1RSFA

Nmr structure of monomeric car d1 domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
126
structure length
126
Chain Sequence
GSSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the coxsackievirus and adenovirus receptor domain 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Coxsackievirus and adenovirus receptor
total genus 20
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rsfA00
2WUCL 4LRIA 1LP9B 4PGEB 4H8WH 5IUSA 2VKXA 3OKOA 3DURB 3QUMA 3MLUL 1UADC 3QXUA 3QA3A 1MHPH 2X5PA 4JFFA 3BH9A 3I85A 5F7YC 4UU9B 1BZ9B 2PO6B 2VABB 1WF5A 3IDJA 3EZ8A 1SVZA 2P4AB 2F5AL 4W70A 4JVUA 5HHMD 1W0YT 5GS1B 2W65B 3RU8L 4OZFH 4PJ8D 4OV5B 3V6OA 1OAYH 4QRSB 1T1WA 3JTSA 4KMLB 1EUTA 4LLQA 4P3CL 2NY3D 3DMMC 3LMJL 4JG1H 5LAXB 1CQKA 1XGRA 3BP5A 1H3PH 4P2RA 5FYLH 2QQNL 3MXWL 4EN3B 5MP6L 4X6BB 3BZEB 4DUVA 3Q5YA 5EOQH 3ARGC 3O6FD 3MRCA 1OTTD 3F58H 5EOTB 4JM2B 4JKPL 1K5NA 4WEUD 3OSKA 2NTFB 1I4FA 2O5ZL 3I9GH 4QXTA 2Z35B 1CIDA 1DFBH 3VXUA 2A77H 1OY3B 4PJDA 4MQXD 3QWRA 5EU4A 5C0FB 1ZGLM 4K55A 3C5JA 5C0JA 4NO3B 4YE4H 1C5DA 5IFJB 3O2WH 3ULUL 5E5UB 3ULUC 4KHXL 4MAUL 5C0AB 5TQ2H 4S0SD 3HI6L 3G6JB 5SWQB 5AD0B 2R4SH 1F5WA 1G1YA 5GS3A 2EZ0C 1ONQB 4L3EE 5JW5A 2F5AH 4APQB 3VFNA 1T0NA 5M95B 5J1SC 5I9QB 5AZEL 4YBHA 4D2NA 4ZFGH 5HYJA 1A7RL 3ULUF 4PY7A 4L4TB 2IBBA 2DD8L 1KCVL 1D5IL 1WZ1H 2FECI 4Y4KA 1J18A 5MP6H 2GSGA 1C5CH 2EIZA 2A73B 2FJHB 3DX7B 2R9HD 3W0WD 2FSEA 4L3EB 4HKZB 5CZVH 1UT9A 5JPMA 4LVOC 4JZOB 4OLZH 5B8CA 3OJVC 3DOSA 4HLZG 3O6FA 2ZPKL 4PR5A 4AT6B 3I3EA 1U91A 2OTWA 4GFTB 5D7KD 1K8IB 5DWUH 2YC1B 1YEKL 2I5YH 3VFVB 5I8CA 4FQQA 1WAAA 3EYFA 4MA3A 2RR3A 3TO2B 5DDHA 2F58L 1S7XB 3AXLA 4HH9B 3U4BL 5ISZA 4DGYL 1ZA6B 2QQLL 4NKDA 2NZ9C 3THML 1FNGA 3LQZA 3OB8A 1GGYA 2GITB 1RUAH 3BYTA 3GSRB 1QA9A 4LCUA 5HY9A 1MJJA 1GH7A 3A67L 3BWAB 2PYFB 2RBLA 5ID1B 3VI4F 4P9MH 2ATKA 3LS4L 2VL4A 1T3FB 5JNYB 4OGAD 5C9JB 3O9WC 3HNTL 4KDWA 3GMOB 3LRGA 4U49A 4DW2H 5D1ZD 3TO4B 3RVWD 2OCFD 4XBEL 3WFDL 1AE6L 2K7QA 4OFYD 4LL9A 2R2HA 3BXNB 5FHBL 2B4CC 2EC9T 5L0QC 4EKXA 1FHGA 3LEXB 4YUEH 2HH0L 2YD2A 4I0PC 2NY1C 2YRPA 4H1LA 5F7KC 2AI0L 5IB5A 3UZVB 1RIVL 3Q5TA 4XGZA 1UZ8B 5J9PB 4X7EC 3U4BH 3LVEA 1LO3H 2YPVH 4P49A 3U48A 1P4BL 2FX8H 2JB6B 1EEZA 2KPNA 1B0GA 4P2YA 5F9OL 4JM2F 4PRNB 5ITBH 2APBA 5I18H 3GBNH 3HPLB 5IB5B 4YBLC 4MAYC 3MYJA 4FNLH 4Z0XB 1T7XA 4K23L 4QHKJ 3DVIA 4JDZA 5JZ7D 5FAAA 4BZ2H 2VDOH 1F3DH 3BKMH 5IVZB 1FVEA 2D7MA 5D7IF 1V7NL 1FNSL 1V05A 2ORBL 4P5TB 3GUTB 5MENA 1JHLH 2OJEA 1MCIA 1P5UA 3GIZH 4JQVC 5AAMA 3V9FA 3DHMA 3QUYC 5EWIL 4L4TA 1A7BA 2AW2A 3OGOE 1BLNA 1IGTA 2VOTA 2XTJB 4QRRB 4RX4A 5I1HL 4XZUB 2VLJA 1GCFA 5HHOE 1FFOA 3HR5A 1ZHBB 5FHBH 4OF5A 2B1AL 1LEIA 1I9IL 3DGGB 1OQXA 2OMBA 5GS0C 5JQHC 2HFGH 1VCAA 3J7HA 5AG9A 1II4E 4WO4B 3VFWB 3BZDA 1BD2E 3RWFA 1RJLB 4KJWD 5LBSL 3GI9L 5FECB 2WIIB 4I2XA 4MNGB 3WDIA 1FFQA 1ED3A 3HC4L 2MCPL 4EJ1C 1T1XB 5DRNB 4AEIL 3SJVB 1R3JA 4APQC 1WC7A 5C09E 5D1QA 1K2DB 3GIVA 4JY5L 4JFPB 2EDBA 3HZMA 5DRXA 1UXSA 2RAMA 2IG2H 1RZFH 5FHAH 5HHNA 3DO7B 3OHXB 5DD3L 5I16A 1PG7W 4Q97A 3ROLA 5CJ5A 4Q7DA 5SWSD 4HX1B 4PRHA 3VFTA 4EN3A 5I6XC 5FHAL 5HI4C 2VMFA 5T3ZE 4AENB 1KCUH 4U1MA 4MQ7B 3CLFH 5D1ZA 4PRIB 2P24A 1T1WB 1EHAA 2VXSH 1I8MA 1J11A 3S36X 1VPOH 4LHJB 3GSUB 1CGSL 2EDNA 2IQ9H 4YH6A 1PEZA 3P0YL 2AJYL 2EH8L 1I7ZB 4O51B 1JGLH 1S9VA 2ED7A 2P8LA 4R8WH 4XVUC 3GBMH 3TBVB 1JPGA 3MRBA 4RNRB 1XFPA 4M3KB 4JY6A 2VTFA 1I85A 4XXDB 1KJ2H 4LSPL 4MJ6A 4FTVD 1RJZA 5DURD 12E8H 3UTTA 3PV6A 5MENB 4L9LB 4AM0B 4PRAA 1YY8A 5BXFB 4ELKA 2G60L 4D8PA 2X9WA 2YPLE 1BFOB 4KAQH 2VDLH 4JRXE 4KKCC 3VW3H 4UT6L 3WXWH 4MMXC 1ZANH 3JWOC 3T0WA 3LN5B 3BGFC 3EO0B 3L1OH 1IQWH 3D25A 2EEBA 1WTGT 5JPNA 3H0TA 1Q72H 1CGSH 3MV9D 1U41A 2LU7A 4X7CC 3VXRE 3MTRA 3OMZA 2FEEI 1DFBL 5BS0B 1JYWA 1FV1A 2CDEB 1WBXB 2NY1B 1CVSC 4LRNH 1CXLA 4PJAE 2GYSA 2X41A 1PKQB 5K9OA 5DWUL 2KZWA 2NW3A 4LIQL 3L6FB 4FQIL 1TZHB 3CZJA 2SEBA 1FYTA 2DQEL 3WNPA 2Z92B 3S88L 5DGQA 2ESVA 5GJTL 3SPVB 1A6AB 5D93C 1LO2H 4CNIA 1T83A 1YQVL 1HXMA 3DX6A 4P2QA 4YBLB 3RBGA 1FYHB 4AY0A 4LSQL 4UINH 4NHCL 3VXSA 1U93B 4Z7UF 2NQCA 1F3DJ 4OF7A 2VDQH 3NTCL 5HGGS 1Q9KB 1DLHA 1G84A 4NCC1 1RJYB 1CFQA 2IAND 1T04B 5HBBA 5F7DB 2MTPA 2V7HB 3NTCH 5ID0A 3OF6A 3VW3L 3BVNB 1T4KA 4KGLA 1IRAY 1MVFA 5EC1A 3SQBA 1T2JA 1KEML 3BO8A 3D48R 4DTGH 3SKJL 4M5ZH 4J3UA 1QQDB 4N5UA 3KPQB 5C0CD 1QSEA 3GI8L 3W0WB 4NNYA 4ESKA 3BEWB 3UPRB 1MCBA 2XZCL 1AQKL 3BZ4A 1UWGL 4XNQA 1PG7X 1D5ZB 5DR5H 4YHKH 1XGQB 1AXSA 1OB1B 1QQDA 2BVUA 1HNGA 3FN9A 3UJJL 5BV7L 3NCJL 4UUJB 4Y2DC 4XI5C 3T8XA 3KLHD 1UXWA 2ITCA 3KPMA 1LE9A 3O4LB 2EDOA 3RDTA 4NYLB 1QTYT 1WFTA 4XI5D 5IJKA 4NNPL 5EU7C 5EN2A 4NQVB 2IFGA 3QWOA 1DN0B 2DQIH 3WEXB 4FNLL 2XNAA 4WCYH 4KI5D 4OI9A 2DQDL 3E8UL 3SDCC 3MUGA 2YPLB 2XWJA 1CLZL 4IBLT 4KKBD 2JJVA 4C58B 3SEPA 4D0BA 5MEQA 1MCFA 1PEWA 3NACH 4ZUSA 3MBEA 1OD7A 4HBCH 1FV1B 1E4WH 4OB5L 4PJ7E 3KPSA 1MI5D 1U92B 3MLWH 3L95B 2Y07H 1FO0A 5JW4R 2RJMA 2XFXB 3B9KC 3JV6B 3S35H 2UWEB 3QXDA 5EIIB 2ICWA 1C1EH 1KCRH 4HJJL 1B0RA 4PJDF 3VFOA 4PGDB 3VWJA 1KPUB 2A83A 5HD8C 1FRGL 1L6ZA 4G6AC 5TDPB 2CLRB 1F42A 3C2SA 3UZEA 3H2WA 3FRPA 4F7PB 5FCSH 4QYOA 3LH2L 1K3IA 3HZKB 2ZUWA 3HKFA 4MJ5B 1ZT1A 3SDAA 4ODUA 4HS8H 1HIML 4CU6A 1FDLH 1SJVA 2WMPA 4G8GB 4O5LL 5F7LB 4QEGA 3GMMA 5IMKA 1S7TB 4F33A 1F58H 5E8NB 4LGSB 2XA3A 5ALCH 5A3IC 5DUPH 4JFYB 1FC2D 2AJZB 2IPUG 5HYJD 4JFDE 4AIZB 3V0VA 3MRGA 5E95B 1VFBA 5KANI 4TRPH 3JUZA 3DX8A 4MZ2A 3E2HB 1MWAL 5KS9E 2CK0L 4DGIL 4S1RL 1C16B 2BY0A 4XXDA 2BDNH 2VXUL 3IFPB 3SY0B 5HHXH 1DQQB 2NY3B 3RJQB 4URTB 4JFEA 1I1AB 2GCYB 4PJDE 3WJLA 2OR9H 3D85A 4HGKC 1E6JL 1UJ3B 3I9GL 1WBYA 1VEOA 1MJ8H 4RMTA 4LPWA 4I8DA 1BZ7A 2ZCKH 1R6VA 3Q48A 4D8PB 1I4FB 3LSOA 1FN4A 3WLBA 1U8HA 1BQHG 5F21B 5TPWH 4R4BB 2IF7A 3S34H 4Q9QH 3JV4A 4YHPB 3EZJB 4LCWB 4LPVA 4PJ9B 4V1DA 3W11D 4TSBL 4UQ2B 4XC3L 1U8HB 2E7CA 5C08A 4XPGL 5EBGA 1YECH 3PNWA 1H5BB 2P5WB 4LKCB 2YD4A 4QWWD 1A4JB 1FL5B 4PRAB 4GXUN 1IGIL 1NGPH 5JXAL 3MYJB 3P9MA 3SE3C 3MV9E 5FOBB 1ZANL 2DM3A 2QHRH 1KCUL 1VADB 5E00B 3V6BR 3VI3E 3F5WA 4AH2B 3FQTA 4PG9B 1YEDA 3QG6B 2DJSA 1F2XK 3UYRH 1N8ZB 4G7YL 4PJBB 4JRXD 3P9LA 1U91B 1Q94B 2OTWB 2YPLD 1CFNA 1JMZA 3BP7B 2EEAA 4PD4J 4Q6YA 5D7JC 1ZWIB 4Y2DA 3TZVC 1YUHB 3RTQB 3MLRH 4CMHC 2PETA 1JVKA 1OTUC 4KUZH 4OT1H 4LHUD 4P23B 2EDJA 4IRZH 3TT1L 1U8NB 3MLXH 2D7QA 3ILQD 4LAQH 4HC1A 3VFTB 1A14L 2WP3O 4HUXB 3VJ6B 2J8UE 5KOMC 4S1SL 2WK2A 1CWVA 4YX2L 4CNIB 1CFVH 5LJYH 3QUKB 1EK3A 4QHMA 5GGRY 3IDXL 5L8LB 4XWGL 1J1PH 5TE4H 3G5XB 5DRXB 1EAPA 1TVBA 1UENA 4CMMA 1R5IB 2Q7NA 2EDDA 1J8HD 3ESUF 4FFZL 3DIFA 1A6ZB 3QEHA 5FA4A 5DGRA 4IHOA 5T3ZD 5C07D 2OJZH 1MCRA 3P30L 2NY1D 3V6FB 3PL6A 2BOCA 4CGTA 1CLCA 2OYPA 4U1MB 4PRPE 4NQSB 2O5XH 2R56H 2BNRE 4J1UB 1I1YB 2XWTB 5SWZA 3WXVH 4R0LA 3MRMA 4P2QE 5K59F 2DLHA 5GGVY 5D6CA 4WTXA 3LH2H 3IKCA 5CBEB 3RNKA 2NTFA 1HHJB 3C60D 4LEOA 2YOCA 4FXLA 3D85D 3EYOA 4EDXA 1NCDL 3QO0A 1JFQH 3PHSA 2IAMA 3BN3B 4Y2OA 2FX7H 2ZUTA 2DI9A 2AJSL 1A3RL 4HCRA 1A7PL 4MDJB 4WHYH 4EUPA 3WHXB 5MEND 2P5WE 1FYTE 3BPCB 5E00A 3IT8D 1W72H 4MD4B 1DJSA 5F1NB 3G5YB 3RVVC 5TE6L 3FFCA 3IU4L 5BVPL 1I9RL 1CGYA 2P43B 4OZGE 1KPUA 2CGRL 1LP9E 2HFTA 4LMQE 3Q1SL 4OZFB 2F54D 3BE1H 3CDFA 4YHIA 4B50A 4WEMB 2J6EH 1G7MA 2NY5H 3GMPA 2EKSB 1KEGL 3F7RA 1BLNB 1IGTB 3EOTL 4GG6B 1QR1A 4MMZC 5BCAA 4OZHA 4U1HA 1FNEB 3GJEA 5IESH 1SBSH 5IVXA 3MRNA 1SJHB 4ZDHA 3VGBA 3WSQH 1N0LA 1MH5A 1U8MA 1IT9H 5JOPE 2H26A 2BNQE 5JO5B 3X12A 1YMME 3BP7A 5GSVB 4MD0B 1FZOA 4MAYA 4R0LC 2NXZC 3MRIB 1P9MA 2EDWA 4UOJA 1T1ZB 4JO1L 4MNGA 5T3ZL 3Q0HA 2WSKA 4MXQD 4NQDB 3V8CA 5ECJE 4XCYA 2R0KL 5DEGA 5SX4H 1WCBA 2SEBB 1C16A 4QOKD 4Q9BA 3S5LG 4KV5F 1PX4A 5DQJA 3X13B 3CAFA 1H5BC 1X5YA 5I73B 3ARDB 4Z7WB 4X5XA 1BFVL 1IGJB 1VDGA 1WFNA 1T21B 4FQ2L 4I0PA 3UTSB 4HK3J 5F7EL 1QFWI 2X89D 4NP4H 4F9PC 4M9PA 5DMJB 4WWKB 3F7VA 1FNAA 3RQ3A 3MRRB 2YK1H 2AJVL 3SKMA 4KK5D 3WLWC 4P9ML 1ZVHA 1XGPA 5KSBB 5FO7B 3VMOA 1FJ1B 3P4NA 4TPRL 5IG7B 3ZHKA 4XVJH 4NUGH 5L2JB 4X4ZA 4U1SB 1ZLVK 4N8PA 2FJGA 3NPZB 3CDGB 4LRIC 4L8CA 4MCZB 3CVHA 2CO6B 3H9SD 3DV6A 5CKGA 3ZDXE 4POUB 4CMHB 4QRUB 3VG0H 1D5ZA 5HHMB 5ESAB 1AIFA 1S5HB 1A6WH 1RI8A 4P23C 5I75B 4P2OA 1RV6X 5IVOA 4EOWH 2DQUH 5HDBE 1X5GA 3QISA 2ZWLT 5FGSA 1YPZB 1QYGH 2VISA 3UYOD 3G6JA 3T65A 2XFXA 2JB6A 4TUJB 3T3PE 1MCOH 1IZJA 5CBAA 2IWGA 2Y23A 4XTRD 3VGEA 3QQ3B 3WUWG 3VG9C 5IB2B 4R2GD 4MA1C 5JORB 1A6UH 1ACYL 1KCKA 4MD4A 3QXAA 5FA3A 1CVRA 2B8OT 1CLYH 3QUXA 4IDJL 1T22A 2YN3A 4PRPD 1RZKC 4XCFL 2NY4C 2CRIA 5JHDD 1RZFL 4X99B 43CAB 3DX9B 3L3HA 5FV1L 3MA7B 3QUZC 1JGEA 1XF4B 4J2XA 4JRYB 3UXFA 4XVSH 1FP5A 5EZJB 3O6MH 3ZTNH 4F8TA 3U1SL 3F7YA 3PHQB 3VWKC 3DRTB 5EBWB 3DNKA 4TUOA 2HJKB 5C09B 1NAML 2YUZA 1CD9B 3TT1H 4JFOB 4P46D 4PJ5A 3DX6B 5GSRB 4TULH 1HYSC 3MV9A 2HFGL 4PFEA 4YFDB 3LQAH 5GGTL 1S7UB 3W39A 4W6YB 2X9XA 1DR9A 4Z7WE 2BOCB 2PXYB 4JB9L 4NZUH 1RSFA 5LWYL 3HI6H 3IJYB 1WFUA 2KL6A 3QYCA 4MXQC 1HINH 1F6AB 5A2JH 2LFGA 4YAQB 3EO9L 4ODHH 2Q76B 1KB5H 4LSPH 4IOIB 1RUMH 4YZFF 5EUKB 3RGVA 4Y19E 5GRXG 5DK0A 1DBJH 1N64H 1ZT7A 3UAJD 1EMTH 3WFEH 2QQNH 3HA0A 3MXWH 3N1MC 1A02N 5D1ZB 1ULVA 3HTLX 2M2DA 3HE7C 3BO8B 5SX4I 2BY2A 3MGOA 4YHLH 5LCVH 4PRHB 1PZ5B 3S3SA 3B5GA 2H45A 2LVEA 5IEHB 3TCLB 3SDCD 1PSKL 5FO7A 3TVMC 1KTLB 4M9OA 1NPUA 3HZMB 3MJ9L 4HWUA 4GW4A 5HYIA 1TQCB 3VFSA 3MV8D 1MIEL 5L8KB 1S9XB 1HZHH 2ZKHL 5CGYC 2AK1H 1LO3L 2YPVL 3HRPA 4MCZA 1FZKA 4HGWA 2EE6A 3D5OF 5JW3H 2HWZH 4K94H 3UROR 1E28A 1RK1B 3P4MB 2ARJQ 4NCC2 5KVDL 2OM5A 4JFFE 4CAGA 1MIMH 1R3IH 5GGSA 2VLKB 1FIEA 4JREB 3FRUA 4HIJB 1DP0A 5LG1A 4AENA 1NUNB 3QDAA 5FF6B 2NXYC 5J6HA 4OCMC 3NFNB 4NN7C 4X6CE 1UACL 2PW2A 4WTWA 4ZPVB 5F1SA 32C2B 1ZOXA 3IU4H 4RA3A 3KLSA 5HI3D 2X4QB 4GMSH 1BFOA 5T1LB 5LCVL 4ZFOA 1RJCA 2F5BL 2FYYB 2OP4H 4MNQD 5HVWA 1F4WH 3QDGE 4HWEH 5IEKA 4L3CA 2HVJA 3ZL4L 3MLWL 1CXEA 2D4FA 1M05B 3F12B 4W4NA 1TZGH 1S7VB 1WAAF 5HYJE 2PXYD 2ZSVA 2DQCH 3BPLB 3H3PL 5MERA 3KGRA 3QPXL 4MGXA 3VXUE 1I7RA 4JN1H 3JUYA 4RX4D 3MV01 4UAOB 5A2IH 3BPNC 1OL0A 1ZT4A 3MR9B 3OX8B 2XXCB 1RULH 5BW7A 1DVFC 4GG6E 1Z2KA 2BNQB 1U2CA 3QEQB 4XPHH 2BSRB 3D18A 2AI0H 3V4UH 4DZ8A 4KQ4H 2HRLA 2HLAA 2OQJB 3ARGA 4JLRB 3OJMB 3AAZB 2HYMA 2N7AA 1XR8B 1Z9SA 1E4KA 1MCJA 1BP3B 5M94B 4MA1B 1GAFL 4N8CL 4KZEH 3VWKA 4LEOB 1T2QH 3SDAD 2P42B 3FQRB 3GMRA 4X6FA 3T0AA 4LLYB 4XCFH 1KSRA 4YLQT 3VXMA 4OF8A 2ZUQB 4TPRH 4PV8A 5C2UB 1MI5E 1RZJH 2IH1B 3FQWB 4I18A 3SKNA 5FB8A 2OTPA 1E4XH 4KJYB 4FFWD 4OCWH 1U2HA 3QUXC 2NR6D 4G9FD 4PJFE 3IVKA 4HFWB 1MAML 5C70A 2M1KA 3OAYH 3QFJA 4ZNCD 3VFPA 1G9NC 3DROA 5C1MB 2PW2B 4ZPVA 3TP4A 1ETZB 1TZIB 5JXEA 4JDTH 4PRNA 3D2UA 1GZPB 4HV8B 4YFLF 2FX9H 1KJVA 3RVWC 3MLPA 4F7CA 1VKXB 4ONFH 1N26A 1RUML 1HCVA 3GSNH 5EZLA 4JDTL 3RZCC 1U6AH 1MCEA 3T0EA 2YBRA 1XAUA 5KSAC 5HPMA 4JM4L 3FT4B 3OR6B 1DQJB 2NX5B 2F58H 3KWWB 1LEKA 4PGZA 4HIHB 4GRLB 4YHMH 1T03L 2XWJB 3HE7A 7FABH 4JG0H 3TBYA 2DOCA 4MVBC 1J05A 2NPLX 3PHOB 3O9WD 4HGMA 1NANH 1MI5B 4JG1L 1LEKB 4KROB 3K4ZA 4GH7B 3HFML 3QNYB 2Y5TB 1OQOA 3MLZL 4FS0A 5JOFB 1N8ZA 3UTTB 2F74B 4JKKA 1JV5B 5DMGC 1A6PA 3RDTC 3ECBA 4OJFL 4Y5YC 4I0PD 3MFFB 3CFEA 5B3JE 1KCSL 1H0DB 3ZTJH 3ELAT 1XR8A 5IOPA 5EO1B 5TGBB 1MY7A 5DJ6B 5FYJH 4JY4A 4JREC 3ARBB 4MWFB 1IVLA 5DHYB 4I18C 4JB9H 4NZUL 2E7LA 1J10A 2YD3A 5EZIH 3TN0C 4PD4K 4LVNC 4GKSB 3NVQA 4IMLB 4YHOH 1A2YB 3VXSD 4MNQB 1FNFA 5I16B 5EFIB 4O5LH 4NRZB 3RWDA 3ARFB 5FDYA 4JM2A 4AQOA 1FVDB 4H5SB 3IU3B 4JHBA 5BQ7A 2VDNL 5D7LD 1MHHB 3MREA 2C3VA 2DLGA 2MFNA 5DRNA 3B9DA 1MHEA 3V4VH 4F7TB 5SWZB 5LXGH 5IHZB 5I2IA 3BUTA 4X4ME 3O3DA 4LPCA 3RKDD 1KT2A 3ZE0E 3ZHDA 4DKAA 4QHNB 2ATKB 3SKMB 4HIJA 1A7OH 3JWOH 5B4MC 4Y7MA 1E6OL 4AYFA 4LLUB 3EDEA 1KPRB 4WUKL 4NWTL 4M6OH 4X5LA 1FPTL 5HGDA 4UAOC 1ES0A 2I9LB 4WW2B 4JFYA 1MJ8L 3QWQB 3G9AB 4RFEB 4MXVF 2GTWA 2E8ZA 2ADIB 3BH8A 4K94L 4I2XE 4KKLC 5JW4N 2FRGP 1XIWB 3Q6GH 3L5WA 2QSCH 4Y4KB 4PJXE 3C60A 2YSSB 4J4PA 5IW6A 3GUTA 4F58L 5L6YL 2DIBA 2OX5A 3TYFB 3F7YB 3PHQA 1IEAB 1C7SA 2D7OA 1QFWL 2EH7H 2YPKA 1QKZH 5DC4B 4HLJA 4PRIE 2CDFB 4BZYA 3RFZC 2AK4A 4R7DB 4FQCH 4PIRF 4B7LA 4N8VB 1MCDA 4RQQA 3BQUC 1G9MH 1HHKB 2BCKA 5F7HA 4Y19A 4CN4A 43CAA 5HHPB 1HHGB 2VE6A 3L3DA 2VR9A 3QDGB 1F4WL 3VGHA 3QUXB 2V9QA 1OT1A 3MJ7B 5E0QA 3KXFB 5I1LA 4G6MH 1YNTB 2UVEA 1RPQA 4N0YL 2P7TA 1IQWL 4F15B 1URLA 2J12B 4N9OB 4WUKH 2GJ6A 1ZHNA 4B41A 1IKFH 2D4DA 3P77B 1BWWA 1CL7L 1KNOA 3D39B 3BJLA 4UT9L 3Q6GL 2B0SL 5DZLA 5MHSE 2XKNA 2QJDA 2QQQA 3H42L 3RPIA 4QOKE 1UVQB 5KSAB 4QTHA 1I1AD 5D1QD 3FO9B 4QY8B 3DO7A 2DQJL 1FL6B 1AGDB 3QDMB 1DUZA 1TQBC 3CZFB 5E6IA 4H8WC 4RDQG 2AJSH 3C6LB 2UY6A 1Q0XL 4FQCL 5KZCD 2VWEC 2XPGA 3OJ2C 1VENA 5HGHB 5JOPD 1KUMA 2AK4D 3MRLA 3TA3D 4AEEA 2ORBH 1GC1H 2DQDH 3E8UH 5DRWB 3FO2A 4PLKC 3I3BA 4NM4H 3R4DA 2ZCHH 2ARWA 1R24B 4NHUA 5CUSH 1TVDA 1ND0A 5KANG 4PYGA 1FBIL 1UJTA 3HPJA 2AJ3A 4PJIA 4ORGB 3ARSA 4RMQA 1GZQA 4OFVA 1JF1B 4TVPE 3MGTB 1QSZA 3VDBA 4XHJC 1IAIH 4FTVB 4C56E 1FZKB 4HPYL 3MSPA 5D2LB 3U0WL 3FQNA 4RBPH 3BKYH 2YKLH 1PVHA 1ZGLA 5BVJB 4QCIB 3QI9A 4HUNB 4XCNA 2OK0H 2Z31B 4ZD3L 3NOIA 1FYTD 4HIXH 4H20H 5MENE 5HTSA 2UUDK 4LVNB 4RQQB 5IMLB 2OZ4L 5GRWA 2N56A 3VFMA 4N9GA 2XV6B 4JY6B 3HN3A 4UUJA 2OR7A 5DUBB 4K2UH 2IH3A 2DBLH 4GRLA 3QFJE 4N5EC 3PABB 4R90H 3V4PH 5JORA 3NA9L 3PL6D 5C0EA 4EEEA 5ADOH 5HJ3A 3U30C 1A3LL 3O8XA 4U1GC 3PGDB 2HJLA 4WY7L 2BNRD 3WHXA 2DMKA 5DUMH 3BX7C 3U7YL 1I9JL 1D6VL 3GB7B 4QHUB 4HPYH 4QRTA 4KQ3L 2F9BT 5C07E 1I7RB 4X83A 1E6JH 1Z3GH 2VITA 4LPUA 1MJUL 4Y8DC 2VLLB 3KPSE 4PV9B 1WEJH 3ARFA 4WTZG 1K4CA 4L5FH 2FB4H 4KK8C 4W4OA 3CDCA 1T0MA 1OAQL 4OAWB 4Y5XC 4NKQB 1SM3L 2A6KB 3JWNC 3K81A 4KK5C 2HG5B 3KNBA 4KI5C 4POYA 3ROLB 4GOSA 4AMKH 1IC4L 1K4CB 4ZO8A 2Z92A 5C7XL 2YZ1A 5ALCL 1NAMB 3BN9D 4X98B 1RZKH 3F65A 5TGBA 1W0VA 5K9QI 3O4OC 2XN9A 4I3SH 4O2CA 2ADFL 3BP6A 1KCVH 1F3RB 1WLHA 1FDLL 3U83A 2I26N 3BQUB 2VN4A 4XCEA 4CU8A 3QT2A 4XP6L 5ANMA 5E2TH 5CCKH 4DFHA 2UZYB 2DKUA 1BJ1H 4ISVB 1HHHA 1H3PL 4M48H 3SGDI 1F4AA 3OV6A 1JPGB 5EUOE 2X70A 3BQUA 5D7JD 2WINA 2XKUA 3S37H 2WQ8A 3MREB 4UTBL 3FMGL 1ERNA 4OSUL 5D2LF 1IILE 5E9DE 5BRZE 2PN5A 5DJ0B 3ARED 2H32B 2ITDB 3HLAB 1M6OA 4L8DA 3H3KA 4LSRH 4KUZL 3MZTA 1WEJL 1LO0H 1U42A 1E27B 3OGCB 4NC1C 2P5ED 3NPSC 4RZCB 3KJ6H 2Y06L 4Z95L 4Z9KB 4HKBA 3WNKA 1I1YA 2OJEB 2XWTA 4JR9L 2GQHA 2NY6D 1EEZB 1PGRB 2ERJC 4NZTL 1U6AL 1TQBB 3B9VA 3JXAA 1G7PA 4FMFA 3SDXB 1Z9OA 5JHDA 3CXDL 4QXWA 1CDBA 3IDYC 2X7LA 3WKML 4ODVL 4ZFGL 2W0PA 1EO7A 4LNVA 1EFXD 3QXTA 3MCLH 3P4OB 3CFJA 4N90E 3VWKD 4LLVA 5JHDB 3QRGH 3P30H 2APXA 3AB0B 2ZSVB 4I3GA 4QRPA 1EPFA 3P4OA 1FL3B 1YJDC 3P9MB 2EDLA 1AHWC 3L5XL 5GZOC 3D87B 4M62H 1EHXA 4JM2C 3X12B 4N1CA 5AG8A 1ZTXH 5DVKA 3MLVL 4KDTA 2R0WL 5CP7B 3RVXC 5CEZL 1YJDL 2VL5A 3IRPX 3VA6A 4GG8B 4LU5L 5DFVD 3EFDH 4OZIF 4LSUH 5EO0A 3FB7A 3H6JA 3EHBD 1UWXH 3D39A 1HHHB 3ARBA 3OAZH 4G7VL 4QRSA 5F1KC 1KIPA 2FZ3A 1MCWM 1U8JA 2MWCA 1BVLB 1W8NA 4WRLA 4M8QB 4OCNC 1L0QA 4E41E 1OAYL 4JFZH 4EI6A 3BEWA 3UPRA 1FNGB 4ZTOH 5AZ2L 5A2FA 1RURH 2A6JA 4HKXB 4W68A 3QHTC 5HPOA 1U8JB 1F3JB 1FVCB 1IQDB 1YMHA 4QT5B 3UC0H 2PR4H 3VFGH 4OF3A 2IBZY 4OGXH 3MROB 2X6MA 3ZE1E 3AM8C 1Y6KR 4OV6F 3VG0L 3VH8B 4NQDD 1N6QH 1CD0A 3MRGB 5D2NC 2VN7A 5E2JA 2IPUK 5E8PB 1Z0NA 1T80A 1JRHL 1NFDF 4OCRH 2B5IB 5ESAA 4Q9RL 4NGHL 4PJ8A 1DUYA 3TIDA 2ATPB 4C4KT 3KPLB 4NNXB 2A74B 5EU3B 4G9FB 1V5JA 2ZUUA 3OL2A 4KI5E 1JF1A 5D72L 5DZOA 1IC7H 5HPMB 5GS2H 3TFKD 1IAIM 4GKZA 3V7AG 3O0RL 4H1LG 3BISA 2C3XA 4RFEA 2ICWI 3I3DA 2QSTA 5D70H 3TIEB 1KTDB 2ZJSL 1KLGA 4HAGA 5TF1H 5HI5C 2CDEA 3LKSB 3RUGF 1CDGA 2Z35A 3VMNA 2CDGA 1ZEAH 3GZKA 5C0AE 3SE4A 1KENL 4EN3D 2P5WA 3O81A 3QG7L 4LPTA 2J3SA 1CLZH 5B8CB 1RU9H 3SGEI 1TNNA 1TJHL 3NGBC 2VLJD 4K3GA 3BDXA 3LKPA 1RU9L 4KQ3H 1MCPL 1V3JA 2BOBA 4YBQC 3VXNA 2C5DC 4CVXA 2WW8A 4J23A 4ZUTA 3RL2A 3UTOA 1ACZA 4D0DB 3U7YH 4U3XA 4UT7L 2VDKH 4ETYA 4WHYG 1JWMB 3P77A 1A3QA 3SDXF 4WUUB 3CCHA 3QDJB 1BREA 3OPZL 2BXZA 1FNEA 5EORL 4OLUH 1A0QH 1INQB 4QRTB 4CJ0A 5IK3A 1J1PL 5TE4L 3TBTA 4ODHL 3HZKA 3QO1A 4AMKL 4OCXL 4S2SB 1F11B 3L6FA 1HDMB 5E2UH 3UJIL 4EI5A 4WWKA 1SM3H 3LDBC 4M93B 5E9DB 5B39A 5BRZB 3IDYB 4EUPG 3LKQA 2W65A 4RAVB 2VXQH 3B5TA 2YWZA 5DD0H 4PRBA 1JHTA 1MFEH 1A3LH 3E6FA 1A6UL 1QLRA 1KIPB 2FZ3B 4X4MA 4RIRB 5FYKH 3C8HA 5DQJB 2W38A 4FP8L 2AV1B 3X3FH 1A7QL 2GY5A 1TPXB 3MV7E 5I17B 1T5XB 1AO7A 2I07A 3BKML 2HN7B 1MCPH 3ARVA 1P6AB 5DRWA 1NMCB 1HSBA 2Z93B 4JRWA 5ID0B 4PJ9A 2AJVH 4PREB 2XG4A 4KTYA 4FFVD 4G5ZL 2ZOLA 5DK3A 3S4SG 2EXYD 3VGGA 2C4FT 2C3GA 4G8EA 2R8SL 4R4FL 4YR6B 2BERA 3WFCL 5MEOB 2X4SA 4G8IB 1EGJH 3MV8A 2GJZA 3KLAB 4Z7OF 2D03H 2Z0BA 4U31A 4UI2A 5IV2A 3MRDA 1KCSH 1P4IL 4QTIL 3PP3K 2X1PA 4ODSH 2QADD 1KN2H 1S8DA 1BBDH 1UG9A 2HRPH 5J6HB 1OSPL 1DQLL 2W9EH 1GRWA 1FO0B 2FECL 1CT8A 4UZGA 3C2AL 3OWEA 3P3YA 4XMKL 4JGUA 1JNHB 4PGCB 3OKKB 5FUOL 1IAII 3CC5B 1MLCB 1J12A 1XGTA 3C5ZA 3LOWA 1QFWH 2EH7L 1H3WM 3WIFB 3O45B 1Z6JT 3MRJB 1A5FL 2E9JA 3B2VL 4PLNC 2O5XL 3QDJD 3O6FB 2HT3C 2VLKE 4WV1B 4HMDA 1MFAH 4UIKH 2AEIT 3KPPB 4Q9RH 2FO4B 1GGBL 1ZVYA 4RMVA 3N1PC 4XNZC 2FJFA 4PTTA 3HB3D 3EOBB 4PJHA 2DYPA 2EKSA 5BZWA 4WV1A 5DJ6A 1PYWB 3MJ9H 1EH9A 4MAYD 1FIGH 3EOYG 2OL3H 4UBDC 2B2XH 5DD1L 1DE4B 2DM7A 4KH2A 3OKEA 1ZHLA 2FIRT 5I8EA 1B0RB 3VFOB 4ELMB 4WI8A 4DZ8B 4IRJA 2NXYD 3OXRA 5DHYA 2C3WA 1NC4A 2VZ1A 3FN3A 1LHZA 5E8EA 3SKOA 3WIHA 4YE4L 1A1OB 1BD2A 5T1MB 5IB4B 2GAZA 3FB7B 3ARWA 3E3QC 3QUYA 4R2GC 2O61A 2BX5A 1BD2D 2EECA 3S9DB 5TF1L 4P4RB 1DANT 1NDMA 1NGYA 1M7DA 4LSUL 4L9LC 2VAAB 3IJSA 3EJYD 5B4MD 1VHPA 4D3CH 4L4TD 2ICES 4G43B 3X14B 3O11B 1ZSDB 2FCBA 4N1EA 5DD3H 5J1AA 1IFHL 3RVVD 1TIUA 4CW1B 1ZAGA 2FBJH 1JWUA 5CILH 5JIKA 4JO4L 5FB8B 3KPNB 1UQSA 3QUZD 2AJUL 4FN0A 4N0FB 5IHZA 4ZSOA 3U36A 1GYAA 1PY9A 3BHBB 3QEQD 2VDLL 4NFBA 1ZVSA 1PW3A 2NY4D 5C0AD 4NWUH 1T5XA 2AJUH 1QBBA 4HT1H 4Z78A 4LCWD 4NGHH 4U0QB 5F71A 1R0AL 2FHCA 4NRZA 4GQ9H 1K2DA 3QZWG 4OIAA 5CJXA 1XF2B 1WWAX 5L8JB 3GSWB 4WEBL 1B88A 2H3NA 4TNVK 1OAUH 4PRDB 1RJZB 1AD0B 5IB2A 1D9KA 1SEQH 3QFDB 4ZYKB 4ZD3H 1T89C 4X7SH 1EAJA 3MMEA 4BH7B 5ABDE 4KJYA 5C2BL 1NCAH 2WP3T 4OQTH 3DUUB 5F89B 3TH2T 4HZLB 4A2MA 3KDMB 1UA6H 4LIQH 2W91A 2OL3B 4NNPH 1BX2B 4BUGA 4M93C 5EBLA 1AKJB 3WMSA 3CFBA 2VC2L 1JZ5A 3FB6A 3CNKA 2CSPA 3N85H 5CZKA 4PRHE 1XF5A 1FCCA 1OLLA 1PFCA 4KY1H 5I1KL 1EBAA 3MZGB 1FL5A 3CSPA 4JQIH 1ORQB 4K3JH 2BC4A 2YD7A 3RVUD 5E03A 1OAXL 4M61B 5F88A 4UB0L 4QHLA 4H88H 3RRQA 1TLKA 4ZDHB 5FEBA 2FNBA 5E08H 4PJCF 2JELH 3TVMA 1XF5B 3UP1A 3DRQB 5ISZE 2GUOA 5E2WH 5TFSH 2FIKB 1ZEAL 4IM8A 1U3HD 5L2KD 4OLYL 1SYVB 4MNGE 4FOMA 2B39A 4MJ6B 1T66C 2DIJA 4CU7A 3MOAH 2IGFL 4M6NL 4PV9A 1XGUA 4AQ1B 4TULL 3CXHK 4L8SB 5E2VL 5A2KH 1FLRL 4P2CG 4J3SA 1A6VL 3WE6A 2V2TB 1F6AA 2FO1A 3DYOA 3LEVH 4KKAD 3DGCR 4WFFE 3BUYA 4FA8A 2HTKD 1S7RB 2WBJA 1OTTC 4DEPB 4UINL 1R3KB 3EFDL 4EI5D 4KKAC 4HKJB 5IBLC 4X6CA 4YHZH 3PQYA 3FRPG 5KSBF 1Y18B 4HWZB 5FDWA 2B4CH 4NQXA 5CIPA 3MC0A 1ZHBA 2VYRE 4V2CB 4G8EB 3AY4A 2JELL 3ETBF 5LXGL 1NGQH 4HJGB 4LDEB 3T1FA 4QHMB 1FFNB 4H88L 2ZUYA 4WGVB 5F7UA 1AO7D 1CL7I 4JG0L 3ALWA 5C92A 1I3UA 3PGFL 1MVUA 4HG4K 4YK4C 1NCNA 2CK0H 1ZLUH 2R15A 3W0WE 5C0ND 1V7NH 3CFKA 3WO4B 3TM6A 1NLBH 4LCIH 2W07A 3GMRB 3D9AH 3V6FA 4FG6D 4OSUH 5GJSH 3D2UB 4H26A 2B2XL 4CKVX 2R2BB 4PLOB 4IRSD 1JK8B 4HIIB 2YMXL 3TNNA 5D6DA 3CIQA 5AD0A 3HAEB 5DTFB 1J0YA 3VCLB 5E94B 2KDGA 2OR8A 3O3EA 4W81A 2AKRB 1XZ0B 4YDLC 3PG2A 1NKRA 5K33A 1R24A 3EOAA 5EC1B 4BQ8A 4MQXC 1G9MC 2P8PA 4FZ8L 4R2GB 1TJIL 2GHWB 5E6ID 4TSBH 3GMNB 4H1LB 2H2PC 5DK2B 2LE9A 5BV7B 1NDGA 4OI7A 4YQXH 5E9DD 5BRZD 3AY4C 1B0WA 3MCG1 3L3IA 3OKNB 3ILPB 5JPMB 2CJUH 3Q3GB 1D5BA 2X4TA 3O9WB 3KYAA 3QRGL 1QFOA 5H2BB 4ZO7A 1DQJA 4LVEA 5F6IB 5FGCE 2ITCB 5GGVH 5DMIH 4PP2A 2ICEB 4G42A 4C54A 1TZHA 3FT2B 5J6GB 1TCRB 2X4PA 3BP4A 2FL5B 3EUUA 1M7XA 3IDGB 1AO7E 1JPTH 5L0QB 1MWAH 4P46B 2Y36H 4PRBB 2VITB 2R1YA 1OTUD 4I0PB 3FKUS 5FV2A 2VDMH 1J0HA 2FLBT 1FLTX 3PV7A 3FJTA 5HHME 4J6RH 5BZWB 2L7UA 4MJ2A 2EO1A 3S88H 2HTLC 2DM4A 5I1DB 3MV9B 1KG0A 4P9HL 1GGCL 2AVGA 3C08H 4FXGB 4X6DB 5B38A 4FQXC 4JJ5A 1PZUB 4HC1L 4FZ8H 5F6HI 4MD0A 5D71H 1CICB 3P11L 4WFFD 2R69L 4OUUB 3IDMA 4HFUH 1RZ7H 3OJDA 2NCMA 1DTUA 4JCLA 1S7TA 3L3OB 1D6EA 2YD5A 3I2CH 3UTSD 2DB8A 4MB3A 3OAYK 4P5TC 5TJWK 4M00A 3O2DA 2MNUA 3UTTE 4JEGB 1RIHL 4Y5XA 2I07B 5IKCB 3TCXA 1FJ1A 5FYJU 3QXWA 4FQHA 1N6QL 4XHQA 4TUJA 4M1CC 4UT6H 5E94A 3T77A 2VLKA 4GAJL 3GMLA 3I6KA 3O8XC 3S8WA 2F15A 1S7SB 2Y07L 1JP5A 4L8SC 3V4VL 3QFJD 1MRDH 2PNDA 1HH9A 8CGTA 1AR1D 3BEVB 3V5KB 2GTZA 4X7TA 1A8JH 2JB5H 2VLRA 3TZVB 4X9HA 1XF2A 3UYRL 1K6QH 3I6KB 3O6KH 2KUTA 3SGKC 5L7XH 1QYGL 1BPVA 2BHYA 1CN4A 4UDTB 1X6LA 1NSNH 3RX8A 3KYKH 3BT2L 4M7KH 1H3TA 5C0CA 4MZ3A 1KTKE 3UJTL 2IALB 4PJEE 3BSZH 5E1AA 5B39G 5IF0A 4DAGH 5LGKA 1TCMA 1XGQA 3PGFH 5D5MB 4RAUA 5F3BB 1R5WA 5L9DH 1RUPL 2VZSA 4NUGL 2BVOB 3KVQA 3VFNB 4NO0A 5JOEA 1E4XL 2IANA 4U2ZA 1ZLSH 2J6EA 4PGDA 25C8H 4NYLA 1KTRL 4YK4B 3ZZ1A 2BNUB 5I6XB 1G0YR 2Q3AA 1NBZA 3E3QE 3L3JA 2WBJB 3OB0H 2GAZB 5IQ7L 2LABA 5KTEL 4Q9CA 3KHOA 5BOPA 1KC5H 2Y1VA 3EJYC 5EO1A 1IEHA 2J8UB 2AK4E 1EJ6A 2YMXH 3BKCH 2XZZA 3FQXA 2JCCB 2HJKA 2FL5A 4IRJD 3GBML 1IC1A 4TSAL 4JHAL 2QHLA 1J9CT 3RIFF 4LCCA 2GKIA 5EFIA 4YDLB 5FFLA 3QO1B 4JGMA 1Z5LA 4FXKA 2VIRA 5F9JA 9CGTA 1A6VH 1U9KA 2JK5B 2UV3A 3UBXI 5IFAH 5D96C 4PJ7B 3QA3B 4HSQA 3G6AA 3ZYJA 4ZS6D 3IU3A 4IEFB 5EU6D 2CH8A 3H9HA 4O4YH 1HSAA 1JI1A 2BRRH 3MBED 4WCYL 3EYQD 5F7EH 3HC0A 4M02A 1HEZB 1YC8A 4C83B 4OLEA 5E7BA 4IMLA 4S1DD 5DHVH 3UTSA 1RMFL 2YD1A 3BEVA 3PP4L 3N0PB 4JZJC 1FFRA 3H9YA 2AKRA 1KJVB 3ILQC 4XRCA 3LZFH 2P8LB 1I9JH 5IKCA 2BNRA 1MHEB 4RFNC 3NMEA 1IGFH 1ZA3B 4K8RH 4HMEA 3PJSA 4H26B 5M7QA 1HOCA 3LQAL 5GGTH 3B43A 3KPLA 4TUKL 2ZCKL 4LLUA 4Z78B 3L7EA 5KSVB 3MLRL 1UWEL 4HHAB 4WEBH 5EOTA 4OLWL 2DLFH 1G0DA 3OKLB 5D93B 2WLYA 3IFNH 2NXZB 5CD3B 2IAMB 4GS7B 1N6UA 2EDHA 3D69A 4C56A 3SE9L 4K7PL 1OAQH 3WBDA 3MRBB 5DD5L 3ARDC 4O2FA 1ORQA 4JHZA 4HIXL 1TTGA 3RNKB 1X9QA 1NMBH 4JRYE 3DMMD 4PJCA 3QCUL 4XP1L 1B4JL 1IEBB 5DUPL 1Y0LB 4U1HB 4WWKC 2P7TB 1A7OL 5TH2B 1YN7B 1DBML 4X5WB 1I1FB 5L2KB 1QLFA 5FYLD 1BFSA 4PJIE 4OBRA 4KTEL 3WD5H 4MJ4A 1K9TA 2A6IB 5DD6A 2CUHA 4KMQA 1Y0LA 3VFRB 4CUCA 4Y19B 2GUOB 3M8OL 4CVZB 3QIUC 5B22A 1IBGL 3EYSL 5KVGH 4PR5B 4AT6A 3T1FB 4P5KA 1NKOA 3ULUE 2RHEA 1CTNA 1D6EB 1RIVH 4LSSH 2W0LA 5GGTA 1FAIL 6FABL 3TV3H 2JJTA 2FX8L 2ZUXA 3FHQA 3CX5K 4HULB 4QO1A 4D9QE 5HHQB 3LKRA 5DD5H 3MACH 4XAWL 2LAAA 5MI0B 2LTQC 1S7RA 2W0KA 1QVOA 1D5MA 5KS9B 5DHXB 4P9HH 5ANMB 5GRVK 4JPWL 3LPWA 4K9EH 4R7NA 3VD3A 1NBVL 3MRMB 3BGMA 1RFDH 3CFDB 1G7QB 2CGRH 4X0KB 1N3NA 1F45A 4I9WE 5KS9A 5IROC 3QULA 3WXVL 1A5FH 2WBJC 4NRXB 3KYOB 2L7JA 1VFAB 4PJEB 1B6UA 2X42A 4GAGL 3ZT5A 1WCQA 3U0WH 4G6ML 1OM3L 3DSNA 4PY8J 1N0XL 1N4XH 1N7MH 3QUZB 3C5SB 1Q9OA 4BJLA 2AEWA 3NCJH 4YR6A 1NCDH 4JZNB 3OKNA 1CICD 3RZWA 3D0VA 2X1XR 5FO8A 1DN0A 2H32H 5IFAL 1FPTH 4V1DE 4LU5H 5F8RC 35C8L 5H37G 1K6QL 2V17H 2IFFH 5D2NE 4LASH 4NO5A 1ZGLB 3F7QA 5C86A 1I9EA 1I3GH 5L2KA 2R1XA 3MLXL 1XZ0A 2HKHH 4LAQL 1G7MB 4P5MA 5D1XA 3TH3T 4EBQH 5ADOL 1W0WB 4EQ2A 5CWSA 3KHQA 3HI5L 3O45A 2D31A 1Z9MA 4G9FE 2GJ6E 4FQXA 4FFZH 2FEDC 1G6RB 3BE1L 5C0BB 1W0WA 4LSTL 5D1ZC 4LK4A 4ONGL 2VAJA 4WI6A 3C8KB 3WNOA 3RAJL 4HUWB 2BNUA 1AE6H 1N5YH 2FSEB 3OKDB 2NY7H 1HHKA 2BCKB 3I6GA 3MCLL 3BDYH 5E4IA 4JO2L 5TH2A 3W2DH 1VACB 2A6DB 5CJOH 2QSVA 1W2KT 3AM8A 4E42B 4POZD 1G7HA 3K0WA 1AP2B 3QAZB 1RZIB 1HYRC 1AY1L 1LNUB 1IAIL 3ULVC 4XP5L 3OAUH 1DVFD 2HKFL 4BELD 1LK2A 2JJUA 4NUJA 5DR5L 3BT2H 2GK0A 4HS3A 4FQLL 1WBZA 1NDMB 4GS7C 3VFUA 3P9LB 5EIQA 3WKNA 4XPHL 3VXPB 1QRNE 3EJJX 1BEYH 1UB5B 1OAKL 3QEQA 2VDOL 4LNRB 2AQ1A 4WFEE 1K4DA 2EYRB 1NCAL 2XRAH 5HY9B 3VXUD 3V5KA 4YGVB 3G6DH 1EBPA 4NNYB 4NKDB 4DKEH 2XPGB 3GMQA 1KENH 4Z77B 1RZGB 3K7UA 4N5ED 5ICYA 4YWGL 3D39E 5I19L 3UTPE 4PREA 2Q20A 3QUXD 2FATH 4X9FA 1T4KB 4WTZA 1KF9B 3M07A 4H5SA 4YEFA 2X1QA 3O6LL 3QIUB 3UC0L 4BYHA 2WV3A 1R0AH 1SMAA 4I5BB 5J57B 1K5NB 1DLFH 2EZ0D 4I0CC 1FG2A 2DL9A 2XNAB 5DFVC 4XP5H 1IGFL 2BVPA 1A1NB 3R06B 5TDNA 3TYGH 2GEEA 2J88L 5FGBC 1XGRB 1B0GB 5CBAB 2VR4A 3T8XB 4HS8L 1BVKA 1WAAE 2HFFA 2R4SL 2LTQB 3QUMH 5EPMA 1F58L 1FGVL 2OTUB 2ENYA 3IAQA 4PJXB 4M5YH 1U8OB 5D7IB 4NKOB 1EEYA 3C9NA 1KCLA 3IFOB 2CDFA 3CMGA 4NOFA 4XNYL 4IS6B 1I7UB 4HXBH 1H5BA 4GG6F 3SO3C 2XN9D 4ZS6C 3RWCB 3QB7C 1YPZE 3ECBB 3BRFA 2N4IA 3L3JB 1HHGA 1JGVH 1M7IB 2FGWH 3NA9H 3ULVH 3WCYA 1PX3A 4M6ML 4PTUB 1OPGL 2P47B 3WHE0 4TSCH 1Q9LB 3RVTD 1BVZA 2DRUA 3ZDXF 4XVSL 3FCTA 3RWGA 3BDBA 1IKNA 3RVTC 2A1WL 2EICA 4PTUA 1FAIH 6FABH 5I8OH 5IGXH 5HI3C 5C3LD 4OZHB 4XNMA 3MJGX 4X6DA 3BFOA 5HDBF 3BOVA 5TQ0H 1J0IA 4Z7NF 3RX7A 4FQIH 5DMYA 4D3CL 3V52H 4DVRL 1I3GL 2H41A 5D7SL 5EUOA 5FA4B 1D9KC 2NW3B 3UEZA 3RUGA 3R0MA 4L4VE 1INQA 3CU1A 4HK3N 4Y5VA 1RZJC 3OKEB 4PUBL 3FHAA 4GRLC 1TETL 3WN5A 4HBCL 5I66A 3UTQA 3PWVB 3L3OA 5HI5D 4S2SA 2IG2L 1DUZB 3RKDC 3E6HB 4RGOL 4RGNC 4NIKB 4WHTB 4KRNA 1QBAA 3DETD 5DZNA 1F90L 1SJEB 3GEWB 5T1DH 2AJXH 4ENEC 1NUDA 3HUJE 3RDTB 3GGWA 2V5SA 4TNWF 4EDXB 4Z7UE 3RWEA 2O5ZH 4GXUM 1EGJL 1AY1H 3E6HA 4ZO6A 3MRRA 5CD5C 4M5ZL 1Q9OB 1CR9H 1OWRM 4P3DB 4HIIA 1JK8A 1TJGL 3MRQA 3QIBB 4MSWB 2GTZB 5CD5D 4R0LB 1S78C 5HGDB 4KTDL 5CEXA 2KQNA 4HIEA 4DVRH 4HZLA 3ZMRA 3OKKA 5DJXB 3ZKQD 1P84J 2P48B 4OZFG 4I48B 1P6FA 2VXVL 4IOFC 1S7WB 2JCCE 3T4AA 2CMRL 2NTSP 1UZ6E 5LQBH 5AZEH 5DHVA 4BH8B 3NCYP 5H2BA 3MRDB 1GJIA 2JJTC 4Z7QF 2ZCLH 4GLRI 4NO0B 1EO5A 3OR7A 1CG9B 4PB9L 3LPFA 4NJ9L 4ZNEE 2R69H 1CDHA 1E4WL 4OB5H 1RUAL 1FZMB 1SYVA 3R0NA 3NACL 2G9HB 3DO3A 4XMPL 5GS2D 4BZ1H 4OGXL 3GI8H 3NBNA 5E2VH 2BSTB 3VFUB 4P2QB 4JFDB 4GXVH 3OKDA 2DLIA 2GFBB 2F8XC 2BVQA 3PP3H 1AQDB 5D5ME 1VERA 3MRHB 1P7QD 4M61A 4IOSD 4P99A 1KNOB 5I75C 1G1CA 1Q94A 3OXSA 3ZKXB 2APWA 3HR5B 1VGKA 1S9WA 3JTTB 4PJ7F 3OZ9L 4GQ9L 1HQRA 2HVKA 3GK8L 1EA9C 5FGRA 4X7SL 4OKVB 4X9GA 5ACMA 4UNUA 2GY7B 3BKJL 4MA3B 4KXZH 2BVEA 5L7XL 1GC1C 1VGKB 4U7MA 3VG9B 3MRIA 3WE6B 3SE3A 4HS3B 1VFMA 4IRSB 2F53A 1Z9LA 2XN9B 2UZIL 1DQTA 1UB6A 5EBMB 4DKEL 4U7KA 2IEPA 3N1QC 2F8VA 3SO3B 3ZDYF 3A67H 5CP3A 1Q9KA 4Z6AT 3G6DL 3TCLA 4AJ0A 4NN5C 4OCYH 5HVHC 2C7UA 1LEGB 1U8IB 4JLRA 5B38B 3A6BH 2VZOA 3HMXH 3J8F7 1ZXQA 1FFPB 5HGBB 4X6EB 1VPOL 3S36H 1UZ8A 2XZAH 3QHFH 5D2LA 5IHUH 3VWKB 2R1WA 1TDQA 5T5FH 4PS4H 2FX9L 4F15C 4PJBE 4YDJA 4BH8A 1JNHA 1NMAH 2H9GA 3HPLA 4PJAA 2YKLL 2OL3A 4RAHA 1OHQA 5C0AA 3L5HA 5EZLB 2FLRT 4U3CA 5LWYH 3MNWB 1QEWA 1AFVH 2ESVE 4IJ3B 2APVA 2DI7A 3TPKA 4PJAB 3T0DA 2BVOA 4LKXA 2H3NB 3VD5A 1CFBA 5JQ6L 1H3UA 4RZCA 3W9EA 4NOBA 4U33A 1QSVA 4LSDA 3CX2A 4U7SA 4F7EA 3ZE2F 3FCTB 1FVEB 1FGVH 4KRPC 1JNNH 5EOCL 3FOLB 3RTQA 3WXWL 4XP4H 4RGNB 5GRJH 1S9YB 3W9EB 4ERSL 2EIZB 2FJHA 4YGAB 1GAFH 5IWLA 4XBPA 3CPLB 4ODUB 3VFRA 3LS4H 5HHVL 1VACA 2A6DA 1G7JA 4XXCA 2A38A 4ZPTB 1Q1JL 2HJLB 4U6VL 3DMMA 4JY4B 5DQDL 2YUWA 4O2EB 5D7LE 1QR4A 3VRJA 1G6RH 4OFYA 3UPCA 4CVZA 3LZFL 3NIGF 2D9CA 4EI6B 3DUSA 2EYSA 4U1KA 4NM8L 1QFPA 1HSAB 3NCBB 4YHNA 3MV7A 5E7FA 3HC4H 3RKPA 3QBTB 4NO2B 2A0LD 3S5LA 5I71B 1ZT1B 4DKDC 4NQED 1KLUA 4M1DH 5C8JB 2QLVB 5K9JL 4J7RA 1EXUA 1NEUA 5FUCC 2BVTA 2DQHH 5ETUB 4WGWB 4A6YB 2HJFA 3EO9H 4Y5YA 4OLVH 5ERWA 2VDPH 3U0PA 3QZWB 2D7NA 1MHCA 2AERT 2F53B 1UKQA 3GRWA 4BZ1L 5CCKL 3TO4A 4XP6H 5KVFH 4WI3A 2QSQA 5IBUG 3V6OE 4MCYB 4NPYA 3SKJH 2IQAA 6CGTA 1QBLH 2DQGL 2E6QA 3JTSB 4LLQB 3RX5A 3MRFA 1MJJB 1NL0H 3TZVA 3IXAB 4QOKA 4DQOL 2I9LA 4NKOA 2ENSA 3FMGH 4ZTPH 3BPNB 4OJFH 3U1SH 1OP3H 3CC5A 1GOFA 1F4YH 5HGHA 5A16A 4P4KC 4KK6D 2CXKA 3EYVB 3MFGB 1EVUA 1IBGH 4EI5C 2GIYA 1U8QA 3DPBA 5F9AC 5KSAD 1CBVL 4HCRH 4U3HA 1V7MH 3BIKA 4JQVA 3FFDB 5I76A 1I7TB 4E5XA 2XQYK 4HC1H 1W72L 5E5MB 3KPRA 4IRSC 3THMH 2Q87A 3HI5H 4DN3L 1RQ5A 4ELKB 3P73B 5DUBA 3MRNB 2ZOKA 3RHWK 4L8BB 1RUKH 1YDPA 1ODAA 1CG9A 2DF3A 4G6FB 1VEMA 5DQ9B 3KPRB 3DWTA 4L4VA 1F90H 4L3EA 3TFKC 2YWYA 1U8OA 5HVHB 4MB5A 1FCGA 3PWUA 1MRFL 2ZUQC 5DHVB 2XZAL 3QHFL 4OUOA 1N59A 3OG4B 1NUFA 5KVFL 1NBVH 2OP4L 4Y16D 2VDRH 3VXRB 4AL8H 2VO5A 4LPYA 1D3CA 1I7UA 2B1HH 3DHJA 1QHPA 3DVNB 1YNLL 2JCCA 2GJ6B 4G3YH 4YDKH 5JUEL 1Q0YL 1MY5A 4GAJH 2P49B 1W8OA 5KOVC 1DZBA 1SYSB 3MO1A 5JLZA 2EO9A 3GNMH 5HGAB 4PPTA 4NWTH 3CZFA 1YJDH 2MSPA 4JQXC 3NPSB 5T1LD 4IJ3C 3LEYH 1KXQE 3P0VH 4HCRL 5ADPH 5GSRA 4RISL 3KNBB 4N8CH 3ULUH 1RZKL 1RHFA 1RUQH 2DWEA 2V7HA 5EC2A 4H20L 1NCBH 5T3XH 4ZFZB 1QFWM 3LEYL 2MQ0A 4OD1H 1EFQA 3IFLL 2GT9B 4XVTL 2BHUA 3GMQB 4NP4L 1QHOA 4U6YB 2NY0D 5L9DL 5TDPA 4U1LB 4KROC 3RVUC 4LVHC 3LQMA 4MQTB 5GISH 5ESVA 1SQ2N 1UVQA 1S7SA 1I1AA 2GCYA 3HNSH 4K71B 1UKTA 3B83A 1XGPB 4RGOH 1F3JA 1FVCA 2X4OB 4P2RD 3UO1L 4LQ1A 3K4AA 3UDWC 3TO4D 4JPKL 2WUCH 2I9TA 1U3YA 2DQCL 2BJML 2DTSA 3EDFA 1JPSH 5CJ8A 3HG1D 3HMXL 3VWJC 2A74A 4AK1A 3QIBA 3L3GA 2NZ9D 3MRFB 1MFNA 5EZOL 4I5BA 3W82A 4DCQA 2Y06H 5D8JL 4K3DL 4Z95H 1FFPA 3KR3H 1MRDL 1P4BH 3ARBC 4QHNA 1BVKB 4OZ4A 3CVHB 1WSST 4Y89A 5DJAA 3MJ8B 4HKBB 1O0VA 4XBPB 1F2QA 3O0RH 4L9DA 5ANME 3HCVA 2R0LH 3VRLF 2EDFA 1A9BA 2Z91A 3ZYOA 2CQVA 5FUCE 3TT3L 1P84K 4IS6A 4WU7B 3WS3B 3FQNB 5D2LE 1ZLSL 3RGVC 3KYMA 1CLOL 1YEFH 1EEYB 1C08B 5C0CE 1T03H 3RGVD 3QG6A 3CFEB 4JVPA 4H0HB 2P8MB 1FH5L 4DQOH 1LK3L 1CLYL 5F7MC 4YHNB 4NO5B 3IDNB 4JANB 2E3VA 3CLFL 3BH9B 4U6HB 4HEPG 5FKPB 1CK0H 5D2NB 4DKFL 2IANE 5HHXL 2VLRE 5GS0H 4N90D 3SHSA 4YIQA 4UT7H 3G04B 5B21A 4WNQA 4HPOL 3HNVH 5T33H 1TCRA 43C9A 2Y7QA 2NX5D 2NYYD 3GSVB 1UB5A 1I8LA 5HHOA 1WK0A 3LKRB 2G2RB 5J0BA 2FHFA 1LO0L 4YNYA 5KS9F 2C1OB 5F6HJ 5GGUA 3SDYL 3B2UD 4QRPB 4X8XA 4XCCH 3ARDD 3QI9C 5CJBA 3SO5A 1IGCL 2X1OA 3O41B 1MHPL 1CD1B 3SE4C 4F37K 5ICYB 4Y1AB 3W11C 1UB6B 5I30L 5E2TL 2OI9C 3BGMB 5GS1A 2WINB 5D70L 4I2XB 4I77H 1MFDL 2VQ1B 1EERB 4XX1E 2B7DT 3VXTB 4TNVF 1U95A 3PL6B 3O3EB 5IM7A 1JE6A 4HT1L 4HV8A 5J12B 4S1RH 4MCYA 3WL9A 4OI8A 2IPKB 4PV8B 5DSCA 5EWIH 3GJFK 4R4NC 3TEUA 3A0OA 1S5IH 3S4SB 2J5LB 1VEPA 5T1KD 5F88B 5CEZE 5E70A 1HHJA 2HMID 4FTVE 4C56B 5FKAA 2DQEH 4Q58C 4N0UE 2YA1A 3LV3B 4S11A 1OGTA 4QNPE 5DO2D 4MS8C 3S35X 4MYWB 3R8BB 4OZ4B 3BIKB 4GBXC 4H25B 4P5TA 4HUUA 4M4RA 1UCBL 4W4OC 5CHNA 1VKXA 4EDWL 2O93L 4OLWH 5CSBA 4I4WB 3RNQB 2V6HA 3NAAH 5IIEA 5GRZA 1V3MA 4PYHA 1INEL 2AEPH 5FM5M 4LHUA 4TNWK 3LQAC 5JW5B 4ZOBA 3KWWA 3KPSD 1ZV5A 4JE4B 1NCUA 1IM9A 1KIRB 3X3GH 1MFEL 4WHCA 5IROA 3QDME 2O5YL 4EN3C 1HH6B 2XN9E 1DDHB 4YHYC 1S7QA 1IEBA 4ONHA 4DK3A 3CPLA 3TBSA 1I8IB 1JHKH 2DKSA 3JWDH 2NW2B 2UWEF 5H8DA 5GSVA 1A47A 4WW1A 5DQDH 2X2YA 5I1AB 2AV7B 4HQQH 1MF2L 3C5ZD 3KR3L 3FB5A 3OB0K 3HC3L 2H8PA 2QL1A 4UTAL 3C60C 5IVXF 2YD9A 1MJ7L 1A9EB 3AREB 4QNPF 3B9KD 3GB7A 1UCBH 3VJ6A 1BBJB 3PE9A 4Z76B 3FO0L 1JGUL 1MFCL 1MOEA 5GZND 3S5LB 4LSSL 3CSYA 4KI1A 3MUY1 5IVNA 3BSZL 1NC4B 4XC1H 5HGAA 2R29L 1X7QA 4YJZL 4HZAA 3O11A 1G7QA 5JHLL 1KN2L 2YC1A 5EUKA 1YUHA 3RGVB 1XT5A 1YMMD 1QSED 4HGWB 5J3HD 1NGYB 1PQZA 4YAQA 2G5RA 3TJEH 1K85A 1MNUL 3LEXA 4PB0L 4U1GB 2FD6L 5I0ZA 5FK9A 1S7XA 3IFPA 4EQ3A 3GIZL 4Y4FC 2EIDA 4ODTL 1AGBA 5BW7C 1NJ9B 5KTEH 2QKIB 4M43L 3FFCD 4V2BA 3U9PL 1HXYA 4ZSOB 1ZLWH 1OGTB 3KLAA 2A9ML 1AIFB 5A3ID 3QO0B 4MNHA 3MRKB 1FRGH 1FN4B 3GKZA 3T4YB 5J13C 1GOHA 5I66B 4H1LH 1KPVB 1QSEE 3L3GB 4HJJH 1C1EL 1KCRL 1IKFL 4TSAH 3NCEB 3CVHH 4WFED 3VFMB 4UQ3B 4MDIB 2R4RL 3MGTA 2ICWJ 5DLML 4LFHG 4P59L 3FT3B 4JFEB 5C0RH 4IRZL 5EBLB 3G9VA 2P5WD 4K3DH 3O4LD 1R3HA 3EFFB 4BH7A 3HMWH 1XF1A 1T2QL 1X4YA 3B9AA 3QXAB 5DT1L 3WFZA 3LKSA 2R2EB 1BOGB 2HT4C 2R1YB 4GMTL 1ZLWK 5H37H 3MRQB 2GJZB 2WBJD 3RY6C 1FZJB 1PJ9A 3EYQC 1RUKL 1HI6B 4Y0GA 3PL6C 5I19H 4QRPE 2PW1A 5C08B 1QACA 3RHWF 2P8MA 2NMSA 3KS0J 1S7VA 3VGAB 1A21A 5I1EL 5FGCB 4YNYB 2BFVL 1EZVY 3MBEB 1C08A 4LAJH 2GJ6D 2NY2C 3VXOB 3T04D 5KAQG 3ZE2E 4U6YA 1AI1L 1JNLH 1LDPL 4O58H 1OGAD 3ET9F 4YXHH 2Q8BH 4MB4A 1QBMH 4PRID 3SGDH 4YO0A 3IDIB 1U93A 1ROWA 1UM5L 2Q7YA 4PBVC 5FYJL 1OW0C 3LEVL 1V3LA 5E24E 2J8UF 3KPPA 3HMWL 4MWFA 2V5RA 5F9JB 2X4OA 5SV3A 3QIWD 4V1DD 2JF1A 1DL7L 1A1OA 1X5HA 1UYWL 2ADFH 5GQBA 4GBXA 3Q5OA 3S96A 3T0XA 5IT2H 5CAYB 1L0XA 4NDMB 1ZT7B 1R3LA 2XICA 4R90L 3WN5B 1KIQA 4ZO9A 4GQPH 5B3JF 4G6KH 4J4PD 4K2UL 5CEZD 5DURB 4YWGH 4WFGD 4F3FA 4NJAL 4XB7A 3GSOA 4I77L 4G9DB 4XB8A 3D3VA 1DLHB 5CZVL 1IGYB 4NSKA 2IQAB 5HVGB 5F7FA 4F7TA 4LSTH 4Y1AD 1HSBB 5JIHA 4PY8I 3IKKA 4ZAKC 1AHWB 1GPOH 1UEMA 3BWUC 2DQFB 5DJ2B 2XTJC 4QXTB 4ORZC 1M71A 2R0WH 4RIRA 4YDIH 2X44D 1JGDB 1ZSDA 4S1QL 4WW2A 1U8PA 5JW4Q 3QUZA 3WNMA 3ZT6A 1AHWA 4PJCE 1BOGA 2OL3L 3AREC 1MLCA 1RY7B 1XR9B 1HH9B 5I76B 1CBVH 1KPRA 4UNTA 3VXSE 4ZUUA 1OARL 3P4NB 4GRWH 1XH3A 1S7WA 3WIHL 3QJFB 3O2WL 4RNRA 1U8QB 4JANA 5IMMA 1JJUA 1CD8A 5H94A 3WUWB 1CFVL 1HI6A 4YX2H 1GZPA 3QDGA 3FRUB 3FQUA 4H0IA 5C0BA 1UACH 4UV4H 1T7YA 1DQDH 3FT3A 3PUCA 3ULUD 4K3JL 3SDDA 2WBWB 3QSKB 1H0DA 1FORL 1T7ZA 3ILPA 2BSSB 1S5HA 5BS0A 1ZMYA 3B2VH 2VLRD 4MDJA 4MXVE 4EUPB 4JO3H 2AEQL 1Q9LA 1F13A 1JV5A 1E6OH 4OD3H 2GSIB 3X11B 5HHPA 3PXJA 2EDXA 3G5VA 3RWHB 1MI5A 1V3KA 1UH4A 1DBKH 4MLIA 1HNFA 2PW1B 2B5IC 2DQTH 4ODWA 1CXHA 1LGVA 2WAHA 1CQYA 5DJZB 3AS1A 1T66D 3BI9X 4JFPA 5A43C 3WD5L 2FGZA 3ULVL 3VXOA 1ZHNB 5DXWA 5GGSY 2XQYG 4P0DA 1FL3A 5IMOA 5HYSA 3JVGC 1S7QB 2A83B 3BESR 4S0TD 2OQJA 2WWMD 4NM8H 4YHZL 2IFFL 5GHWL 4G8GE 2E9BA 1CZ8H 2OXGA 4KV5E 4NHUB 5CLWA 2ID5A 4XT1C 3I6LE 3PGCB 4GG8A 3FO0H 5EIVA 1EHLH 4XNMB 1X4ZA 2DQJH 1H3VA 2EDRA 2UYLB 5ETUA 4CDHA 4RWYL 1CFQB 4PJFA 3HG1E 1T5WA 3GRWL 4CRPA 5B8CC 4OQ1A 2MPAL 1E4XI 2NY0B 2ZCHL 3ARFD 3BHBA 4P3CH 2FEDD 2C1PA 5I8KH 2NLJB 3BZEA 1E27A 3MBEC 1MHHA 5DYOB 2OSLB 5D7LB 3H8NA 5EU3A 1A6WL 4BM7A 4NWUL 5CKAA 4LOUC 3TPUA 1SEBA 5JXED 2H9GB 1SY6H 2C9AA 3QDHA 5SV4A 1AFVL 1RVFH 1MIML 5DVLA 5E8PA 5FYKU 5KJRH 1K8DA 5ENWA 5C0GA 1QSEB 4GJTB 4MX7B 5FYJD 3TJHD 4H25A 2FH8A 2Z8RA 4EVNA 1AC6A 2IH1A 3FQWA 2YRZA 4UIMB 3G08B 4XNYH 2E6JA 5DFWH 4XP4L 1OOAA 2HA1A 4YDJB 2V17L 4LHUB 4P23D 1JI2A 3GHEL 1HILB 4BZ2L 4NQCE 3FB5B 4NJAH 1C12B 4NO0D 4P5KB 3QHZL 4UV7L 3RNQA 3TBYB 1JBJA 3U4EA 3EOTH 5IHBA 4JDZB 4X80H 2X1WL 5DMIL 4M43H 3GJEB 4OCYL 1MEXL 2AXJA 1OP3K 3I50L 4BFBD 1G9ML 2Y6SD 1BX2A 3IDUA 3IXTA 3QNYA 1NFIA 1NMCC 5C0IA 1I7TA 5I1CH 5DJCA 1AXTL 3UZQA 1UM4L 4ZUWB 1QRNA 1EDQA 2WUBL 3DETC 3PWJB 1IT9L 3BUYB 3B2UC 1ADQA 1B2WH 1T89A 3TBWB 1T0NB 5FOJA 1WIOA 2V2TA 3IFNL 1PQZB 5CZXD 3VDAA 2JIXD 3BP6B 5C0RL 1KB9J 3WFDH 2A9NH 4M8QA 2V9RA 1TJGH 3SE9H 4MD5A 4RGNE 2PXYA 1HWHB 3MRHA 4DZBB 3OPZH 2H2SC 1IC7L 3P11H 5SWSB 2WM0A 3SGKA 1WJ3A 4IHOB 4U1LA 2W92A 2V5MA 4JFFD 1WZLA 1T3FA 3BRDA 2BRRL 5I9QC 1FVDA 1CGWA 1NFDB 3K8MA 5F9DC 1QFUL 1FGNL 4QRRE 3RWDB 4YFEA 2J1KA 3HI1A 3DSFH 1OGAA 1QRKA 4F80A 2AGJH 1L6XA 2DMBA 2FD6H 4HS6A 5F72S 4XRCB 3PQYB 2HLAB 3JV4B 1OCWL 4FABL 3TO2A 3WFBH 4LQFL 1MRCH 5T5FL 1BQLH 4DCQB 4F3FB 5DJXA 2CK2A 1VSCA 3EO1A 5HDQL 4FTVA 4H0GA 4PRDA 4O02L 3GSRA 3K74B 2RQ8A 1P7QA 3TNNB 3IB4A 1N2RA 5D7IE 4PJXA 1ZA3A 1NAMH 1KC5L 1XCQB 4Y19D 1KGCD 2HH0H 3GO1L 3NABH 2AXHA 4GAYB 4JDVB 3KYKL 4M7KL 4OFIA 4KMTL 4PS4L 1NGWA 3TF7C 5IT2L 1U92A 1LD9A 1KJMA 2CLZA 4RFOH 2Z4QB 1HINL 2Z31A 3SGEH 3STLB 2IBGA 2G9HA 1A7RH 3OGCA 4L8BA 4WU7A 2FYYA 4JN2B 4Y8AA 3C8DA 4GW1B 1PAMA 4PJGE 3VXNB 2YA2A 5JW4M 1AQDA 2XA8H 2MCPH 4JAMB 5ACZB 4OZIA 1E4KC 4K3EH 4XBGB 3WKMH 4LBEB 4CDGC 1IAKB 3F12A 1TTFA 2A6KA 2NNAA 3NFNA 5IBUB 3HFMH 1YY9D 3NCCB 3E2HC 3IDNA 1QO3A 1P1ZA 3CUPA 4Z18A 4O02H 3LKNA 5JHDE 1QLFB 1TTUA 4DZBA 3MV11 4OKVA 1AJ7L 1KJ2B 4ENED 1I1AC 5HYJB 4WO4A 4RFNB 4Q0XH 1JCKA 2D9QB 4DKFH 3K46A 1ZT4B 3EDJA 4YGVA 4ALAL 1G7IA 3AUVA 1KELH 1QNZH 2Y25A 4S10A 2D7PA 1MJUH 5KAQF 2JIXA 4M6OL 5J89A 4JFQB 4LLDB 3H7BB 5CZXC 4Q6IA 3CFIC 4MJIB 2CMRH 2AAVA 4RSVA 1YEEH 5JA8B 4HKZA 4PLKD 4PJ9C 3M1BA 4MAYB 1NBQA 3RPIB 3I2CL 4LSVH 2BXYA 4GSDL 4HFUL 1AH1A 4IMKA 3BMVA 4JPWH 2W60B 4XH2B 1ZHKA 2I27N 1M6OB 5E6IB 4DVBA 1RIHH 3K8LA 4LCYB 2VJXA 3ABZA 2AXGB 5ITFB 2ZG1A 5HHOD 4LGRB 1GGBH 2J6EL 2MQ3A 3LHPL 3ZYZA 4HH9A 4MHHG 2D7TH 5ILTH 2MHAB 3EDDA 4GAYA 1YNLH 5INDB 1JRHH 3OKYA 1B2WL 1JIBA 3DXAB 5FYKE 3SQOL 4OV5A 1G7LA 3QFDA 3VRIA 1AGFA 1YMMA 1TVHA 1XF3B 1YYLL 2X4NA 2FWOB 3D3VD 1U8PB 3G5YA 1WT5C 2JB5L 4OM0L 3HAEH 5EORH 1QUNA 4WO4C 2W0FB 1S3KH 2R0LL 5T3XE 2A0LC 3CD4A 2OXHA 3WJJA 1B4RA 1DEDA 1FG9C 2VSDA 4LDLB 1XIWA 1RULL 1VGEH 2ZSWA 1CS6A 1UWXK 1JZ8A 1YECL 2IANB 4AIXA 2RB8A 5HVFB 3VXUB 1C5BH 4DWHA 1A6TA 2W9DH 3HE6C 3QQ4B 4RWYH 3W9DA 4OD1L 5D5MA 3RWJB 2BVYA 4ZUVB 1YY8B 1NEZB 5IVXB 1KB5L 2G5BA 5F1IB 3GBLA 3Q2CA 4JRYA 3DSFL 3WIFA 1TENA 1F8TH 4U6TA 5BO1H 3UBXG 2KH2B 3I6GB 5C0CB 3V5HA 4PB9H 4GRMB 1KOAA 3GMPB 5ISZD 4P48A 3B6SB 1UM4H 1A64A 2X9YA 3H7BA 3S35L 5HD8D 2HP4A 4Z5RB 3OXRB 2NNAB 4RRPG 5JLZB 1U3HC 2K1MA 3O3BA 4XNUL 3KLDA 3GO1H 4XBEH 2B20A 2X4TB 3O9WA 1CL7H 1JHKL 4GT7A 4MQSB 3NIGE 4WUUD 3TBWA 4U1NB 4FMKA 1KJ2A 4OLXH 3DVNA 1PG7L 3VH8G 4GUPA 4KFZC 1OSPH 4RISH 3LB6D 5EC2B 2I25N 5EO0B 3L3DB 1OTSD 1H3XA 4UNVA 3D1MC 4WU5A 1U8LA 5DMKB 2Y9RT 3FB8B 4HS6B 2CD0A 1C5BL 2F54A 3OHXA 4KRLB 4YPJA 3RA7H 1U58A 3V6ZA 5BV7C 5CEYA 4DUXA 3JV0A 4PJ9D 4I3SL 4FQPA 2N1KA 3REVB 2YR3A 3NCFB 5D7KE 3H9SB 1FC1A 2X4UA 3E6FB 2DQIL 3DV4B 3HNSL 4TOYL 3RIAK 1HXYB 1BGXL 5BS0D 1KULA 4JJ5B 3GSUA 3IXAA 1J1XH 4OLYH 5F9WC 5IM7B 1NGQL 3MROA 3SGJA 5GGQH 3SPVA 1KFAH 1BOYA 3BW9A 4TTGA 3WUZA 1MCCA 2FATL 1MLBB 3SN6N 3S37L 1A4KB 1KBGH 1A22B 1FLRH 4GRLD 1UCTA 5IJVA 3NFPB 4L4TE 3QWRD 4NC2B 4NNXA 2DDQH 3F7PC 1J8HE 4NKIH 1D6VH 4QRUA 5IW3A 3ULVE 3DJ9A 4G80B 3RWJA 4PJ8B 1WWWX 3S34L 4L4VD 3QH3A 5TPWL 3ZDZF 1JPSL 2ZOLB 2NX5A 4LLMB 3CDGA 4JHWL 1O5DT 3T0VA 2H1PH 3SDYH 2Y4SA 5KSBE 2XOTA 3PDOA 1AD9B 2Z8VC 4Q6IC 1OSZB 2AXFA 3CSGA 1OF2A 1B6DA 4JDVA 5E6IC 3I02B 1S9VB 1J5OL 2CDGB 1BEYL 4NQCB 1A7NL 1CF8L 4E41A 1IGIH 3GMNA 1X4XA 3MA9H 5D7IA 3GDBA 2IC2A 1KLGB 2DQGH 4N68A 3LKOA 1X5LA 4BK4A 1GC1L 1J7VR 2EDQA 2YZ8A 5CJOL 2XA8L 3C8KA 4ZOEA 4JVWA 4RBPK 1EZVX 4GRWF 5C07B 3QIWA 4C55A 2FIKA 3WHE1 1P7KB 4ZOAA 5IOPB 2PTVA 1LEIB 3F58L 4LBEA 2GK0B 4Z7VB 2WWKT 2EC8A 1T6VN 1I75A 4MA7L 3DXAE 3UDWA 3PWJA 1ZHKB 4YXLL 4NKIL 4JZOA 1ZWIA 4Y2DB 4PTTB 4J4PC 1RZ8A 1A2YA 3CU7A 3K1KC 1BJ8A 1ED3B 4X4XB 4OQTA 3QJHB 5I1IH 5DD6B 1MFBL 3ARBD 4MLSA 4GUPB 5LGJA 3MV7B 5ID1A 1U8KA 3HE6B 4NHCH 3ULSA 1MREL 3Q1SH 3QULB 3SDCB 2CKBL 1WICA 4MJID 4POZC 2Q76A 1XCQA 2DD8H 4NQXB 3UX9B 1EJOL 5IJVB 5ISZB 4OFDA 3C09B 4WI7A 3IJYA 5FECA 3SDCA 1AGCB 4JPKH 1IJ9A 1MWAA 3HB3C 3B9KB 4JO4H 3MBXH 3NZ8B 2Q1EA 4B53A 1ZKAA 4DUWA 4X4YA 3LN4A 3WIIL 3CVHL 1NH6A 3QPXH 5FYLL 4P3DA 4R4BA 2X4SB 3ES6A 4KKCD 4JFDD 5KSVA 5IQ9A 4PJAF 1RK0B 1A1MA 1SEBB 2ITDA 3HLAA 1MUJA 5FM4A 1OF2B 3BJ91 3ZT7A 2BC4B 3M8OH 2X10A 4M4PA 4JR9H 5HYFA 4QF1B 5I18L 3V0WH 3RTQD 2Z8SA 4R6UA 2BNRB 2XY2A 1T83C 4LCWA 1KN4L 4QKXB 3QH3B 4Y4FA 4YPGB 3EKCA 1QKZL 4XNQB 1IM9B 3SOBH 3MRJA 1DBBH 1P4LA 3EJZD 1WBYB 4OZFA 3SJVE 1DE4A 2NY5C 2QEJA 2E9WA 1WITA 4HDIB 5EIIA 1MCHA 1QZ1A 3IDXH 4KJWC 3QCTL 2O5YH 2UVFA 5FF6A 4Y88A 1HQ4B 3WFHB 1RAMA 3C6SA 1EFXA 3L95A 1N5AA 2MQCA 3QJFA 4KJPC 1KEGH 4M6MH 4UIKL 5CUSL 3EBAA 3G5VB 3KPTA 4N0YH 2MOVA 5I15H 3TN0A 2VXSL 3ZYIA 5HYSB 4X4XA 2Y5TA 5EU5A 4DN4L 4MJ5A 5JMOC 1UJ3C 2YHGA 4WUUA 3PABA 2VL5B 4FXKB 3TVMB 3ARPA 1NUGA 4F7MA 3SCMD 2A77L 1I1RA 1MQKH 2R56L 5I1HH 1TQCC 1OP5K 4P4KA 4H8WL 3VWJD 2GITA 2ADJA 1G9EA 1WC7B 3O3UN 1I8IA 4TVPH 4M8VA 1CDJA 2PO6D 3GSNL 3X11A 3V0WL 3PWPD 1KYOJ 5IB1A 3BMWA 2F53D 4PG9A 5JNYA 5MEPB 1IGML 5ITBL 5K59E 3EYFB 4PJFB 2B0SH 3MA9L 3PWVA 5K93A 5IP4A 2ADGA 1MCSA 2GJJA 1IMHC 3GI9H 2DJ4A 1BQHB 4ERSH 4OTXH 3LKQB 4RAVA 2XWBA 4J3TA 2B4CL 2VXVH 1R5IA 3H9SA 3X3FL 1BIHA 1NCBL 4U0RB 5T3XL 3FAXA 3VD9A 3SBWC 3VI4E 3H3BC 3TA3B 2PCPA 4XPBL 1C5CL 1JUFB 2D0FA 25C8L 5INCA 4NFCA 1QBLL 4K9EC 5CFHA 3BRGC 3TBTB 1NCWL 2XZQH 5IR1A 3RY5A 1SJEA 3D0LA 1G6VK 4G9FA 4KKBC 3DV4A 4UOW1 4MSWA 4BFGA 4G8FA 5CGYD 4CN6A 2Z8WC 3SCMA 2CUMA 1ORSA 2N7BA 3MX0A 3T2QA 3GSOB 3P73A 3BPLC 3SJVD 3T1WA 2Q8BL 1REIA 4D9RE 3PIQA 1F4XL 5IF0B 3RUGE 3GSQB 5IW6B 1YNKL 4JPVL 3MRCB 2PTTA 4R3SB 1YN6B 4KMTH 4UV4L 1VESA 3S98A 3AFLA 4HUVB 4G8GD 3FZUC 3W0WA 1H8SA 4NZJA 4WHTA 5C6TL 3MUJA 3LPGA 1NGWB 4K94C 4DGYH 3CGTA 4XMKH 1HQ4A 4OBSA 5E4EB 2CRMA 1JGUH 1MFCH 1SJXA 2R2CA 4J8RB 5BZDA 1VA9A 3C9NB 4YHML 4Y5VC 4OFKA 4JM4H 4RMWA 2CJUL 1VFOA 2UY7A 4G8IA 4IIQB 5CSZA 3SDXE 1JZ3A 4XHJD 4J8RA 5SWQA 5BZDB 3C87A 4XMPH 1BWMA 1R3HB 3NH7L 5ICZA 2VZ3A 4KHTL 1QO3B 3L3KB 5H94B 4ZUTB 3RL2B 3TJEL 4IMKC 3QCUH 4NN5B 3DI3B 1JGEB 3PDGA 4WWKD 3OBAA 5E99H 4JFDA 2M26A 4M7LH 4QRQB 2HT4D 3DVGA 4QXGH 2XKNB 1EGJA 1S5IL 5IB3A 1LK2B 3CSBA 4JJHA 3GJFB 5KVDH 4MNQA 1HYSD 4B5EA 3TBSB 3QIUD 3G04A 1G7IB 3V7MA 3IAGC 4QRQA 1BM3H 4CJ1A 2D3VA 3AU1B 2Q3ZA 1DL7H 4X5XB 2ICWB 3T08A 5KW9L 4OZHF 2VWEE 3NAAL 3U6RA 3SOBL 3HZVA 2VB5A 3S37X 4HUKB 3T3MF 4F57H 4FQHB 4UOW0 3RZCB 3RI5K 3W39B 3CFCH 5DO2C 3F7VB 12E8L 1J0KA 3MXVL 1NFKA 1QD0A 5D5MF 1JN6B 2F19H 4AIZA 1JTTA 4NKMB 3VFPB 4PJBF 4XCCL 3RVXD 3VFGL 4LP4A 3CCHB 2IPTL 3OKMB 4HJ0D 2ADGB 2BSED 3S96B 1ITBB 3DLQR 1H8NA 4UDUB 3IDMB 4L8CB 4P9HC 1DBMH 4CN1A 2HT3D 2CIIB 1AXIB 5L2JA 4MDIA 3BH8B 4HXBL 1MAKA 1PZ5A 4M1GH 4P2RB 4RRPA 3WFCH 3QAZC 5SWSE 1CE1H 3GSXB 4UTAH 4Y16B 5F3HA 1H9VA 1NAKH 3ES6B