKB 3H6JA 3T8XB 5I1HL 1G9NL 3VFMA 5DTFB 1GGUA 4OUUB 2MMXA 1IGJB 4AT6A 1T1YA 1SJHA 3PG2A 3AXLB 4B7LA 2BVPA 1R3LA 2JCCE 3MV7A 3BEWB 4NZRL 4YLQT 2H26B 4ODHH 1TZHB 4Q6YA 4WY7H 3W9EB 2F54A 3O2VH 4HXAH 1LK3H 1DQQA 4K8RL 1WK0A 5KSUB 4LMQI 2GJ6A 2VL5B 1DBKL 4MD0A 2DQTH 2ZUXA 1FZMB 1B4JL 3HN3A 3Q6GL 4PYHA 1YYMH 3WO4B 3IYLW 1UJ3A 3HE7A 3HI1B 2ZCHH 1FNHA 2AVGA 3CDFA 3M17B 4O02L 5I18L 3NCYS 1UM5H 4Y1AD 1AO7E 1MIML 1BJMA 1FGNH 4DW2H 4PGJA 3TPKA 4IHOB 1DQTA 1CT8A 2AQ3A 3DURB 5HY9A 2IPKB 1VPOL 1WZ1L 1JGEA 1T2XA 3BPNB 5EPMB 3AS2A 1DEEB 1V3KA 4LSQH 1TMCB 5BO1H 3B9KD 4P23A 3OXRB 3TIDA 5CEXA 3CLFH 3C5ZD 5JO5B 3VXNA 2A0LD 2R8SL 2I07A 4NZTL 1NGPL 3UCRA 3BD3A 3GHBH 2GITA 3NFSH 4KTEL 3LEVL 3P9MA 1TJGL 3U9UA 2V9RA 2JJVA 4LEXH 3WXVH 5FGBC 3T2NH 1JTTA 3BZ4A 4GBXA 2X4OB 3WNOA 1A7RH 2LAAA 1K85A 3SDXA 5FYJE 5KN5A 1M71B 4JO2L 1HHHA 4Z7UA 1SMAA 12E8L 2YC1B 2H1PL 1YPZA 2EE3A 5HHOA 1B2WL 1DQML 3VXSA 3JTTB 4HIIA 2P46B 5EZJA 5C08B 2D31B 1J8HB 4LGPB 1NC2B 1HZHH 3O3BA 4TULH 1TVHB 2FATH 2AJUH 3G9AB 4LCYB 3GBML 3T09A 3JV5A 4OGZA 4QTIL 2VRAA 4FZEL 2HVJA 4YJZL 4ZOEA 5CCKL 3FN3A 1DUZB 1MUJA 5TQ2H 5KOVC 3INUH 4NN7C 2X7LB 3WMSA 4UDUA 3KPPB 4TUJA 1LEGA 3C2AH 5T5FL 5DK0A 2W9DL 2IGFH 4JRWA 4OM1L 2BOCA 2AAVA 1YECL 4M6ML 2P44B 5IEKA 2LTQB 2CKBB 3TBVB 4XMPH 1BAFL 4EN3D 4OGYH 2ADFL 4F80A 4TNVK 4P2OA 3LS5H 4WHYG 4KKLD 3BKJH 4JKKA 5GRYA 3WCYA 1JPST 1BECA 2ZCLL 1AXSA 3BZFB 5GGQL 5LAXA 5EBMB 2IH3B 3REWA 3Q3GB 3PWVB 3TT3L 3WLBA 4TSAL 3TJEH 4NQUA 1NAML 1F02I 4NQVA 5IF0A 3I9GL 2PYFB 3QO1B 1AI1H 3UP1A 3MBXH 5HI4C 1T80A 3TWCL 2X4RB 4WIQA 4OQTH 5J56B 5ISZB 3V5DB 3MCKA 3EZJB 1J1XH 5DRNB 4TUOB 5IG7B 1RHHB 2EXWC 4UIKH 1RUPL 1NMBH 3ZDXF 4YE4L 4JN1L 1MRDH 5E9DE 4M9PA 1C12A 1NLBL 5F7DA 2OCFD 3D0VA 4OKVB 5IQ9B 1RK1A 1FZKB 3WNMA 2NTFA 1NUDA 2B1AL 4LEOA 3LV3B 3B9VA 3CFCL 3LN5B 4CW1A 4O2CB 1EHNA 4PJCA 1LO5B 5A43C 3O3EA 1IGYA 2Q20A 1QD0A 5HSFA 5DUPH 4V2BA 2DDQH 1IEAB 1KPRA 1S8DA 5DD5H 3SDAB 2VB5A 1Q94B 4X6EA 5TDPA 2BOBB 3PF2A 4LOUD 5D71H 5I8OL 3QNXB 3X3FH 1G7IB 1ACYL 4R2GB 4XCYA 4R4FH 4OF8A 4OZFG 1LK2B 4XBGA 3ROOB 4U1LB 1YN7A 1NDGA 2C5DC 4RIRB 3CUPA 1WVZA 2G9HA 4TVPL 2GI7A 3TLRA 5JOEA 4PP2B 4JDZB 5KVGH 5JHLL 2VQ1A 2K1MA 1EEYA 3I84A 2RHEA 4BZ2L 1U8IA 5CSGA 5SWZD 2R23B 2ZUYA 4JB9L 5LGKA 1QPXA 5KJRH 4GRLB 1CR9H 2IQ9H 1WEJL 4FXKA 3RTQA 2GTWB 2EC8A 4XXDB 5CLWA 4MWFB 3VRIA 2XNAB 3E6FB 3FO2A 2JB6B 1RV6X 3PHSA 4X6CF 3NCCB 2FZ3A 4PGCA 3D2UB 3L5IA 4OIAA 1AD0A 4YK4C 1RI8A 4LSSH 4OZGB 4WFGE 4P5TA 3H3BC 4N0UA 1IC7H 4GUPB 4DUWA 3N0PB 1YQ2A 4F3FA 5EU4B 2D0HA 1JWUB 4X6DF 3QIWB 4I48B 3VFOB 5ID0B 3EFDL 3QG7H 4XGZA 1YC8A 2JF1A 3KPNA 1H5BA 2ZUQB 2FR4B 4U1KA 5T3XD 3VG0L 3DYPA 4I0PD 2FHCA 3NBNA 3JV4B 1T5XA 5A16A 4K9EH 1EXUA 4WFFE 3WJJA 4UINH 2FB4H 2EH8L 2J8UF 3LIZL 4XVSL 2QSVA 1YNKL 4MJ5B 3RVTD 4G8GE 3HAEH 3BYTA 4QOKB 5HYSG 4IRJA 1ETZB 4NGHL 4F7TA 5D1ZA 1U3HB 3GSQA 3LPFA 4LQFH 3FO1A 1PZ5B 1JZ3A 3N50A 1U58A 3WSQH 5BRZB 5DRWA 2E9IA 3PUCA 2AEQL 2ZJSH 3QB7C 3L3OA 4U0RC 3PWPA 5CJBA 4JO3H 1DN2A 1V3MA 1TZIA 1B9ZA 2PTVA 4PS4L 1A4KB 1ZGLB 3QH3B 2R9HC 4P4RB 5KZCB 3UMTA 1WZKA 5D7LB 4NDMB 1QLRA 3JWOL 4Y16B 4WWKC 3EIFA 3T04D 3K4DA 4JY6B 3VE0A 3MV8B 4ZAKA 1PYWA 3OAUL 5FKAB 5GGVY 4W81A 4XBPB 3TNMA 2IANE 1HSBA 1NCDH 3FQNA 1QFHA 4D9QE 1MCLA 1YZZA 2NQCA 3SN6N 2VWEC 3IDMA 4PRAA 1FDLL 4AL8L 3O6FD 1QSVA 4U1HB 1F97A 4QWWD 4JFXB 5EC1A 1RQ5A 4LBEA 4X7SL 1UQSB 4TNWF 3ULUL 1OP5H 1MQ8A 1GYAA 2HTKC 3R0MA 4OB5H 1E28B 4XZUB 3MJ9L 2O5XL 4I4WA 5FYLL 1U8JA 3QDMA 2Z0BA 3SKJL 2F5BL 2WIMA 2EDQA 1S9WB 5F7LB 1ZOXA 1EHAA 3UC0H 2XWTB 1RIHH 3FQWB 3E1F1 2DI8A 4ELMF 3ULUF 3FO9A 5DMYA 1E6OH 3TV3H 1CE6A 3IB4A 4EOWH 2XI9A 4UQ2B 2HVKA 1GJIA 1UB6A 4MXWH 1MLBA 2OZ4L 3HZVA 4NM8L 4UNTA 2B0SL 3IKKA 3V4UH 2X42A 1M05B 3IFLL 4JPIB 3S3JA 2A9ML 5CP7B 4Q9RH 3LKOA 5TF1L 2IF7A 1TETH 3X12B 1DFBL 3NCEB 1VACA 4A2MA 1MI5A 4FQXA 3JZ7A 2BY2A 4NM4H 2B8OT 1VADA 1IBGL 2HKFL 5C71A 4J1UB 2AJSH 1MCHA 2NNAA 4Z6AT 3ZE2F 3T4YB 3O45B 2RCSH 2VH5H 3SKOB 3FRPG 2AI0H 3DXAB 3AS1A 4HFWA 1H3PL 4FNLH 4Z0XB 5IHUL 3WDIA 3HB3C 4IOIA 2IPTH 4L8BA 1CLZL 4Z5RA 3VWJC 1VGEH 3BX7C 4RGMB 3G9VA 3J7HA 3QUYD 4PRID 5DMKB 4RMRA 4NZUH 1S3KL 4KRPC 5DMJB 4YHZH 4CVUA 1LNUA 2EDHA 1JHTA 4HLZH 3Q1SL 3BEVA 5HGGS 2JIXB 5TE6L 2OX5A 5FYKL 1XGQA 1YY8B 2FYYB 5H94B 1P7QD 4G9DA 3MSPA 5J6HB 2CLRA 2NXZC 3NMEA 3LS4L 3RZCB 1SEBA 1CLYH 5DA4A 5E6IC 1HXMA 3IF1A 4JRYE 3HR6A 1CI5A 1II4E 5GJTL 2R29H 2VITB 2VDPL 3MLVL 1CQYA 1V7NL 2NY2D 1WC7A 3U0WH 3VD9A 1P1ZA 5AD0A 4CL7A 2VDNH 5KSAC 1U8PB 3C6LD 4KGLA 5LBSL 4QRRD 2NY1D 3V6BR 4WFHD 3OF6D 3UTSB 5DMIH 1H15A 1B88A 4H88L 3TVMA 3S4SG 3LKSA 1G1YA 1V05A 1TDQA 1XGTB 3CPLB 5KTEH 1LO4L 1CD1A 4XPFH 4YBQD 3TA3D 1R5WB 5DHVH 43CAB 4KK5D 2X4UA 3W9DA 5EH1A 1UM6H 4C56B 4QRTA 3IETB 1X5GA 5IT2L 4EI5B 4MLSA 5F89B 3WV0A 3S5LG 2ENYA 2CRIA 1K6QH 4M61A 5JLZA 5IB3A 1S7UB 3QEGL 4ZUVB 5D7IE 4P3DA 1HQRB 1IZJA 5ITFA 3S36L 3NFNB 1S9XA 1I1AB 4HIXH 1PSKH 2ZCKL 3MV11 2FEDC 4LCWE 1GZQA 1HWHB 2DIJA 1YMHA 3STBA 5AWNL 1ORSB 4HC1A 4OUOA 5ILTL 1P4LA 1Q0YL 1RUQL 1KBGH 2B2XH 2VSDA 1QRNA 4KJPD 3CFIC 4NWUH 1FO0H 5IHLB 2NTSP 5DZNA 2OSLB 4Y2OA 4XP5L 4Z7QF 5LVEA 4LLUA 2JLLA 4KI5D 3RI5K 4ENED 1JPSL 3RWEA 1X5ZA 3ARZA 3O0RL 1Z9OA 1KIRA 3DIFA 1NSNL 4YO0B 4FA8A 3W0WA 4JR9H 4M1CC 3OJDB 2BY1A 3O41B 1RJLA 3TYGH 5I17B 1LP9F 4JVUA 1I7UA 5ETUB 1SM3H 5LQBL 3R06A 1NGYA 3LSOA 2DLTA 3VRJB 4P4KD 1DL7H 5D1XB 1N64L 3MYJA 3KPMA 3KYMA 3QISA 4G6AD 2G5BB 5AYUL 3QCTH 2F54E 5GZOD 5C07A 1OT2A 2GJ6E 4DGYH 1HKFA 2I24N 3V6FA 5I1IH 2L7JA 3C09B 3F7YA 3CXHK 1CE1L 4NQSB 1YN6A 4EEEA 1D5MB 5JW3L 1Q9WA 3QUMH 5D70L 3VFVB 3DUUB 4DKEH 2BFVL 4KJQD 3IJSB 2BVQA 3QIUD 3K1DA 5ADPH 1MWAA 5HGAA 5E00A 3LEXA 4XNZB 4IRSD 3GSVA 5D7JC 5FHBL 5KAQG 5F6HI 5C0AA 2P8LA 4LQ1A 4RA3A 5C6WH 3GRWH 3GIVB 3QQ3B 2JJWA 4I13B 1IM9B 2HTLD 1PKOA 2P45B 3L9RB 4ZUSB 2ICCA 3MRMB 1ZHLA 4Q6IA 5CMAA 3VXTB 2XZQL 1FL3B 4HUUB 3ZTNL 4FZ8H 3TZVD 5ALBL 1SVCP 5DT1L 4PPTA 4GAJH 3J8F7 2XN9A 1IFHL 1KLGB 5INCA 3QHZH 3HC4L 4YUEL 2FL5A 2W9EH 3FHAA 1TZGH 3SDXE 2VIRB 1KEGH 1A5FL 1GGIH 4ZODA 2OQJB 3UAJD 4Z7UE 3H3PH 2Z8WC 5J57B 1FAIL 4G5ZH 5FM8A 4MZ2A 2BERA 1YPZE 5HHOE 3C60A 2CLZA 3LH2L 3VXSE 1SJEB 2X4QB 1QSFB 2W65B 1KNOA 1F4HA 4P2RD 4NWTL 1AGBB 3O6MH 2APVA 4OLXL 4XNMA 4Z7VA 2R1WB 3DSFH 3OAYH 5GS1A 1JL8A 1U93B 3HUJB 3SDDB 2P49B 2CDFB 1ADQL 2CR3A 4J3XA 1JNLH 5JW4N 3S37L 4N0YH 4JRXA 5KVEH 3HCVA 2X4PB 5GHWL 1G0XA 2VXTH 2ZKHL 4JHAL 5DHVB 3WUWB 2ESVB 1FN4A 1OWWA 4HWBL 1AC0A 3KNBA 5EFIB 1FFPB 3AAZB 3FB8A 1A7OL 1I1FA 1SBSH 4Y4FC 4ZNEA 4Q2ZB 4NKIL 4IRZL 4XC1L 1IKNA 2F58H 3L5WA 5CWSA 3IVKA 3BHBB 3BOVA 3IJYB 1L7IL 2CRZA 5E0QA 3BH9B 5I1DB 4HSQA 4ELKA 2BJMH 1AIFA 4YPGA 4PJDF 2OTUA 1XGPA 3KYNA 4JFPA 4JG1L 1L9NA 5SX5K 5DVKA 5T1LB 3KVQA 4HPYH 4NN6B 3ZE0F 2UZIL 1ZK9A 3D9AH 4KTYA 1QLEL 1N6QL 4HKJA 4Y4KB 4PD4K 4MJ6B 5D8JL 3KXFA 3WFCL 4LSTH 5DR5L 3BIBX 2ADIA 4YFLI 3ESVF 4UV4L 3HE6B 5CGYD 4KJWD 3QNZA 1FO0B 3HG1A 3P4OB 4Z0BH 1MCOL 1ZA6A 5I6XB 1O7VA 1OP3H 3BP6A 5DRXA 3MFFB 2BC4B 4EZMA 3FN0L 1OD7A 4DKFL 2NW3B 5CJ5A 1JV5B 1WBXB 5D2NC 4R8WL 3VFNA 3B8SA 3IDNB 4NP4L 4QHMB 4Z9KB 1FSKB 1QLFB 3PV6B 1NCAH 2YSSA 3O8XA 3MNZA 3NAAH 3IDYC 4L9LC 4LLDA 4N0FA 1IT9H 4PJ5A 5D72L 4UB0H 5FF6A 1YQVL 2IQAA 5KSBB 4PJCE 4XCNB 3KPQB 4JKMA 5C08D 4QRUB 5FUOH 1J8HD 1OF2B 3UZEA 2X2YA 1KUMA 4TVSa 4U1NA 1C5BH 4ALAH 1ZT7A 5CIPH 3A6CH 4HAFA 3GZKA 4FQHA 4HFUL 4RX4D 3H9YA 4F8QA 1N0XL 5C0BA 4LCCC 4PRPB 4YK4B 3VJ6B 2PYED 4OLUH 3QUMB 4GS7B 3BXNB 4X5XA 1XZ0B 4XXCC 4RNRB 5E4EC 1I7ZB 3PWNB 5LGHH 4F15B 3GSRA 4PJFF 5BVJB 2EIZA 4K7PL 1G6VK 4XP6L 1A0QL 1OM3H 2Y5TA 4WVRA 3VXMA 1BWMA 1PKQB 2BNRB 1FPTH 1EERB 1KG0A 5CAYB 3MUGB 3TESA 3SOBL 1MLCA 1YC7A 3FHQA 3EHBC 4S0TD 3SE9H 5HHVH 1KJ2H 4FQQB 3DVNB 1ZKAA 1RURL 1HH6A 1TLKA 2A6IB 5I9QB 2CKNA 1KIPB 3FOMA 3QNYB 5AG9A 4ZFZA 3G08B 4M6OH 4MNGA 3RUGF 4FQ1H 4K3HA 2VISB 3GSXB 1J05B 3W39B 1G9MC 4G43A 3ARBC 5CZXD 1DQJB 3ZTJH 4ZUTA 3SE8L 4N0UE 3HLAB 1TQBC 4OT1H 3BP5A 5KANG 1QFUH 1YJDL 4HT1H 4M7LT 3QWQB 3SE4A 1RUAL 3MRQB 1EHLH 5CLTA 5ESQB 3EOBA 5E8NA 5TQ0H 4LSUH 2V2TA 4PBWD 3D1MC 3D25B 3VXOB 4LCIL 2DBLH 2VDQH 1JN6B 2UV3A 1CQKA 2VAAA 4OLEA 2CIKA 1QKZH 1JGDA 2EH7H 4OCWH 1CGTA 5FUZL 2X1WL 2O26U 1JGUH 3QULB 5SX4I 3DHJA 5BZDA 3VGAC 3P4MA 4QRSA 35C8H 3FFDB 2HWZH 6FABH 3U82B 1OAXH 1NMAL 4OD3L 2GQHA 3I85A 5IVXF 2QKIA 1T7VA 2A77H 4OCSH 3G5YB 4RWYL 1A7QL 3SDAD 1U8HA 5D96B 1RUML 3LMJH 4XNXH 3GSNA 5EOCL 5DVNA 3PWPE 1NCTA 1N8ZA 5IP4A 5F1NB 4R2GD 1S9VA 4OD2A 5TGBA 2EKSB 2DQFB 3QFJA 3CC5B 2WWMC 4JPVL 1NBQA 1L4IA 1WCBA 1XCQA 2NW2A 3T4AB 2ZNWA 1YEJL 1D5XA 4PGBB 4JM2C 3VD5A 1PBYA 4N9GB 2WQ8A 2WK2A 4DGVH 4KRNA 1BLNA 4G6FB 1CDIA 2KUTA 1CVSC 5E2WH 2P8PB 1R5IB 1FNFA 3G5VA 1CBVL 1U9KA 4HUVB 1ORQB 4GRLD 4Z18A 3OB0K 1YEDA 2X4TB 4PJIB 1A6VH 1T04A 1EMTL 4E42B 4PY8J 1FZJA 2VMFA 1CXFA 1JHLH 2JCCB 3T77B 5T3XL 5I76B 1CFVH 2H6PB 3U30B 4H0GA 3PQYD 1BD2B 3D2UD 3UDWA 3ES6B 3QDME 1DJSA 4GT7A 1A9BA 1E6JL 4YBLB 4X4XB 2CK0H 1EZVY 2HLFD 4JFYB 1S9YA 1AO7B 1KCRL 3QIWD 5HHNB 5D93C 1FBIH 2X5PA 2YPKA 4HUXB 5I1GH 5JOFB 3QP3A 5E5MA 2DQGH 5ECJE 3TBSA 5C0RH 4P9MH 1P84J 1DDHA 1WISA 3ULSA 3ZLQC 3MLXH 3V9FA 2XA8L 4G8EA 3D69B 4Q9QH 4ZXBB 1Z3GL 2DIAA 4L29B 4XB7A 2FX9L 1KLFA 2Y6SC 5EU3B 4LVNB 2ZOKA 5DJ8B 1KGCD 4M4RA 1SEQH 5DHYB 1JF1A 3ARQA 5IROA 5EUKB 1LEKB 1A6PA 4CVXA 4XNQB 4EUPA 4QOKD 3WNNA 4KKNA 1NQBA 2YUZA 3DX8A 5HYFA 3R8QA 1U3HD 2NXZB 1MI5E 2NX5B 3ZHKA 5E6IB 2FECI 1MFNA 2H8PA 2NY4C 2W0KA 2ITCA 3NPZB 3HE7C 1Z0NA 2NYYC 3DO7B 4J23A 5BRZD 4PY7B 4NJAL 4HG4K 2LV4A 5FHAH 3UTOA 3QEUA 4NNYB 1ZV5A 3ROLA 5GRZA 2A6JB 1F6LL 3BW9A 4P3WA 2X41A 5C92A 4RDQG 3MBED 4P5MA 4Z7WF 5KZCD 1EGJH 4PJBA 4EXPX 2E9JA 5D7LD 3KR3L 5ERWB 3VU2A 4Y16D 1KJ2B 2PCPB 1KTKE 1T6WA 4UUJA 5LWYL 2AK4B 4Z78B 4PB9L 3D39D 3MV8D 4WW2B 4G80B 4RMTA 2DD8H 4P23C 1K8DA 4TUKH 1UKTA 1A14L 4L1HA 1FVEA 3B9DA 5KS9B 1EVTC 2FRGP 1CL7H 1QNZL 3RJQB 4BH7A 5EU6B 4GW1B 1I85A 1FFRA 3QAZC 3STZB 3ARYA 4U6HA 3SPVB 3F6IA 5E03A 4MA7H 4N90D 2ZSVB 5IMMA 4Z8FH 4HBCH 1F2QA 4NQEA 3EJZD 2X1QA 4NQXA 1OAZL 2DQUL 2R1XB 5C8JA 1IAKB 5C0GB 2R4RL 4PV8A 1S7QA 4HIHA 3MRPB 1J12A 4PUBH 3HNSL 3U4BH 5BXFB 3U0TB 1MFEH 2LAGB 3FO0L 3Q5YA 2ZG1A 5IW1B 3BPOC 1ND0A 1P53A 4NFDA 32C2B 4G8IA 4D0DB 4ONHA 4X6BB 4YXHL 3DLQR 3D0LB 1RZGB 3VI3F 2W0FA 4QXGH 1XR8B 1FC1A 5SWQA 3MA9H 3BGFC 4RGNE 2J8OA 3CX5K 1HYSD 3GMMA 1MY7A 3ARGA 4WU5B 5E94A 2ICWA 1MCQA 3NGBC 5AZEL 2OM5A 4I3SH 4LP5A 2AKRA 2KZWA 3MJGX 3VMOA 3D85A 4E0RA 2FX8L 4GAYB 1IAIH 1DBJH 1PG7X 3LHPH 1FL5A 3T1FB 1QRNE 2Z31A 5F1IA 4HDIB 1HHKB 2VLRA 5E9DB 2Q8BH 3R8BB 4WGVB 3UTQA 4S1SL 4X9IA 3CSGA 3DXAD 2WUCH 4M6AA 3EO1A 2AXGA 1C5CH 1UZ8B 5A40E 3SDYL 5FUCE 5C0DA 1VFBA 3TIEB 4OLWL 15C8L 4J6RH 1F4YL 5L88H 3RPKA 3W0WE 1M7IA 4MNHA 1EIBA 4W4OC 1F13A 1Z5LB 2JIXD 4JJ5B 5JXEC 1U3ZA 4XVTH 4JKPL 4CUCA 3STLB 2PR4L 1H3UA 3WNPA 1HINH 3W2DL 4PLNC 3HAEG 1OAQH 1MPAH 2CIIB 3QWOA 4X5LA 4Z95H 2ZUWA 3G6DL 1RJYA 3RIAK 3MZTA 3NCMA 5C07E 5IKCA 3GSUB 1KJMA 4H0IA 4OZIA 4WW1A 5IM7B 4EBQL 2ICES 2RQ8A 3PXJA 1G9MH 3MLTA 1WF5A 1J0YA 4NJ9H 4PJ8A 1G9EA 4UT7L 4JDTL 3VDAA 4LVHB 3IGAA 5JR1L 3MLSH 1NANI 1V7ML 4GRWF 4ETQB 2CQVA 3QQ9C 1LVEA 3IDGB 4U4BA 4UDTB 4EI5D 5I15H 1T03H 3L3JB 3X13B 5L2KA 3QUXA 4XCFH 1MRFH 3KLHD 4QRPD 3B2UD 1SVZA 1ZS8B 2NY7L 5K59F 4MDIA 1SYSB 1KT2B 3FL7A 1TIUA 5AUMA 1HH9A 1K4DB 2V5RA 4JDVA 1NH6A 1P4IL 3SCMC 1I1AD 4LLVA 4MQSB 1NCWH 4S1RL 4KRMB 4H25B 4KAQH 5CD3A 2Q86A 2XN9E 1C8PA 5IESH 4OD1L 4M1GH 3WE6A 1R5VB 1GIGH 3BUYA 3FRUA 3OMZA 4HV8A 3ZKSD 5HVFB 1IGTA 1TJHL 4BZYA 2R0KH 5CJXA 5IK3B 2RAMA 1KC5H 3S35X 3V4VH 2FJGA 3OKMA 3T3PE 1VFAA 4KI5F 1WLHA 4LF3A 4AQOA 4G8GB 1AE6H 1I7RB 3OBAA 4X6CA 1T5WA 1AHWA 1YUHA 2YBRA 2YS4A 1B4JH 3UJTL 1D6EB 3OKOB 5FCSH 4P46C 2XA3A 1T21A 3GKWH 1LQSR 5B3JF 3MC0A 4Z7VE 4M7LL 5E08H 3MJ8B 2BVOA 9CGTA 2RBLA 3ULUC 4LIQH 5ACLA 5D1XD 5DFTA 4JRXE 1WZ1H 3CSBA 3WXWL 5LCVH 2EE6A 1VKXA 1J10A 3EOTL 1D3CA 5KW9H 3VRLE 1ZGLM 1KLUA 3LKRA 3VFWB 1AGFB 4R4BA 4ZNEE 2IANB 2ILLA 1CDGA 1NFDF 3BKYL 5DJ6A 5MENE 1YYLL 5TPWL 5BVPH 3T0EA 4GFTB 3MNVA 1ES0A 4PV9A 3MRCB 4LVOB 3VA6A 3RWFB 1N5AA 4BUGA 3V4PL 1G6RA 1AP2A 3QI9A 5IV2A 3DI2B 2XKNB 1E4WL 2HJKB 3KXFE 4HLZG 4WRLA 4Z76B 4G8FB 1WWCA 3HI5H 1B3JA 2P8MB 3ZL4L 3KLAB 3MJ7B 4JY4A 1IM9D 4MHHG 5J06A 3F5WA 2QSTA 2VR5A 4OCRL 2AJZB 3O6KH 3G04B 3HG1E 4JN2B 4LKXA 4YR6A 3UYRH 1A3QA 3L3GA 1T89C 1I9EA 1EJ6A 4CMHB 1Q8MA 1LE9B 3NCJH 5KAQF 4DGIH 3MA7B 5D2LA 1TQCB 2DTML 4RBPK 1FCCA 1IGMH 4U1JA 4W70A 3S3PA 4FQ2L 3IXTA 5JPMA 4JY5L 4JFHE 2KH2B 2EYTB 5CJOL 1ZVSB 4X7DC 4LU5L 5EIIB 1MREL 3WUWG 3KPSA 4MAUH 3HFMH 1UA6L 4FABH 1QFPA 4FFWC 2D7OA 3TYFB 2A74A 2FJFA 3V6OC 5L2JB 3I50L 3MZGB 1RJZA 4QRQA 1QSFD 1NGXB 2DKUA 4ZPTB 1HHIA 1EFXA 3RL1A 3WS6C 4OF0A 4P9HL 3S96B 4I9WD 1QFWI 2ADFH 1P2CA 3U0PB 3IU3B 3SDDD 5C0BE 5DQDH 1WWWX 3TNNA 4QCIB 3EO9L 5IHZB 4XPBL 1M6OA 3X14B 2PO6C 4ERSH 3WHXB 5HI4D 2ESVD 2F19H 1JYVA 3MJ9A 4AIOA 3AGVA