1RT4B

Hiv-1 reverse transcriptase complexed with uc781
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
429
structure length
404
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 117
structure length 404
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt4B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4B02
1JXLA 3Q8PB 1FKOB 3QYYA 4ZVHA 1FK9B 3CJ2A 4KFBB 1RTJA 3KLGA 4ZP6A 3MECB 1JKHB 3MFHA 3BSNA 4DG1B 2BQUA 4FBUA 3CDWA 5F8IA 3KLIA 5C42B 3KK3B 4I2QA 4MKBA 2YNGB 2WOMA 4RW4B 2R2TA 2DPJA 2VG6B 2OPSB 3MTKA 5CYQA 4YMEA 4PWDB 5KFBA 4ZP7A 5JUMA 1DLOB 2JEIA 3FQLA 1JLGA 1RT7A 1QAJA 2IA6A 3QZ8A 1S9EB 3KJVB 3M9NB 3M8PA 3TVKA 3PHEA 4Q45A 1LW0A 1S6QB 3HVAA 5KT2A 4WZQA 4O3SA 1JLQA 3PW2A 4K4SA 3T5KA 3V6DA 1HYSB 3EZUA 1SUQA 1RYRA 3GYNA 1EETA 3MR6A 5DGAA 1LW2B 1N4LA 1RTDA 2BR0A 3IS9B 2YNIA 1RTIB 4Y2CA 1S0MA 1TVRA 4O3RA 1RT3B 4NLUA 3C6UB 5C25A 4OL8A 1W25A 1IKVB 5HLFB 3LP1B 1QUVA 1HQUA 3KHLA 1T3NA 1SV5A 4QWDA 3BSCA 3LP2B 3I0SA 2FLNA 4TXSA 4RW7A 3PR5B 1RTJB 3KLGB 2YKMA 3KLIB 4NLGA 3DMJB 3GIJA 1ZTTA 3IRXA 5JXSA 4RW8B 2XCAA 3T5HA 2V4QA 5CYMA 4ECRA 1JLCA 2HAIA 4FS1A 2BQ3A 2ZD1B 3N6MA 1JX4A 4F4WA 2B6AB 2IM1A 3BQ0A 3ISNC 4J9QA 4R8UB 1JLGB 5EWEA 3NBPA 4R5PA 2XI3A 5KFMA 4KE5A 4XO0A 3QGIA 4ED6A 2XWYA 5F8GA 3ISND 1HPZA 4IFYA 3OLBA 1LWFA 4KKOB 3FFIB 1K1SA 3UPFA 2O5DA 1TL3A 5EWGA 2R8KA 1EETB 4DL5A 4TY9A 5F9NA 4I7FB 1GX6A 1TVRB 1MMLA 3DRPA 1IKWA 3FSIA 3CJ5A 1S1VB 4RW9A 1LWCA 5J2MB 4QWAA 3HVTB 2FVRA 2IM3A 5KFTA 4IR9A 3H5SA 2B5JA 4O4GB 1TKZA 3N6LA 5KFAA 2YKNA 4ED8A 4RW7B 4KHRA 4ZPCA 4O3PA 5KG0A 4NLSA 5KFZA 1FKOA 1RTHB 2FVQA 5KFFA 4KFBA 2F8EX 3MECA 1JKHA 3IRXB 4MK7A 4DG1A 3CJ0A 3NAIA 4RU9A 2W7PA 2BQRA 3DYAB 3V4IB 3IG1B 3T19A 5C42A 3KK3A 1XR7A 2WRMA 3OHAA 2YNGA 4J9OA 4RW4A 3ICLA 5DG8A 4J9PA 4KAIA 2VG6A 4TQSA 4QWCA 3RB3A 2OPSA 1JLEB 3RBDA 2IAJB 4PWDA 3E01B 3PJXA 2HNYB 4NLWA 4J9KA 4PUOA 4NLDA 5EDWA 2IBKA 1DLOA 3OHBA 4O3QA 2JC1A 1DTQB 2AGOA 4ECVA 1S9EA 2YNHA 1HNVA 4NCGB 3KJVA 3UR0A 4WFZA 4F4YA 1N48A 2IJNA 2R2SA 2ATLA 1NHUA 3V6KA 1S1TA 3Q8SB 4FS2A 4TYAA 1S1UB 5J2PB 3MF5A 5KG2A 3UQSA 3DRRB 2YNFB 3DLEB 1HYSA 2R2RA 5KFPA 1S1WA 4ED2A 2IMWP 3KLEB 1T05B 1LW2A 1IKWB 5L1IA 3GIKA 3IS9A 1RTIA 3LANA 1RT3A 5KFVA 2UUWA 3C6UA 4RW6B 5KG1A 3DRSB 1SH2A 1IKVA 5DLGA 5HLFA 3LP1A 3LALA 5HP1B 5F9LA 4K4ZA 1HQEB 1RT4A 3BGRB 3LP2A 1S9GB 4IOBA 3GV8B 4Q8FA 4DL2A 1WNEA 2GIRA 5KFDA 3RBEA 4K4UA 3DOKB 1KHWA 2J6UA 4IFVA 1N5YA 3TQ1A 1RT5B 4ID5B 3DMJA 3CDUA 5KT6A 4KV8B 4QWEA 4RW8A 2XC9A 2W9CB 1DTTB 3QGHA 3FRZA 2ZD1A 2C2DA 4Y3CA 1RAJA 5F8HA 1TL1B 2B6AA 1I6JA 4PUOB 5C24B 3CJ4A 5I3UB 4R8UA 4O4RA 3QLHB 2GC8A 2GIQA 4NLVA 4K4TA 5KG3A 2YNHB 1HNVB 2OPPA 4EO8A 4EO6A 4ECTA 3QIPB 4WXWA 1S1TB 3IGVA 5KFNA 2AX1A 4G3IA 4KKOA 3LP0B 4J9RA 4ZVEA 4J9LA 3FFIA 1TV6B 3DI6B 1RDRA 1C0UB 1UWBB 1S1WB 2ILZA 2ASJA 3UDLA 1S4FA 5DQGA 5HBMB 4I7FA 4DL6A 4KSEB 4RZRA 4IRCA 3KNAA 4XPEA 3H2LA 2IC3B 2UVWA 2IM0A 1S1VA 5J2MA 1TKTA 3HVTA 2V0NA 3V6JA 3LAKA 4IDKB 3CVKA 3DM2B 4MFBB 2HNDB 1RT4B 4O4GA 4QWBA 4EBDA 3H5UA 5J1EB 3I5AA 1FKPB 4IG0B 4IFVB 1RTHA 3BQ2A 3E51A 3CWJA 1HARA 1RT2B 3KOAA 3GILA 1TQLA 4B3OA 3DYAA 4U6PA 3V4IA 3IG1A 4TQRA 3D5MA 3OL6A 4K4WA 4IR1A 2VA2A 5K14A 5KT7A 4IRDA 3M9OB 2HWHA 1RT6A 1VRTB 5KFWA 2UVUA 1SH3A 1C2PA 1JLEA 2IAJA 3E01A 2HNYA 4RUCA 4ED0A 4GC7A 4ECWA 2BE2B 3CDEA 4F4ZA 4ECXA 5KFXA 4WE1B 3IN5A 3T5LA 2W8KA 1S97A 1DTQA 4QPXA 2OPPB 5KFKA 4IH6A 4NLYA 5DQIA 1S0OA 4WZMA 4KO0B 3DLGB 5EWFA 5DQHA 4NCGA 4EYHB 3V6HA 4ZPDA 3MFIA 3KLHB 3PZPA 3GIIA 3GV7B 5L1LA 4J9SA 1S1UA 5J2PA 4M94A 3BSOA 2AU0A 3CIZA 3RAXA 3DRRA 2YNFA 3DLEA 5KFGA 2DPIA 4NLQA 4NLOA 1QE1B 3M8QB 3MEGB 3KLEA 1T05A 1S48A 4TLRA 3RB4A 5F8JA 1TP7A 1TKTB 2V9WA 3G6YA 1HMVB 3TAMB 3KK2B 2FVCA 4ZPAA 4RW6A 3DRSA 4H4OB 5KG6A 2C28A 2J6SA 3PW5A 5HP1A 3C6TB 2OPRB 4TYBA 3SFGA 1HQEA 3BGRA 4Q8EA 1S9GA 1ZETA 1REVB 3DOKA 5KG4A 1T03B 3IGNA 4B3OB 1RT5A 3DOLB 4ID5A 2IJFA 2FLLA 4G1QB 5K14B 3KHRA 4KV8A 4MK9A 3I5BA 1RT6B 2W9CA 1XR6A 1DTTA 4Q0BB 1S49A 3H4BA 5DG7A 3OSNA 1VRUB 5DLFA 3NMAA 4QW9A 3QGGA 2HNZB 3KLVA 1TL1A 4J9MA 3H5XA 5C24A 3JYTA 5I3UA 1RYSA 4NLTA 2IM2A 5J2NB 3QLHA 4IG3B 4RNOA 3MR5A 4ZP9A 2WONB 1R0AA 2W7OA 4K4XA 1JLFB 1C0TA 3QIPA 4F50A 4DL3A 5KFCA 3LP0A 2ZKUA 5DG9A 1TV6A 3DI6A 4EEYA 1C0UA 1UWBA 4ZHRB 4Q44A 4ECUA 5KT5A 5J2QA 5KFHA 1EP4B 4NZ0A 2I5JB 2XGQA 3ITHB 5HBMA 5HROB 1KHVA 4WYWA 4O3NA 2RDJA 2UVVA 2RKIA 4ZVGA 2IC3A 5KT3A 5KFSA 5KFJA 2W9BB 1U09A 3MEEB 3H40A 4IDKA 4NLPA 4NYZA 2BANA 3DM2A 5EUHA 4MFBA 2HNDA 4J9NA 2AGPA 4TY8A 4GC6A 3RB6A 4YR2A 5J1EA 5F8MA 1D1UA 4TN2A 1C1CB 1FKPA 4IG0A 2ILYA 5F8LA 3GV5B 4ECSA 5L9XA 1JLBB 3FQKA 2R8IA 2OH2A 4LSNB 4DL4A 4MIBA 1IKXA 1RT2A 2E9ZA 4LSLB 2HMIA 4JV1A 1J5OB 3BR9A 3SFUA 1TKXB 3MEDA 4WFXA 3T5JA 4WFYA 1VRTA 1S6PB 1IKYA 3DDKA 3HKWA 2XI2A 2XCPA 3JYTB 4FBTA 4M95A 3KMSA 1BQMB 2FJWA 2BRKA 2BE2A 2R8JA 2FVPA 3Q8RB 4WE1A 4KHMA 3G6VA 2B43A 4ICLA 1R0AB 2AX0A 4KB7A 4KO0A 1C0TB 3DLGA 3KLFA 5D3GB 4F4XA 3JSMA 3KLHA 4O44B 2R2UA 3PVXA 4JV2A 2CJQA 3HHKA 1RT1A 2OPQB 3KK1B 5J2QB 2WB4A 2WK4A 3FDSA 4RNHA 1ZTWA 2AGQA 2D3ZA 1LWEA 1QE1A 2RKIB 3M8QA 1JLAB 3MEGA 1HNIA 5KT4A 2WTFA 1Z4UA 2RF2A 4YR0A 1HMVA 3TAMA 3KK2A 4PQUB 4EYIB 3OSPA 3VQSA 2JEFA 5KFLA 3I5CA 2BANB 4H4OA 5DGBA 3PR4A 4H54A 4TY8B 3KHHA 1T94A 2BRLA 3BJYA 3NGDA 1SH0A 3C6TA 2OPRA 2QV6A 3GQCA 4NLXA 3M9MB 4WYLA 1REVA 4X2BA 1IKXB 1NNDA 2ALZA 2EC0A 3V81B 1T03A 2HMIB 4DEZA 3DOLA 3MEDB 2JLEA 2RDIA 4YQWA 2AQ4A 1S1XA 4G1QA 2VG7B 3BREA 3I0RB 2XGPA 2HWIA 4Q0BA 3N6NA 5T14A 1IKYB 4H4MB 3CO9A 4I2PA 3NKYA 1C1BB 1VRUA 1RA7A 1N6QB 4LQ9A 3CJ3A 2V4RA 2HNZA 1N5YB 3PW4A 2VG5B 4IH5A 4URQU 4Y2AA 1S9FA 4ICLB 5J2NA 4IG3A 1MU2A 3KMQA 2FJVA 3KLFB 5KFEA 2WONA 3JSMB 4MK8A 3EPIA 3PW0A 4I2QB 1JLFA 2WHOA 2WOMB 2I1RA 3OL8A 1RT1B 1YVFA 4MKAA 4JV0A 2C2EA 2QE5A 4ZHRA 4ZVFA 5CYQB 3H4DA 2FLPA 2R8GA 1LWEB 2UUTA 1EP4A 3D28A 2I5JA 1HNIB 2WCXA 5KFQA 3ITHA 2W8LA 5KFYA 2RF2B 5HROA 1IM4A 3RAQA 1JIHA 3H98A 4WXOA 1RT7B 2W9BA 1OS5A 4MH8A 3MEEA 1S10A 5I42A 4EBCA 5FDLA 3M8PB 2JC0A 2CKWA 3OLAA 2ASDA 1LW0B 1QAIA 1JLQB 5KG7A 2R8HA 4ZPBA 1C1CA 3V6DB 1BQNA 2ZE2A 4ECQA 1XR5A 1SUQB 5KFIA 4IRKA 1JLBA 4R0EA 3MR2A 2E9RX 4LSNA 1S1XB 1KLMA 1RTDB 2C2RA 4LSLA 4URSA 1RA6A 4RNMA 1J5OA 1NHVA 2YNIB 1TKXA 4NRTA 4LQ3A 3H59A 4YR3A 2UVRA 4I2PB 5C25B 4RNNA 4YP3A 3G6XA 3QIDA 4RNFA 4IQXA 2FVSA 3OL9A 1S6PA 4MIAA 1HQUB 4HKQA 1SV5B 2FJXA 3MR3A 3DLKA 3I0SB 3BSAA 2C22A 3SI8A 1BQMA 3QO9A 1MU2B 4K4VA 3G86A 3T1AA 4ZMMA 4K4YA 4HYKA 3NL0A 4NRUA 1FK9A 2YKMB 1K1QA 3NAHA 2JEJA 5D3GA 5L1KA 3LAMA 2D7SA 4O44A 4NLRA 5CYMB 1D0EA 1JLCB 5KFOA 3HVWA 4JUZA 2VA3A 4KBIA 2OPQA 3KK1A 4IKAA 2D41A 1CSJA 4ECYA 4ED7A 2E9TA 4QW8A 1JLAA 4IH7A 3NBPB 4R5PB 3PW7A 2ASLA 5KFRA 2D3UA 4URGA 2J6TA 4PQUA 5I42B 5FDLB 4Y34A 3BQ1A 1GX5A 4DL7A 1HPZB 4IFYB 2JEGA 3H5YA 1LWFB 3GIMA 5F8NA 4ED3A 3PJWA 1S6QA 4ZP8A 3EPGA 3RB0A 1BQNB 2ZE2B 5L1JA 1TL3B 3Q8QB 1KLMB 4U7CA 3V81A 2W9AA 1S0NA 2AWZA 3DRPB 4EBEA 4ED1A 2VG7A 5KFUA 5KG5A 4RW9B 1LWCB 3I0RA 5C5JA 4O3OA 3OL7A 4Q43A 4K50A 4H4MA 2B5JB 3QZ7A 1C1BA 3DLKB 1TKZB 4XPCA 2YKNB 1N6QA 1N56A 4ECZA 3KHGA 3QO9B 4RUAA 2VG5A
chains in the Genus database with same CATH superfamily
2NLWA 2CVEA 3CC2S 1UVJA 5EX3A 2XMMA 3D1HA 3VF0B 1FESA 2MZQA 3CJKA 1T9TA 5KFBA 2DGUA 2WVBA 2ERRA 3MAAB 3J7Z5 3UNGC 4UOGA 3PHEA 4V1Ak 4ZVSB 1N5VA 2A6MA 2HHHJ 5AXKA 2YKPA 2J9DA 4UW2A 2NR0A 3IXQA 1FWLA 2CZ4A 3LP1B 3QATA 3HZGA 4LF6J 4RW7A 4UUWA 1RTJB 3KLGB 3O6QA 1MWQA 2HRYA 2OAUA 4RW8B 4OHXA 4WF9Q 8ATCB 1FRJA 2VIHA 2PT0A 5IQQA 3VALA 3OTEA 3MI7X 1FX4A 4ED6A 4IFYA 2HQDA 3D6HB 4LUBA 2MKSA 1G7CB 1RISA 1EETB 4DPTA 3X3UA 4FVCA 1W26A 3BO3A 1RAFB 4QWAA 4LF5F 2B5JA 3RG6A 4O23A 3BF4A 1RTHB 1GMWD 3MXHP 1FI4A 4KFBA 2F3JA 4EMDA 4DJBA 5C42A 3NG8A 2VG6A 1JLEB 3RBDA 2HNYB 1M0SA 2R42A 3D7SB 2MB0B 2AGOA 5FLXY 2N3LA 2PEBA 1HYSA 3QQCD 2HHWA 4UZBA 2UU9F 4NCAA 2AYGA 5H1SV 1HBNB 5F9LA 2GJFA 3VVTA 3GU0A 3M8WA 2KJVA 2ROGA 2Y0BB 3LGMA 2XC9A 3ZTPA 4OZ1A 4B9NA 3PO4A 4PG8A 3W61A 4R8UA 4ERDA 4O4RA 2HFUA 4Y0FA 4Y28C 3T41A 3QT5A 3DFEA 4TNOA 4B9LA 1X4FA 4A8SA 2N7CA 3HVTA 3J81U 1FRMA 5A0YB 1HNWJ 1FDBA 1VQYA 6AT1B 4BWJA 3ZO7A 3M6UA 2KM8B 2VA2A 3CNQP 3HSZA 3FSYA 2IAJA 3E01A 2U2FA 3TNVA 5M2UA 4DR6J 1EAYC 2MQPA 3MFIA 2BX6A 3RAXA 2CQBA 2OD6A 4NLOA 1T05A 2ZH9A 2OFHX 2ZH1A 4OYIA 1O6XA 3CXCR 3O8WA 3HZEA 3PW5A 3BGRA 1ZETA 4WTYA 4BBYA 3IGNA 2ZH6A 2F4FA 3I4PA 4B3RF 1TL7B 1LK7A 3SDEB 1JJ2R 4FP9A 3NNAA 3G82A 4RNOA 3QLHA 1SKSA 3D2WA 1FERA 4NZ0A 4ZLJA 3K57A 1KHVA 1IR0A 4LR8A 4P72A 4F0MA 3DM2A 4LVNP 4IG0A 1NJWA 4AQYF 3R5CA 1FKAF 2DNYA 1VRTA 3K17A 4PG4A 2WZ1A 2CJQA 4OJ3A 4ITSA 3NCPA 1V5IB 2WK4A 3ZTSA 1HNIA 3HHLD 4BWMA 4DR3J 4X4PA 2R7RA 1KQGB 3CW2C 4H4OA 2FPHX 4TY8B 1VQ9S 4GO7X 4YQWA 4G1QA 3N6NA 4H4MB 2XO6A 1M5VC 2YQ0A 2MZTA 2FJAB 4LQ9A 1NRKA 2V2QA 4AQYJ 2HAFA 4IG3A 2AYBA 4FYVB 4DV1J 3GYGA 1ZM4A 2WOMB 4Q2LA 1SJ3P 5E41A 5H9EJ 3ITHA 5KFYA 5HROA 1YJTA 1UPMB 1WOOA 3R1HA 2XM3A 1RT7B 3TZYA 2W9BA 2VKRA 5FDLA 2R7VA 2VODA 1NK8A 4URSA 2XMAA 5G0RA 1CEZA 1VJWA 2R7OA 3SQGA 1OQ3A 4X4SA 3ENWA 1S6UA 3O2IA 1K1QA 2K06A 1FXLA 2CA9A 2X7IA 3U7JA 2GO8A 5ITHA 2G1DA 4QW8A 2ASLA 2CQDA 2R7QA 1H2UX 5ETVA 2UP1A 3PJWA 2M8DB 3IBFB 3FGVA 3BPDA 3R2CJ 1T95A 4N77A 2DIVA 2A6OA 4Q43A 1C1BA 2ZUGA 4X4RA 1FE0A 1RE1B 1SCJB 4P7VA 2YWKA 4B08A 2FLOA 4YMEA 4OYXA 5JUMA 3O3LA 2JEIA 3NWRA 3QZ8A 1UETA 3GG0A 5HMXA 2P9GA 4DSFA 2HHSA 1SUQA 2MKJA 4A48A 1DARA 3GR0A 4K59A 1TVRA 2HPUA 1PAEX 4QWDA 2N4CA 2YWHA 1S59A 2BBEA 1WTBA 2R7WA 1U24A 4DR4F 2RRNA 3KLIB 5JXSA 1UFWA 3N6MA 3BPSP 1X4GA 3OBIA 3ISNC 1Q81T 4HDHA 2HW3A 4G6VB 3UD3P 1SQGA 4FN5A 2CJ9A 7AT1B 3IAS9 4NPOA 3TAQA 3KG0A 2B7BB 2RHQB 5J2MB 3ZTQA 5EHHA 1KS2A 5KG0A 5KFZA 2LYVA 4JI2J 4JV1A 3OTDA 1MG7A 1XR7A 2RB7A 1DY3A 1RSCA 4DR4J 3P6YC 4YDXA 1FJ7A 4NCGB 4WFZA 3DRRB 2YNFB 2W7AA 1XC9A 4LF1A 3A8KA 1RI7A 3TZXA 2VPXB 3LALA 3OV7A 2X1AA 4M8LA 1H38A 1RT5B 4QWEA 2CPXA 2BJ8A 2P6TA 5E3RA 4WTOB 1HNVB 5U47A 2YKOA 5IQ6A 4G3IA 3UCUP 2HS0A 4DV0J 3WX4A 2BEFA 2IM0A 1KVJA 4HHHA 1ZH5A 4DXLA 4MFBB 3IC1A 1UW9A 1H0HB 5J1EB 3K8WA 4TQRA 1NDKA 3C15A 3M9OB 3BH7B 2F9DA 3PRDA 1N8RT 4AFFA 4P7TA 4ZPTR 1S99A 3T5LA 3VAHA 3OFFA 4Z7YA 1VC6A 3MM9A 1Q8BA 2H9ZA 4PAAA 5J2PA 5KFGA 3RB4A 2GJIA 4DS4A 5LXYA 5E3PA 1SJRA 4DV7J 5HP1A 4UTGA 2OPRB 2HBQB 5ETQA 5K14B 4TU7A 3LGNA 1X4BA 3M30B 1G3OA 3K5OA 2FC8A 2PA8D 4F50A 2ZKUA 3D0HE 1EP4B 2I5JB 2XMUA 2AF6A 4ZVGA 5K8OA 2LFVA 1RWNB 3I87A 4A46A 3QPIA 4ZCMA 3RB6A 4YR2A 1GTHA 1CC7A 2NZCA 1TKXB 3JTNA 1RAEB 4ZPWR 4FBTA 2ATCB 2DT9A 3ENAA 1R0AB 2GV1A 1X4HA 1NPPA 2CZVC 4DCOB 4FNIA 1RAOA 2O66A 2E66A 1IQZA 1QE1A 4ZN3A 1SKWA 1UVNA 1R27B 1VBZA 2JEFA 1HBOA 4H54A 4ED5A 4GVBB 4HHUA 3KDNA 4D3GA 4NYOA 5DZ6A 2JLEA 3M6XA 1KBRA 2GO9A 2XGPA 1T9VA 2G2ZA 2GNKA 1NJIT 2RD5C 5J2NA 3NY0A 4ED4A 4I6WA 2V94A 4X66F 1W2BR 2VPWB 3CJKB 2QE5A 1WD6A 3D28A 3HF5A 2HBRB 3CCTA 2JC0A 3DXBA 2HBYB 1YDLA 2IRXA 4R0EA 3F44A 4NRTA 4LQ3A 4YP3A 2DEJA 4MTPA 3DLKA 4RR5A 2IPOB 3RBZA 2CQ2A 4NRUA 5E3QA 2V68A 4PABA 2JEJA 2X3DA 4F8RA 1AB8A 2EK6A 4NLRA 4LFBJ 1GNKA 1NKBA 2VQFF 4OHYA 4PQUA 4IFYB 4DZ6A 2BE9B 3V81A 2QRRA 5I4MA 2W9AA 2B5JB 4XPCA 3AHPA 4HH1A 1N6QA 4OHWA 1TTHB 5A2QY 4KFBB 1WKKA 1P9YA 1ITPA 5C42B 1VI7A 2VG6B 1NUEA 4P10A 4U8VA 2K7JA 2JZ5A 3VWSA 5D77A 4EWTA 4WZQA 1HWLA 3W62A 1CULA 4O3SA 1JLQA 1HYSB 2VV5A 1NZ8A 2V8GA 4U96A 2CPDA 1LV5A 3PJ9A 1T3NA 1R43A 2FLNA 1REGX 1K8AT 1DJ0A 3EUNA 3ZZZA 2LDIA 2HKEA 4R8UB 4XTTA 4ZCIA 3DXSX 4B3SJ 3E2EA 2R8KA 4F0KA 2F63A 4DN0A 4YHHF 3SXLA 3HVTB 4DFKA 2GW8A 4I69A 3L95X 1FA0A 3K8VA 4DSJA 1UJ6A 2H51B 2KG0A 1R7IA 3H7HB 1XMOJ 1CBKA 1JKHA 4U9RA 4TQSA 2IAJB 4OX7A 3E01B 3PJXA 4PG6A 3ILOA 4HHJA 1RAIB 3MF5A 1S1WA 1T05B 5L1IA 5KFVA 3C6UA 1SH2A 4Q5VA 4K4ZA 1YJVA 2CG4A 3BGRB 2V34A 1KHWA 1NSKL 4WP9A 2Z4PA 4DS5A 2RSQA 2R7XA 3CJ4A 3G82B 2DB1A 3QLHB 3W64A 1MNEA 2ZHAA 4ELTA 3BO2A 2ILZA 4CRJA 4IRCA 4XPEA 2DO4A 1S1VA 2C42A 1N34F 3DM2B 3ISZA 4O4GA 1NDPA 2PA3A 1YITS 1SJFA 4JYAF 4IG0B 2OFGX 3CWJA 1TZ0A 3EWGA 4PXDA 5KT7A 1VRTB 5KFWA 4I1TA 1HNXF 2PFDA 5HL7Q 2BE7D 2WSFC 4IH6A 2DGTA 5JVGQ 2DNRA 1TU0B 1S1UA 4M5LA 2M0GB 4M94A 3BSOA 3CIZA 2J8SA 2POKA 4CLFA 3DCAA 4RW6A 3PYFA 4H4OB 4CLZA 2ABYA 3GFHA 2ZH4A 2DRBA 4J7CA 2FIUA 4X4TA 1N34J 2FLLA 5B7WA 4G1QB 1RU2A 1TELA 2CNKB 3PACA 2KRRA 1TL1A 1YG0A 4P6QA 5I3UA 4NLTA 1N32J 4IG3B 2Q6BA 3N0VA 3NGSA 4DL3A 5KFCA 3LP0A 2LXIA 1NK7A 1IWGA 1U1KA 4MT1A 1PKUA 3ITHB 5HROB 3C8YA 1HBMA 2KXHA 2W9BB 2YPZA 2VF3A 2DNZA 3DLBA 5GAGU 4JI5F 3J7A1 2XSJA 1IKXA 4MAKA 3D0GE 5G0RB 4ZJLA 2ZKTA 3SQGB 2D9OA 4USWA 4UY85 3NP5A 2AD9A 2XMVA 2HHQA 4ILRA 4P2SA 2QO3A 3NMRA 2ZH5A 2Q6CA 4DU8A 5J2QB 3SSQA 1TFWA 1RKIA 4FXDA 3TYTA 3PR4A 3HULA 1NK6A 2BRLA 1B4SA 4ILLA 2Y1LB 4NLXA 5BYRA 2RUGA 3D67A 3UDVA 3DOLA 3LO3A 2QN6B 3FK4A 3ZC4A 5CCMA 5I3PA 3NKYA 3ZZRA 1C1BB 1VJQA 1RA7A 3B6BA 4CLUA 3D1OA 3B4DA 2LU2A 1VLOA 4YB1P 4P9SA 5B0GA 2I1RA 4CLWA 2M3DA 3MAHA 5DS7A 2DD8S 4GVLA 4W90B 1ICEB 3VAFA 2OI2A 4K0KJ 3T1YF 1BQNA 1XR5A 1SUQB 5A8WA 5M2RA 1RKJA 1XNQF 1U1PA 1I3OB 1JB0C 3FKBA 3SI8A 4K4VA 2EBEA 3T1HF 3UDEA 2D7SA 3JQMA 2MKIA 4DQRA 1OY6A 2FUG9 1U49A 2KI2A 2K3IA 2IIHA 4QQBA 1N36F 5I42B 2HRTA 1WC4A 3H5YA 4C3KA 2R4FA 2FJBB 4DUYF 3V4MA 5KFUA 2EXUA 3NGRA 2VBYA 3QO9B 1JXLA 2W2MP 2DJWA 1L3UA 4OX9J 1CJVA 3M32B 1V5VA 2Q1LA 1C4CA 1I5OB 3T1HJ 3BN7A 1U1RA 2V4JA 2D3O1 1JLGA 1YBTA 2FQQB 4QU7A 1MN7A 1LW0A 3PYEA 2KN4A 4O3RA 2BKPA 5F41A 4DPWA 4WWSA 3I0SA 3ZXWA 1NJZA 1WELA 3TO8A 4YN3B 5IV3A 2HHUA 2JNJA 2A1BA 3H20A 3CCES 1Y0HA 1UA1A 1JX4A 4KPYA 3ZZTA 2IVMA 4KE5A 4LR9A 3HCXA 4J9UE 4KGXB 4NYPA 5HSPA 2ZDPA 2O5DA 2EW9A 1FXDA 2QMXA 4C3MA 4E0DA 4Y65A 1RU1A 3SV3A 3F56A 3UD5A 5A8KA 2XHCA 3VHQA 2ZM6J 4RO0A 4J9OA 2L9WA 2ZZMA 3HFKA 3C15B 2ZFHA 3RB3A 3PFOA 4UOCA 3CCWA 5ETNA 3GMGA 4DQPA 3MM9B 3IWLA 3AQOA 3NOGA 1TUGB 1VBYA 5J2PB 1XNRF 4KJIA 2D69A 2KFYA 2XG8A 3TZZA 1ACMB 6FDRA 1SXLA 4CDIA 1IKVA 1Y5LB 5HP1B 3LP2A 2B8PA 3NGTA 4DWIA 3WX8A 3QGHA 2VUGA 5ETMA 4LFCF 3U1NA 3N79A 2GIQA 1NLKL 5KG3A 2HQFA 1FFGB 2AX1A 1HLWA 4J9RA 4J9LA 2ASJA 2ZVIA 1WC1A 2YX1A 4M5DA 1SPBP 9RUBA 2V0NA 1XNRJ 5LSRA 2MJUA 1RT4B 2KHDA 3QMQA 2F4VJ 3I5AA 5B0FA 1HHSA 4NZ6A 1J2VA 4KH0B 1O0PA 4U6PA 4B3OA 2RS2A 1XBWA 3OJUA 1C2PA 2N7YA 3MEKA 4ED0A 2ZBCA 2CVIA 2AMCB 3FBFA 3ZZOA 5IWAJ 4LFCJ 5DQIA 1UFKA 3VGTA 5L1LA 3BS9A 4IO9Q 2XMJA 1QE1B 3SQOP 3WC2A 1Q86T 2XLIA 1HBOB 3VR1A 2OTLS 2LQ9A 3NS7B 3LGHA 1SB6A 1HWJA 4J90A 2UZAA 2XZTB 3VZIA 2YH0A 3HSDA 1K47A 2VONA 1M5SA 4ILMA 5DDOC 1TUVA 5J2NB 4YS2A 2V8VA 2J8AA 3C19A 5HMYA 2F40A 1S5ZA 3IAM9 1OWXA 4J9NA 1RWOB 2K2PA 2B9WA 4GC6A 4A8YA 3W2VA 4X65F 4KHPF 4P2XA 3UN2A 3L9ZA 2ADBA 3SFUA 4WP8A 3Q22A 3DDKA 3AXKA 4NZ7A 3CO0P 2FJWA 4W4MA 3Q8RB 2GCFA 2ROEA 5HJYA 3JSMA 4PR6A 3TVYA 1F5AA 4PEOA 4UZCA 3P3DA 3HHKA 2PI4A 1N5TA 1ZTWA 2D3ZA 2NXUA 3HT3A 4PQUB 2YKAA 1LOUA 2KVIA 3OTOJ 4DX6A 1T0TV 5HVHA 3ILJA 3V81B 2H5EA 5AE2A 1U4BA 5B0AA 1Z1ZA 2HWIA 3AD8C 3CO9A 2J0WA 1N6QB 1H74A 3PW4A 2ADCA 2HQIA 4FF4A 3DNCA 3BGOP 5KFEA 1KNZA 2WONA 2MEWA 3CULA 3IWNC 2IA0A 2HHPA 2DR5A 1PO6A 2DYAA 1TL5A 3H4DA 2UUTA 4K8RA 5D4PA 3MHYA 5GMEA 3W65A 2HIYA 2VKZG 1CULB 1JLQB 1DRZA 1BLUA 1KLMA 4RNMA 2UVRA 3KXDA 4RNFA 4P52A 4HKQA 2FJXA 2G1HA 3ZZUA 4KGKA 3NL0A 5IT0A 3M6WA 1HIYA 4JUZA 3AB2B 1ZPWX 2BJ3A 1G1XA 1UJ4A 4FKXA 5BR8F 1QM9A 1Q4RA 2Z57B 3PDNA 2DISA 4FPRA 4X4NA 1R6VA 3WQPA 1QSSA 4WFBQ 1FRIA 4UQGA 5GVQA 2FJDB 1YJ7A 4ANDA 4RBVA 3CJ2A 1JKHB 2VDHA 2KXNB 1VFJA 4CLSA 8AT1B 2J5AA 3VGSA 1K73T 3TJ9A 3HXMA 4Q45A 5EGYA 3V6DA 4NMXA 2N4DA 1RYRA 2MKKA 1WKLA 2YNIA 3C6UB 5BYQA 4U8YA 3D1QA 3KHLA 4DX8H 4CI0B 4FVMA 2EFOA 1IQTA 2AEMA 2V4QA 2VD3A 4EK2A 2HGLA 2J0SD 2YPYA 1K0TA 4R5PA 5KFMA 3QJJA 4XO0A 3P8BB 1B3TA 3UPFA 3RW7A 4F3QA 2M52A 2Z30B 5F9NA 1U2FA 4CQ1A 1MMLA 3ZTRA 1NU4A 4USIA 1S1VB 2VC0A 4IR9A 4DPYA 4O4GB 5KFAA 4RKUC 1FKOA 3Q89A 3MECA 4DUTA 1FHTA 1K0VA 4KPCA 4DCPB 1M90T 1XK8A 1L5UA 3NCQA 1EJ7L 1OPZA 5EDWA 5C2GA 4LFAF 4N8OA 1N48A 2FDNA 2R2SA 1S1UB 1GXTA 1XQIA 1KRPA 1W7WA 1RACB 1X0PA 3GIKA 3VGUA 4RW6B 5HLFA 5AE3A 4F0HA 2B9EA 3TQ1A 3EZOA 3UN5A 2JLGA 1GMWA 2NYHA 3SCLE 1TL1B 1Q82T 4PG5A 5I3UB 3I9ZA 2VU5A 2CYYA 1FDAA 4KKOA 3LP0B 2L9DA 3UDLA 5IT4A 2HVDA 1T9WA 1HBMB 4CLPA 3GTYX 2E5LJ 5B0EA 4J5OA 4XIUA 4K2XA 3MD3A 3UVJB 2XSJB 3E51A 1NAQA 3FBBA 1F60B 2P9EA 1MWZA 2QSFA 3K7RA 1QAXA 4DL0C 4ECWA 1I51B 3TW0A 3GIIA 3JTPA 1P1LA 1UVLA 4EFAC 1Y3KA 4C0OC 5H9FK 3DRSA 5KG6A 3HI9A 3PY8A 2O3DA 1HQEA 2BACA 3THPA 3DOLB 2CXEA 5IT9Y 3ZZYA 3CCZA 1RHMB 2J9EA 2WVEA 1RT6B 3H4BA 5DG7A 3FEZA 3NMAA 1PCAA 4QZVB 3B4MA 4B3TF 2BJDA 2BM0A 3K58A 5IS2A 4YB7A 2H3EB 1TV6A 1UWBA 3J80U 1FNXH 5KFSA 4QOTA 1OY8A 2GA7A 4NLPA 4RPFA 1FX2A 1FKPA 5A8WB 4G1PA 1RT2A 4WCEQ 1UL3A 3CT9A 4IOCQ 2V50A 4L74A 1HQ2A 1BHNA 4QIVA 5BXIA 3OR2A 1BQXA 3KUEA 3NLCA 4F4XA 1JXVA 1ZM9A 1RLDA 2PMWA 3UI3A 1VOMA 2H4YB 4WIQA 2RKIB 4U7UK 2HVZA 4EYIB 2D74B 2DK2A 3TANA 5JJBA 5KOXA 2PFFB 1T03A 4DEZA 2EFVA 2L08A 4I2PA 1WOSA 4DR7F 3R2DJ 1CJVB 2FJVA 3CIMA 3THTA 5LL6d 2JDJA 1RT1B 3CMAS 1RWXB 3LWMA 2X3GA 4ES2A 2WCXA 2V4JB 4KY3A 2NZ4A 2G9OA 1MSWD 1LW0B 4IRKA 4CYUB 2HGMA 3I0SB 2FZKB 4HYKA 3PYGA 2MQLA 2DNMA 3JQKA 3NAHA 5L1KA 3R8YA 4CCHA 5KFOA 4DR7J 4KBIA 4JI6F 1VGYA 4QPTA 1RWMB 2Y3YA 4ED7A 3BBCA 2J6TA 1R8BA 4JI0J 4XK8C 4ED3A 3W5YA 3LA0A 5D4LA 3Q8QB 4U7CA 1PILA 2VG7A 1N33F 3OL7A 2KDOA 4RUAA 2FHOB 1KQSR 5GMKa 4HTIA 1RADB 1RTJA 3KLGA 3IMQJ 1Q8KA 5D0GA 2UUAF 3SV4A 4QYZK 4DU7A 2X1BA 4LVOP 2RAQA 1GMUA 3UD4P 3KJNB 3M8PA 1OO0B 2E29A 1UZDA 3HFZB 2BKOA 4BCAA 5CD4H 3R5GA 3PRBA 1EETA 2APOA 3FEYB 4E8UA 1IKVB 5G4DA 4GKJF 3LP2B 3F73A 1DZ5A 3TJ8A 2RRBA 1WI8A 1V3ZA 5D0EA 1JLCA 3AH6A 4F4WA 1H2TZ 1FNOA 2CPZA 2RQMA 2LA4A 3KNGA 5F3TA 1LQ9A 4RUBA 4M5DB 4LF8J 2HQCA 4FYWB 2NXCA 1HBNA 2FY8A 1DFDA 2YY3A 3RW6A 5KFFA 2YNGA 3WDOA 2UUBF 2GS8A 3FC9A 2GQQA 4N5SA 1HNZF 2YWFA 5LMNJ 2IBKA 4ZA1A 4CNZA 1GH8A 2GJ2A 4DI6A 3Q8SB 2CWXA 1E6YA 5D78A 1IKWB 2B56A 1RTIA 3LANA 1RZMA 2QLXA 2PC6A 1Q95G 2GZOA 1F9HA 1FFSB 4Q8FA 4DL2A 2GIRA 4OZ5A 8RUCA 2M7SA 2R7TA 4MIWA 2B4VA 2ASYA 2D1CA 1RXOB 4Q2MA 3P96A 2CJKA 3JSYA 2B6AA 2B7CB 3R9LA 2M2BA 1U25A 2UUBJ 1EIYB 3QT8A 2KZZA 4ECTA 1CS4A 3JB9k 2ZHOA 2PO4A 2UV8A 3Q8YA 2G4BA 4LF4F 1FJEB 4ID8A 1IBLF 3W2VB 4V19X 4QR1A 1HHQA 1L3KA 3D5MA 2K1RA 4IR1A 2V63A 3OTCA 2MZSA 1SC1B 4W98A 1RUSA 4QJVA 4FYDA 3W8GA 1FJGF 2RJZA 3AA9A 4J9VA 2W8KA 1DTQA 2KYZA 3TX8A 4EYHB 3MZIA 4HTJA 4KTQA 3BBBA 4IYQA 4OZ0A 2QIFA 2AU0A 5C7PA 1YBUA 5F8JA 3MM6B 1TKTB 2KM8C 2PSZA 3GZ7A 4TYBA 4F2RA 1DHMA 2NXJA 4I4BA 2Z2MA 4LF4J 2H65B 2E7WA 2CDRB 5ETKA 1VQ7S 3T6JA 2QLFB 2ZBRA 4FNHA 1U8WA 2IM2A 1DQAA 2WONB 2DIUA 3D68A 2P6SA 1EKSA 2RVJA 4GO5X 2EKNA 1FJGJ 4B3MF 2QL5B 5ETRA 1S12A 2AW0A 4C0HA 2DNLA 3FJ2A 4NYZA 4ZCKA 4YOEA 4EZ6A 4TY8A 3PEJA 1YIJS 3BR9A 4PRFA 2LQBA 3RUBL 2XCPA 3KMSA 2R8JA 2KT2A 2QA1A 3CTRA 3KLHA 2CQHA 2GFFA 3PVXA 2ZC4A 3J7YI 2AGQA 2ZOMA 3KJQB 2QLJB 4A8FA 2VASA 2R7UA 1M1GA 1REVA 1Y9OA 3ZNJ1 2VQEF 3D6TB 1L3VA 3BREA 2E7XA 3BYRA 2HNZA 4PQAA 1S9FA 2JH3A 3D0IE 2ZNYA 4MK8A 1KWMA 5B0DA 1HWIA 4NOHA 2FLPA 2ZZNA 4C97A 3RAQA 4O0NA 2RF2B 1QDUB 2EFPA 1Y00A 2BVZA 2ZJQQ 1S10A 4EBCA 5HK4A 4OI1A 3V6DB 3MTJA 2B4OA 3FCWA 3VAGA 4LSLA 2YNIB 4JOUA 1NSPA 3FZ2A 3G6XA 4K4YA 1WHVA 5GADU 1KQKA 1PBAA 2DY9A 1AXQA 5CZXA 1RCXB 4R5PB 3PW7A 3EPGA 1ZPVA 2DHAA 2M8HA 1X4DA 1Y11A 1S0NA 4ELUA 4LJMA 3QZ7A 3OVBA 4ZCLA 1UEVA 2FHJD 1FKOB 4ZVHA 3MECB 4F7VA 2QTWA 4A8QA 3KLIA 4Z2XA 4M1KA 2UV8G 4WK1A 1X5TA 1BE4A 3MPVA 1ZAXA 2RNEA 5KT2A 1D3WA 1NSAA 1GXLA 2M5YA 3K59A 4Z7CA 4CO4A 4R25A 4QCLA 5HLFB 1HQUA 1VQSA 3HSJA 5AXNA 3L09A 3GIJA 3BB5A 1ZTTA 1IN0A 1RQ0A 2D3OR 1IXKA 4USMA 3BQ0A 1Y4ZB 1EQ0A 4L76A 3QGIA 3ISND 3LOUA 4KKOB 4FDFA 2M4MA 3R27A 2RDDA 3MURP 2YX4A 2CJBA 4OYAA 1TKZA 4ZPCA 3RZAA 1X7VA 1NZAA 4NXNF 3I31A 1OQ6A 1PYOB 4L3NA 2BQRA 1F3VA 5T41A 2DY1A 3GJSB 4X62F 4J9KA 1HNVA 4LRBA 2FY1A 4PXEA 4A8WA 3K5LA 2NUHA 5KFPA 3MPUB 4EZ9A 1QSLA 3NNHA 3DRSB 2H1YA 2Y8WA 1HQEB 3I32A 4ZJQA 3MOJB 4K4UA 3DMJA 4PCQA 1HW9A 3QT6A 1AFJA 2ZD1A 3FNNA 4EU0A 4NXNJ 4PUOB 4NLVA 5IM0B 4MYTA 4GKKJ 4N7TA 5KFNA 4X62J 1TV6B 1UWBB 3N9UC 2V2ZA 1SVDA 2HZCA 1FKPB 3VTIA 4E2FB 4IFVB 4JI1F 4ELVA 1YJWS 2H4WB 1RT2B 2VDIA 2PMZD 3GILA 3K5NA 3DYAA 1R8AA 5K14A 1VMBA 2DCUB 2VFTA 2V8PA 3U1LA 3CDEA 5GAHU 1YX2A 4ECXA 3OR2B 2HQGA 3V6HA 5EWFA 2VC1A 5FJ4A 4DR5F 4PG7A 5E0OA 3LQVA 4KIAA 1IR2A 2NQPA 2HSEB 4ZPAA 2BABA 4OZ3A 1EKRA 3W3SA 2BV3A 1DURA 3DDIA 1T03B 3A8EA 1SL2A 3MM8A 3UCGA 3KLVA 4F3OA 3OPKA 3MR5A 5LJ5Y 2OO4A 1R0AA 2KRBA 2ZDOA 2VICA 2AHOB 1Q16B 1NK9A 5KFHA 1M5HA 3MGJA 4WPAA 2UVVA 3ZTOA 4FF1A 2Y0SD 1SL0A 4DR5J 2HGNA 3AJ2A 4GVBA 5A2QU 5AT1B 1D1UA 3J80Y 1VQ5S 4LF6F 2DRAA 2LEAA 4WFXA 1VLYA 1VBXA 2G2OA 2MLYA 4M95A 3R7BB 2GMJA 2WVCA 2XYHB 4HT5A 1YQHA 2IRYA 3M8YA 1AROP 2AZ1A 2MHEA 1S72S 3EPIA 1XN9A 1SKUB 3VQSA 3I5CA 2EEYA 3ULHA 1KVKA 2JSXA 1PJ7A 4OX6A 3OR1A 4DR1J 4X2BA 2OEKA 5A6PA 2VG7B 4Y2KA 3H8YA 2EFGA 2MKCA 2R9LA 1NJXA 1VRUA 1R8PA 2MYFA 2A10A 4PPDA 4CWBA 3ONQA 4OV1A 1N52B 4C8OA 3POTA 3AT1B 6FD1A 2VFSA 2E1AA 4R0JA 1JXEA 2FZCB 2GVZA 4MKYA 2YWGA 3M8PB 2ASDA 2CKWA 4DV2J 2YWEA 1SJ4P 3DLLQ 2YTCA 1F2HA 4DN9A 1J5OA 1NHVA 5CYJA 4MMOA 4MIAA 1KD1T 3Q0AA 4WIIA 2XNQA 4M5GA 5D3GA 2DO0A 2P2CB 1JLCB 3RTVA 2GGPA 3BKTA 2E9TA 1NHKL 1FFWB 5D6GA 2Z56B 1RBAA 1WJ9A 1HNWF 4O3OA 1L3TA 2ZBIA 2CQPA 1O8BA 2UXCF 4F04B 1FDNA 3HM9A 2GQCA 4MKBA 2YNGB 4C48A 1WI6A 4P71A 4DR6F 4ZP7A 2YBVA 4ANCA 4QU6A 4WKRA 2DR8A 4ALZA 1YJRA 1E6YB 3NCRA 3T9NA 1UA0A 3T9ZA 2AT1B 1RTIB 5B08A 5C25A 4WK3A 4CT8A 2YQ3A 1WORA 2RH3A 2MZJA 2MZRA 2CQIA 2UXCJ 2CWKA 2HFZA 3EZ5A 2B6AB 1F9FA 3UW1A 2QLBB 2W01A 3DLHA 3DOMA 1WEYA 2KL8A 3OLBA 1HPZA 1LWFA 1CS4B 2DNGA 4HR2A 1X4CA 1S77D 4RW9A 2CJXB 3H5SA 3GCWP 4TLQA 1WC3A 3D6FB 2K1RB 2RE1A 3OUYA 4RW4A 1HR0F 3HFVA 4P73A 1WSVA 4KAIA 5E5NA 4PWDA 3OT9A 1WOPA 4J37A 4NLDA 2Y1IA 3M8ZA 1DLOA 2J0XA 1DTQB 1LEOA 3JAMY 3OXFA 1S9EA 4ECVA 3AAWB 2RU3A 4DR3F 1A0OB 1X8DA 3U02A 1H3DA 4FYYB 4ED2A 2R2RA 1KR4A 3FEXB 5SZTA 2A0FB 1GT8A 3G71S 3GV8B 2RQ4A 2L48A 5KFDA 1Q7LB 2SXLA 4F25A 4ZVTB 5C2CA 4DV1F 4UUXA 1I6JA 1SJQA 2GC8A 1NXIA 4AL7A 1HR0J 2RUSA 3OW2R 1RWKB 3HHEA 4WXWA 2GX8A 4DR2F 5L46A 1KFSA 3AD9C 1D09B 4KSEB 3KNAA 4USHA 2C3YA 1CVJA 1EZZB 2I2YA 1PJ6A 3HD2A 2IBOA 1YZ7A 4NMLA 2ZOGA 2Y1JA 1TQLA 3UNYA 3OL6A 4IRDA 2O01C 1FD8A 4RUCA 3GJQB 2ACYA 2HFSA 4DPUA 1S0OA 2LKZA 5J1NA 5JMNA 4CLYA 3KLHB 3CGIA 4RBUA 4J9SA 3ZZPA 4LT6A 2OEMA 3LWLA 1XERA 4DR2J 3CCSS 2WW4A 2RU9A 3SSSA 4ZS6A 2ZH7A 1TK5A 4ZK7M 1REVB 1S4EA 1V9OA 1OY9A 4KGZB 5D0RA 3OSNA 1QJHA 4Z37A 2HNZB 5C24A 2OKQA 2W2OP 1QVFR 4K4XA 5DG9A 5J2QA 2XGQA 3Q8UA 1Q53A 3NOCA 2LXFA 4IDKA 3FBEA 2HHXA 3NEKA 2E1PA 3WIUA 2HNDA 2AJ0A 1S79A 2ALYB 5F8MA 2HFOA 4MIBA 3X1LB 2OTJS 4LSLB 1RHRB 5LMUF 3D4JA 2BJ7A 1GFWB 3HKZD 1NH7A 4KQZA 2OMLA 2XI2A 2B51A 2MQQA 2NPFA 2F1FA 4WE1A 3TP2A 3VAJA 3J81j 4YB5A 2BW2A 1WTFA 2FHMA 2GIFA 2BA9A 1B7FA 3RJMB 2Y9HA 1IM6A 2XS2A 5KT4A 2HQ3A 1VRQC 1TR0A 2BANB 4BC9A 5DDRC 3NGDA 5GMDA 2QV6A 1YK9A 3TI0A 1KQFB 1NNDA 4GRSA 2QT7A 2HMIB 2J7UA 1FWKA 1FVQA 4JI2F 1VYAA 5T14A 3C16A 3CSKA 1R6YA 3AJDA 4ZITA 5LMUJ 2Z2YB 2BMBA 3PW0A 1M5OC 2HHTA 2WSCC 5K8MA 2DGOA 4ZHRA 4ZVFA 2DGVA 1LWEB 3O1LA 1BD6A 3H25A 5I42A 5KOWA 3OLAA 2W4PA 2EG1A 2BJ1A 2R8HA 4ZPBA 2MLZA 3M2VA 1GK8A 1JNZB 1S1XB 1PC5A 4NA1A 2V69A 5HI7A 2C2RA 3H59A 1ZA2B 4IQXA 3AOBA 2FVSA 4LF9J 3D66A 1HQUB 1PC4A 5LSLA 1FWPA 3EYZA 2VBZA 3QO9A 3M05A 3M32A 4ZIVA 2NS1B 4PXCA 4D3HA 4IKAA 1P27B 3JXOA 2XLJA 1QTMA 3IO1A 3BQ1A 1RWVB 4DFPA 4DV0F 3W2WA 3GIMA 1JJCB 1FRKA 4ZP8A 4JB8B 1CJTA 3CD6S 1CPZA 1NEEA 2LEBA 2AEJA 1TKZB 1N56A 1URNA 3NGUA 2VG5A 4RUHA 1P9QC 1PJ5A 3MFHA 4TU8A 4ETZA 3CDWA 2IFXA 5LJ3Y 1WUUA 1U1OA 1DBDA 2CADA 2NSCA 1G6BA 3MCNA 3MPDA 3CJQA 1P1TA 1H72C 2CQ1A 2XMKA 2BDPA 1LFWA 4L6V3 4DV7F 4KC5A 1MROA 4DV4F 4ZVRB 1JNRB 3RGIA 2KO1A 1QUVA 1HD0A 1VC5A 2JHEA 3LPYA 3W60A 1MWYA 3DMJB 3MM5A 3BR8A 3TEHB 2XNRA 2ZD1B 4WFNQ 5LSOA 4K5SA 2KXFA 1SC4B 5I3QA 1URRA 3IR5B 5ETTA 2UXDJ 4USTA 2VJUA 5HQ8A 1EARA 3P4UB 5EWGA 2ZJPQ 4PYDA 3C14A 3GE9A 4P74A 3T6BA 3TUJC 4DV6J 2FVRA 3N6LA 4DV4J 5E3AA 3DGPA 4NLSA 1WF2A 4RU9A 1NSQA 2QL9B 4AL6A 3DYAB 3T19A 1D9AA 4IQMA 2OPSA 2XYPB 1X0FA 2QYCA 1R3NA 5HANA 3QAEA 1Q79A 3V6KA 1QUPA 2AZ3A 1T3OA 1MMNA 1SBRA 1ZAVA 4M5IA 2IVFB 3BGUA 3EE3A 2CPYA 2V9KA 9ATCB 1FXRA 1UJ5A 2QL7B 3DU6A 1Y3JA 5H9EK 4QBUA 4CO3A 1RT4A 2HRUA 2UXBJ 4NEYA 3MM8B 4Y3CA 4OHZA 2NSBA 1YSJA 5FIIA 2YNHB 1TKDA 3MUVP 5BJRA 3FFIA 4C11A 1N88A 3JSBA 5DQGA 4N8NA 3H2LA 3V6JA 1LNQA 1BWEA 4QWBA 4EBDA 2C2NA 2MDAA 3V4IA 4I64A 1Q7YT 1AT1B 4V19J 2KU7A 1VCTA 3B82A 3CD7A 4F4ZA 4YY3F 1KONA 4LFBF 2OPPB 5KFKA 3MOZA 2Z58B 2GHWA 2E1CA 2N3OA 3KDOA 3KLEA 2NYIA 3H2VE 4F3MA 1J5EJ 2QG9B 1UEUA 1S9GA 3W9JA 3GIRA 1IJFB 3OR1B 5LXRA 5KG4A 3QJPA 2YX7A 4B9TA 3IFEA 4A8OA 4DLEA 1Y10A 4MK9A 3PIPQ 1XR6A 1QSYA 1N0VC 1VRUB 4QW9A 2PE8A 5IC4B 4I0WA 2YQ1A 2CQ0A 3POTB 3QIPA 3N28A 1CJUA 1OYDA 4ETXA 2VPZB 4YY3J 1C0UA 2PEHA 2F65A 2B0GA 4FYXB 4O3NA 2GVZB 2RDJA 3K0JA 5KFJA 3CCLS 1YKWA 4LBHA 5EUHA 1M5PC 4LBPA 3WHIA 3Q8VA 4AT1B 4ECSA 4KR0B 1F2GA 2NPIA 1J5OB 4OMFG 2JVOA 2RHSB 1CLFA 3R6LB 1B70B 4BC7A 4KHMA 4AL5A 3U27A 3PKYA 2DRDA 5D3GB 1C0TB 1NDCA 4O0IA 3PXGa 1U0HB 2C2KB 4ZVUB 3OXGA 2GGPB 3BEGB 2MKYA 4CM2A 4B3SF 2DTJA 4PKDB 4LRCA 2WTFA 2HLUA 1FCAA 2VOOA 3EGVA 5DGBA 3PG9A 2QZ8A 2G2YA 3HJVA 1IUJA 2EC0A 3MEDB 3AQPA 2AQ4A 4Q0BA 1XMOF 5SUHA 4C98A 1U45A 2Q43A 4EI2A 4CLKA 1LXJA 2AJ1A 1IR1A 1LWXA 3A3OB 2AYEA 2ZC3A 4U7UD 1RJJA 1JLFA 2V6AA 2AJ4A 3MAQA 3PHTA 1IM4A 1XMQF 2B9YA 4WBFA 3GCXP 1UAWA 3QRQA 5DM6Q 5KG7A 3AXMA 2E9RX 5C25B 2ZWPA 2VHGA 4C4WA 2OUGA 3ZZ0A 1BQMA 3AOAA 2LQJA 7FDRA 1SIWB 1XEZA 1WHXA 5D0HA 1X5PA 2QLWA 1CSJA 3Q83A 3DOMB 1HPZB 3KUHA 1LWFB 2XYGB 1XMQJ 5RUBA 3CCVS 3IWXA 3HPOA 1N5SA 4RW9B 5C5JA 2VFVA 2OEJA 1RP5A 2VBWA 1IBMF 4FS2A 2JFKA 4F4KA 1FK9B 2DGSA 3BSNA 3AFGA 1UWAA 3OUYB 4RW4B 3J7AN 4PWDB 3CUNA 5HATA 1N0UA 1DLOB 3G8SA 2IA6A 1S9EB 1NM2A 3HVAA 3OQ2A 1FNMA 2MQMA 3TQEA 2J0QD 2A3JA 2OHDA 4QR0A 4YFUA 4ER8A 1RBLA 2HIQA 2HFNA 1SV5A 1QLNA 5ETPA 2Z2ZA 3W5XA 1IBMJ 2MKHA 4JI8F 5MLCV 2CQ3A 4FS1A 1N32F 4WU3A 4BLGA 2DXEA 1E6VB 4C9DA 3G2XA 4L72B 4J9QA 2XWYA 3RYLA 3SCIE 4U67Q 1X5OA 5K8PA 5IT9U 4QIWD 2JLFA 3DRPA 2VOPA 1HBUA 3HSGA 4KT0C 3BKFA 3HT0A 3C66A 5KFTA 5BYSA 1NDLA 3IR6B 3MMCA 4KHRA 4JP8A 4DSIA 2W7PA 3NAIA 3GONA 4JI3J 2CUYA 1OMSA 1BUXA 1QY7A 2MMYA 1JK9B 4JI8J 3JSRA 2RRAA 2KG1A 1IBCB 4F26A 1RWWB 5E2QA 2IMWP 3PTWA 1ZBTA 2KT5A 2W24A 3SBMA 5DM7Q 2GMHA 4C8LA 4I67A 3UVJA 3F41A 5KT6A 3FRZA 4M5MA 5C24B 2QMWA 1KN6A 2E5IA 3M2RA 2JRSA 4HT7A 3MD1A 4RBTA 1YJ9S 2DVIA 4ZVEA 3AB4B 2XZDB 4K0KF 2C2MB 1KDNA 4IDKB 2HNDB 2H5IB 2UUCF 5GAGI 4YB6A 1BY9A 3CCMS 2QA4S 3IG1A 2VH7A 1RAGB 4RLEA 1RT6A 2UVUA 3DDNA 2QEXS 1YBAA 3C2PA 4WE1B 1S97A 4QIFA 4NLYA 1SI9A 3EDQB 2MY8A 4NA2A 3R97A 2N82B 2B4UA 2ZH2A 3CMES 4F4AA 1PGZA 2E1RA 4G65A 2BJEA 2DR6A 5CXTA 1UVMA 4HEA9 1WG4A 4C3LA 4ID5A 2W9CA 4OX9F 3C16B 2UUCJ 2C1EB 5A6WA 3H5XA 3VVUA 1U26A 2MQOA 2G0CA 2W7OA 2DH8A 4HH0A 1WACA 5HN0A 4EEYA 1L3SA 2DGXA 4ZHRB 4M5NA 3KYLA 3HLUA 2RKIA 4H4KC 5K9FA 1MN9A 4DFJA 1X9MA 2JJ4D 3BDEA 5F8LA 4LF5J 1S76D 3GV5B 1C4AA 3M2VB 2M88A 3HHDA 2XHWA 5DRKA 2E9ZA 1YRUA 2MQNA 1UVKA 2KVQE 2L9NA 1HWKA 3JYTB 5GAEI 2R3VA 3PX4A 2BRKA 2B43A 2YKQA 4DCJB 4ENOA 3VAIA 3A13A 3TOQA 1T9XA 1RT1A 3G9CA 2H5JB 2CQGA 1OJ4A 3AD7C 2QJ3A 1HMVA 5CCLA 3OSPA 3TUIC 3CJ8A 1TL4A 3W2WB 1G2EA 1LK5A 1WF1A 2HVEA 2IDEA 3BJYA 5CD4A 3P5TL 2UU9J 1CJTB 2M9KA 4CYUA 3N4WA 2X1FA 5MAOA 2HG4A 4AUKA 2ZM6F 2VG5B 1UCNA 4IH5A 1YHQS 4Y2AA 3VQTA 2CPHA 3UCZP 3DGVA 4CH1A 4DQIA 4QIGA 2R8GA 4OI4A 1AUDA 1PYSB 4RWXA 3FBCA 3K5PA 3VV2B 4LR7A 4MH8A 2KFNA 5AXLA 2XZWA 2WBRA 1BGXT 1SQEA 2CG8A 3TZWA 1MROB 4RU2A 3TUZC 1R8CA 3UR3C 3BSAA 3P49B 1MU2B 4ZMMA 1IBKF 3MM5B 1U1MA 3Q86A 3KK1A 3R7NB 3LUYA 1JLAA 4IH7A 4Y34A 5ADZA 4NI2A 2QA2A 2ZE2B 3C14B 2GAGC 5F3ZA 2F4VF 4ED1A 2WSEC 3PRVA 1S0VA 1T9UA 4ECZA 1ZA1B 3DGPB 4B3RJ 4DSLA 3QRPA 1XTZA 3TA1A 4FBUA 5K8NA 4DF8A 4C8KA 5IWAF 2OPSB 1IBKJ 2KHCA 2CNOB 2E5HA 1RBOB 1M1HA 2MZ1A 1S6QB 3QBCA 1S0MA 4Y2CA 1CQNA 4PYAA 2ZUAA 1ZM2A 2W1BA 4TXSA 3S01A 3CD5A 2ZHBA 2FHJA 4MJKA 4RJVA 4ECRA 4I56A 3E8OA 3NBPA 2XI3A 2G13A 5E33A 2ACMA 3FMWA 3FFIB 4C11B 4X4UA 1K1SA 2KT3A 2ZVSA 1TL3A 4DL5A 4OYOA 4FZVA 2IMOA 1GX6A 1IKWA 3M2UA 2YXLA 4YDDB 2IHR1 4DDFA 4ZVQB 2CPIA 2JL9A 2YKNA 2F8EX 3IRXB 4DG1A 3V4IB 2WRMA 3K2YA 4CIOA 4QWCA 4OJGA 5DO2A 2X1GA 2LLZA 3EVWA 1FTCA 2JC1A 3A8IA 1S7HA 1D8YA 2E5GA 1FRXA 3KLEB 3OTOF 4OYZA 1APSA 1VQ4S 4DX5A 4C8ZA 3MMAA 1S9GB 4HVZA 4IOBA 1D8ZA 4A4JA 1R0CB 2KB2A 1VQNS 4DX7A 3GLJA 3IA0A 1T02A 1PYTA 4LSZB 3M4XA 2VPYB 1EQMA 3QIPB 1S1TB 1CJUB 4CO5A 2DH7A 5FD1A 1C0UB 2DEIA 4TU9A 1HI8A 3EICA 3MM6A 1TKTA 3MMBA 3GB0A 3B78A 1HARA 2EG2A 3D9BA 1B0PA 1R89A 2EBGA 2HWHA 2MSSA 3C46A 1MMDA 3QT7A 4Y6IA 3QFWA 1RHJB 1WC6A 3GV7B 2C3MA 3EXYA 1UP1A 3Q24A 4M5KA 3WIVA 4DPXA 3NS5A 2OGUA 5AXMA 3I5BA 4Q0BB 2CQ4A 5IFMA 3TEGA 4WFAQ 2RS8A 1PSDA 4CT9A 1JLFB 1VS3A 4KGMA 3R5BA 4NWBA 4WYWA 4LRAA 1I94F 5KT3A 1U47A 2AJ2A 4IUFA 4AD6A 1WHWA 2ILYA 2E1MC 4A47A 2R8IA 4DL4A 2HS4A 3QWPA 4OFZA 3T5JA 1GQEA 5HO4A 1BQMB 1HHTP 2BE2A 1NB2A 2AX0A 4CO0A 3DLGA 3G6ES 3W8PA 2R2UA 2ROPA 4RNHA 1Z4UA 2RF2A 3GFZA 4LF7F 4NX9A 5B0BA 1I94J 4DBQA 4CH0S 2ALZA 2MGZA 3NNCA 2XY6A 2VFRA 1IKYB 4BHQA 3E3XA 3CB4A 2YVSA 3CJ3A 4URQU 4ICLB 1RABB 4B9MA 1QD1A 3KMQA 3KLFB 2Q3PA 1TFYA 4P2MA 5CHCB 1P6TA 4MKAA 2Z0GA 1R8HA 3CF5Q 4WXOA 2VL1A 3I9V9 2EFQA 4X4OA 4LF7J 4ECQA 3MR2A 3OTBA 2WVFA 2VZ9A 1S6PA 1SV5B 4DQSA 2OJ3A 4AYBD 2L3MA 3A3PB 3QSIA 2EI5A 4O44A 2CNNB 1Z2LA 3HP6A 3EGNA 2IY5B 2XEXA 2YH1A 2XMTA 1CQMA 2CFXA 2DHGA 4NA3A 3H2UB 3R7SB 1F3FA 2E5LF 4FXVA 2HZAA 3DRPB 1HBUB 4RL1A 2LMIA 2DNPA 3MMCB 1N5YA 3ZNUA 3C3LA 1VHFA 3W9HA 4DUZF 2IYIA 2AP6A 1VQPS 5F8IA 3CC7S 4I2QA 4ZVPB 1RAHB 3G4SS 1YGYA 3CCJS 3FQLA 1QAJA 3G8QA 2XMWA 3CMQA 1X60A 3M9NB 3TVKA 4Y2MA 1VC0A 3T5KA 2BR0A 3A12A 5F0UA 3BSCA 1O5JA 4CO1A 1GEHA 1K9MT 5T7LA 5CQGA 4OX8A 5CYMA 2HAIA 4OZ2A 4DUZJ 2PN6A 3M2RB 5HMZA 1YJNS 3FCVA 3L7UA 3SIPB 3HHNB 5HQLA 4TY9A 5L9NA 1LWCA 3W66A 1U6BA 4RW7B 1X5SA 4O3PA 4Y00A 5DDQC 1UMJA 3DRXA 4DHVA 2QSWA 4OI3A 1FRHA 2FVQA 4MK7A 3BN4A 3IG1B 5DDPC 1YI2S 4CO2A 4J9PA 2KYXA 4X66J 2NXEA 4PUOA 4OJ1A 5IM0A 2H48B 2IJNA 3RU0A 3I55S 4TYAA 3Q23A 5CA5A 3BH6B 2UUWA 5DLGA 1WNEA 4IFVA 1WF0A 3QNWB 4ID5B 2BOAA 4PXBA 2W9CB 3H90A 4JI7F 3MR7A 1V6HA 3SSRA 5DJBA 3RRKA 2A2DA 2VQFJ 3AJ1A 3ET6A 1RDRA 4XDCA 2RILA 3ETOA 1ZAWA 7FD1A 2LEPA 4ZLLA 4B17A 3EVOA 3BQ2A 4EGLA 1TMJA 4K4WA 4ZKAA 4CTAA 1SH3A 5KFXA 3PYDA 4QPXA 4JI7J 4WZMA 4ZPDA 3N5FA 4OYPA 4JI0F 5B09A 1HMVB 1IWAA 2RQCA 4CP5A 3J7ZT 3DHXA 2IDLA 1HI0P 3P5BP 1WWHA 1Q1KA 2P5VA 3DC2A 2HVIA 2LA6A 3ADAC 2PGCA 2MLXA 1M5KC 3ILIA 4I6YA 1WC0A 5HBMA 1U09A 3H40A 1Q0NA 4YHHJ 4X4QA 4BS2A 2OH2A 4N56A 2XY7A 2G0IA 2DHXA 3DKDA 3R6GB 4KO0A 3UN3A 1SC3B 3M8RA 2DKOB 3HHLC 2EVZA 3FDSA 3KK1B 1RHQB 4OQJA 2VB6A 1JLAB 1KTVA 3MUMP 5KFLA 3IM8A 3KHHA 4NI2B 3C6TA 2CNLB 3HVRA 4LF8F 4WYLA 3NXZA 3BV8A 4LBIA 2KFZA 3M6VA 3HMJG 3WBZA 3J81Y 1U48A 5DZ7A 4PWWA 1FJCA 3IBCB 2F8HA 5LMNF 2C2EA 1U2CA 1DQ8A 1ELOA 1HNIB 1JIHA 2FHKA 5HAOA 5HVFA 1FD2A 4F02A 1ROFA 1S57A 1F5BA 5KTQA 2M70A 1U1QA 2V2VA 4WJBA 2NUUG 1F9EB 1FO1A 1SJ1A 3CEDA 4JYAJ 1AW0A 3SZ2A 4RNNA 1JQGA 3MR3A 2Z2LA 1H7WA 3JAMU 1SIZA 3NGKA 1HNXJ 2DGWA 3D3CJ 2DR7A 3N01A 4KH1B 1YJUA 5LM7E 3NBPB 2R7SA 5KFRA 3PX6A 5FDLB 1KLNA 1VQMS 2JEGA 4ZVOB 3NWGA 1TL3B 3HO1A 3SEOA 4NCBA 3KFWX 3M2UB 5KG5A 3CD0A 3I0RA 2F8MA 2YKNB 3KHGA 2FD2A 3Q8PB 2MY7A 4DG1B 2DPJA 4PWUA 2BOPA 5CYQA 3LH2S 2DXDA 4ANEA 4N47A 3OD2A 2J7KA 2DCLA 3TUPA 3JS9A 1X9SA 4K4SA 2DNHA 1LKZA 4H4KA 1RTDA 3PCOB 4JI5J 3ILLA 4OL8A 1QTNB 4CLTA 3MMAB 5D15A 1VIXA 3CDAA 2QA4G 2KH9A 2XCAA 2XS7A 4CLLA 2JVRA 5EWEA 2HLTA 4OZJA 4UT4A 2CAJA 4ZJOA 4USUA 3PO5A 2MTLA 1TVRB 4I68A 3MMBB 5GAEU 1KSPA 3DN9A 1BMQB 1HKAA 4LIWA 3U1MA 3GPAA 2J76E 2U1AA 3KK3A 3FCHA 2ZNZA 2VBXA 5DETA 5DG8A 2QFJA 5JVHQ 1FVSA 4ES3A 1ZZFA 4Y2IA 2CRLA 2ATLA 2HYIB 3FRYA 3UQSA 3T1YJ 3GFYA 1HA1A 3S6EA 4DSKA 1XNQJ 3RR8A 3CDUA 1H2VZ 2NXNA 1RAJA 1DQ9A 1RB0A 2C2ZB 1CG2A 5LT5A 4OZLA 2H54B 5IV4A 3W9IA 1N36J 1AZSA 2GQ2A 4G1IA 1S4FA 2DGQA 4RZRA 2KKHA 3DLJA 4EUVA 5IXUA 4DUYJ 5D4NA 1NBEB 3H5UA 3B8HA 3TWZA 3QGPA 4LMZA 1UPPA 5L8RC 4WP3A 2BYCA 2BE2B 1KTQA 3DLGB 5DQHA 4W92B 1OPIA 3PKMA 4UQTA 1S6OA 1R0BG 2XB2D 2DPIA 3MPYA 4K2JA 3MMJA 2V9WA 3G6YA 2FVCA 4B9SA 2J6SA 2JWNA 5F0WA 4Q8EA 5L38A 2CPJA 2DBBA 3EGWB 1XWLA 2OELA 2WW8A 2MGZB 1VQ8S 1Y5IB 3QAUA 3US5A 3KHRA 4KV8A 1DTTA 4C8MA 2LQ5A 3TR5A 5DLFA 3GJRB 5CABA 2E5JA 5AE1A 1I1GA 4ZP9A 2RQKA 2HK3A 4P2FA 3DI6A 2KTQA 4ECUA 3V2UC 4C6AA 2CZ9A 4F2SA 2IC3A 3MWBA 1SL1A 2BANA 2AGPA 2DH9A 2LDYA 1RHKB 4OLOA 2PMHA 2W4DA 2HMIA 3TJAA 1NK5A 3S1TA 4WFYA 1S6PB 4N76A 1GTEA 2RIJA 4DSEA 2LXUA 4KGVB 2FVPA 1WSRA 1YRTA 4ES1A 4O44B 5GADI 1U8SA 3D54A 2AEFA 1RK8A 4K50A 1LWEA 4DV3F 3M8QA 3MEGA 2FJEB 1H73A 5EN1A 1ZS6A 3KK2A 3TAMA 3LPEA 3AOCA 5A8RA 1YWXA 1X4AA 3GR1A 1HWUA 1S1XA 1KOHA 2GHPA 4HACA 4OZNA 2C3PA 2V4RA 4Q7AA 1N5YB 2NREA 1RAAB 2DHSA 1M1KT 1XMBA 4I2QB 2WHOA 1B0TA 1YVFA 3CDBA 2W8LA 5KFQA 3EJMA 1FE4A 1F0XA 4JV5F 5IZHA 4DV3J 4ZOSA 1S7IA 2KJWA 2OMOA 2I8EA 4ZLPA 2K7KA 2C22A 4J91A 2NCKL 3LTOA 1SC6A 5T7LB 3LAMA 3ELHA 2B9XA 5CYMB 3HVWA 3KG4A 5HQMA 3KTQA 4GKKF 2AYMA 2RMLA 2D3UA 1NH8A 4WKYA 1GX5A 2ZITA 3I82A 4UF4A 1JJ4A 1RWUA 4JV5J 4LF2A 4OI6A 3TX0A 4EBEA 2AJQA 1LWCB 2ZH3A 2I6WA 2O67A 1VQLS 3DLKB 1ULRA 2BQUA 1V3RA 1U7LA 5H9FJ 5ETOA 2HBZB 4HL9A 1NPKA 5DGAA 3MR6A 1FDDA 2I0XA 3IRWP 4N41A 1QVGR 1W25A 4X65J 4KHPJ 1SQFA 3GYXB 2AV5A 3A3NB 3PR5B 3KKFA 1JWWA 3HX9A 4NLGA 4OJHA 4JBCA 5E3CA 3OFGA 4CNYA 1RWPB 1OSDA 2PD1A 1JMTA 2Z8QA 3ET6B 1NCLA 5HJXA 4UOHA 2C2OB 3FSIA 3BGLA 4FF2A 2PIIA 2IM3A 4ED8A 3I56S 4HLBA 3OHAA 1X31C 3ICLA 4CTAB 4NLWA 1LXNA 3TVZA 5GAHI 1T7PA 2YNHA 1TK8A 3KJVA 4F4YA 1NB7A 2BZ2A 2J9CA 1P8GA 2CDQA 1YLXA 3IM9A 4FXWA 1LW2A 3IS9A 2FZGB 1RT3A 4BDPA 4DR1F 1UW4A 3RRHA 1FTRA 4WU2A 3RBEA 2EK1A 1FF2A 3Q2TC 4RX6A 5M2PA 1H6KX 4OI2A 4X84A 4USVA 3W5ZA 2XLKA 2ZH8A 2OPPA 2K3KA 3QFHA 4P75A 4C2MA 1S1WB 5BR8J 1W2IA 5HBMB 4I7FA 4DV2F 3PV8A 2UVWA 2LECA 3LAKA 3CVKA 4ZPVR 4DFMA 3V5RA 1F6TA 1VBKA 1TAUA 3R5JB 3VCDA 4KO0B 2ZBPA 3UDCA 2KZMA 1NJYA 1T8EA 1NPRA 4FPIA 3DLEA 4NLQA 1S48A 1CJKA 1U6ZA 1TP7A 3VZHA 5A76A 3C6TB 3SFGA 3AODA 3DOKA 3GSIA 4QYZJ 1UVIA 1FT8A 1S49A 2F5GA 4KYZA 1YZ6A 3QGGA 1AA1B 1VR6A 3A8JA 3TAPA 3N5BA 1C0TA 3MCSA 4OYWA 3OFHA 1U0HA 2HVHA 1WC5A 1UZHA 1KKHA 1OIAA 2F9JA 2BXJA 1EHWA 1B0VA 2IYGA 1WG1A 5L9XA 3MEDA 2Q79A 1PIEA 4NXMF 2DNQA 3TRGA 1U6FA 4JV2A 4NE9C 4LFAJ 3LF0A 4DMZA 1U0SA 3PFEA 2B8QA 1D9FA 1T94A 3EVMA 3GQCA 1U1NA 1F1BB 2LVWA 1IKXB 1NKEA 1B64A 1CC8A 1UEKA 3I0RB 4HI2A 2W2PP 3BGFA 2CIMA 1MW7A 1ZOTA 2DNNA 2X51A 3MM7A 3CCRS 2VJVA 3FUYA 4NXMJ 5CYQB 1RLCL 4I6AA 3H98A 2A18A 1OS5A 3MEEA 2RT3A 1NK4A 1C1CA 1X4EA 3BBFA 1JLBA 2BUNA 4LSNA 1RTDB 4OHVA 3PNIA 3D3BJ 1KEKA 5J1PA 3OL9A 4B9UA 3D6MB 2EFNA 4OYBA 4MKVA 4C8NA 3ZFVA 1FK9A 2QYGA 4UOFA 1Y5NB 2OPQA 2WBMA 3R5AA 3T3FA 1GXUA 3RB0A 1BQNB 4ZLNA 3L4BC 1HI1A 4DLGA 2AWZA 3I6PA 5IOLA 3W63A 1Q8LA 5AJ3F 1VQOS 1GAOA 3O5TB 1WEZA 1VK8A 2ZEJA 1AYEA 3KK3B 3KUGA 1X9WA 3QWUA 4B3TJ 3M1VA 3MTKA 1E6VA 1VISA 2A2CA 3HDSA 2IJRA 5K20B 1U02A 3CCUS 4TVAB 3PW2A 2IRUA 5IC6B 3EZUA 3GYNA 3KJFB 3H0PA 2DITA 1NMEB 2V8DA 1WKJA 4NLUA 3WZ0A 1KP6A 2GHVC 3MDFA 1FEHA 2L41A 2GAHC 2YKMA 1VK3A 4IO1A 3M8SA 5AJ3J 4OI0A 2V8HA 2HFVA 3T5HA 2WVDA 2GVDA 2ZWOA 1JLGB 2OSQA 2W2QP 4UY8T 3JQJA 1AZSB 3HHLA 2Y8YA 3G87A 4K7QA 2ZBQA 4QYRA 1N5QA 3CJ5A 1BWVA 1U2RA 2OD4A 2F7VA 3RRGA 5L39A 2EKYA 5FLXU 3CJ0A 4DPOA 2MQ8A 3G96A 3MAAA 5K5MA 3OHBA 1WDTA 2BM1A 1UTAA 3DHWC 4AE5A 3UR0A 3VAKA 2CPFA 1NHUA 2MJNA 1B7YB 3ETMA 2W25A 3MUTP 3W1YC 3DRYA 4USKA 5KG1A 3LP1A 2HZVA 4AXJA 2CJAA 5A8KB 1LFPA 1FRLA 2J6UA 3FMBA 4OIXA 4RWWA 4KV8B 4RW8A 3M7VA 1DTTB 2C2DA 4NEZA 3O44A 4JI6J 4EO8A 5LOQA 2QX0A 3DI6B 1FEEA 4DL6A 1U1LA 4E98A 4OV6A 2IC3B 1VQ6S 3R1LA 1MLAA 2V5HG 1N33J 4FF3A 1RTHA 4LF9F 3Q2SC 2P8IA 4A8XA 4AXIA 3KOAA 4QR2A 1Q78A 3RAMA 1JLEA 2HNYA 4TKTA 3IN5A 1R31A 2UUAJ 4C8YA 2J9DE 2MSTA 3GG1A 3M8QB 3MEGB 2CJYB 3IR7B 4ZDNA 1ZYQA 3KK2B 3TAMB 1A7GE 1PAUB 2C28A 5A8RB 2V2KA 3I96A 3MCMA 3IBWA 3SMZA 4B3OB 3RR7A 2IJFA 3BKUA 4GKJJ 3CJRA 4HACB 1A9NB 3JYTA 2JOQA 3PIOQ 2XY5A 4YEAA 4L75A 4M5HA 1ZZNA 5THWA 1TMMA 4Q44A 5KT5A 5HMWA 4LRDA 4HI1A 4TN2A 5A0YA 4PPZA 2HS3A 1WG5A 3S8SA 3HKWA 1HW8A 3G6VA 3PM9A 1HNZJ 5EX0A 4DOZA 1HD1A 2WB4A 1UFLA 2UXDF 3PX0A 4F36A 3TA2A 1TAQA 3M9MB 4DV6F 3HJFA 4CM0A 4C7QA 1TL7A 2QMUB 3SDEA 2XULA 2FYXA 3FSXA 4DZDA 2OSRA 1MU2A 3JSMB 2JX2A 4JV0A 2J7WA 2V67A 5HVGA 4CH7A 2W2NP 1KVIA 3BM7A 1BXNA 1RGVA 1QAIA 4DQQA 3F0NA 3BZQA 2B4PA 3GP9A 2ZE2A 5KFIA 4ZIWA 1KFDA 1RA6A 3SCKE 4YR3A 1IBLJ 3QIDA 1PG5B 3MPWA 2O1PA 2UXBF 1HL6A 3G86A 3T1AA 1KC8T 4XAKA 3HK2A 1H98A 3H42A 2VA3A 3OXLA 1SKRA 1YTYA 3J7YU 4YUDA 4K5RA 3SCJE 2D41A 3EXCX 2BJ9A 1XJWB 4X4VA 4S0MA 1TK0A 2C3OA 5F8NA 4LIRA 1S6QA 5L1JA 4M63A 3GWCA 3QJLA 1KLMB 3CJSA 4QIEA 3GFXA 2OP5A 4H4MA 2HHVA 3IP0A 3W7BA 2FTRA 2B3TB 3QYYA 3BYPA 4ZP6A 2FGCA 1HFEL 3K5MA 2WOMA 2R2TA 1OSCA 3AA8A 3CJTA 2DXFA 1RT7A 1Z2ZA 4B3MJ 3KJVB 1A6LA 2QC3A 2PDAA 1K44A 1IVZA 2K8GA 1LW2B 1N4LA 1J5EF 3IS9B 1RT3B 3WC0A 1WHYA 4OYMA 1YRXA 3TA0A 2BW7A 2LP4A 1J27A 2BKNA 3IRXA 2DHHA 2BQ3A 1H7XA 2HWTA 2IM1A 2IVYA 1GMVA 3QSYB 1Q8IA 2XSFA 4A8KA 2XQCA 5F8GA 3SYZA 5D4OA 1Y7PA 2WAQD 5KAKA 4I7FB 3LW5C 3R5DA 3AY0A 2GMLA 3THVA 2VQEJ 2E44A 4OLPA 2I38A 5CZVA 4MYUA 3RBXA 3S7RA 1N54B 4O3QA 1RCOB 3TARA 5D8HB 1S1TA 4U95A 2Y1RI 3FZBA 5KG2A 3DLEB 1CJKB 5ETSA 5ETLA 4USJC 1F5CA 2FC9A 2PI5A 1WDDA 4PZVA 2W4CA 3DOKB 5B0CA 3NRBA 3L3CA 1D9DA 2I9SA 4L3KA 1V3SA 5F8HA 1G4CA 1ZM3A 3MCOA 4K4TA 2D9PA 4KRWA 1AFIA 4EO6A 2OIHA 3IGVA 2LQ8A 3L7OA 3EGZA 2LCWA 2VFUA 2XS5A 3UO0A 3CCQS 3B54A 4DF4A 5J2MA 1XIQA 3OVAA 2COLA 2EC2A 2OLWA 1VQKS 1RTZA 1NKCA 2QGFB 2FB0A 3UE2A 1T9YA 4JI4F 4M5JA 2MPUA 3EM1A 3A1YG 4GC7A 3A4TA 3K89A 1AUSL 3PZPA 4NCGA 3EDRB 4CZCA 2AIRB 3CPWR 3DRRA 2YNFA 3ENQA 4TLRA 2XTJP 2CPEA 2CQCA 1VHIA 2LU1A 4HDGA 3I4HX 3OJSA 3GSDA 3OFEA 2ZZTA 1RT5A 3JTOA 1O51A 1WEXA 4J9MA 1RYSA 2ZOFA 2P9CA 4NL5A 3BDPA 1Q5YA 3MM7B 4JI4J 3DU5A 4F67A 3BO4A 3R3TA 1KOOA 1IJEB 2AJFE 2AKWB 3KWMA 3FVYA 3ENVA 1VDHA 1NO8A 3MEEB 3G8TA 4ZN1A 4X64F 3KG1A 4MFBA 2HURA 5J1EA 1C1CB 1JLBB 3FQKA 2YWWA 4LSNB 2DNKA 3HD1A 2XWXA 1IKYA 3UWTA 3VGVA 4ICLA 4KB7A 4LREA 3KLFA 4B02A 1B99A 3EX7B 4A8MP 3GJTB 2OPQB 1T11A 1VIOA 4YR0A 2JFDA 2XO7A 3QRRA 2QFIA 1SH0A 2OPRA 4GMKA 4X64J 2RDIA 2DNOA 2HEKA 2G0JA 1BC6A 3M30A 4JI3F 2XBPA 4NASA 2E7VA 1EB0A 3OL8A 2C3UA 2EWHA 3OVSA 3M1VB 1EP4A 2I5JA 3CC4S 1JJHA 4DV5F 2ZJRQ 3P45B 3UFCX 2FGOA 3L7PA 1QAYA 4FKYA 5CAAA 1TKXA 4JI1J 3VAMA 4I2PB 2HK2A 2WB1D 3CE8A 4B9VA 1UKUA 4LRFA 3PEHA 1Q5VA 1OYEA 1TUWA 2YKMB 4IOAQ 1PBUA 4ATNA 1NK0A 1D0EA 2GVDB 4L73A 4ECYA 5CH7B 4C0BA 3NS6A 3EMTA 4URGA 1EX8A 2EPIA 4DL7A 2HHHF 2MXYA 3HHLB 4XDDA 1RHUB 4DV5J 2Q66A 1DAXA 5E7OB 2MHNA 2DR9A
chains in the Genus database with same CATH topology
2FJDB 2FD2A 1P9QC 4RUHA 2NLWA 3Q8PB 2CVEA 4RBVA 2MY7A 3CJ2A 3CC2S 3MFHA 1UVJA 1JKHB 5EX3A 4TU8A 4DG1B 2XMMA 3D1HA 4ETZA 3CDWA 3VF0B 2IFXA 5LJ3Y 2KXNB 1VFJA 1FESA 2MZQA 3CJKA 1U1OA 2DPJA 4PWUA 2BOPA 5CYQA 1DBDA 5KFBA 2NSCA 2DGUA 3LH2S 2J5AA 2ERRA 1G6BA 3J7Z5 1K73T 3UNGC 4N47A 2J7KA 2DCLA 1P1TA 2CQ1A 2XMKA 3HXMA 3PHEA 4Q45A 2BDPA 1N5VA 1X9SA 4K4SA 2DNHA 5EGYA 1LFWA 3V6DA 1LKZA 4L6V3 2N4DA 1RYRA 4DV7F 4KC5A 2MKKA 1MROA 4H4KA 1RTDA 5AXKA 4DV4F 2YKPA 2J9DA 4UW2A 2NR0A 2YNIA 3IXQA 1JNRB 3C6UB 2CZ4A 4OL8A 2KO1A 5BYQA 3D1QA 3LP1B 1QUVA 3KHLA 4DX8H 4CI0B 1HD0A 3HZGA 3MMAB 1VC5A 4FVMA 2JHEA 4RW7A 2EFOA 4UUWA 1RTJB 3KLGB 1VIXA 3LPYA 3O6QA 1IQTA 2HRYA 1MWYA 3CDAA 3DMJB 2QA4G 2OAUA 2KH9A 4RW8B 3MM5A 2XCAA 4OHXA 3BR8A 2VD3A 2V4QA 4WF9Q 2XNRA 2XS7A 2ZD1B 2JVRA 4WFNQ 1FRJA 2HGLA 5LSOA 2PT0A 4K5SA 2J0SD 5IQQA 3VALA 1K0TA 5EWEA 4R5PA 2KXFA 5KFMA 3OTEA 3MI7X 5I3QA 2HLTA 1URRA 3IR5B 4OZJA 3QJJA 4XO0A 4ED6A 4IFYA 4LUBA 2MKSA 1G7CB 1RISA 3UPFA 3RW7A 4F3QA 5HQ8A 3PO5A 5EWGA 1EETB 2ZJPQ 2M52A 3GE9A 3X3UA 4FVCA 5F9NA 1U2FA 3BO3A 4CQ1A 1TVRB 1MMLA 1NU4A 4I68A 4USIA 1S1VB 3T6BA 4QWAA 2VC0A 3TUJC 4LF5F 3MMBB 2FVRA 5GAEU 1KSPA 4IR9A 3DN9A 2B5JA 4LIWA 4O4GB 3N6LA 5KFAA 4O23A 3U1MA 5E3AA 3DGPA 4NLSA 3BF4A 2J76E 4RKUC 1FKOA 1RTHB 1WF2A 2U1AA 3MXHP 4KFBA 2F3JA 3MECA 4RU9A 1FHTA 1K0VA 4DJBA 4AL6A 3DYAB 3T19A 5C42A 3KK3A 1M90T 1D9AA 3NG8A 1XK8A 4IQMA 3FCHA 2ZNZA 1L5UA 2VBXA 5DETA 5DG8A 2QFJA 2VG6A 3NCQA 2OPSA 1JLEB 3RBDA 1OPZA 2HNYB 5JVHQ 1M0SA 1X0FA 5EDWA 1FVSA 2QYCA 4LFAF 4ES3A 4N8OA 1ZZFA 4Y2IA 2MB0B 1R3NA 2AGOA 1N48A 2FDNA 2CRLA 5FLXY 2R2SA 2ATLA 3QAEA 1Q79A 3V6KA 1QUPA 2N3LA 2HYIB 1S1UB 1T3OA 3FRYA 1MMNA 1GXTA 1SBRA 3UQSA 1HYSA 2HHWA 1KRPA 1ZAVA 2UU9F 2IVFB 3BGUA 1X0PA 3GIKA 2CPYA 2V9KA 2AYGA 4NCAA 4RW6B 1FXRA 1UJ5A 5H1SV 5HLFA 1HBNB 1Y3JA 3DU6A 5AE3A 3GFYA 5F9LA 4QBUA 4CO3A