1RT4B

Hiv-1 reverse transcriptase complexed with uc781
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
429
structure length
404
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 117
structure length 404
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt4B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4B02
3N6NA 2WCXA 5L1KA 4IR1A 1J5OB 2FVRA 5KG5A 5KG2A 2W9CA 1VRTA 5KG3A 1HMVB 3DI6B 2HNYA 4LSNA 4ICLB 1LW0B 3I0RA 2JEJA 4B3OA 5C24A 4NLOA 3OLAA 3T5KA 4DL3A 2D7SA 4KFBA 3BQ0A 4KV8B 3IGNA 3LAMA 3CJ2A 4IRKA 4R0EA 1EETA 2VG5B 4EO6A 3BSNA 1RT5B 2J6SA 2HMIA 2C2DA 2IM1A 2RF2B 5CYMB 4K4UA 4MKAA 2VG6B 3LP2B 1IKXA 3DDKA 4U7CA 4U6PA 2AGPA 4YP3A 5DG9A 1JLAB 1RT2B 4F50A 2OPQB 2HNZB 3DMJB 3MEEA 4DG1B 3V6DB 5J2NB 3OLBA 4J9SA 3T19A 5KFFA 4ZP7A 5C5JA 4DL6A 4EBDA 1RTDA 2ZKUA 4TY8A 4IH5A 5EWGA 3T5HA 2ILZA 3NKYA 3M9NB 3HVWA 4RU9A 2XC9A 3PHEA 4Q8FA 4ED8A 2ASDA 4RW7B 4NLPA 4ZPAA 5L9XA 2OPSB 3KLEA 3ICLA 4QWBA 2XGQA 5CYQB 4ED0A 2JC0A 1T94A 4TXSA 3IN5A 5J1EB 1JLGA 3G6VA 4O44A 3H98A 1JLEB 3V4IA 4K4XA 4NYZA 3PW4A 3IRXB 2ZE2A 3NBPA 2HNDA 5J2MB 2UUWA 2AX0A 4DL7A 4J9QA 2ASJA 1QE1B 3ITHA 3E51A 4I2QA 5F8LA 5EDWA 1S6PB 1FK9B 3BSAA 4K4YA 2FJWA 2BQRA 3FFIA 3DOKA 5DG7A 3JYTB 3RBDA 2FVCA 1S1XA 2WTFA 2HAIA 2C2EA 1RTIA 2YKMA 5KFXA 3QO9A 1LWFA 5C42A 3VQSA 1S9GB 3M8QB 5KFDA 1RT6B 4ID5B 3M9OB 3KMQA 1RT7A 4H4OA 3HVTB 3KJVA 4PUOA 2AGOA 2UVWA 2IBKA 3QIPA 1EP4B 1UWBB 2WK4A 3GIMA 4MIBA 3ISND 2R8IA 1S9EA 4R5PA 3C6TB 1S1TA 3KNAA 4ZMMA 3DLEB 1HQUB 1JLCB 4YR3A 1S10A 1C0UA 4MFBB 4RW6B 1S1VA 2R8JA 1NHUA 3QYYA 1DLOA 4G1QA 4NCGA 3FRZA 4ZP8A 1JLFB 5KG4A 2WONA 5EWFA 1C0TB 1DTQB 1KLMB 1TVRB 3C6UA 4J9KA 4OL8A 4J9PA 1MMLA 4O4GB 5F8NA 3QZ7A 3ISNC 4ZP6A 1TKXB 1JLQB 4QW8A 5KFPA 5D3GB 2QV6A 3KOAA 1JLBB 3KK1A 3GYNA 4JV0A 5DQIA 5JUMA 3KMSA 2IA6A 3QLHA 4R8UB 2OPPA 5KT7A 4K4ZA 3PJXA 1TV6A 2ZD1B 4O3SA 5EWEA 3M9MB 3H4BA 1N48A 1I6JA 2C2RA 5J2PB 5J2PA 4EYHB 1C1CB 4IOBA 1RT3B 4RUAA 4YQWA 2BQ3A 5KFIA 5KT5A 5HBMA 1R0AB 3UDLA 4EBEA 2OPRA 4NLSA 3DYAB 4GC7A 4JUZA 2BE2B 2HWHA 2R2RA 3KK1B 4TN2A 3BR9A 3GV7B 5D3GA 3QIDA 4DEZA 3I0SA 4ZHRB 3H5SA 3PW5A 1TKXA 1IM4A 1TKTB 1DTTB 1S1UA 3MEGA 4RW4A 4DL5A 5KFAA 2E9ZA 1W25A 3CDUA 1N5YA 5KFKA 1HQEA 1S0MA 3CJ0A 3FQKA 1C0TA 1TVRA 3I5AA 3OL9A 1MU2B 4H54A 5KG6A 1T05A 1IKYB 3DRPB 5HLFB 3MEDB 5FDLB 4O3OA 1VRUB 4RW9A 5KFSA 3V6JA 3PW7A 3DM2B 3IG1B 3RB0A 4WZMA 5FDLA 3MEDA 4MFBA 4KKOB 2IJNA 4YR2A 4HYKA 2J6UA 3DLEA 3T5LA 3DRSB 3MR3A 1S1TB 3C6TA 4NLRA 3LP1A 2GC8A 4HKQA 3KLHB 1TKTA 3KHGA 3I0SB 4H4OB 1RT7B 3KJVB 4PUOB 1HYSA 1KHVA 2ILYA 3M8QA 1S9GA 1TL1B 2YKNA 3D28A 4J9OA 2BE2A 5F9NA 4QWDA 2FLPA 3QGGA 1RYSA 4NLQA 5DLGA 4O3NA 3PVXA 2W7OA 2V4RA 2IC3B 3QGIA 3JYTA 4KO0B 1S0NA 4NLUA 4O3QA 2YNFA 3DOKB 3H59A 1RYRA 2ZD1A 3CVKA 2JEFA 1S6PA 3FSIA 3CIZA 2OPPB 1HNIA 2OH2A 3H4DA 1T3NA 3GV5B 5J2QA 3Q8QB 4NLTA 1JXLA 1RT4A 4XPCA 4QPXA 1RDRA 2JLEA 4IDKA 4IG3A 4IH7A 3EPIA 1S1WB 4IG3B 4IDKB 1N6QB 3IS9A 1DTQA 1JLGB 4MH8A 3KLGB 4WZQA 2YNIA 1CSJA 2AGQA 1S9FA 3CDEA 1RAJA 5KFUA 1HNIB 1LWCB 1JLCA 1HQUA 2JEIA 2AWZA 3HKWA 2UVUA 5KFRA 2W9BB 1UWBA 3MTKA 2FJVA 4KO0A 4NZ0A 4QWAA 2EC0A 3N6MA 3HVTA 3PR5B 3H5XA 2RDIA 1TL3B 4NLDA 1RT6A 4WFYA 1D1UA 4NRTA 1LWFB 1TL3A 1RTIB 3GQCA 3KHLA 3SFGA 3T1AA 3KLHA 2WRMA 3KHHA 3H40A 3BQ1A 1S49A 2W9BA 5KG1A 1OS5A 1ZETA 3DRSA 4ECVA 4K50A 1LWCA 4KKOA 4ZVHA 4I2QB 1QAJA 3IG1A 3DM2A 3ITHB 1QE1A 5KFCA 4F4XA 1VRUA 4RW9B 2YNIB 4TQSA 2HMIB 2FLLA 1IKYA 3DRPA 3KLGA 5HLFA 5KFTA 1XR5A 2VG5A 2BRLA 2ZE2B 3IS9B 1N6QA 1RA7A 4K4VA 1S1WA 1N5YB 1JLEA 4K4SA 4KFBB 3MEGB 4RW4B 2B43A 5KT2A 5F8HA 3I5BA 4EYIB 3FQLA 1RT4B 4ECZA 2J6TA 4B3OB 4IH6A 3OL6A 5J2QB 3RB6A 4TYAA 4ECSA 1K1QA 3DYAA 4M94A 2OPRB 5HBMB 1R0AA 4WYLA 1RT3A 2YNFB 4QWEA 4K4TA 1GX5A 2VA3A 3H2LA 3JSMB 5KFVA 2IC3A 2D3UA 1TV6B 3QLHB 4R8UA 5KG0A 3GV8B 2YKNB 1TL1A 4NLYA 1FKOA 4F4ZA 4DL2A 1HYSB 1TKZB 1RTHA 4WXOA 4DG1A 2HNZA 3DMJA 3MEEB 3V6DA 3V6KA 1U09A 2OPQA 4ED1A 2VA2A 4RZRA 1JLAA 4WYWA 3C6UB 3LP1B 2IM0A 4Q0BA 2CKWA 2I5JA 5KT3A 3LP2A 4KAIA 1JLFA 2FVQA 2VG6A 2ASLA 1DLOB 4G1QB 2D41A 5CYMA 3BREA 1S1VB 4YR0A 4J9LA 1C0UB 4RW6A 1T05B 4WFXA 1RT5A 1IKVB 2W8LA 1MU2A 1FKPB 3G86A 4RNMA 1HQEB 2ATLA 1N56A 3KLVA 3KHRA 1EP4A 3QIPB 2GIRA 4NLWA 3LAKA 4LQ9A 1DTTA 1S1UB 4ZHRA 5C24B 4J9NA 3CJ3A 4IRCA 1SUQB 2YKMB 1S4FA 3DI6A 4Y2CA 1HMVA 1Z4UA 4J9MA 2UVVA 1ZTTA 1VRTB 1S1XB 1SH3A 4MIAA 3PZPA 3BSOA 3EZUA 1C1CA 1SV5A 3DOLA 5KFMA 1HNVB 3BGRA 5KFEA 3KLFB 4FS2A 3KLIA 1SH2A 3SI8A 1FK9A 2FLNA 3KK2A 5KFHA 2IMWP 1XR7A 4O4RA 1LW2A 4NLXA 1JLBA 2D3ZA 4K4WA 5HROB 2JC1A 2XGPA 1JLQA 3LP0A 4RNHA 2WOMB 3I5CA 3Q8SB 4MK8A 2BRKA 3CJ4A 4O4GA 4Y34A 3V4IB 3OSNA 1KLMA 2E9TA 3LALA 4O44B 2WONB 5KFGA 1T03B 4IQXA 5DQGA 4URGA 4NCGB 4IFYA 2DPJA 2UVRA 4RW7A 3EPGA 3V81A 4ZVFA 4R5PB 1S9EB 4Q43A 2I1RA 4IFVA 3FDSA 4WE1A 1NHVA 1QUVA 4WFZA 4RNOA 2VG7B 1S97A 5KFNA 1JKHA 3CJ5A 3OL8A 4IRDA 1HPZA 4WXWA 2IM3A 5KT4A 5K14A 1RTDB 4TY8B 4ID5A 1YVFA 3BSCA 3CO9A 4NLVA 4RNFA 3QO9B 5C42B 3TAMB 4MK7A 3SFUA 4PWDB 3PW2A 5L1LA 3BQ2A 1LWEB 5KFBA 4J9RA 2B6AA 3FFIB 2B5JA 1IKXB 4Y2AA 4ZPDA 2V9WA 4F4YA 3OHAA 3BJYA 3D5MA 4TQRA 2RF2A 2WB4A 1JX4A 3PW0A 2HNDB 3NBPB 5J2MA 4ECXA 2W8KA 3RB4A 2BANB 3IRXA 3DLGA 4I7FB 2XCPA 4KV8A 4ECQA 3NAHA 1NNDA 4ECYA 4MKBA 3NGDA 3M8PB 4H4MB 5J1EA 4IG0B 5KT6A 5CYQA 2OPSA 4ICLA 3KLEB 2WHOA 5KFWA 5L1JA 4LSNB 2HNYB 2FJXA 3IGVA 4KBIA 2V0NA 2W9CB 2YNHA 1IKWA 4URSA 1SH0A 3G6YA 4Q44A 3NAIA 2R2SA 4ECRA 2C22A 1IKWB 4M95A 3MR2A 3E01B 1BQMA 4ED6A 3MECB 4ED7A 3MR5A 2RDJA 1RT1B 1D0EA 4FS1A 2R8KA 3T5JA 1TQLA 4JV2A 4ZP9A 4IG0A 4MK9A 4JV1A 4H4MA 3M8PA 2RKIA 1KHWA 5J2NA 2XCAA 2R8HA 4TLRA 2IAJB 4I2PA 5EUHA 2V4QA 4RW8A 4TYBA 3Q8RB 3LANA 3OL7A 1RT2A 3RAXA 3DLGB 4I7FA 4ECTA 2BR0A 2BANA 2JEGA 4ECUA 2E9RX 2GIQA 2DPIA 5KFZA 3HHKA 1HARA 1QAIA 4DL4A 4Q8EA 2F8EX 1S0OA 1WNEA 2AX1A 4ZVGA 3GILA 2B5JB 5DQHA 1EETB 2UUTA 2B6AB 3RBEA 4ED3A 4FBUA 5HP1A 4I2PB 2IAJA 4QWCA 1RA6A 1REVB 2RKIB 5F8GA 3TAMA 3I0RB 4URQU 3GIIA 1LW0A 5I42B 4ZVEA 5T14A 3KK3B 5K14B 2R2TA 5KG7A 3QGHA 2FVSA 3PJWA 1BQMB 1S6QA 4QW9A 1J5OA 2VG7A 5KFOA 4LSLB 2O5DA 2IJFA 4IFVB 3N6LA 1RTJB 3GIKA 4KHMA 2YNHB 2YNGB 5F9LA 5L1IA 3V81B 2AQ4A 4KHRA 5F8MA 1XR6A 3DRRB 1ZTWA 1BQNA 2FVPA 1T03A 3UR0A 3DLKB 4PQUB 3RAQA 3NMAA 1N4LA 4TY9A 5I3UB 5DG8A 2R8GA 5I3UA 3MFHA 2IM2A 4Q45A 4G3IA 2C28A 5C25B 2WOMA 4XPEA 3LP0B 4XO0A 3UQSA 3RB3A 3NL0A 5HROA 3DRRA 2XWYA 4ZPBA 5KFLA 3OSPA 3HVAA 5KFQA 3TVKA 3G6XA 2ALZA 2XI2A 1S48A 4KE5A 1HNVA 3BGRB 1C1BB 1SV5B 3DOLB 4RNNA 1LWEA 2HWIA 3QZ8A 4NRUA 2XI3A 4IR9A 1S6QB 1K1SA 4PWDA 3Q8PB 3KK3A 5JXSA 3V6HA 4KB7A 3CDWA 5I42A 2CJQA 2W7PA 1SUQA 4Y3CA 4FBTA 4NLGA 4LQ3A 4YMEA 1HPZB 1REVA 1JKHB 3H5YA 3MR6A 5HP1B 4F4WA 1JIHA 4WE1B 3CWJA 3UPFA 5DGAA 1C1BA 4EBCA 3PR4A 1FKPA 3GIJA 4IKAA 1IKVA 4O3PA 5DLFA 5KFJA 5DGBA 4X2BA 3MF5A 4IFYB 3MFIA 1GX6A 1C2PA 2I5JB 5C25A 3TQ1A 4Q0BB 4GC6A 5F8JA 5KFYA 4KSEB 3OHBA 4RW8B 2BQUA 4O3RA 4PQUA 3DLKA 1RTHB 1BQNB 4ED2A 1TKZA 3H5UA 4ZPCA 5F8IA 1FKOB 1LW2B 1RT1A 2W9AA 4EEYA 3KK2B 2R2UA 3MECA 2QE5A 3KLIB 1TP7A 4ECWA 3E01A 2AU0A 2YNGA 3KLFA 4RUCA 3JSMA 4EO8A 1RTJA 4LSLA
chains in the Genus database with same CATH superfamily
2WCXA 2IYGA 4ILRA 1Y5LB 1J5OB 3A3NB 2ZJQQ 1R7IA 1JJCB 1VRTA 2W24A 5DZ7A 5KG3A 2CQ2A 2GHVC 3P4UB 4DR5J 2HNYA 3UD5A 1QM9A 1N8RT 2IY5B 1H72C 3CT9A 4KGXB 4ZKAA 1VGYA 3KTQA 1MMDA 3OR1A 3WIVA 4DBQA 3LAMA 2DK2A 2GNKA 4IRKA 5D0RA 2VFTA 1EETA 2VG5B 5HVFA 1TAUA 1NSAA 1O0PA 2FIUA 1PYTA 2F65A 3AT1B 2D3O1 1W2BR 4K0KF 4DV6J 3AAWB 1QUPA 3U27A 4K4UA 2LQ9A 4DUZF 3EGZA 2NQPA 2KZZA 2MZRA 3NXZA 4N8OA 2FDNA 5IS2A 2PMWA 4OYWA 2RU3A 3HK2A 1JLAB 2DTJA 1RT2B 1BQXA 1SQEA 2GX8A 2OPQB 2QN6B 2V2VA 3HDSA 2FY8A 1X4BA 3V6DB 2RU9A 3QWPA 1FXDA 5J2NB 1IUJA 1Y11A 3FC9A 1Q81T 4ZP7A 4OJ1A 2JZ5A 2XZWA 2XZTB 3A13A 3M6WA 9ATCB 2GQCA 2JLGA 2MQOA 2EFVA 2VFSA 2VPYB 2NREA 3PACA 1N36F 4DV1J 3P5TL 2CPJA 4X4RA 2KXNB 1WHYA 1UZHA 1RKIA 5FJ4A 3AOBA 1NU4A 4LF2A 2FHJA 3OJUA 2OPSB 3KLEA 3CD0A 3ICLA 4QIWD 4ED0A 1R6VA 5E7OB 4U67Q 3IN5A 2DNKA 4JBCA 2NXNA 1IBCB 2K7KA 2J9CA 2XMUA 2CWXA 3G6VA 4NCAA 2KFNA 5LMNF 3V4IA 2YWGA 4NYZA 4DR7F 3PW4A 1VC6A 3DLBA 3I9ZA 1TUGB 5J2MB 2UUWA 1T9TA 3W62A 2AX0A 4DL7A 5GVQA 4J9QA 4DLGA 1QE1B 1OSCA 4OX6A 1NDLA 5F8LA 4C9DA 1DBDA 4LUBA 4NX9A 1YG0A 3EVOA 1TL5A 4A47A 4K4YA 4WFNQ 1L3KA 2APOA 3FFIA 3HI9A 2BQRA 5DG7A 1R8AA 2ZOFA 2CVIA 2MZ1A 4ZCMA 3K7RA 4CNZA 4KC5A 3OV7A 2C2EA 2BW7A 1AW0A 3PIPQ 2ZH7A 4IOCQ 4E8UA 3M6XA 1K8AT 2AT1B 1K44A 2VU5A 4KJIA 2GHWA 2NSCA 5KFDA 4ID5B 1UVJA 3KMQA 4E98A 2ZITA 3CNQP 5DJBA 4USJC 5A2QU 2AHOB 3AOCA 3QIPA 2RHSB 3MUVP 1RXOB 1U6BA 3ISND 2F4FA 1CQMA 3CIMA 2BYCA 4HHHA 4C6AA 1NK6A 2KXHA 1C0UA 2GMLA 1NHUA 1TAQA 3QYYA 4HH0A 4ZVPB 5HVGA 2V69A 4DV7F 4C11B 1OSDA 3TQEA 2R7RA 4OL8A 1LXJA 3R8YA 4O4GB 2UU9F 2UUBJ 4PEOA 5IXUA 2K06A 1FRJA 1NDPA 3UFCX 1N33J 2ZBQA 2MGZB 3KOAA 2XY7A 1AXQA 1PC5A 1U6FA 3GYNA 5CHCB 5LL6d 4JV0A 3KMSA 1OIAA 3RW6A 2YX4A 3W5YA 2ZD1B 2NLWA 2V2QA 3WIUA 3SBMA 3M32A 2QMUB 5EWEA 5J2PA 5SZTA 3TANA 1S7HA 1X60A 3NEKA 2CQ0A 3TX8A 2RQKA 3UCUP 2OPRA 4LRFA 2V67A 5A8KB 5DDPC 4GC7A 5HQLA 2BE2B 2HWHA 4DU7A 2DH8A 4WP8A 3KK1B 5D3GA 3D68A 3OXGA 1TKXA 1TKTB 1FDDA 1YK9A 2ABYA 1XNQJ 3CDUA 5H1SV 3U1MA 1I94J 1TVRA 2X7IA 3MM7A 2E5JA 2F8HA 2HZCA 4J5OA 3SIPB 5C7PA 1YWXA 2HS0A 2HS4A 2YX1A 1LOUA 4L75A 3MEDB 5FDLB 4O3OA 5KFSA 2C3OA 4U95A 2GA7A 5KOXA 5DM6Q 2BA9A 3OJSA 5FDLA 3MEDA 4MFBA 3MHYA 2Z2YB 3P8BB 2C3PA 5IT4A 1X4EA 1HA1A 3RBXA 4KY3A 4OHZA 2M7SA 3D7SB 3RAMA 1TKTA 1FDBA 2A2DA 4KH0B 3QBCA 1FCAA 4PUOB 1KHVA 2ILYA 4USKA 4RL1A 3U02A 2MXYA 3THVA 1TL1B 3OR2A 2BE2A 5F9NA 3OW2R 4NLQA 1RLDA 4P6QA 4RR5A 1B0PA 4FVMA 2VASA 5HVHA 2CPEA 2YQ1A 1HW8A 2YPYA 4O3QA 1FXRA 3I87A 3DOKB 3BYPA 1S0NA 3PY8A 2ZD1A 4DFJA 3CVKA 1OY9A 3FSIA 4JI4F 2YWWA 2LQBA 4W90B 3H4DA 4DV3J 4P74A 1JXLA 4XPCA 4A8YA 1J2VA 3PKYA 3CW2C 2QL7B 4IDKA 5HJYA 3MTJA 4IH7A 2GVDA 2GVDB 1S1WB 4C3LA 2CIMA 4IDKB 3DLJA 4EZ9A 4DLEA 3T9NA 3EZOA 1WI6A 2B7BB 3DU6A 3GWCA 3R2CJ 3IR6B 3Q83A 3ULHA 2YNIA 1M5VC 4P52A 4J90A 3M7VA 3J7YU 2AGQA 1F5BA 2HHHF 2Q66A 1RAEB 2XS5A 2RRBA 2MYFA 2B4PA 1LWCB 4DL0C 3PO4A 3QSIA 3F73A 2L41A 5HI7A 4LF9J 2XMMA 2W9BB 2Y1RI 3IO1A 3T6BA 3MPVA 3JXOA 2UUAF 4YOEA 5E3AA 2DHGA 1H7WA 3PR5B 1GQEA 1TL3B 3NP5A 1N5SA 1KTQA 3G2XA 4NLDA 4WFYA 3MOZA 2QA4S 4ER8A 4GKKJ 4QIVA 4ZPWR 4DR3J 3SFGA 4FVCA 3TOQA 2WRMA 3QWUA 5HQMA 3VAKA 1UEVA 1WC5A 3KDNA 2GO8A 4F3QA 3H40A 3BQ1A 4W98A 1GMWA 4KHPF 3OFFA 3BB5A 1D9FA 3DGPB 1XQIA 3HFKA 1QAJA 3HFZB 2FJEB 1QE1A 3RTVA 3T6JA 2YBVA 4TQSA 4Z2XA 2HMIB 2DNHA 1XTZA 3KLGA 1PJ7A 2GGPA 3N0VA 4LBHA 5KFTA 4X64J 2VONA 2BRLA 5D4PA 2DNPA 2YY3A 2XSFA 4K4SA 4KFBB 1SB6A 1RT4B 1OQ3A 2DBBA 3UDCA 4WP9A 4IH6A 3OL6A 2HBZB 4ECZA 1F2HA 4DWIA 4XK8C 3R97A 4QU6A 5A8KA 2EW9A 2MZTA 2OPRB 1FEHA 4HDGA 2BOPA 1H38A 3IWNC 3E8OA 3CCWA 4WYLA 4KGZB 1FDAA 2YNFB 4QWEA 1F60B 4K4TA 2H9ZA 3QFHA 5LXYA 4YFUA 2D3UA 2MY8A 3B4MA 1KS2A 1VBYA 1X4HA 2CRLA 2JDJA 2OSRA 4BWMA 3GV8B 1D8ZA 7FD1A 3WDOA 2UV8G 2DGVA 1VQ5S 1RTHA 1NSKL 2FHJD 4OHXA 5HL7Q 4AL7A 4BLGA 3V6KA 3V6DA 4DFMA 3FSYA 2OPQA 1VBZA 1HWJA 3P49B 1PBAA 4RZRA 1JLAA 2EI5A 2V6AA 3E3XA 4AXIA 4JI2F 4LF5J 2CA9A 3OT9A 2HBYB 2QT7A 3PTWA 4WU2A 1FKAF 1T9XA 2UXDF 3D1QA 2EC2A 2G4BA 4HHJA 1C0UB 1YDLA 1T05B 4WFXA 1WWHA 2W8LA 3TYTA 2CDQA 3AOAA 1YQHA 3G86A 4N8NA 1HQEB 2P9EA 2ATLA 4JYAF 4B9VA 2HHTA 3QIPB 3LAKA 4LQ9A 4ZHRA 2CPYA 3IM8A 1JNRB 3CJ3A 3BPSP 2AD9A 4DR6J 1HI1A 2G2YA 4Y2CA 2V2ZA 1VRTB 1D9AA 1ZBTA 5DO2A 4NYOA 2AYMA 4X62F 3K0JA 3BGLA 1O6XA 5F0WA 2PEBA 2IIHA 3FVYA 1NM2A 3QT6A 3I4HX 2FLNA 4K5SA 1T02A 2IMWP 1CC8A 5GMDA 1JK9B 3VZIA 4O4RA 4ELUA 1LW2A 4NLXA 1KLNA 1FERA 1JLBA 4DN9A 4K4WA 5HROB 1TU0B 2JC1A 1XBWA 2PE8A 4RNHA 3S6EA 3QRPA 3VVUA 3W65A 3N28A 2CZ9A 2DXEA 3NS5A 3MPUB 1D8YA 1HBNA 4JI7J 1RADB 4C8LA 3V4IB 4I6YA 4F26A 1PIEA 3OSNA 4LF6J 2E9TA 3HF5A 2B4VA 1CULB 5HO4A 1FWKA 4RWXA 3AH6A 1WTBA 1TK8A 3J7A1 1J27A 4M5JA 4NCGB 1OO0B 3QSYB 2OD6A 2DPJA 2UXDJ 3UO0A 2J7WA 1RHKB 3EPGA 2DGXA 1GXLA 3FGVA 2HVIA 4HT5A 4CLWA 2E7WA 2RNEA 4WE1A 1NHVA 4RNOA 4CDIA 1S97A 4J7CA 4LIRA 4PG8A 5KFNA 3OL8A 1HPZA 2K1RA 1HHQA 1T9VA 5K14A 2OFGX 3BGFA 5LM7E 4ANCA 2ZM6F 3PX4A 1QTMA 4NPOA 2RUSA 3BSCA 3K8WA 4CTAB 1NK7A 4BC7A 5C42B 4B3MJ 4FF2A 4MK7A 2RH3A 4PG7A 3D3BJ 4ILMA 4NYPA 3SFUA 1H2TZ 1SJFA 2ZJRQ 4DSEA 4X65J 3KDOA 5IM0A 1G4CA 2UZAA 3HO1A 2MKJA 1FNXH 4M63A 1T95A 4HH1A 2B56A 2UUCJ 1UVNA 1ZZFA 4M5IA 1APSA 1PG5B 4UZCA 2KKHA 3EZ5A 2W8KA 3RB4A 4UUXA 3ENQA 4PKDB 1K9MT 3CB4A 3DLGA 4I7FB 4KGVB 2XCPA 1K73T 2R7TA 3KG0A 5LJ3Y 4NL5A 3OR1B 3N5FA 1EQ0A 2ZHBA 4MKBA 3PYEA 2FPHX 5J1EA 1O51A 4USIA 4IG0B 1UL3A 3O1LA 5CYQA 3MDFA 4J9UE 5KT6A 4OMFG 2R42A 5KFWA 4CT9A 5B0BA 1ZH5A 2R3VA 2HNYB 2FJXA 1GAOA 3NOCA 5D4NA 4M5HA 4YY3J 4KBIA 3B82A 4RWWA 2DCUB 3CCSS 2MKSA 3G6YA 4ECRA 3MR2A 4QCLA 4DOZA 4B3TJ 1BQMA 3IWLA 3ZO7A 3UN5A 3AA9A 3J80U 1D0EA 3TO8A 4FNIA 1TQLA 3T5JA 4IG0A 2DNQA 1PYSB 2RKIA 2VUGA 2WVFA 2R8HA 4DV4J 2V4QA 4RW8A 3MMCA 3ZZOA 3QGPA 2Y1LB 3VZHA 3Q8RB 4PZVA 2C3YA 3DLGB 4I7FA 1NAQA 1RBLA 2ALYB 3I96A 3Q8VA 4L6V3 2VD3A 1HQ2A 1NUEA 1V3SA 2D1CA 4CWBA 2E9RX 2BJ8A 5KFZA 3PX6A 1FF2A 3BGUA 1X4CA 3RR8A 1QAIA 4ID8A 1B3TA 4MMOA 2HBQB 4WU3A 4C98A 4YDDB 4DV5F 2EG1A 4GO5X 1S0OA 4KT0C 5ETRA 4OQJA 3UNYA 1XMQF 1UVMA 2MQMA 5HP1A 4I2PB 1RP5A 2O01C 2ZH4A 1VK8A 3KNGA 1NJZA 5HMZA 1CS4B 3DNCA 1WC4A 2HEKA 3AJDA 4ZS6A 3GIRA 4ZVEA 4LFCJ 5K14B 3B6BA 3V4MA 3BKFA 1WC3A 4FYDA 2HGLA 2XYPB 4YEAA 3GIKA 3GFZA 2G1DA 1RWKB 4EU0A 3PRDA 4C3MA 1ULRA 1KQKA 3VVTA 1HBUA 2MY7A 5F8MA 2UUCF 1S12A 4GVBA 4NCBA 4DSIA 1XR6A 1VYAA 4A8FA 3SSRA 1ZTWA 1VOMA 2O66A 3O44A 5D0GA 4C97A 5I3QA 1CULA 2V2KA 3RAQA 1B7YB 2ACMA 2V8VA 5I3UB 2Q6BA 2DT9A 4ELVA 2QLXA 4KPYA 2IM2A 1NRKA 4G3IA 2C28A 2Z30B 3RB3A 3UQSA 2C3UA 5HROA 2YH0A 3QJLA 1U02A 1X5OA 2CNNB 4ZPBA 3AD8C 4P7VA 4IUFA 3UVJA 3OSPA 3SCKE 1JNZB 1FE0A 1R27B 2XI2A 3PYGA 4LR9A 1S48A 1Z2LA 1FE4A 1LWEA 3EXYA 4Q2LA 3SDEB 3EDQB 4FXDA 2O3DA 4IR9A 2G0IA 3MUMP 2M88A 3R1HA 3FUYA 4QR2A 2C2KB 3KK3A 3JS9A 4PABA 3AJ1A 4KB7A 1HI0P 5I42A 3MPYA 2W7PA 4IOAQ 2ZH3A 4JOUA 2KL8A 4NLGA 3OUYA 2BX6A 4LQ3A 2G2ZA 3M1VA 1REVA 1RACB 1RTZA 2WW8A 1DY3A 2AEJA 2ZOGA 3UPFA 1FDNA 5DGAA 3HKZD 4G65A 1SJ4P 4UT4A 1QVGR 4EBCA 3FCVA 4M5LA 4ZVHA 2HYIB 4IKAA 1U24A 4UY85 2A6OA 2DR6A 2EFNA 2BZ2A 1XC9A 4ES1A 2CPFA 5BR8J 4IFYB 3MFIA 4CLKA 3JAMY 1GX6A 3EXCX 1B70B 3R3TA 5IOLA 3T1HF 3P6YC 5C25A 1WF2A 2OFHX 4F4AA 2PA3A 4A8KA 4GC6A 1Q78A 1B0TA 2UUBF 4GKJJ 2LEBA 5F8JA 2XY5A 3ZTQA 4ZOSA 3H25A 2Q6CA 2BACA 3TUJC 3J7ZT 2OD4A 1RTHB 2ZFHA 5A8WA 1BQNB 2X1GA 3H5UA 5M2UA 4DPXA 3HD2A 1ZM9A 2AV5A 1YZ6A 2BEFA 2FZCB 4BDPA 4C8OA 1UAWA 1C4CA 1X4GA 2R2UA 1PYOB 1TP7A 3I9V9 4ECWA 3E01A 1RAIB 2AU0A 3KLFA 2VFVA 2Z4PA 3NOGA 3ZZPA 3BKTA 1PJ6A 2DNZA 4RUCA 4IR1A 2QTWA 4Y28C 5KG2A 4OX7A 3MCOA 5IZHA 4PXBA 1HMVB 3DI6B 3UCGA 2C42A 4X66F 2B7CB 3RGIA 5L39A 4A8WA 3AFGA 2PT0A 3DHXA 4P72A 1J5EJ 5C24A 2MQPA 3OLAA 1M5PC 2JEJA 2D7SA 4AXJA 3TZYA 2IVMA 4KFBA 3GE9A 3N4WA 1IR0A 4JI0F 4KV8B 3IGNA 3W9IA 2XM3A 3BQ0A 5CXTA 3RUBL 3BBFA 4V19J 2YKAA 4LFAF 4R0EA 2VQEF 3NNHA 2DXDA 3DFEA 3CJ8A 2ASYA 2M70A 3BSNA 3LGMA 2XSJA 2J6SA 2HMIA 2B8PA 2RF2B 5CYMB 1WUUA 1XJWB 3G82A 4L3NA 4MKAA 3HSGA 3PRVA 1JMTA 4CO5A 3DGPA 3SSQA 3CCQS 5DZ6A 3D0HE 4DF4A 3DDKA 3EICA 3ZNJ1 4U7CA 1NK8A 2X51A 3MAHA 3NWGA 2CJAA 4F50A 3RJMB 4PQAA 1R8BA 1PKUA 2PFDA 5GAEU 2DB1A 3IAM9 4G1IA 3P3DA 4CYUA 1M0SA 3L4BC 2RS2A 2XY6A 4M8LA 2ZNZA 1IXKA 1J5EF 4Y65A 4LF7F 1VI7A 1W7WA 5B0GA 2CNOB 2HHWA 1NDKA 1DQ8A 1TMMA 2PIIA 4HTJA 4L76A 2RDDA 4A8QA 1OWXA 2XG8A 2XC9A 2BV3A 3R5GA 3PHEA 4Q8FA 3HHDA 4FNHA 4NA2A 3CPWR 4NLPA 4ZCIA 4ELTA 1WEYA 3F44A 2JC0A 1T94A 3LH2S 1UEKA 4TXSA 4CT8A 3JTPA 1YJVA 3H7HB 2MQQA 3H98A 2IA0A 5I3PA 3FEYB 2F4VJ 2H5JB 4K4XA 1IBLJ 1KQGB 2CJ9A 3IRXB 1Q86T 2ZC4A 3C66A 4OJ3A 3NBPA 2HNDA 4DUZJ 1CG2A 3HT0A 2M3DA 5LSRA 2RMLA 1YX2A 3E51A 3I31A 3GJTB 3L09A 3W63A 1JXVA 4F67A 2GCFA 4LREA 1FK9B 1OY8A 2W4CA 2UUAJ 3C14A 3M30A 3DOKA 2LXFA 3KJQB 1Y5NB 1YJWS 1MWQA 5JVHQ 2MKCA 3L7OA 1HNXF 1BGXT 3CUNA 3G8SA 3NGSA 1RTIA 3R6LB 2K3IA 2YKMA 2WZ1A 3QO9A 3VQSA 3OR2B 3BM7A 3VAJA 5KAKA 3LGNA 4PUOA 3RRHA 1KTVA 4LRBA 2IBKA 3W61A 3PO5A 3OVSA 2ZBCA 3C15B 2KI2A 1EP4B 2H51B 6FD1A 3GIMA 3D6TB 3ADAC 3CTRA 3M8WA 1K0VA 1S9EA 4R5PA 3WX8A 4AQYJ 2GZOA 1Q8LA 1YBAA 2F40A 3UWTA 3VQTA 3MWBA 1HQUB 4F7VA 4YR3A 4MFBB 3RZAA 2R4FA 3IM9A 5ETSA 1N5TA 4G1QA 2GVZB 4F04B 2HHXA 1JLFB 2IJRA 1EQMA 2JX2A 2JWNA 5KG4A 3MM7B 4F4XA 1TVRB 2B0GA 1KLMB 3NGKA 3J81Y 4J9KA 3NNAA 4C2MA 4IO1A 3DHWC 4LMZA 1SKRA 1R0CB 1CJVB 3R5AA 1SJQA 4QZVB 1E6VA 4ZP6A 1TKXB 1JLQB 5KFPA 2QFJA 2UP1A 5D3GB 2C3MA 2OGUA 2QV6A 4AE5A 3KK1A 5GAGU 1YJ9S 1B0VA 4LF4J 2HQ3A 2ZHOA 1F3VA 2ZVIA 3QLHA 2A1BA 1VQ7S 3N9UC 3CXCR 2IA6A 3PJXA 3TJ9A 2PMZD 1FD8A 2BKPA 3FCWA 1MN7A 3M9MB 1UA0A 4NXMF 3H20A 5J2PB 4I6AA 4CIOA 1C1CB 4RUAA 4YQWA 3CCES 4EYHB 1M90T 1R0AB 5AJ3F 4NLSA 4C4WA 3CSKA 1BY9A 2DHHA 2LU1A 2RS8A 4EMDA 2DO4A 1HNWF 1VHIA 4DI6A 5JVGQ 1B64A 3O3LA 3BR9A 1PGZA 2MGZA 3QIDA 3OTOF 3H5SA 4K2XA 2XYHB 1F2GA 1IM4A 1I94F 3TA1A 1M1HA 1RHUB 4OHVA 2ZZNA 2WVBA 1REGX 2V94A 2X3DA 3M2RA 3P45B 5KFAA 4C0OC 2FLLA 5F3ZA 2EFQA 4NI2B 3MAQA 2NYHA 1Q8IA 4H54A 4C11A 4TU7A 3DRPB 5HLFB 1F1BB 1F3FA 2FTRA 2O1PA 1VRUB 4RW9A 3V6JA 1OYDA 3D2WA 2V8GA 3CDBA 1HL6A 4KKOB 2YQ3A 3NS7B 3TW0A 1IJEB 3NCRA 4C48A 5AXNA 1UFWA 3PIOQ 3MR3A 1U1QA 1HNXJ 4LF1A 2HBRB 3PXGa 4DQQA 2J9DE 2IRYA 3GONA 1VQNS 1RK8A 4DV4F 2LKZA 3KLHB 2VICA 3KHGA 2N4DA 3I0SB 2Y8WA 3D28A 2RE1A 5DDOC 1IQTA 2H54B 1VLYA 2GS8A 2RQMA 4NE9C 3U1LA 4QWDA 3QGGA 4LR7A 1N33F 3G87A 2NXCA 2PEHA 3M05A 4O3NA 1X5TA 3W5XA 5DLGA 1QSSA 2PI4A 4B9NA 1GMWD 2WBRA 3N5BA 1IBLF 1JXEA 5D4LA 1PJ5A 3H59A 3QNWB 2XTJP 4DSFA 1XMBA 2Q43A 1NEEA 1RYRA 2AYGA 4JI3F 3CIZA 1HNIA 2PA8D 1IWGA 1VR6A 3ZC4A 4DX7A 3ZZ0A 3WZ0A 2HS3A 4NLTA 4QPXA 4RBUA 1RWNB 1F0XA 1T9WA 2C2ZB 2KFZA 2MKYA 1CJUA 2ZVSA 3CD5A 3M2UA 1ELOA 1YSJA 2XEXA 3IS9A 2HRYA 5J1PA 4HLBA 4ZLLA 4F25A 3POTA 1M1GA 4PWUA 1X7VA 3CDEA 1CJKA 1UCNA 1XN9A 3W66A 1JLCA 2VQFF 3G8QA 3FBCA 5CABA 1TR0A 2ZUGA 4Q5VA 3NGTA 4O23A 2G2OA 3VV2B 4NZ0A 4DSJA 2FJVA 2EC0A 1HD1A 1FRXA 1U8SA 4J9SA 2DRBA 2VJUA 2DNLA 4BCAA 3N6MA 3HVTA 1BMQB 2RDIA 1U1NA 1LK5A 2DGUA 3OBIA 2R7QA 1FFSB 3GQCA 1HBMA 2MHNA 1ZAWA 1SC1B 1AYEA 1MNEA 4LFAJ 1VBKA 4OZ0A 4B3RJ 1FJEB 3MXHP 2LQ8A 4B3RF 2B4OA 2HFNA 2NUUG 5KG1A 2HAFA 3DRSA 4AT1B 2QSFA 4JI5F 4K50A 3PM9A 1RBOB 2AJ4A 4I2QB 2AEFA 2IPOB 3IG1A 4X66J 2YKQA 4P71A 5KFCA 5K5MA 3IXQA 4R0JA 4N47A 2V8DA 1VRQC 3D6FB 1Z2ZA 4MKVA 2VG5A 5IWAF 2ZE2B 3PX0A 1N6QA 1QAYA 1R8HA 1WEZA 1JLEA 2Q3PA 4I0WA 1UPMB 5EX0A 4NA3A 3U1NA 2ADBA 4JI7F 5ITHA 5KT2A 3I5BA 1F9EB 2W2NP 1R3NA 2MQ8A 5J2QB 1EKSA 2VQFJ 3RB6A 1JJHA 3CC7S 4JP8A 1N32F 1R0BG 4M94A 1VCTA 3IR7B 4MJKA 4N41A 1RABB 2DR9A 2FHOB 1RT3A 3C2PA 2G9OA 3QT7A 2VA3A 5B0EA 3JSMB 5KFVA 1K0TA 1YITS 2IC3A 1U47A 3B4DA 1TV6B 4NXNF 1S76D 2R7XA 4BC9A 4QR1A 2RRAA 1Q1KA 3FCHA 2YKNB 1FKOA 1HYSB 1HBOA 2ZBRA 3EVWA 3IC1A 4I56A 2N7YA 3CJKA 3HZEA 2GW8A 4WKRA 2EKYA 1I51B 4Y6IA 4DDFA 4DPTA 4ED1A 3PKMA 3PYFA 2QLFB 1Y5IB 4KGMA 4C0HA 3LP1B 3G96A 3QFWA 4DPYA 2I5JA 5KT3A 1RAAB 2FVQA 1N54B 2VG6A 1AT1B 2R7VA 2DY1A 1R31A 1FNMA 1S1VB 2CPIA 3BREA 2RT3A 1XEZA 4HEA9 4YR0A 4JI2J 1QDUB 4LF5F 3NNCA 4ITSA 3MM5A 2LXIA 4OX9F 1MU2A 3CCJS 2KHDA 1ZZNA 2IRUA 4BHQA 2CXEA 3Q86A 5CD4H 4RNMA 4WIQA 3KLVA 3S1TA 4DU8A 1FVSA 5BYQA 4DSKA 1DTTA 1S1UB 4CNYA 4J9NA 2A18A 4NMLA 1FESA 4I67A 2KJWA 3TAPA 1IBKJ 4FPRA 2Y0BB 5H9FK 1EX8A 2YWKA 2Z2LA 2UVVA 3NCPA 1SH3A 1TK5A 3BSOA 1W2IA 2I0XA 3EZUA 1E6YA 3DOLA 4USHA 2NR0A 1HNVB 5B0DA 3BBBA 1ZOTA 3KLIA 1VISA 3ILLA 1FEEA 3WC2A 2XQCA 3ENAA 2J0XA 4BS2A 3LQVA 3GG0A 2E1PA 3LP0A 4PXDA 2WOMB 4YB5A 2R9LA 3GSIA 2GQQA 3ONQA 4MK8A 1KQFB 3CJ4A 2YWEA 2PD1A 3OTBA 5KTQA 1U4BA 2DEJA 3SSSA 2HVZA 3CD6S 2IRXA 3T1YJ 3Q22A 2Z8QA 3IAS9 2WONB 3HSDA 4X64F 1U1KA 3W2VA 1PAEX 4IQXA 2FLOA 1WC6A 1JWWA 2DRDA 1U2CA 4TU8A 3CJTA 1U1MA 4RW7A 1URRA 3JAMU 4LF4F 2XWXA 4MAKA 1NH7A 3QT8A 2BM0A 3KUGA 2XB2D 4ANEA 4Q43A 1KDNA 2YTCA 2BVZA 1U0HB 3FDSA 1QUVA 2J76E 3BGOP 4M5GA 3HM9A 1DFDA 3KWMA 1GTEA 2QSWA 5KT4A 2U1AA 5D4OA 4TY8B 5JMNA 1QJHA 1R8CA 1Y3KA 4PCQA 1RKJA 1YVFA 3CO9A 4NLVA 4RNFA 2JFDA 5E3QA 1VIOA 2A10A 1CLFA 1IBKF 3C16B 5U47A 1HHTP 1UZDA 3KYLA 1NPRA 2CG8A 2EFPA 3HHLC 2DGTA 2V34A 2VIHA 4J9RA 1O5JA 2B6AA 2F7VA 3P96A 2DIVA 2OSQA 2E5LF 4DR2J 4F36A 3MOJB 1LKZA 4HHUA 3CMAS 2OEKA 1ZS6A 5CZXA 5AE1A 4F4YA 2HHHJ 3BJYA 3D5MA 4TQRA 2WB4A 2X1FA 4RO0A 1P6TA 1NB7A 1RLCL 2ATCB 3MURP 3UD4P 3W5ZA 1R8PA 3OTDA 2BANB 5MLCV 4QIEA 2OEMA 2VBWA 4W4MA 4V1Ak 5B0FA 5HMXA 5IFMA 4QPTA 2DIUA 4PYAA 4ECYA 1NNDA 3SQGA 1NB2A 4H4MB 2HFOA 3UDEA 5J1NA 3SZ2A 3DOMB 4OI2A 4ICLA 2WHOA 4ENOA 4R25A 5L1JA 4LSNB 3HSJA 2KT2A 3PCOB 5AXMA 2DO0A 3G6ES 1TL7B 1S57A 2ZNYA 4NEZA 2ZWOA 2DITA 4WK1A 3HCXA 2YNHA 2XMTA 3FZ2A 3T9ZA 5A8RB 5KT5A 1I1GA 1MN9A 3TP2A 5GMKa 3NAIA 3PEJA 3BEGB 5CD4A 4M95A 1RAHB 4BWJA 1FJ7A 4ED6A 3KUEA 3MR5A 4X4OA 2W4PA 2XMKA 3W2WB 2L3MA 2HLTA 4OI4A 2ZZMA 1WD6A 4L72B 4RUHA 1GT8A 3MMAA 2XNQA 1SC3B 2EFOA 3D6MB 1YZ7A 1WF0A 3TUIC 4TLRA 3TZZA 4QOTA 4TYBA 1NO8A 1SQGA 2OEJA 2RIJA 4KIAA 4Y2IA 1L3UA 2HHSA 2LDIA 2KT5A 3OTCA 1NLKL 2I38A 2MDAA 2N7CA 1UVKA 1PILA 3HHKA 4B3MF 1RWXB 3MM6B 1HARA 2VBYA 1HFEL 4DL4A 3BH6B 5BR8F 4MYUA 3EGWB 2EG2A 3L95X 4ZVGA 4JI5J 4BBYA 1FJGJ 2EBEA 2F63A 2IFXA 4NOHA 3CCLS 4UY8T 2GIFA 4DUTA 1XNQF 2QG9B 3R7SB 2IAJA 1M5HA 5F8GA 2IVYA 1CJTA 3TAMA 3I0RB 4B9TA 4RKUC 2CUYA 2VL1A 1LW0A 2CVEA 3KJNB 4DCPB 3KFWX 5L38A 4HDHA 4B17A 5T14A 4O0IA 4ZLPA 2M8HA 3R1LA 2XLKA 4ZIVA 1S6QA 3L7PA 5BYRA 3X3UA 4K5RA 2DR7A 2VG7A 2VFRA 5KFOA 5H9EJ 2O5DA 1ICEB 2IJFA 1U48A 1RTJB 1IBMJ 4GO7X 4U7UD 1IM6A 1XMOJ 4WKYA 1MROA 7AT1B 5L1IA 1H73A 4JI0J 4YDXA 2DH9A 4G6VB 2DR5A 2XULA 3GP9A 2OLWA 4C0BA 4FXWA 1UEUA 1AA1B 2FVPA 2CJXB 2LQ5A 3DDNA 3OPKA 4AL6A 4PQUB 1W26A 1Q82T 1WG1A 3NMAA 1N4LA 1G1XA 2CFXA 2LDYA 3SXLA 5DG8A 4OLPA 3A1YG 1UPPA 1P9QC 4XO0A 4G1PA 2FGCA 5F0UA 4CP5A 1GMVA 3J7Z5 3DRRA 2MQLA 3HD1A 3FKBA 2ZEJA 4ZVSB 2BJ7A 1AZSA 2KU7A 3BV8A 3ET6A 3HVAA 3D54A 2HG4A 5E0OA 4F3OA 3S7RA 2HK3A 4JI3J 2DHAA 5ETMA 1C1BB 1NBEB 3H0PA 3HHLA 2J7UA 2HWIA 4RNNA 5A0YA 1NMEB 2XI3A 2MLXA 3IMQJ 3M8RA 1CVJA 4IQMA 1BXNA 4PWDA 5A6WA 1C4AA 3Q8PB 1VQOS 2HQGA 4WWSA 3TEHB 2NXUA 2CJQA 3OVAA 3T1HJ 3C19A 1KFSA 2F1FA 3CCTA 2BOAA 3PV8A 4OJGA 1GNKA 3TJAA 3AHPA 1JKHB 4X62J 3MR6A 4W92B 1MWZA 4OZ2A 1C1BA 4CLSA 2H48B 3QRRA 1Q95G 2V50A 1VJWA 1IBMF 1FKPA 3GIJA 2L08A 3ELHA 1OPIA 3R6GB 5A76A 3ET6B 5KFJA 3ZZUA 4YUDA 2DHXA 5DGBA 4DFPA 3MF5A 1D9DA 3R27A 2G0CA 4WTYA 2P6SA 3ZNUA 5M2RA 2XNRA 4TKTA 2N82B 4Q0BB 1WDDA 1YRXA 4MT1A 4TNOA 3RBZA 1Q5VA 2JH3A 2PO4A 4KRWA 3OHBA 2BQUA 1WC0A 4PQUA 3OFGA 3W1YC 4DSLA 4UOFA 3D67A 3WC0A 3M8SA 3TVYA 3Q2TC 3F0NA 4HACA 3BBCA 1RT1A 4QYRA 4ERDA 2ZH8A 3T3FA 3KK2B 2QE5A 3MECA 3QZ8A 1CQNA 3H2UB 1KRPA 2BDPA 5AJ3J 2YWHA 3BO3A 1RTJA 3N6NA 5KG5A 2W9CA 3BZQA 2I2YA 1SKUB 1SC6A 4M5DB 3CE8A 5A6PA 1KBRA 2W01A 1LW0B 1UWAA 4USMA 1BUXA 3I0RA 1U6ZA 3AODA 4NLOA 3MCNA 3Q8UA 3PYDA 4DL3A 4KHPJ 2EK1A 1GH8A 3F56A 2MZJA 3CJ2A 1Y0HA 3HHLD 1SKSA 3G8TA 3EGVA 3NGRA 4E0DA 4UW2A 4EO6A 1RT5B 3NWRA 4OFZA 2IM1A 3MAAB 2B4UA 2XS2A 4GKKF 5ETNA 3ZTRA 2OO4A 4LBPA 4LFCF 1PO6A 3R5JB 3IP0A 3LP2B 3Q8YA 1IKXA 1SCJB 1WKJA 1RWVB 4U6PA 2AGPA 5DG9A 5C2GA 2P5VA 4IO9Q 2C2MB 2LYVA 2HNZB 3DMJB 3MEEA 4DG1B 2XZDB 2XMVA 2HZAA 5HMWA 3OLBA 3T19A 1X5PA 2NYIA 3PRBA 4OI1A 5KFFA 1SXLA 2NPFA 1PAUB 1H7XA 3J81U 3A8IA 5THWA 2ZDPA 4CO1A 4DX6A 5C5JA 4DL6A 4EBDA 1RTDA 3B8HA 1TELA 2ZBPA 2ROGA 2H5IB 4IH5A 2CQHA 3M6VA 4LIWA 2ILZA 2H1YA 2MHEA 3LO3A 2L9NA 3NY0A 3VHQA 2GJ2A 2X3GA 3J81j 1KKHA 1ZAXA 1TL7A 4KTQA 2OI2A 2ASDA 3K5PA 1Y00A 4RUBA 4ZPAA 1GMUA 3RG6A 5L9XA 2KDOA 2XGQA 1KNZA 4HT7A 2MKHA 4PYDA 2C1EB 4ZCKA 5K9FA 1BD6A 2RAQA 3UNGC 4D3GA 2J8AA 2ZH5A 3PG9A 1NK0A 4O44A 3MMBB 2CG4A 3CULA 3C8YA 3GMGA 5K8OA 3TR5A 1RU2A 3TX0A 2F4VF 5K8NA 2P8IA 2ADCA 2M4MA 4YY3F 2ASJA 3QT5A 1SJRA 3MUTP 3ITHA 3R9LA 2V4JB 5EDWA 5FIIA 4KQZA 2FY1A 1S6PB 2VB6A 4N56A 2BE9B 2L9WA 4ES2A 2FJWA 5GADI 3DRXA 1YKWA 1UKUA 1P1TA 1WEXA 1SIZA 2K2PA 2QYCA 2ZBIA 1IN0A 4OZNA 2M2BA 4DCOB 4F0KA 4U8VA 3EYZA 2WTFA 1S1XA 4U96A 5G0RB 4HTIA 1UFKA 2VPWB 3IRWP 5KFXA 1T9YA 4ILLA 1LWFA 1BE4A 1S9GB 3M8QB 2MZQA 1RT6B 3CJSA 4JI6F 1RT7A 4H4OA 3KJVA 3TZWA 2DNMA 5K8MA 2AGOA 1QD1A 1BC6A 3LWLA 1N5QA 1H3DA 1ZAVA 1NK9A 3W64A 2RSQA 1UWBB 3LPEA 2WK4A 1WORA 4MIBA 9RUBA 3BN7A 4FDFA 3MM8A 1H2UX 1SVDA 4OYPA 4A48A 2R8IA 2BJ1A 1S1TA 3VAHA 2OIHA 4FF3A 3KNAA 3A8KA 3M2VA 1MLAA 4RW6B 3ILOA 4J91A 1DLOA 3PJ9A 4I6WA 3JSRA 4ZP8A 1G6BA 1TTHB 2WONA 2CJBA 2J9EA 1C0TB 1DTQB 5IV4A 5EWFA 3C6UA 1FNOA 1VQKS 5D0EA 2HURA 1DRZA 3HFVA 5E5NA 3FSXA 4OIXA 3QZ7A 5F8NA 5D78A 1H74A 4QW8A 3CJQA 3M8ZA 3BF4A 2JSXA 1KVJA 1U0SA 3RW7A 5DQIA 3G4SS 4KYZA 5FLXU 3RRGA 4R8UB 2OPPA 2F9JA 5KT7A 4UOGA 4K4ZA 2E1AA 1N48A 1I6JA 1V5VA 5LJ5Y 2FQQB 2MQNA 4IOBA 3TNVA 3K57A 4LF6F 2HHQA 2VPXB 1JQGA 5HBMA 1A7GE 5AXLA 3UDLA 2ROPA 4EBEA 1UTAA 4Q7AA 3DYAB 2G13A 3CMES 4NMXA 2R2RA 1NJWA 2HHVA 3GV7B 1U25A 5L8RC 3D1OA 4DEZA 4USWA 3HXMA 3TUPA 1DTTB 1S1UA 3MEGA 4RW4A 1UMJA 2AJ2A 2DKOB 4HL9A 5B09A 1W25A 2HVDA 1N5YA 5KFKA 4WCEQ 4EFAC 2ZH2A 4YB1P 1MU2B 1YJUA 3DRYA 3H8YA 1IKYB 1HWIA 2QL5B 4USVA 1FTCA 3PW7A 1ZM2A 4WZMA 3DM2B 3HP6A 3ETOA 1S59A 3MM9B 2J6UA 2IJNA 4HYKA 3DLEA 2Y0SD 2DR8A 5DM7Q 5AE2A 3C6TA 4NLRA 3LP1A 2Q1LA 2QO3A 2PDAA 4P75A 1VMBA 5ETKA 3R7BB 2EWHA 3L3CA 4JYAJ 1HWLA 2QLBB 4CLFA 4TLQA 1R89A 1WDTA 1HYSA 1HBOB 1XWLA 4WTOB 4J9OA 3CC4S 2YKNA 2V68A 2CPXA 3Q0AA 2FLPA 1U1LA 2ZKTA 2V4RA 2FJAB 2IC3B 3OXLA 3OTEA 3JYTA 4KO0B 1NSPA 3QGIA 1TFWA 2XS7A 1B7FA 5LMNJ 1VQ4S 4EK2A 4MKYA 3BO4A 3GG1A 2C2NA 3FZBA 2OH2A 2OPPB 4LSZB 5MAOA 2F8MA 3QAUA 1T8EA 2VOOA 1F9FA 5J2QA 1Z1ZA 3Q8QB 3HT3A 1QAXA 1RDRA 5E3PA 1OY6A 1YJNS 2RQ4A 1FRMA 4IG3A 1EKRA 3D6HB 1Q4RA 1T0TV 4IG3B 1VIXA 1N6QB 1I5OB 1DTQA 1KVKA 4K7QA 3QPIA 1VJQA 3TA2A 1JLGB 1QTNB 1DARA 4MH8A 3Q89A 3SV4A 1SL2A 1F5CA 2E7XA 2BMBA 1RAJA 4DUYJ 2H4WB 3PNIA 3E2EA 3OFEA 5DDQC 1WG5A 1RCXB 3GFXA 3PDNA 4A4JA 1HR0J 3FBBA 2EEYA 1WSRA 2AWZA 3HKWA 4C8NA 5KFRA 3UW1A 1VQMS 1XIQA 1UWBA 2FC8A 3JTOA 4KO0A 3H2VE 3MTKA 4GVLA 4DN0A 5D6GA 1N5VA 3FRYA 3K59A 1TK0A 2DH7A 2OJ3A 1NZ8A 3H5XA 1YI2S 4DMZA 1S5ZA 1RT6A 3QJJA 2DXFA 2FHKA 1D1UA 1GK8A 1LWFB 2KRBA 4I68A 5T7LA 2XMAA 4JI8J 2A2CA 3A3OB 8AT1B 3KHLA 1V3ZA 3T1AA 3KHHA 2JVOA 1URNA 1R43A 4TU9A 3UD3P 4B3SF 1S49A 1T11A 1OQ6A 4ZVUB 1OS5A 4CH0S 1ZETA 4ECVA 1WG4A 4DV0J 2FJDB 2K7JA 2V4JA 1VFJA 1Q53A 3MM9A 2FZGB 3DM2A 3ITHB 3DKDA 3DXBA 1MWYA 1DJ0A 2Z0GA 2FC9A 3POTB 5DRKA 5GAGI 1IKYA 4XAKA 1X9WA 4O3RA 3QJPA 5EN1A 2FB0A 5BXIA 1G7CB 4FN5A 5E33A 5ADZA 2QFIA 3IS9B 2OMOA 2EVZA 1RA7A 3QQCD 1TMJA 4RPFA 4I69A 2E5LJ 1N5YB 4K4VA 3DC2A 1EZZB 4ZDNA 3MEGB 4RW4B 3VGSA 2J6TA 4EYIB 4L74A 4B3OB 3V2UC 2M52A 4Z7YA 4ECSA 3MMJA 2DEIA 1NKBA 3DYAA 2JJ4D 1Y4ZB 2ZWPA 4LRCA 5GAEI 1SQFA 5A2QY 1N34F 5HBMB 4YHHJ 1GEHA 4OYZA 1A9NB 1GX5A 3DXSX 3H2LA 3A8JA 2LEPA 2HRTA 2AJQA 2M5YA 4DPOA 5LSLA 4YB7A 1CBKA 4R8UA 2B9EA 4CO0A 3OTOJ 3FMBA 2JLFA 4DV2J 3D3CJ 1TKZB 1V6HA 2I9SA 4AFFA 5K20B 3TAQA 3EE3A 4WXOA 4DG1A 2HNZA 3DMJA 3MEEB 3SMZA 1U09A 1FVQA 1Y10A 1ZA1B 3C6UB 2FUG9 3KKFA 4WYWA 4B9MA 4NXMJ 2CKWA 1TZ0A 3ZZTA 3LP2A 4KAIA 1IR2A 4Y2KA 2CNLB 2VDHA 4OYAA 2ASLA 1DLOB 4J9LA 2LA4A 2DNYA 3CMQA 3MAAA 4RW6A 1RT5A 1IKVB 1RHRB 2ZC3A 4NI2A 3RR7A 4GMKA 2QLJB 4DS4A 2P9CA 4NLWA 2R7SA 4F3MA 1HIYA 3W9HA 3K17A 1FA0A 2DNRA 2FD2A 3LA0A 2DYAA 3AB2B 4B02A 1KSPA 1SUQB 4IRCA 2NZ4A 1M5SA 4M5DA 1S4FA 3R5CA 1RSCA 2ZM6J 5E2QA 1KR4A 1RWUA 5G0RA 1S1XB 4C7QA 2BKNA 4ZJQA 3PZPA 4AQYF 1C1CA 1SV5A 3BGRA 2CNKB 2H4YB 3SI8A 2X1AA 2JRSA 3KK2A 2XLIA 5C2CA 5KFHA 3K5NA 4DPUA 3MCSA 4AUKA 1XR7A 4HI2A 2GV1A 4FF1A 2GMHA 3D0GE 5IC6B 1JLQA 2XGPA 3I5CA 3Q8SB 4OI0A 1FFWB 2DGOA 2HGNA 1FX2A 2BRKA 3D66A 1CJVA 3GR1A 1M1KT 1UJ5A 3U7JA 2OP5A 4CI0B 1S6OA 4P7TA 2BKOA 2UV8A 3NS6A 1KLMA 3SCLE 2Y1IA 2CQ3A 4O44B 5AT1B 3KJFB 1T03B 4U7UK 4GRSA 4I1TA 1YRUA 4CLPA 5DQGA 2HQDA 3EJMA 2U2FA 1VC0A 3O5TB 4OYIA 1CC7A 5H9EK 3AXMA 3IA0A 3V81A 2RUGA 4R5PB 1S9EB 2D9OA 2I1RA 4IFVA 1XERA 2LEAA 5D15A 2K3KA 4WFZA 1JKHA 4WXWA 2J5AA 2IM3A 3BR8A 3I55S 1RTDB 4M5MA 4RBVA 3SCIE 4C8MA 1K47A 1RWOB 3LPYA 3QO9B 2HSEB 2C2OB 2CJYB 4L73A 5B0CA 1YTYA 1RQ0A 2L48A 4PWDB 2HIQA 4X4SA 2FZKB 1SKWA 2PC6A 1YJTA 5L9NA 3BQ2A 5L1LA 2PI5A 1YBTA 2VF3A 1JJ4A 1S99A 3M30B 1U45A 4KH1B 2B5JA 4IYQA 2CYYA 1IKXB 2H5EA 1AZSB 1TUWA 2HFZA 4CO4A 4CH1A 2Z58B 2V9WA 2MJNA 3OHAA 2VH7A 2DCLA 5LMUF 1VQ8S 1XNRF 3ZTPA 1OJ4A 3LW5C 1WKKA 3JQJA 1X4AA 1SL0A 2HNDB 3NBPB 3P5BP 4ECXA 2MTLA 3IRXA 2WAQD 4P2FA 4ECQA 2CDRB 1YLXA 4HR2A 3ILJA 1NK4A 3NGDA 2ROEA 1Y7PA 3M8PB 2CQ1A 1P9YA 2RD5C 3JSYA 2YKOA 3LOUA 4I64A 3CCVS 4JV5F 1TL4A 1VK3A 3I32A 1X31C 4DV0F 1OMSA 3K5OA 2VPZB 2MLZA 3CO0P 2V0NA 4N7TA 1EB0A 1KP6A 4FZVA 1IKWA 4OZ1A 4URSA 3UN2A 2W9CB 2UXBF 2VQEJ 1I3OB 2R2SA 2C22A 4DR7J 1IKWB 4F0HA 2KYZA 3HHEA 1WHVA 1WTFA 1BLUA 3MECB 2HQCA 4ED7A 3CCZA 4FYXB 3Q24A 4QU7A 3BDEA 2F9DA 2D9PA 2D69A 3GPAA 1RT1B 2ZJPQ 4XTTA 4ZP9A 3KUHA 3I6PA 1LV5A 3M8PA 3J80Y 2DHSA 4CYUB 2IAJB 5EUHA 3THPA 3CCMS 3R2DJ 1AFJA 3AD7C 3O2IA 3LANA 2RJZA 4PXCA 2VJVA 3V5RA 2GAHC 4DQSA 4ECTA 2QEXS 2BR0A 2CQDA 3HMJG 4ECUA 4Y0FA 4DV1F 1HR0F 2PFFB 2A3JA 2DPIA 4DUYF 1RE1B 2HFSA 2IDLA 3LUYA 3M8YA 4X84A 3NGUA 2EBGA 2F8EX 4Z37A 3GFHA 2XSJB 3BO2A 4Q8EA 2B9YA 4ZN3A 1WNEA 2AX1A 2JFKA 2B5JB 5IQQA 2UUTA 4CZCA 1LFPA 3D9BA 5B7WA 1L3VA 4X4NA 2F5GA 3AA8A 3W60A 1QLNA 4QYZJ 2ACYA 4FYVB 1Q8BA 5HSPA 2WSCC 1RA6A 4GKJF 4ZIWA 5IV3A 1M5KC 2SXLA 2ZOMA 3TUZC 3HPOA 4DR3F 2CWKA 4URQU 3NMRA 2CPDA 2J0QD 3GSDA 3W2WA 4S0MA 4DV6F 1TKDA 2R2TA 4JV5J 2BM1A 3QGHA 3PJWA 4ZJLA 4QW9A 2KT3A 2Q79A 1YRTA 2J7KA 5A0YB 4IFVB 1YIJS 2YNHB 1NPKA 5F9LA 2AQ4A 3V81B 3JQKA 4KHRA 2ZDOA 1G3OA 2KG0A 3LWMA 2OTJS 1RWPB 4N77A 3MGJA 2W2OP 3LTOA 3BKUA 3DRRB 3PHTA 4UF4A 1BQNA 2W2PP 5A8WB 1T03A 2VBXA 4CLLA 2BXJA 2DVIA 1ZM4A 4DR5F 3NG8A 4PG4A 3SQGB 4FPIA 1NZAA 3A3PB 2R8GA 2B3TB 3MFHA 3SYZA 3SCJE 4Q45A 3Q23A 1SC4B 4OV1A 3HVRA 5C25B 1RHMB 2AMCB 4Z7CA 4NA1A 1RZMA 2Y9HA 2NS1B 3S01A 3M6UA 1T7PA 3ZZRA 2Y1JA 1ZYQA 5KFQA 2J0WA 3G6XA 4C3KA 4XDDA 4WF9Q 2P2CB 4AD6A 1MROB 1RAFB 4DR4J 4KE5A 4MIWA 3BGRB 2VFUA 1SV5B 1DURA 2HLUA 3ZTSA 3K2YA 3EVMA 4AYBD 4WPAA 1LNQA 6FDRA 5GAHU 1S6QB 5JXSA 4WFAQ 4LF7J 2KZMA 2W25A 5G4DA 3A4TA 4V19X 1KN6A 1SUQA 4Y3CA 1WJ9A 4FBTA 1LFWA 2PSZA 5FLXY 4B9LA 1CJTB 1CPZA 4YMEA 2WVCA 3K5LA 4F4WA 1H6KX 2CAJA 4JI1J 2NPIA 3MR7A 3TWZA 2MKKA 3AQPA 1RBAA 1IKVA 4A8MP 1X9SA 2LXUA 4X2BA 4OYBA 1U49A 4KPCA 2O67A 4OZ5A 3MM6A 4CO3A 4UOHA 4EWTA 1C2PA 1X9MA 3K58A 2R7WA 3TQ1A 3O8WA 1PBUA 4P2MA 4WP3A 4DFKA 4OZLA 2G0JA 1SBRA 5CQGA 5ETPA 1S7IA 4DV5J 1ZA2B 1TKZA 1WF1A 2E1MC 3IR5B 3D0IE 4ZPCA 3ZTOA 1JB0C 4ED2A 2W9AA 4EEYA 1QVFR 3UR3C 2GHPA 1FD2A 1RAOA 5IT9Y 1VQYA 2RB7A 2PGCA 3KLIB 2VV5A 2OHDA 2XYGB 3M4XA 4PXEA 3PFEA 4EO8A 1N34J 3HULA 1HLWA 3MD1A 2MPUA 2GJFA 2VC1A 5L1KA 2FVRA 2VODA 3QATA 2HPUA 4ZN1A 4JI6J 4LSNA 3GTYX 1RAGB 4ICLB 4FF4A 2KVQE 4F02A 3EGNA 4B3OA 3GYXB 3T5KA 2E66A 2BJDA 4QIFA 3CD7A 2YPZA 2UU9J 1WOSA 1VDHA 4MYTA 5DDRC 2CPHA 4LFBJ 3FBEA 1KFDA 1VHFA 4ZLJA 5RUBA 1RHJB 3I4PA 4DV2F 2C2DA 2MZSA 2NSBA 8RUCA 1NKCA 4WJBA 2VG6B 1KWMA 2NCKL 5DS7A 1ACMB 3WQPA 2E29A 5M2PA 4Y2MA 4X4VA 1LWXA 4YP3A 1NHKL 1YBUA 4CO2A 2QMWA 5LSOA 3ISZA 2RRNA 3OQ2A 3C16A 3MD3A 3CJKB 4B9SA 1VC5A 1BHNA 1N88A 1VLOA 3DDIA 3JTNA 5T7LB 4P2SA 3TRGA 1NJYA 3AB4B 2KHCA 2JVRA 2ZKUA 4TY8A 1ITPA 2X1BA 5EWGA 1WC1A 4CH7A 4DZ6A 5B08A 2CQPA 3T5HA 4LF8J 3NKYA 4OX8A 3M9NB 1U2FA 2ZZTA 3HVWA 3DU5A 4J37A 3AY0A 2MEWA 2FGOA 4RU9A 1QSYA 1FWLA 2Y8YA 4X65F 2MMYA 4EI2A 2VKZG 5E3CA 3KG1A 4ED8A 4OYXA 4RW7B 2CZVC 4N5SA 1ZPVA 5HATA 4QWBA 5CYQB 2CQ4A 2IVFB 4ZVQB 3PFOA 5J1EB 3NRBA 1JLGA 2CZ4A 3CGIA 4UZBA 2GJIA 2XHWA 2V8PA 1NDCA 3BPDA 1JLEB 4PAAA 2CQCA 1V3RA 3GR0A 1U1OA 3AJ2A 4B3SJ 1Y9OA 2QLWA 4YB6A 3ZFVA 2ZE2A 1X0PA 4X4TA 4UQGA 4DQIA 2CQGA 4ZCLA 1RI7A 4CRJA 4JI8F 2ZH6A 3SEOA 2AEMA 3GCXP 4I2QA 4LRAA 4ED4A 1YGYA 3BSAA 1VQLS 4P2XA 1RB0A 5EHHA 1FO1A 2E5GA 2YWFA 3X1LB 4Y00A 5IM0B 3JYTB 3RBDA 3OVBA 2FVCA 2NXEA 2ZHAA 4X4UA 4NEYA 1X0FA 2HAIA 3AD9C 1N36J 2AJ1A 3J7YI 5C42A 2P6TA 1VS3A 4RBTA 1H98A 4CTAA 1YHQS 5SUHA 3M9OB 1V5IB 5H9FJ 2V5HG 1Q7LB 3W9JA 5BJRA 3HVTB 2UVWA 4USTA 4FP9A 2RQCA 3QAEA 4RX6A 3US5A 1N0UA 5EX3A 2XLJA 4DR4F 2OKQA 3D4JA 2YQ0A 2M8DB 4UUWA 3C6TB 2IMOA 4PG5A 4WIIA 3DGVA 4ZPVR 3VCDA 3DLEB 4ZMMA 1JLCB 1D09B 2XMWA 5CZVA 1S10A 4F2SA 1G2EA 4ZVTB 2IHR1 1S1VA 2HK2A 3I56S 2R8JA 4DR6F 4NCGA 3FRZA 2ZH1A 2OAUA 5L46A 4C8ZA 2V63A 3MZIA 1KONA 4J9PA 3GJQB 1U2RA 5DETA 1MMLA 1HI8A 1U8WA 3OXFA 1BWEA 3M2UB 1HBNB 3FJ2A 1DZ5A 1FRKA 2HVEA 3ISNC 5E41A 2KM8C 3ZZYA 1UFLA 3UDVA 2E1CA 3R5BA 1JLBB 4LT6A 4QBUA 5JUMA 1UJ6A 5D0HA 1WOOA 2WVEA 2IBOA 2LP4A 2B8QA 1TV6A 4L3KA 3S8SA 4LRDA 2I6WA 6AT1B 1L3TA 4O3SA 1SI9A 3H4BA 2C2RA 2BQ3A 1RT3B 2KYXA 2XHCA 1GTHA 2GAGC 1KOHA 2YVSA 3FEXB 4NZ7A 5KFIA 3JQMA 4WK3A 1EJ7L 4QR0A 2VKRA 3HSZA 4YN3B 1NK5A 4JUZA 2OUGA 4WFBQ 4TN2A 1NXIA 2VC0A 3N79A 3PW5A 2IDEA 4LVNP 3I0SA 4ZHRB 2CPZA 5EGYA 1NJIT 1L5UA 1RWMB 3ILIA 2VOPA 2F3JA 4DL5A 2E9ZA 5ETOA 5LMUJ 4UQTA 1HQEA 1QY7A 2E1RA 3CJ0A 4D3HA 3FQKA 1S0MA 1C0TA 3I5AA 3VTIA 3OL9A 1IWAA 5AE3A 5KG6A 3GFYA 1T05A 3CC2S 3G9CA 1S6UA 4QIGA 3IG1B 3ENWA 3RB0A 2YX7A 4YR2A 2B9WA 2RVJA 4UTGA 3M2VB 4DZDA 3DRSB 3T5LA 3BDPA 4JB8B 1S1TB 2RHQB 4PPZA 1P8GA 3HJFA 3MM8B 4K8RA 2LMIA 1D3WA 1DHMA 2GC8A 3G71S 4HKQA 1FFGB 2K8GA 2BBEA 2KB2A 5ETTA 1SIWB 1UJ4A 1PCAA 3GB0A 1HBMB 1FRIA 3BS9A 4NASA 1IR1A 4H4OB 1RT7B 3KJVB 2BW2A 2WVDA 1ROFA 3NLCA 3M8QA 1S9GA 1EARA 2IYIA 3B54A 3MI7X 4OZ3A 1S79A 1RYSA 5AXKA 3FK4A 3PVXA 2DISA 2MJUA 4ZJOA 4B08A 2W7OA 4EGLA 1XMOF 1VQ6S 4NLUA 3D1HA 2YNFA 1YJ7A 4KR0B 1PC4A 3VGUA 3HLUA 4DJBA 4DX8H 1A6LA 4ZK7M 3SV3A 1XMQJ 2LA6A 2JEFA 3ZZZA 1S6PA 2FHMA 3NCQA 1FWPA 1CJKB 3AQOA 3GV5B 3RU0A 1T3NA 2A0FB 2V8HA 2W2MP 1RT4A 4M5KA 1DQAA 1E6VB 3Q2SC 2JLEA 1NPPA 1UVLA 3ENVA 3EPIA 2DNNA 3VAIA 5IC4B 1CJUB 1RHQB 2FYXA 4LJMA 4LF8F 3C46A 3MMBA 2R7UA 2G1HA 2GGPB 3KLGB 2KM8B 4F8RA 1X8DA 4WZQA 7FDRA 4EUVA 2VHGA 1CSJA 1S9FA 1B4SA 4CLYA 5KFUA 1HNIB 3UN3A 1HQUA 3RYLA 5HMYA 2JEIA 2DNGA 1AUSL 2MSSA 5T41A 3C3LA 2UVUA 2AJFE 4B3TF 5E3RA 2KXFA 2COLA 2AJ0A 4QWAA 3VAMA 4PPDA 2LECA 4DR1J 3J7AN 5LOQA 4LBIA 1O8BA 4U8YA 2XO7A 2EPIA 2J0SD 8ATCB 4NRTA 4DV3F 1TL3A 2AIRB 4LR8A 4UOCA 2QYGA 1RTIB 4ZVOB 1UETA 5HAOA 2CADA 3UE2A 3KLHA 4JI4J 1TFYA 1HNZJ 2MB0B 2MSTA 1FRHA 1UW4A 2LU2A 4LVOP 4E2FB 4CLZA 5CH7B 4XDCA 2W9BA 4FKXA 1P27B 3C14B 1HNZF 2KG1A 3EWGA 1LWCA 4KKOA 3VF0B 2DY9A 2QGFB 4DQRA 1T3OA 3BYRA 3LF0A 1VRUA 4RW9B 2YNIB 1N0VC 2AP6A 2HFUA 3DRPA 5HLFA 1GXUA 2PMHA 3I82A 3H90A 2VZ9A 1XR5A 4OHYA 2DNOA 1XK8A 1NCLA 3KG4A 4H4KA 1S1WA 1RUSA 3VAGA 1Y3JA 3K5MA 3M2RB 1LQ9A 5HQ8A 2WBMA 2JNJA 2B43A 4PG6A 4A46A 5F8HA 1S77D 3FQLA 3A12A 3QRQA 1FRLA 4J9VA 4TYAA 1K1QA 1FXLA 4M1KA 2QJ3A 3MPWA 1L3SA 1R0AA 4DF8A 4DS5A 2CQBA 5GADU 4KGKA 4OV6A 4OZJA 5CCLA 2HIYA 3F41A 4H4KC 3QLHB 3AXKA 2N3LA 4C8KA 5KG0A 4F4ZA 4RLEA 1TL1A 2A6MA 4HACB 4NLYA 5ETQA 4DL2A 1H2VZ 3JB9k 1CEZA 2DD8S 2I8EA 2Y3YA 2ZUAA 4HVZA 3RRKA 4ZITA 2QA4G 2DGWA 5K8PA 2UXCJ 2EKNA 4OJHA 2VA2A 4CCHA 1FT8A 2H3EB 1N52B 1NKEA 4FYWB 1LK7A 1ZM3A 4Q0BA 2IM0A 4O0NA 3GCWP 1JLFA 4NWBA 5F41A 3MCMA 3HHNB 4G1QB 2GVZA 1DAXA 5CYMA 2D41A 1FI4A 2GO9A 5D77A 3A8EA 3FMWA 2W4DA 3B78A 1FKPB 2KJVA 2LVWA 5GMEA 5IT0A 3KHRA 1N56A 1EP4A 2GIRA 3C15A 1UP1A 2QA2A 4TVAB 4ZVRB 5LXRA 5C24B 2J9DA 2W7AA 4ZPTR 3WBZA 2YKMB 1V9OA 2PN6A 3DI6A 4J9MA 1HMVA 1Z4UA 3TARA 1ZTTA 4MIAA 5F3TA 3H42A 2CQIA 1U1PA 1VQ9S 3HHLB 5KFMA 2MLYA 5KFEA 4ETXA 4YHHF 3KLFB 3M32B 1T9UA 1YJRA 2LCWA 2Z56B 2GFFA 1SH2A 4FS2A 1IJFB 1FK9A 3HJVA 4P10A 2HKEA 5HANA 2KVIA 3TI0A 5CCMA 1X5SA 1RU1A 2D3ZA 2HFVA 1HD0A 3WX4A 1BWVA 4CLTA 1SJ3P 3CF5Q 3VALA 3L9ZA 1AB8A 4X4PA 1HNWJ 2Z2ZA 4HI1A 4O4GA 2XMJA 3ETMA 4A8OA 4Y34A 4X4QA 1HWUA 4OYMA 1KVIA 4F4KA 4OX9J 3LALA 3FBFA 1JJ2R 1WHXA 1GXTA 5KFGA 4QYZK 3N01A 2MKIA 4URGA 5ETVA 1WOPA 1M5OC 3TJ8A 4F0MA 4IFYA 2EFGA 2UVRA 2RILA 2WSEC 4ATNA 2AYEA 4ZVFA 2KRRA 3R5DA 4K2JA 4IRDA 2VG7B 5HJXA 1U1RA 3CJ5A 3M1VB 4DX5A 1IQZA 1GFWB 2KN4A 4ID5A 1AFIA 3DCAA 2M0GB 3DLLQ 2GMJA 4NXNJ 3TAMB 2LFVA 3UI3A 2E5IA 2E5HA 5HN0A 3PW2A 2NXJA 1WHWA 3GJRB 5FD1A 3W8PA 1Q16B 5I4MA 1LWEB 1UW9A 3SDEA 5KFBA 1FJCA 1DQ9A 1RGVA 3FFIB 2QZ8A 2P9GA 3W3SA 4DHVA 2N3OA 2DRAA 4FXVA 4Y2AA 2HVHA 4ZPDA 4N76A 1N32J 2NZCA 1Q0NA 2FJBB 3G82B 2RF2A 1HKAA 2HHUA 1JX4A 2HGMA 3PW0A 2Z57B 5J2MA 4CM2A 4CLUA 1KD1T 2OTLS 1MMNA 3JSBA 4OLOA 5CYJA 1X4FA 2J8SA 2HW3A 2UXBJ 5KOWA 5D8HB 2AZ3A 4KV8A 4FKYA 3NAHA 2DGQA 5IWAJ 1U7LA 2BJ9A 3GZ7A 1H0HB 3QMQA 1S4EA 4QQBA 2UXCF 3K8VA 3MMAB 3CJRA 3TZXA 4YS2A 2OPSA 3KLEB 1LEOA 3WHIA 2QIFA 2WW4A 4GVBB 4K0KJ 3FNNA 3HZGA 1HBUB 3IGVA 1VBXA 3CCRS 1HW9A 1KOOA 2NUHA 1OPZA 3EMTA 1NSQA 1SH0A 4P73A 4Q44A 4B9UA 1FJGF 4ETZA 1NH8A 4NZ6A 5A8RA 2ZH9A 5IT9U 3E01B 4PWWA 4LF9F 5BYSA 1EHWA 2VDIA 2KO1A 2YXLA 3LGHA 1XNRJ 2RDJA 4AL5A 3TA0A 2M9KA 3VAFA 3DOMA 4FS1A 2R8KA 4JV2A 1F5AA 4MK9A 1SPBP 3W8GA 4JV1A 3L7UA 4H4MA 2XCAA 1X4DA 1KHWA 5J2NA 1OYEA 1RWWB 2W1BA 3ZXWA 1IVZA 4I2PA 2BJ3A 2LQJA 2ERRA 2R7OA 3OL7A 2KFYA 3K89A 1RT2A 3RAXA 1LXNA 1HHSA 3PEHA 2BANA 2JEGA 2AYBA 2AF6A 2V9KA 3BH7B 2GIQA 4ED5A 2YH1A 3FEZA 1KEKA 1B99A 4I4BA 2BJEA 4ALZA 1KC8T 3OD2A 1WKLA 5IQ6A 1MG7A 4C8YA 3DN9A 4DCJB 1S72S 1ZPWX 3GILA 5DQHA 2VBZA 1EETB 1Q8KA 1EIYB 2B6AB 2DJWA 3THTA 2GQ2A 3RBEA 3EX7B 4ED3A 3MMCB 4FBUA 4CQ1A 4QWCA 3UCZP 1REVB 2B51A 2RKIB 2D74B 4A8XA 3OUYB 4Q2MA 2QC3A 1R6YA 1PSDA 3GIIA 5LT5A 5I42B 4MTPA 4USUA 4ANDA 3GYGA 3KK3B 1RCOB 1A0OB 1SJ1A 1FTRA 2N4CA 2JL9A 2FVSA 5KG7A 1BQMB 2AW0A 2DGSA 3HX9A 1J5OA 1MW7A 2WB1D 2EK6A 4DR1F 2W2QP 2HZVA 4LSLB 3N6LA 2KH9A 1U0HA 5CA5A 4LFBF 3GJSB 4KHMA 2YNGB 1HWKA 4OYOA 4CM0A 4DXLA 4DQPA 4WBFA 3SQOP 3VGVA 3DLHA 3UVJB 3TVZA 2OMLA 4ZLNA 4OI6A 1QSLA 3VWSA 4PRFA 4DR2F 3W2VB 3W7BA 3UR0A 3DLKB 3BN4A 4TY9A 3OFHA 5GAHI 4OHWA 4PR6A 5I3UA 4P9SA 1UA1A 2CJKA 2HHPA 5ETLA 2JOQA 4XPEA 2WOMA 3LP0B 3NL0A 4K59A 2E7VA 1RISA 2XWYA 2B9XA 3VR1A 4RU2A 1RJJA 5KFLA 1SL1A 1VQPS 3TVKA 2HWTA 2ALZA 4U9RA 1Q79A 1HNVA 1AROP 2EXUA 3DOLB 1E6YB 2HRUA 2Z2MA 2YKPA 4NRUA 2AKWB 3CCUS 1K1SA 2L9DA 2BE7D 1U26A 4A8SA 3V6HA 2QA1A 3CDWA 3MEKA 3EUNA 4RJVA 5B0AA 3EM1A 4OI3A 2HQIA 3R7NB 1VQSA 5CAAA 4EZ6A 1CS4A 2K1RB 3T1YF 1HPZB 1EAYC 2XBPA 3H5YA 1F6TA 5HP1B 1JIHA 4WE1B 2OELA 3CWJA 2E44A 1NJXA 3IBWA 1WELA 3VGTA 4DPWA 3PR4A 3CEDA 4JI1F 1UVIA 1FHTA 1AUDA 1FX4A 1WSVA 3IFEA 3IBCB 2HQFA 3MM5B 3MPDA 3GU0A 3IWXA 4O3PA 2WSFC 5DLFA 4FYYB 2BABA 4ES3A 4F2RA 4DV7J 4QJVA 2I5JB 2H65B 1S0VA 3O6QA 2KTQA 5KFYA 2AZ1A 4KSEB 2QX0A 4ZA1A 1P1LA 4RW8B 2XO6A 1Q7YT 3CDAA 3IBFB 3DLKA 4XIUA 3TEGA 2QL9B 5F8IA 1MSWD 1F9HA 2JHEA 2LLZA 1FKOB 2QRRA 1LW2B 1WI8A 3GLJA 5HK4A 2QMXA 3EDRB 3T41A 2BUNA 2D3OR 1KQSR 1Q5YA 2YNGA 1TUVA 2POKA 3JSMA 3KXDA 4M5NA 5JJBA 1WACA 4LSLA
chains in the Genus database with same CATH topology
2WCXA 2IYGA 4ILRA 1Y5LB 1J5OB 2ZJQQ 1R7IA 1VRTA 2W24A 5KG3A 2CQ2A 2GHVC 2HNYA 1QM9A 1N8RT 3CT9A 4ZKAA 1VGYA 3KTQA 1MMDA 3OR1A 4DBQA 3LAMA 2DK2A 2GNKA 4IRKA 2VFTA 1EETA 2VG5B 1TAUA 1O0PA 2FIUA 1W2BR 4K0KF 4K4UA 3AAWB 1QUPA 3U27A 2NQPA 2LQ9A 4DUZF 3EGZA 2KZZA 2MZRA 4N8OA 2FDNA 5IS2A 2RU3A 3HK2A 1JLAB 2DTJA 1RT2B 1BQXA 1SQEA 2GX8A 2OPQB 3HDSA 1X4BA 3V6DB 2RU9A 3QWPA 1FXDA 5J2NB 1IUJA 1Q81T 4ZP7A 4OJ1A 2JZ5A 2XZWA 3M6WA 2GQCA 2JLGA 2MQOA 2EFVA 2VFSA 2VPYB 2NREA 3PACA 1N36F 3P5TL 2CPJA 4X4RA 2KXNB 1WHYA 1RKIA 5FJ4A 1NU4A 2FHJA 3OJUA 2OPSB 3KLEA 3CD0A 3ICLA 4QIWD 4ED0A 5E7OB 4U67Q 3IN5A 2DNKA 4JBCA 2XMUA 2K7KA 2J9CA 3G6VA 4NCAA 2KFNA 5LMNF 3V4IA 2YWGA 4NYZA 4DR7F 3PW4A 1VC6A 3DLBA 3I9ZA 5J2MB 2UUWA 2AX0A 4DL7A 5GVQA 4J9QA 4DLGA 1QE1B 1OSCA 4OX6A 4C9DA 5F8LA 1DBDA 4LUBA 4NX9A 1YG0A 1TL5A 4A47A 4K4YA 4WFNQ 1L3KA 2APOA 3FFIA 3HI9A 2BQRA 5DG7A 1R8AA 2ZOFA 2CVIA 2MZ1A 4ZCMA 3K7RA 4CNZA 4KC5A 3OV7A 2C2EA 1AW0A 3PIPQ 2ZH7A 4IOCQ 4E8UA 3M6XA 1K8AT 4KJIA 2GHWA 2NSCA 5KFDA 4ID5B 1UVJA 3KMQA 4E98A 2ZITA 5DJBA 4USJC 3QIPA 3MUVP 1U6BA 3ISND 1CQMA 3CIMA 2BYCA 1NK6A 2KXHA 1C0UA 2GMLA 1NHUA 1TAQA 3QYYA 4HH0A 4DV7F 4C11B 1OSDA 2R7RA 4OL8A 1LXJA 4O4GB 2UU9F 5IXUA 1FRJA 3UFCX 2MGZB 3KOAA 2XY7A 1AXQA 1PC5A 1U6FA 3GYNA 5CHCB 5LL6d 4JV0A 3KMSA 1OIAA 3RW6A 2YX4A 2ZD1B 2NLWA 3M32A 5EWEA 5J2PA 5SZTA 3TANA 1S7HA 3UCUP 2CQ0A 3TX8A 2RQKA 2OPRA 5A8KB 5DDPC 4GC7A 2BE2B 2HWHA 2DH8A 3KK1B 5D3GA 3OXGA 1TKXA 1TKTB 1FDDA 2ABYA 3CDUA 5H1SV 3U1MA 1TVRA 4J5OA 3MM7A 2E5JA 2F8HA 2HZCA 1YWXA 2HS0A 2HS4A 2YX1A 1LOUA 4O3OA 3MEDB 5FDLB 5KFSA 5KOXA 2C3OA 5DM6Q 2GA7A 3OJSA 2BA9A 5FDLA 3MEDA 4MFBA 3MHYA 2C3PA 5IT4A 1X4EA 1HA1A 4OHZA 2M7SA 3RAMA 1TKTA 1FDBA 2A2DA 1FCAA 4PUOB 2ILYA 1KHVA 2MXYA 3U02A 3THVA 1TL1B 3OR2A 2BE2A 5F9NA 3OW2R 4NLQA 4P6QA 1B0PA 4FVMA 2VASA 2CPEA 1S0NA 1HW8A 4O3QA 1FXRA 3I87A 3DOKB