1RT5A

Hiv-1 reverse transcriptase complexed with uc10
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
542
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 143
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt5A05
4CJ5A 3HVWA 2FJXA 3QNNA 3NBPB 3LAKA 1B92A 1T3NA 2VWJA 4TYAA 4Y3CA 3LP1A 4TSXA 4CECA 1C1AA 4K4YA 3N6MA 2AGQA 3SQ2A 5KFYA 4J2BA 1K6YA 3O3FA 2YNGB 3KHHA 1KFDA 3CJ5A 3I5AA 1HNVA 1YVUA 4BDYA 4CIGA 4OLAA 4HCBA 1S48A 4FJGA 3LAMA 3L2RA 1TP7A 2A1RA 4CJFA 1S5JA 5F8GA 5KFSA 4NRUA 4I7FB 1ASUA 4DLEA 3RMBA 1HPZA 2BE2A 3GIIA 3ZT2A 3KLHA 3FQLA 1U04A 4NYZA 4IH5A 4M45A 1HARA 3MTKA 2IMWP 1J5OB 3PX4A 1TKTB 2QKKA 2IJNA 4OVLA 4O55A 1VK0A 3MECA 2YHAA 2WRMA 2AJQA 5D3GB 4Q0BB 3AA2A 4E19A 1DTTB 3O3GA 2V4QA 2D0BA 1VRTB 3H08A 1TKXA 5J2MA 3OYJA 1N56A 1JXBA 2UVUA 2VA2A 1ZBUA 4CHPA 3OHAA 3GIKA 3V6DA 4ZPBA 1T03B 3LPUA 1VSFA 2BRLA 4LQ3A 3K2PA 1RA7A 4Y34A 4YR3A 3DRPA 2KFZA 2FVPA 1I3AA 2B5JA 1VSMA 3L2VA 1L3UA 4KTQA 3DYAB 1JLBB 3C6UA 3PJXA 4URGA 4W5QA 1HQEB 4FCYA 3PR5B 2VWKA 4PWDA 2OPQA 1KVCA 5F8LA 5KFQA 1SUQB 4GVMA 1BGXT 3PUFA 3QO9B 4J2DA 4TQRA 3ZT0A 1NHUA 4FLTA 2AX0A 4URSA 4DSLA 4NLDA 3AVIA 5KT7A 1QE1B 2HHUA 5KG2A 4Z4HA 1U09A 2UUWA 4J9SA 1RBSA 2AWZA 2J6TA 2IDOA 4FLZA 4YFUA 5I3UB 3TANA 2BGGA 3V81A 3ZSYA 4Q8FA 4FJNA 2GIRA 4FLXA 4EP4A 2JGUA 1RA6A 1S0OA 3D45A 5KG7A 3H5XA 1TV6B 4RW7B 3MXMA 3DRSB 4M3UA 3H4BA 1RTJB 2YNGA 4KAIA 1D5AA 5KFMA 2FJWA 2B5JB 2WOMA 1C1BA 4RU9A 2WK4A 4C8LA 1HQEA 3OJSA 1RDDA 3QEIA 4CJSA 3RMCA 2O4GA 3I5BA 5FDLA 3TI0A 3HK2A 1BQMB 5DG7A 3S9HA 3QO9A 3P83D 3PY8A 2HMIA 4CEEA 4KSEB 3VQDA 3M8QA 3IG1B 2PZSA 1XHZA 4EBDA 2C2RA 5KFDA 2R2TA 3I8DA 4F4XA 3K5MA 4B9UA 4AHVA 4O5BA 4Z4IA 4ELVA 4C8NA 1JXLA 4ED1A 3OYIA 4B3OB 2J6UA 1ZBLA 5HBMB 5C5JA 3UIQA 4CEZA 4B9MA 1X9MA 2D41A 1J9AA 1EXQA 5C24A 1XWLA 2YKMB 2FVRA 4DF8A 4ECTA 4B9LA 3CO9A 4CIFA 3V9WA 4CEAA 1GOCA 1S1UA 3KK2A 3CWJA 5E41A 3F9KA 4RUAA 1HMVA 3AVNA 4DTJA 3OYEA 3OYFA 1SL2A 5FDLB 2ZE2A 4ELTA 3LP0B 3DM2B 3SQ0A 3B6PA 4WYLA 4J9LA 3V9SA 1T05A 3T5JA 4TYBA 3M8PB 3C6UB 2XGQA 4CFBA 1S9FA 3CFPA 3H5YA 3KHRA 4NCGA 3MR2A 3CYMA 1JIHA 3MAQA 2B43A 2R8GA 4PWDB 2IOCA 1FKOB 3QGGA 1NKBA 3H40A 4DF4A 2XRIA 1BCMA 1TAQA 1RTIB 1LAWA 4ID5B 3KLVA 3FDSA 2OZSA 4IDKB 1L3TA 3NF6A 1RBUA 3N6NA 4FJ5A 4QWCA 1YT3A 3NH0A 3JYTB 4WZQA 3RR8A 4NLGA 4CK2A 2OPSB 1RT6A 5DGBA 4URQU 4JUZA 1VSJA 4ZHRA 3VQ9A 4HTUA 1LW2A 4K4SA 4KKOB 2B4JA 2P51A 1C0UA 3AVGA 4ED0A 2KZMA 2D3ZA 4K8ZA 3VA0A 4KI6A 4FLYA 3ZSZA 4ZP8A 3Q8PB 3HP9A 3OL8A 4I7FA 1EP4A 4CERA 2RF2B 1JLQA 4QWAA 4B9VA 2J6SA 4IR9A 1CXQA 4Y2CA 4FZXC 4YMEA 5F8NA 3SUOA 3M9OB 4DQIA 4KFBA 2CKWA 1ZETA 2KW4A 4J9MA 4FJ7A 3NHGA 2HNYA 4FK4A 3RBDA 1FKPA 3NAEA 4IG0B 1RT3A 5EU7A 3D28A 4EZ6A 2YHBA 4MFBB 4FXDA 3Q8SB 4KREA 4EBCA 3ISNC 3M8SA 3CJ0A 1TGOA 4DQSA 2FLLA 4R8UB 1IKWB 4TQSA 4KB7A 3OLBA 2C28A 1BISA 3SFUA 4NZ0A 5KFJA 3V6JA 1WNEA 2W9BA 3MEGA 3T19A 4AHUA 1JL2A 3BREA 3OS2A 1S6PB 3FQKA 2RN2A 2HHQA 4J2AA 1HMVB 4QAGA 1S9GB 4OKJA 1RDRA 1JKHA 4CJKA 1RTDB 1LW0A 2WCXA 5CYMA 3BDPA 2BR0A 3BQ0A 2W7PA 4EYHB 5HLFA 3T5KA 1BIZA 2E4LA 2EHGA 4DL3A 1XHXA 2BQ3A 2BDPA 4DG1B 4FYDA 1K1QA 1QS4A 5J1EB 3ZCMA 1MU2B 3NAIA 3OS1A 1NK7A 4MFBA 4CHOA 4MQ3A 2X78A 3TAFA 4EZ9A 1BQNA 5K14A 5CZ1A 4FJKA 2RKIA 1FK9B 2HHTA 2DPJA 1NOZA 3CG7A 3VQAA 1W0HA 1WAFA 3VQQA 4CF9A 3SI6A 1GOBA 4FK0A 3KLIA 4FLWA 2F8EX 1RTHB 4F4KA 1C6VA 1BI4B 1D0EA 1Z26A 4RW9A 3FSIA 1VSDA 1RBVA 4MIBA 1JLAA 2HHVA 3HHKA 1LWCA 3QERA 4DLGA 4G3IA 1KSPA 3DLGB 4WYWA 2UVRA 3WNGA 4C8KA 3I0RA 4O44A 2XCPA 4DTNA 3M8QB 1WLJA 4IG3B 3OY9A 1RT4A 4Q45A 1U47A 4E1NA 4ZP9A 1VRUA 3QZ8A 3NL0A 3ZSQA 2XCAA 1RYRA 4AH9A 1TVRB 3K58A 4N5SA 4OKEA 3PW4A 5FROA 3TABA 3AVJA 2RKIB 4WE1B 1FKPB 4K4WA 1QAJA 3ITHA 4KRFA 4E89A 4PA1A 3V9UA 3E51A 5DQIA 2YKMA 5DGAA 1RTHA 3KK2B 5JUMA 3QIOA 3LP3A 1KTQA 1T7PA 4FW1A 4IFVB 3CM6A 4DQRA 4R5PB 3U6FA 3T1AA 2HB5A 2ZQBA 2JEGA 1IKYA 4DTXA 2GC8A 2GV9A 3RRGA 2IAJA 4KV8B 2G8FA 1CZ9A 3RMDA 4TN2A 4WFZA 1WSHA 1QE1A 1WNSA 4CFCA 2G8WA 4EYIB 3H2LA 4NLSA 1S49A 3AA3A 1HYZA 3PW2A 1JKHB 1RT5B 4ZVGA 3QESA 1TVRA 5KFGA 3CJ4A 4U7CA 2FBYA 4K8XA 3SUNA 3WNFA 3JYTA 4GC6A 4LSNB 4O0JA 4EO6A 4H54A 2I1RA 1JLFB 1TL3A 4XPCA 3AVKA 4PUOA 2IC3B 5CY4A 1S6QB 2JC1A 3LDSA 1HJRA 3QLHA 1C0UB 2FBVA 3BQ2A 5L1KA 4CF1A 2IA6A 1VSEA 3KIOA 4CJPA 4ZP6A 1YTAA 4J9RA 3OSPA 3HP6A 5K14B 4M3YA 1SH3A 1JLCB 4AILC 2XI3A 4FW2A 3MEDB 4ECUA 4ED8A 4K4UA 4KV8A 4F4WA 3SUQA 3O4NA 4CJTA 3DLEA 1UWBB 4NLVA 5L1IA 3KK3B 3IG1A 4KHQA 4Q5VA 4QPXA 4JS4A 3BSOA 1NJWA 3EYZA 1XR5A 1LWEB 4E1MA 3PR4A 5JS2A 2YNHA 1QSSA 1NK8A 3IRXB 2E9ZA 1RILA 4BWMA 3LPTA 2G8HA 3MF5A 4CGDA 2F8SA 5F8MA 4E7IA 2XI2A 1RT4B 1EETA 2E6LA 3AO5A 4HCCA 1RT3B 3PW0A 3CDWA 3GV5B 1IG9A 1NK0A 3DLHA 4OKKA 1VRUB 3L8BA 5KFXA 4YR0A 4JRPA 1Q9XA 1RYSA 3TAGA 4KTZA 1JLCA 2V0NA 3QGHA 4ZPCA 4DSKA 4WXOA 1RDAA 4LH5A 5KFTA 3OVNA 1RTJA 3SYZA 5J2QB 1ASVA 3OYMA 1S6PA 3C6TA 4F8RA 3CM5A 4ECXA 3V4IA 3PZPA 3G0ZA 4DTPA 4FBUA 3NGDA 3NF8A 4CEFA 4CGGA 2D7SA 1T94A 1S1VA 3ZT3A 4E0DA 4DSFA 4RW8B 2O4IA 4CE9A 4F4ZA 3RWUA 2R8HA 4NLYA 2IAJB 4YQWA 4Q0BA 3KMSA 4ECYA 2Z1IA 1RDCA 4C8OA 4O3QA 3QEXA 3PO4A 1LW2B 3ZT4A 3GV7B 3V6DB 4DMNA 2IBKA 3MEEB 5KT4A 3OYBA 1IKVB 2VG5A 1DTTA 4M42A 4KBIA 3KLIB 4KHWA 5C24B 2JEFA 4KHMA 1IH7A 2KTQA 3M8RA 1UA1A 1NNDA 5EUHA 3NKYA 3KLGB 3DI6B 5J2NA 1ZBHA 5KT2A 1SH0A 3OYGA 4B9TA 2HNZB 1D8YA 2C22A 3QEWA 3DLGA 1RCHA 5EWEA 2OPRB 2W8KA 4MK9A 2DPIA 4JRQA 3LZJA 2D3UA 4Z0UA 2VG6B 4KB0A 5JS1A 2B6AA 3NH2A 1TK0A 4FM1A 1A5WA 4DU3A 1WSEA 3RAQA 4CK3A 1NJZA 3NDKA 3QETA 3AO2A 4CIEA 1RDBA 3V81B 1CZBA 4CJLA 2V9WA 4R8UA 3ICLA 2OZMA 1XR6A 4W5NA 3CJ2A 2HWIA 1BCOA 1LWFB 2E9TA 2HVHA 3BJYA 1L3SA 3HJFA 4E3SA 4Y1CA 2Z1GA 4ZVEA 1SV5A 1U48A 4DSJA 1RT6B 4ID1A 3VQ4A 1C1BB 2JEJA 3RB3A 2XHBA 3TR8A 1T8EA 3M9NB 5KFAA 1HYSA 2Z1JA 3HXMA 2W9CA 2BQRA 1HNIA 4J9PA 2ZD1B 1HQUA 4KO0A 1SL0A 5J2NB 2OYQA 5KFPA 2RF2A 5CYMB 3EPGA 5JXSA 1UOCA 1TL1B 1XC9A 3TQ1A 5KFUA 3NCIA 4DEZA 4NLPA 3CVKA 5DQGA 1N48A 1NKCA 1S9EA 1DTQB 3C6TB 2Q3SA 3L3VA 5HRPA 4OLBA 2FVQA 1RT5A 3NGYA 3KLFA 1KHVA 1C2PA 1SH2A 3S3NA 4CGFA 3NBPA 3KLEA 4DS5A 5HBMA 1CLQA 3U3YA 3LP1B 3DMJB 4B9NA 4WZMA 3A2FA 3L2UA 3VQ8A 4NLXA 4TLRA 4ED7A 4JS5A 1BI4A 4CEDA 4G1QB 1HYSB 2OH2A 4MK8A 2AQ4A 2AGOA 4J9OA 4J9NA 3KNAA 1UAXA 4AHTA 3DM2A 1LWCB 3O3HA 5I42A 4DU4A 3HKWA 4DTRA 3MEGB 1IO2A 4DQQA 4IKAA 3C95A 2FBXA 4K4TA 3L2QA 4ZVHA 1WSIA 2X6NA 1S0NA 3KD1E 2QE5A 1GOAA 3NF9A 1TKDA 3UDLA 3AV9A 5KFZA 4CGJA 4CJUA 3OJUA 4OPJA 2HNZA 2ITGA 3IS9A 2XY7A 5HLFB 3GV8B 3V1QA 1NJYA 5DG9A 1T05B 3DMJA 1J54A 3G6VA 1QSYA 4DWIA 4IBNA 3VA3A 4LH4A 1KLNA 3T5HA 3AVCA 1FXXA 2A1SA 4HUGA 3OYCA 3BSNA 3ZSWA 3MR6A 4ID5A 3HYFA 4FLUA 5KG1A 1W9HA 3DOLA 1YTUA 3CQ8A 4ZTJA 2JC0A 4R0EA 3OYDA 4Q43A 3HVAA 1SV5B 2X74A 4CF0A 1B9FA 4IOBA 1RT2A 5HROB 4J9KA 4NRTA 5CYQB 1Z25A 3HVTB 4RW4A 2ILYA 4RNOA 4KHUA 3FRZA 1JLAB 1HNIB 2FC0A 1NJXA 1KHWA 5KFEA 1B9DA 1HQUB 3WNHA 4FS2A 3DLKB 3HPOA 3AVFA 2F8TA 4AHCA 3SPZA 4DL4A 1NK5A 1YVFA 3QIDA 4L8RB 4LSNA 4NLTA 1D9DA 2R2RA 4PUOB 4UQGA 2W42A 2Y1IA 5F9NA 5KFNA 4K4ZA 5I3UA 4TY8B 3CDUA 3TAQA 4W5OA 3DRRB 3VQPA 1LV5A 2DFFA 3MR3A 3MR5A 4BWJA 3ITHB 3MEDA 3OHBA 1TV6A 4RW7A 3TAMB 4FM2A 4FJIA 4H4MA 3RB6A 3RMAA 3ASMA 1WAJA 4BE1A 2JEIA 3DDKA 3KK3A 2R8JA 2G8UA 3KKRA 4KE5A 1NK9A 5DMRA 3S3OA 1RTDA 2G8VA 1S1TB 4OGEA 5DLFA 4DL7A 1WN7A 1S1XA 3DLKA 1KRPA 5EDWA 4EEYA 4B8AB 3CFOA 1VSHA 1LAVA 1S9GA 1Q9YA 5J1EA 1TK5A 1J5OA 4ECWA 2IJFA 4F2RA 1U49A 2I5JB 3IS9B 3TVKA 1KVBA 4M94A 5KG5A 3BR9A 2W9AA 3ZSVA 2YNIA 2Y1JA 4MH8A 3IN5A 4Y2AA 4ZVFA 3UQSA 4KAZA 3OL7A 2FVSA 1KLMB 2DTUA 2W8LA 3QLHB 4WFXA 3GILA 4LSLA 3VQ5A 3LP2B 2KFNA 4FJXA 3RAXA 2UVVA 1SKWA 1SL1A 3IAYA 1TL1A 4N76A 2P1JA 3T5LA 3QNOA 5KFBA 1I39A 4B08A 3KJVB 3PHEA 4LQ9A 2OA8A 2XC9A 3NF7A 4RW4B 3HVTA 4KPYA 2HVIA 4M3RA 4B9SA 1SKRA 3HO1A 1FKOA 4F2SA 5KFHA 5KFLA 3L2WA 5C42A 3BSAA 5KG3A 2BANB 3SQ1A 5KFRA 1RT7B 4IDKA 4O4GB 1A5VA 5J2PA 3QZ7A 3SNNA 4DL2A 3PV8A 2HNDB 3V6HA 2VG5B 4CGHA 1EETB 5KT3A 4WXWA 2KQ2A 4HHTA 3VQSA 5KFWA 4BE2A 2R8KA 5KFIA 4TY8A 3BSCA 4IFVA 4H4OA 4YP3A 1IM4A 4CEBA 4LSLB 1X9WA 4RW6B 1MMLA 1Q8IA 1ZTTA 4GMJB 2BQUA 5I42B 5EWFA 2VG7A 3VQBA 4CCHA 3ULDA 1K1SA 1ZYQA 5T14A 4KTWA 3JSMA 3NH1A 4BDZA 4Z4FA 3IGNA 1QQCA 3GIMA 2ILZA 4QWBA 4KFBB 4Q44A 4ICLA 1BQMA 2IM3A 2Z1HA 3UPFA 5C42B 2XO7A 1S0MA 4RG8A 4ECRA 2HMIB 1S1XB 1IKXB 3HVRA 1S4FA 1NKEA 3IGVA 2F96A 1RT1A 3HL8A 3SZ2A 2IC3A 1R0AA 1JLGB 3EZ5A 2XY5A 4ECZA 4FZYA 3SFGA 4YR2A 4E7LA 4H8KA 3B6OA 4M3TA 2DFHA 2NUBA 4BE0A 4I2QB 4NYFA 2HWHA 1Y97A 4RNMA 2IM0A 4JV0A 2WONA 4MKBA 5L1JA 3BGRA 5HRSA 4IR1A 1JLFA 1TL3B 3MXJA 2XY8A 4DSIA 1KLMA 4HUFA 5CYQA 4CF2A 1CSJA 1KFSA 4DU1A 1NK6A 3AO3A 4J2EA 5KFCA 3WNEA 4JLHA 1S9EB 3I5CA 3ZT1A 1D9FA 4IH6A 2XY6A 4O3RA 2YKNB 1D1UA 4FS1A 3LANA 3VN5A 4DFMA 4QWEA 3RB4A 3IRXA 4FVMA 3CDEA 2OPRA 3KLEB 4BDPA 3KHLA 2JLEA 4F3TA 1IKXA 4DL5A 4FJLA 4DFJA 3M8PA 1C0TB 3H5UA 5KFVA 4M41A 2PYJA 5DQHA 2W7OA 4K4XA 2C2DA 4MIAA 1QTMA 5KGXA 2RDJA 4FBTA 1ASWA 4XPEA 1RTIA 4QOZB 1BIUA 4ED6A 4G1QA 1T03A 1QHTA 3SJJA 3MXIA 2V4RA 2PY5A 4CEQA 2E9RX 3LZIA 3I0SA 3BGRB 3TAMA 3DRPB 4O3PA 4BACA 3QEPA 4KKOA 3D5MA 4ZPAA 3DLBA 2ATLA 2R2SA 1QUVA 3PW5A 4FM0A 2OPQB 3DOKA 5DK5A 1RAJA 1C1CA 4W5TA 3P5JA 2UVWA 1JLQB 3AVAA 4IFYB 2AGPA 3I0RB 4O44B 5J2QA 4EP5A 1WSFA 3DYAA 5KRSA 4RNHA 3BQ1A 4NCAA 2FVCA 3PX6A 3SV4A 2EC0A 5KT5A 3QIPB 2UUTA 2G8IA 1N6QB 2I5JA 1S1VB 2LSNA 1SUQA 3GQCA 1HRHA 5KI6A 4NLQA 4CHZA 4JV1A 3OYAA 1A5XA 3DOLB 3EY1A 3TAEA 1RT2B 4CJEA 4CFAA 3SCXA 5KFFA 3C94A 5KGWA 4RNFA 4NLUA 3AVMA 4Z4GA 4AHRA 1QSLA 2QK9A 4XO0A 3MEEA 2XGPA 3K59A 1IKVA 1X9SA 2WONB 3TARA 1JLEB 3VQCA 2WB4A 4ZTFA 2WHOA 2VG6A 3QEVA 2G8KA 3KJVA 3TAPA 4CK1A 4DTMA 1KVAA 4N41A 4J9QA 3KK1A 2YNFA 2WOMB 3OYHA 3AVBA 3QIPA 3HM9A 4ED2A 3KLGA 3DI6A 3KHGA 4EBEA 1TKTA 5HRRA 4CHYA 3LWMA 2HHWA 4DTUA 4DFPA 2RPIA 1C0MA 2D0AA 3PJWA 2ETJA 3CFRA 3DRRA 1F21A 3OS0A 4DL6A 4GC7A 5KG0A 1C0TA 2BRKA 5F8HA 2OPPA 3DLRA 3HT3A 3AO4A 3OSNA 4OJRA 1ZBIA 2RDIA 1S6QA 4K4VA 5FRMA 4CGIA 1S1UB 1U4BA 1LWFA 4CF8A 4C8MA 1DLOB 4FJ9A 3S3MA 2VG7B 3I0SB 3LP0A 1SKSA 4M95A 3OLAA 2EX3A 1HNVB 3KK1B 3DLEB 4GW6A 3GYNA 1UWBA 3CIZA 3RTVA 4NCGB 1QAIA 3KKSA 3SUPA 2W9CB 4ZP7A 2GUIA 2ZD1A 4FJ8A 4IRKA 4DTOA 1LWEA 4XIUA 3TWHA 4F3OA 2O5DA 4K50A 1S1WA 3FFIB 4IG3A 1JX4A 2OPPB 2ATQA 2FJVA 2VA3A 4DSEA 4DQPA 3GIJA 3Q8RB 1N4LA 3ISND 4IRDA 4QCLA 4E7HA 2DY4A 4I2QA 1DLOA 4RUCA 2WTFA 3KOAA 3V6KA 1VRTA 2OPSA 4U6PA 1KCFA 3AVHA 4OPKA 4H4MB 2HAIA 3NAHA 2ZKUA 1TQLA 4F4YA 4M3XA 3OL9A 1ZBFA 4ECQA 1OS5A 1X1PA 4WFYA 4NLWA 4CFDA 5DG8A 4O3NA 1IKYB 4RW8A 1JLEA 4OL8A 3AA4A 3PX0A 1VSLA 3CJ3A 1L3VA 1VSKA 4F50A 3K5OA 2IS3A 2DFEA 1J53A 4CJVA 4KB1A 4IQXA 1REVB 1JL1A 2QXFA 2D0CA 5KRTA 3L3UA 4PQUA 4E7KA 2XWYA 3NGZA 4B3OA 3SPYA 2HNYB 3E01B 3N6LA 3ALYA 5F9LA 2FLNA 3M9MB 2GIQA 2P5OA 4MKAA 3V9XA 1GX6A 2IGIA 4FJMA 5HROA 4AHSA 4DTSA 4KHRA 2E6MA 5KG6A 3DOKB 3LP2A 3ZSRA 4DS4A 4HVJA 3V1OA 1HPZB 2BE2B 1U45A 1WSJA 3H98A 1EX4A 3KMQA 3NE6A 4DG1A 3NMAA 5C25A 3MFIA 1TAUA 3AVLA 4O4RA 3OL6A 1REVA 3P1GA 3O4QA 4E7JA 4FJJA 3OYNA 4CJ3A 4TXSA 1L5UA 1W25A 1S97A 4LD0A 2R8IA 3MECB 3NGIA 3E01A 1HYVA 3G86A 2YV0X 5D3GA 4KI4A 3H5SA 4JV2A 4O4GA 1S1WB 2ASJA 4Z4CA 5T7BA 1VSIA 2HNDA 1BL3A 1S10A 3VQ7A 4CJRA 4ZHRB 3OYLA 1TKZB 3VQ6A 4CHNA 5KFOA 5HP1B 3V9ZA 5KT6A 5KFKA 4OGCA 4RZRA 3ZSXA 1BQNB 3EZUA 2D5RA 1FK9A 1S1TA 2YKNA 3EPIA 4KO0B 3PVXA 5F8JA 1EP4B 4CJ4A 4FLVA 4N56A 4CESA 3LWLA 3D0PA 3KTQA 4QW9A 1RBTA 4M3WA 2ASLA 3H59A 2YNFB 1JLBA 1RBRA 2QKBA 1CXUA 3VQEA 3Q8QB 2ASDA 3V4IB 3QINA 1GX5A 4LY7A 5SWMA 2HHXA 4M3ZA 5HRNA 3HPHA 2IM1A 4CJQA 1O1WA 3KLFB 4ICLB 4O3SA 1Z4UA 4FK2A 4PY5A 4Z4EA 4B8CA 1ITGA 4HUEA 1N5YA 4W5RA 3K5NA 4DFKA 1RNHA 1NOYA 1RT1B 4FZZA 1JLGA 2HW3A 2FBTA 3NFAA 2QV6A 4PQUB 4Q8EA 4KHSA 5L1LA 2IM2A 5L9XA 4X2BA 2HHSA 3HPGA 2AX1A 5CZ2A 2YNIB 4NLRA 4WE1A 1XR7A 1C1CB 2ALZA 3KLHB 3PW7A 4RNNA 4O0IA 3DRSA 4YNQA 2W9BB 2KZZA 2C2EA 3AO1A 3UR0A 1EKEA 5FRNA 3RR7A 4O3OA 1TK8A 2R2UA 4NYNA 5EWGA 3F73A 3QGIA 4MK7A 3RBEA 3KD5E 1N6QA 4R5PA 1LW0B 1I6JA 2P5GA 4KHYA 1UA0A 5DLGA 4ELUA 4CEOA 2GBZA 3FFIA 2B6AB 1N5YB 5J2PB 1NHVA 2X6SA 4QW8A 4N47A 5C25B 1WSGA 1BHLA 4Y1DA 4TY9A 1MU2A 1TKXB 5J2MB 4I2PA 1XI1A 4NCBA 4ZMMA 4HYKA 2PYLA 2BANA 3U3GA 3THVA 4H4OB 3G6YA 3K5LA 4CHQA 3G6XA 1RT7A 4EO8A 1G15A 1NK4A 4I9LA 4QWDA 4IG0A 4IRCA 4HKQA 3RB0A 3SV3A 3ZSOA 4I9QA 3OYKA 4FJHA 4IKFA 3QYYA 1TKZA 4KHNA 4ED3A 3JSMB 4RW9B 5HP1A 1IKWA 4ZPDA 2FLPA 4ECSA 4RW6A 3MFHA 5SZTA 2R7YA 2AU0A 3SQ4A 3LALA 3V1RA 3G10A 2YNHB 2ZE2B 3SI8A 1JXEA 3HSTB 4IFYA 3K57A 3RRHA 3T3FA 4NLOA 4ECVA 3PO5A 1DTQA 3H4DA 4CJWA 1R0AB 5KG4A 5F8IA 3AA5X 5KTQA 4I2PB 4IH7A 2CJQA 1ZTWA
chains in the Genus database with same CATH superfamily
3HVWA 4V19J 1VQLN 1B92A 2VWJA 4Y3CA 2R42A 1M90T 1IBMJ 4CECA 2DEIA 2HS0A 4K4YA 2AGQA 3SQ2A 4P10A 1SC3B 2ZFHA 3Q7BA 3M2UB 1N32J 1K6YA 3O3FA 3EGZA 1KFDA 2XYPB 3CJ5A 3I5AA 1HNVA 4FJGA 4XTTA 3J7AP 4CJFA 4MO5A 1S5JA 4IWVA 4DL0C 2CJKA 2B4UA 1A9NB 2GVDA 1NUEA 3GWCA 2GGPA 3BM7A 4CT8A 4IEIA 1EX8A 1V3SA 3KHYA 1FVQA 5AQLA 3M1VB 3MTKA 2BKOA 2IMWP 1NJIO 4JB8B 5HATA 4O55A 4ETXA 1VK0A 4M5DB 2YHAA 2WRMA 2Z2ZA 2AIRB 2YHWA 1BLUA 1HR0J 3QT6A 1OH6A 4FPBA 5J2MA 1N56A 1JXBA 4ILGB 2ZH7A 2VA2A 1X4BA 4JI4K 5LY3A 4CLWA 4CHPA 3FBCA 3TVZA 3RSEA 2Z2MA 1T03B 2Y8WA 3LPUA 3VF4A 2BRLA 1YJ9S 2CH5A 1BC6A 3DRPA 2B5JA 2F65A 3TR5A 5H9EJ 2VFVA 4W4MA 2Z2YB 4UZBA 3O6WA 4ILLA 3C7NB 2XBPA 2MQLA 2NXNA 5DM7L 1KVCA 2HMPA 3IR5B 2X1GA 4J2DA 4GKJJ 3RG6A 3MM7A 3VTIA 1K8AT 3N4WA 4HR2A 2P9GA 1M5KC 1RBSA 3I96A 2J6TA 4QOTA 2X7IA 5I3UB 3TANA 3CJRA 3FEZA 3H2UB 3IDHA 3P6YC 3ZSYA 3A5MC 4DV1J 3M30A 4NXNJ 2GIRA 4C8ZA 2YJEA 3VAHA 3T7ZA 1YJTA 3HJVA 1HBUB 2YKQA 2M9KA 1S0OA 4GNIA 3CIPA 4M3UA 4KAIA 2B5JB 1XNRF 2D0PA 4EU0A 1C4CA 1OKJA 2B8QA 1RDDA 2P2CB 4I6AA 4B3TK 2O4GA 1YG0A 3TI0A 4I4BA 1RDWX 3SQGB 3PY8A 2HMIA 3CULA 4ZA1A 4KSEB 3LGNA 3ZZPA 2PZSA 3QMLA 1XHZA 1S3XA 2C2RA 2HOEA 4F4XA 4NLBA 4B9UA 4EK2A 1JXLA 4ED1A 3OYIA 3EZOA 2J0QD 3UIQA 4CEZA 1IQTA 3O80A 2D41A 4FWSA 5KOWA 1J9AA 2N7YA 3C16A 3BKTA 2FVRA 2NRRA 4DF8A 2DH7A 1IBMK 4M5GA 3QRPA 1Q95G 3CWJA 4RUAA 2L9DA 2ZBRA 4U7UD 3QB0A 4ZKAA 4DTJA 2C2ZB 4AUKA 3OYEA 1SL2A 2A3ZA 2ROEA 4JI6K 2B4PA 4ELTA 2MQQA 3LP0B 1RBOB 4JI4F 4WPAA 5CR4A 2BJEA 2XGQA 3EGVA 1VFJA 1S9FA 2ZVSA 5LSRA 2E5HA 4ILJA 4LF5J 4K5SA 2A41A 2RE2A 3H40A 1W26A 3VGTA 2MSSA 2B9XA 1NGJA 3MR7A 3MMJA 1LAWA 2OTLN 3KLVA 1RAAB 2Z2LA 2IYGA 4I6WA 2AW0A 3NF6A 5C12A 3TZYA 1VAZA 3RR8A 4NLGA 4CK2A 4JUZA 3VQ9A 3AB4B 1HNZJ 4UZCA 3AFGA 2J0XA 1Q0NA 4ZOSA 4K8ZA 4FLYA 4ZP8A 4DV7J 3O9SA 3OL8A 2Q0UA 1GLDG 3VEYA 3H3OB 3CB4A 2Y8YA 1LNQA 1CJVA 4CT9A 3TW0A 1HLUA 4Y2CA 2HS3A 5LXYA 3P38A 3EVWA 4QZVB 1CBKA 2DH9A 2ZGYA 4DQIA 5JMVA 2CKWA 4Z94A 4OHVA 5F2RA 4FJ7A 1P1TA 2CQCA 3H25A 2OFGX 1RGIA 3O8WA 4EZ6A 1KQKA 2MEWA 4KREA 3CJ0A 4DQSA 4TQSA 3R6LB 1BISA 5ETTA 5TKWA 2G0IA 4NZ0A 2O8CA 2QXLA 2W9BA 4NI2B 2E1AA 2KLAA 4AHUA 4QS8A 2WAQD 2E20A 3CT9A 2MQPA 2HHQA 4J2AA 5M2RA 1E3MA 2ASOA 1RTDB 3ATUA 2H1YA 5BRDA 2M7SA 1Y5NB 2W7PA 4X4UA 3P96A 3PTWA 2EHGA 3FMBA 2BQ3A 2LXFA 5J1EB 2HGNA 1ICEB 3D1HA 4MFBA 4CHOA 3CCUN 4MQ3A 3EEQA 2D1KA 3TAFA 4CNZA 4OI1A 1FK9B 2HHTA 1WAFA 1U2RA 3B4DA 1GOBA 4OX9F 3PCOB 2R7WA 4FK0A 1NDPA 2AYBA 4B3MK 4X65K 4FXVA 2D3OR 1BI4B 2V5HG 1D0EA 4RW9A 1TU0B 1QHAA 3TZWA 5E7OB 2XYHB 2Q1LA 3GPAA 4A47A 2CGKA 3P45B 4JP8A 4G3IA 3DLGB 1KXPA 3BBCA 5C0YA 5JVHL 3A1YG 1U47A 3R9LA 4E1NA 1K0VA 4ZP9A 1HI1A 5DDOC 3QZ8A 1RYRA 1TVRB 5LJVA 3ONQA 4FWMA 4N5SA 3TABA 1VQMS 4WE1B 2XWXA 1QAJA 3EO3A 4E89A 3KK7A 2K1RB 2CPIA 4YN3B 5JUMA 3QIOA 4IOXA 1KTQA 1GK8A 3D6FB 4R5PB 5K8OA 2DNOA 3K0JA 1UVLA 2JEGA 2AEFA 1Y10A 5AQNA 1IKYA 2K06A 4QIWD 2GV9A 4J90A 3VAGA 2Y3YA 2Z8QA 1CZ9A 2ASYA 4ZVRB 1WSHA 1H0HB 5AZJA 2EPIA 2VC0A 4GVBA 5IWAK 1FD2A 5JJBA 2ADCA 3VVTA 4A46A 3QBXA 1TVRA 1SCJB 3CJ4A 4K8XA 4U8YA 3U7JA 1JNZB 2RU9A 2ZEJA 4XPCA 2IC3B 4LFBJ 5B0FA 1U25A 3LDSA 1IBLJ 1C0UB 4FXWA 2FBVA 3BQ2A 2IA6A 1VSEA 8RUCA 4CZGA 4JD2A 5GIOA 4M3YA 4JK7A 4NB4A 2LXIA 2R7OA 4FW2A 1HBNA 5JLFA 1FRMA 4ED8A 4K4UA 4YHHJ 3O9TA 3SUQA 1UWBB 5L1IA 3IG1A 4KHQA 1FA0A 4X64F 2HFSA 4U67L 3MI7X 5ETVA 3CJ7A 1NZ8A 2D3O1 3CW2C 4W92B 1QSSA 2VQFK 2YNHA 4DR4J 1QDUB 3IRXB 3FBFA 4BWMA 2W2PP 3L4IA 1YZ6A 3W2WB 2D0OA 1XNQJ 3PIOQ 2XI2A 4UOHA 1UVJA 4HCCA 3CHWA 1WDDA 3CDWA 3DXMA 1OIAA 3L8BA 3GIRA 4JI8K 3L7UA 5C2DA 5CHIA 1WEXA 2UXBK 1WSVA 4UY8T 3KXDA 3GCXP 1X8DA 2PMZD 3A8IA 1SIWB 2V0NA 4FO0A 3FZ2A 3IO1A 1RDAA 2BX6A 3Q2SC 2KRRA 3NG8A 3OYMA 2XMJA 3M5RA 1KP6A 3G0ZA 4FBUA 3NF8A 1RAGB 4JNEA 3UKRA 2ZBQA 1DY3A 3R97A 4E0DA 3O2IA 4RW8B 3U1LA 2IAJB 3A5NC 4AL5A 2H48B 4KGMA 5FPDA 3KMSA 5ETMA 1H72C 2HVZA 1RDCA 4F67A 2MLYA 3O5TB 1VR6A 3QJJA 2V8GA 3U02A 2LEAA 4OZJA 3MEEB 3OYBA 1K8KB 4DCHA 2VG5A 3M32B 4KHWA 3C66A 2JEFA 2E5IA 2LEBA 5E3RA 3M8RA 2HBQB 3AA9A 2IVPA 1RKIA 3FK4A 3NKYA 4L72B 4B9TA 3RU0A 1D8YA 2RB7A 4AFFA 1KVKA 2OPRB 4MK9A 3R5GA 2GUPA 2EFVA 2D3UA 3J7ZT 1XEZA 4ENOA 5CZVA 2R7VA 4DV3F 2LDIA 4DU3A 5AZIB 1WSEA 1M90O 2PI4A 4CK3A 4LMZA 3QETA 1IR1A 2R4FA 3M05A 4DR6F 4YDXA 4PG6A 3VGVA 4BGBA 3VAFA 3V81B 1CZBA 2I7PA 4R8UA 3ICLA 5HL7Q 1NU4A 1NGHA 1LWFB 1MLAA 3GDQA 5GAGU 4Y1CA 1Y4ZB 4DCJB 4A8SA 2CA9A 1RT6B 3DGPA 5GAGI 4F36A 4DN0A 3RB3A 3TVYA 2J0SD 1U1KA 1JK9B 1ZM9A 2WBMA 3GCWP 3HXMA 2BQRA 1HNIA 2H3GX 4DX6A 1HQUA 1SL0A 5J2NB 4HI2A 5KFPA 2RF2A 5CYMB 2GJIA 2YWHA 1YSJA 4H4KA 3PYFA 3MOZA 4BC5A 5DQGA 1N48A 3NOGA 1NSPA 3L3VA 3MD3A 1X60A 1RT5A 4DPYA 3KLFA 1KHVA 1SH2A 4KC5A 3LPYA 4DN9A 3FSXA 3NBPA 4DS5A 2W7AA 5HBMA 3US5A 4YEAA 5CD4A 3VQ8A 4DPXA 2MLZA 4DR4K 1YJRA 1EARA 3LH2S 1KVIA 3FZFA 3LGHA 2L48A 2CQPA 2OH2A 2GTDA 4DPUA 1Q86T 4J9OA 4IO9Q 1LWCB 2CJBA 3O3HA 1VLOA 1HBOA 4DU4A 1VOMA 3MEGB 2E5JA 2F8MA 1IO2A 4IKAA 2HF4A 3C95A 2GJ2A 4K4TA 2RHQB 4OHYA 1VQ7S 1T9YA 1HW8A 3IS9A 3FRYA 3GE9A 3FCHA 1OVYA 2DGUA 3GV8B 1HUXA 3VF0B 3AAPA 2VDIA 2F4VK 2ZDOA 5AQKA 3TOQA 4DWIA 4IBNA 3VA3A 1M5PC 3AARA 4LH4A 1TELA 4OYPA 4QR0A 5F1XA 3VV2B 2J76E 1IM6A 4TU9A 3MR6A 3VVUA 1FRJA 3P8BB 2WTUA 2BBEA 3HYFA 1Q7LB 4LVNP 1HNZF 2N4DA 4PEOA 3CD6N 3CQ8A 4R0EA 3DDNA 3OYDA 3HVAA 4DU7A 1KTVA 2ZHBA 1IQZA 1RT2A 1Z1ZA 2AYEA 2Q31A 2RS2A 1PGZA 3T69A 1NJXA 4RWTA 1HQUB 2DGOA 2NRZA 4U67Q 3D6TB 1EQYA 3CJBA 1N36F 4M5HA 2ZH3A 1NK5A 5H9FJ 4LSNA 2E1RA 5CQGA 2HSEB 1XIQA 5F9NA 2QN6B 5I3UA 1ILYA 3CDUA 2CVEA 4LREA 1TMMA 3C6AA 3WEEA 3TAQA 3CCMN 3LDQA 2QMWA 2NRXA 2GCFA 3MR3A 1DT9A 1I51B 3MEDA 4RW7A 2EWSA 1FEEA 4FM2A 2DCLA 3A3PB 4DU8A 3RB6A 5E3PA 1R31A 3ASMA 4NXMF 2JEIA 1GEHA 4CNYA 3QQCD 2AJ2A 1RTDA 4IEEA 4LF9K 4HI1A 5HAOA 1LCUA 1KRPA 4BRNA 3H2VE 4Q2MA 1S57A 3VAJA 3WQPA 1S9GA 1VJQA 5J1EA 3UD5A 2AHOB 2DR8A 3Q8YA 4OYAA 1U49A 3W5YA 3MZIA 4M94A 5HANA 2GO8A 4YHHK 2MKSA 5KG5A 4DV4K 1XNRJ 2YNIA 4N8OA 3GMGA 4UOCA 1UETA 4CLZA 4ZVFA 3IN5A 4KAZA 4AQYK 2C42A 2FVSA 2K7JA 1WC4A 1M1KT 2VQFJ 1IJJA 4C0HA 2G2ZA 2QG9B 2KFNA 2BJ9A 2J9DE 1T95A 1SKWA 4N76A 1Q16B 3T5LA 2FZCB 3QNOA 3G71S 3KJVB 2FGOA 2CPEA 4ISGA 3N28A 2OA8A 1N8RT 4LR9A 2RE1A 4RW4B 4KPYA 1HHQA 1UCNA 2QIFA 1SJFA 4B9SA 2E88A 4DHYA 1F9HA 1HL6A 3HO1A 1FKOA 4FF1A 3TSQA 3L2WA 2COLA 5KG3A 1CC7A 2E5LK 5KFRA 4O4GB 3R6GB 1NH7A 3QZ7A 4DL2A 1N33F 4MT1A 2DHAA 2O8BB 4JHDA 3CCJN 3B78A 5KFWA 4DR4F 1IBKJ 3M30B 4YP3A 4ANEA 1IM4A 4LSLB 1NG9A 2E44A 5IWAJ 1AUDA 4RW6B 1MMLA 1HD0A 1ZTTA 3ZEUA 2JSXA 1FJGJ 5I42B 5KQDA 2DHXA 1ZYQA 4MTPA 3A3OB 2ZOFA 1RLDA 1U2FA 1IUJA 4BDZA 2Q1NA 1S6OA 1NU0A 3UD4P 1UEKA 1QQCA 2QFIA 1Q5YA 4JV5K 4KFBB 3W64A 3UPFA 2Z1HA 2XO7A 1YBAA 4RWXA 2HMIB 4LRAA 3HVRA 2CUYA 1AW0A 3DLLQ 3IGVA 4K8RA 2UUCJ 3SZ2A 2IC3A 1IWAA 1OY9A 1Y0HA 3PJ9A 2XM3A 2L9NA 5H9FK 4FL9A 1U1RA 1KS2A 4JKGB 4J7CA 2HVEA 4Q7AA 2ASPA 4K0KJ 4BE0A 2J5AA 4I2QB 2NNWA 5GADP 5HJXA 2CJAA 4RO0A 2V8VA 1PC4A 1JLFA 4DSIA 2XY8A 5BR8F 2IMOA 1REGX 1KFSA 1NXIA 4J2EA 3WNEA 1CJUB 1S9EB 4AM7A 3MUTP 2XY6A 2YKNB 3LDOA 3I56S 3VN5A 2N7CA 3IRXA 3PRDA 4OI2A 3CDEA 3SMPA 3GG1A 5IZHA 1N34J 2JLEA 4F3TA 1JWWA 4DL5A 3PIOL 2O1PA 3OR2A 1HNXJ 1Q86O 4IOCL 4YDUC 4TNOA 2BJ8A 2GHWA 1FE4A 1ZH5A 4MKVA 3CEDA 4K4XA 2C2DA 2KXHA 1FRLA 1JNRB 2AJ0A 1ZAXA 4F25A 1RFQA 3UCZP 3KNGA 4OZ0A 5ELZA 2BKNA 1I94J 4CEQA 2GMLA 4PCQA 3LZIA 4EAHD 1T44A 3TAMA 2CPFA 4C9DA 4O3PA 4BACA 1F1BB 3TZZA 4DUYF 3W3SA 3THYB 2PMWA 4ES2A 2HZCA 3DLBA 1N33K 4D3HA 1N32K 2R2SA 3VEWA 3UKRB 1UJ4A 2OPQB 3DOKA 4M7XA 3ZEUB 1B0PA 2AGPA 1T3VA 4EP5A 3KDOA 5B0BA 1NLKL 3BQ1A 3PX6A 4HH0A 4WP3A 4WCEQ 3GQCA 4CHZA 2LXUA 2QTDA 2ZOGA 1KDNA 5K5MA 7FD1A 4B1YB 2Q43A 2I2YA 4YB1P 1QLNA 4XH4A 3OTBA 4Z4GA 3Q7CA 4HT7A 2NQPA 1QSLA 4WQ5C 2XGPA 3K59A 3SK3A 4PHTX 1VC5A 4BRGA 3HD1A 4KGZB 1XMOJ 4ZTFA 2PA3A 4J9QA 5HVFA 4ES3A 1PAUB 2EFOA 5C2GA 3QIPA 3HM9A 2WVFA 2K7KA 5DS7A 1IXKA 1RE1B 4EBEA 2HHWA 4Y2MA 4DFPA 2AD9A 3HT0A 2ETJA 3DRRA 4KHPJ 4CZJA 4OJ1A 4GC7A 3MMCB 5GAEI 2OPPA 2GS8A 3K9JA 3N5BA 4OYXA 5GINA 2DHGA 3A12A 1S6QA 4K4VA 1IWGA 2Q0RA 3S1TA 5KPTA 1WG5A 1YK9A 3MTJA 1DLOB 3EVOA 2M52A 2G2YA 3SBMA 1SKSA 1FRIA 3AT1B 1RU2A 3CCUS 1HNVB 1KEKA 3M1FA 4WFBL 1KKHA 4NCGB 3SUPA 2GUIA 1FDDA 3Q8VA 3BV8A 4DTOA 1W97L 2DVIA 2UXCJ 1TUUA 4DV2K 1U1PA 2UU9F 5MLCQ 4BC9A 5LJ5Y 3FFIB 4IG3A 2ZM6F 4QYZK 2ATQA 2FHKA 2BJDA 3M2VB 2V9KA 4E7HA 3I31A 1RCXB 4LF5F 3OFEA 4L3NA 2W40A 3KOAA 2RUSA 1CC8A 4OHZA 1FERA 1S7IA 4H4MB 3NAHA 4ECQA 3OBYA 1EKRA 2GAGC 4JI5F 1OS5A 4PL7A 5DG8A 4O3NA 4CZKA 4RW8A 4OL8A 2UXDF 3MX5A 4GV3A 1VSKA 3K5OA 2JWLA 2IS3A 1FNOA 4CJVA 3SCKE 1YBTA 1YGYA 2K2PA 2DITA 4FYXB 1WBDA 3N6LA 3P5TL 5I3PA 1T11A 2RMLA 2QI2A 3M9MB 1Q79A 2GIQA 2P5OA 4X62K 3V9XA 2IGIA 3MWBA 3FZLA 3N5FA 4AHSA 5EVZA 3BN4A 2VF3A 1D4XA 2E6MA 1B7FA 2W41A 1NO8A 2GAHC 4HVJA 2BE2B 4UF4A 3I32A 3D0IE 3SBTA 4DV7K 3ILJA 3H98A 4ZVPB 5CD4H 4Z37A 2CPYA 4DG1A 3NMAA 3G87A 3GJSB 2JJ4D 1ITPA 3O4QA 4FJJA 4DV1F 2ZC3A 4P7VA 2BW2A 3WEEB 1S97A 4QBUA 3MECB 3NGIA 3E01A 1V6HA 4JI6F 3R5AA 2YV0X 4HACA 2NUHA 3H46O 1RI7A 5J1PA 1SJ4P 2CWXA 4LUBA 4ZHRB 1GT8A 4WK3A 4CHNA 1GLJO 5D78A 4C3KA 4RZRA 4CO0A 3CCSN 1BE4A 4BROA 1FK9A 2LQ8A 1EP4B 3E3XA 3LWLA 3PACA 1PYTA 3KTQA 4QW9A 1TR0A 2P9NB 4M3WA 1LOUA 1PYOB 1V3RA 4LT6A 1FX2A 1CXUA 3NNAA 2DRBA 1R7IA 2KJWA 3P3DA 1D09B 4K0KK 1FESA 5A2QO 3HPHA 2RVJA 1O1WA 3KLFB 4ICLB 4ZCLA 2EG1A 5LMNK 4FK2A 2CPZA 4Z4EA 3J8AA 1S72S 3MPWA 3ADAC 3L4QA 1N5YA 2FGCA 1RNHA 2R7SA 4JKAA 4CD1A 1JLGA 3TEHB 3CD7A 3NFAA 2QV6A 3SXLA 4KHSA 2DK2A 2Y0SD 3IM8A 2AX1A 5FPEA 2VQEK 2J7UA 4NL5A 4RTFD 3FGUA 2VIHA 5IV3A 4CWBA 4JKDA 3DRSA 4YNQA 4DKWA 3EGNA 2DIUA 3FFKB 1HBMA 3Q89A 4NMXA 2D9PA 3WC2A 1RQ0A 1AA1B 3I55N 4KHYA 4B3SF 1X0FA 1UA0A 1WF0A 1Q82O 3RBZA 4JV5F 4DV5F 1FXDA 1CJVB 1N5YB 5J2PB 4QW8A 2AP6A 5AZIA 4DR5J 1N33J 3JTOA 3WXMB 5J2MB 4I2PA 3J80Y 2RT3A 1U02A 2BANA 1GMWA 1UTAA 3THVA 5AQZA 3G6YA 3U3GA 1G4CA 3R1LA 2P5VA 4CHQA 3PYGA 3W60A 3N79A 1BA1A 2KDOA 2XMTA 4AL6A 4I9QA 4JK9A 4FJHA 4FVUA 4ED3A 3O6QA 3QNWB 3BF3A 5HP1A 3H3NO 4ZPDA 5K8PA 1UFKA 4ECSA 1KD1T 5ETLA 1WKKA 4OYOA 4I1TA 4NZ6A 2AU0A 3L7OA 3HSTB 4IFYA 3E9LA 4CZCA 2DTJA 4IOAQ 1DTQA 3H4DA 4CJWA 2XLIA 5LSOA 2OCEA 1HWKA 3AA5X 5CE3A 3GFYA 1RHMB 4I2PB 4DR1J 4IH7A 1NMNA 5LL6d 3PRVA 1TFWA 4CJ5A 3QNNA 3NBPB 4TYAA 3O5BA 1UVNA 4TSXA 1C1AA 2PMHA 2H5EA 3N6MA 4J2BA 1VQ7N 5E3QA 2PC6A 4JN4A 2MYFA 5AE2A 1N34K 1GXTA 3ENAA 4FWKA 3R9PA 1HNXK 1S48A 4HCBA 3LAMA 1TP7A 1FNMA 2BZ2A 3D7SB 3H6EA 4DXLA 1G6BA 3O08A 3RMBA 1HPZA 4X4OA 1TUWA 1U04A 3SCIE 1F6TA 5HO4A 1KOHA 3BBFA 1ZM3A 4I6YA 1S77D 4RU2A 4LF4K 4KY3A 1RHUB 3CD6S 1UW9A 4OVLA 3GJQB 2DNGA 2MQOA 2AJQA 5D3GB 1N0UA 4Q0BB 1RAEB 4DV6J 5IM0A 3HFZB 5A6WA 1DTTB 1UFLA 3O3GA 2F8HA 2D0BA 2E66A 3T6JA 2UVUA 2FHJA 3O1BA 2PBDA 4ZPBA 3VWSA 1VSFA 2U1AA 4LQ3A 4WFNL 2Y0BB 1RA7A 4RLEA 4YR3A 4CH7A 4DV0F 3L2VA 2BYCA 3PJXA 4URGA 1OO0B 1HQEB 2E29A 4FCYA 3PR5B 1SAZA 1FFGB 1I5OB 1ACMB 4W98A 1HWUA 3H45C 2R7XA 3O4WA 4GVMA 4TQRA 2NRWA 4FLTA 2RH3A 2AX0A 3AVIA 5D4PA 5KT7A 5AZJB 1FWPA 1TFYA 1N54B 4C1NK 4Z4HA 5IM0B 3RAMA 4HTIA 4J9SA 4Y2KA 2IRYA 2AWZA 3HCXA 3RVCA 3V81A 3NS6A 3ENHA 4FJNA 2ZVIA 1XQSC 1VQPN 5E5NA 4FLXA 4PWUA 4EP4A 4PAAA 3D45A 5KG7A 2P9PA 4RW7B 1VHIA 3NGSA 2O8DA 2FJWA 1U1MA 5LJ3Y 4M5LA 5IT9O 1OJ4A 2WOMA 1C1BA 1Y3KA 3Q86A 4QIVA 2C3PA 3QEIA 4CJSA 2HLUA 3I5BA 3DOMB 2HBYB 5AFUH 3W9HA 4X62J 3P83D 2BTFA 2FHJD 4RPFA 2A0FB 2CZ9A 3EE3A 3EUNA 3B8AX 3JTPA 2QA1A 1MA9B 4WIIA 2C3YA 3MPYA 4B3OB 1ZBLA 4DV7F 5HBMB 1RAIB 4CZMA 1T9VA 3AH6A 4L3KA 2JOQA 1WHVA 4PWWA 3MMAA 1EO1A 4CZFA 1EAYC 1EXQA 3THXA 2YKMB 4B9LA 3CO9A 1OQ3A 3D0HE 1UAWA 4LVOP 3KK2A 3F9KA 2DHSA 1QTNB 4ISEA 3AVNA 3J7A1 1X9JA 2FHMA 2Z0GA 2ZE2A 1MWMA 1Q4RA 3C8YA 4P71A 4GMKA 1FRXA 3EDRB 4KBOA 5IOLA 1T05A 4CFBA 1YQHA 3KHRA 1JIHA 4FWLA 1FKOB 3QGGA 1RWPB 3T1HF 3HI0A 4DF4A 3O8MA 3L6QA 1QVFR 1BCMA 4ID5B 2OZSA 4DR6J 2GW8A 4QWCA 2M5YA 3M2UA 4CLLA 5E33A 4N7TA 3L4BC 4URQU 5D0EA 3THYA 5AQTA 3AVGA 4ED0A 2KZMA 2JWNA 4CM2A 1VYAA 3HP9A 2ZBPA 4WQ4C 4AE5A 4I7FA 4CERA 2W2NP 2GX9A 5CXTA 2ZWOA 2C2MB 1E6YA 4QWAA 5KQ8A 2J6SA 2RRAA 1JJCB 3THPA 1XTZA 3M1VA 2MHNA 5D0RA 2VQEJ 5AQUA 4GVLA 2NUUG 2Z58B 4C48A 2MZTA 3M9OB 4KFBA 1ZETA 2EFNA 4BC4A 3NHGA 2MZ1A 2HBKA 2CPHA 1QUPA 2BA9A 4UW2A 1SJQA 1FKPA 4WWSA 1VQNN 2UUBJ 3NAEA 2GX8A 2XMWA 5H1SQ 1R43A 2WVDA 3C65A 1RT3A 4DUZK 2YXLA 1WEZA 1VQKS 3ISNC 1ZZFA 3R7SB 4KB7A 4FYVB 1XC3A 3SFUA 2CQGA 1UMJA 1YI2N 1AXQA 5KFJA 3MMAB 2UXDJ 3DGPB 3T19A 4M8LA 5AJ3J 1CULB 2V8HA 4JI5J 3MWTA 1RDRA 1U7LA 4CJKA 1LW0A 2WCXA 2NXEA 4X66J 3RRKA 5CYMA 3DN9A 3BQ0A 2DO0A 1VQ6N 4EYHB 5HLFA 2AJ4A 1BIZA 1ZA1B 1XHXA 3OR2B 2HS4A 3HHEA 3M6WA 1K1QA 3HDSA 1MU2B 3OS1A 2X78A 4JKHA 4JI0K 2KT5A 3GL1A 1BQNA 1CJTA 3TX0A 5CZ1A 4FJKA 2R3VA 3CG7A 4WQ5A 3WX4A 5CCMA 4B3MF 4CO4A 1QD1A 4FPAA 2OIHA 4FLWA 5KPZA 4F4KA 5EN1A 1Z26A 2AZ1A 1UEUA 4MIBA 1JLAA 2HHVA 1YITN 1FJEB 5EY4A 3EJMA 5F41A 4PKGA 3BZKA 1LWCA 3DGVA 2UVRA 4C8KA 4O44A 4KGXB 4BRAA 3N4QA 5IC6B 4IG3B 3OY9A 1A6LA 4LF9J 3CCSS 4DR2F 1RAOA 1VRUA 4QPTA 3SIPB 3ZSQA 1U26A 1J2VA 2JVRA 3N01A 4F9OA 4ZVOB 4OKEA 4ZLLA 2HAFA 3I87A 1FKPB 1FVSA 4LF2A 4OLPA 3U4LA 4JEPA 3E51A 4JI7K 5CH7B 1CQNA 4Y28C 3JS6A 3WIVA 4CLYA 1IBMF 4FW1A 3U9ZA 5G0RA 3B8HA 4C8YA 4KYZA 3O9QA 2HB5A 2CQBA 4KRWA 4TLQA 1XK8A 3RRGA 2IAJA 1WF2A 3SQOP 1FWKA 5HQMA 1QE1A 1T02A 4CFCA 3WBZA 2G8WA 3ZX2A 1NGCA 1S49A 3KG1A 1ZPWX 1HYZA 1RWOB 2RIJA 3PW2A 2NPFA 3J81U 4AXJA 1Y5LB 4DR3J 3NVKA 1X5OA 1LK7A 3CC7N 4BRPA 2RQKA 1JJHA 4NE9C 2HBMA 2VOOA 1F5AA 5KFGA 3KVGA 2GZOA 3WNFA 3VHQA 1B0VA 3JYTA 4EO6A 3MURP 4H54A 4A8QA 1AFIA 1TL3A 3AVKA 2W6KA 3MMBB 5CY4A 1S6QB 1F5CA 1YX2A 1RP5A 3FSYA 1HJRA 3CGIA 3F5TA 2E2NA 3D6RA 4CJPA 5AXMA 3PFEA 4ZP6A 4NX9A 1JLCB 2KT2A 2BJ1A 5JVGL 4P72A 3POTB 4BRLA 1ATNA 3O4NA 4CJTA 5M1NA 1FXLA 3K2YA 3FCWA 3CCES 2UXDK 1NJWA 2YKPA 3PKYA 1XR5A 4M5MA 1LWEB 1NK8A 2VC1A 2E9ZA 1RILA 2E7VA 3FZMA 2AYMA 2J7WA 5GMKa 1VJWA 2ABYA 2OP5A 1RT4B 1EETA 3AO5A 3ZLJA 4ANDA 3DLHA 4TU7A 1VRUB 4DUZF 5KFXA 3BEXA 4JRPA 2UYTA 4Y00A 1RYSA 1RHKB 1VQ6S 3BBBA 3MM9A 1Q53A 3O3LA 1JLCA 4ZPCA 4DSKA 2CG4A 2RUGA 1LWXA 2AZ3A 3OVNA 3SYZA 5J2QB 2I8EA 2AV5A 2XZWA 3S6EA 1WC3A 3SMZA 4DV0K 3VZIA 3C46A 3TJ8A 3NGDA 3OFGA 3MHYA 1RWUA 3ZT3A 5GAEU 4IXCA 3TU5A 4CE9A 2W25A 4ZDNA 4NLYA 4YQWA 4Q0BA 3VGKA 3W9JA 4DV1K 4BGAA 5HMXA 1KVJA 2J0WA 3GV7B 1WKLA 2IBKA 3M6XA 5HMWA 5BN9A 1X5PA 1UVMA 1CS4B 5KT4A 2Z57B 1IKVB 2ZITA 2Y1LB 3AQOA 4KBIA 1IR0A 3K17A 5C24B 2QLBB 4OI4A 4FF4A 2A5XA 4ZPWR 2KTQA 3OBWA 3JSBA 5EUHA 1UPMB 2MKKA 4ATNA 3DI6B 3OVSA 3QRQA 3OYGA 3QEWA 3DLGA 5EWEA 1XNQF 2W8KA 2OSRA 3LZJA 1FJGF 1RWXB 5JS1A 4LF7J 1TK0A 3A8EA 3DHWC 1SQFA 4PABA 6AT1B 3CCTA 4CIEA 1U0SA 1RDBA 2CG8A 4HDHA 3TTDA 1VDHA 5A2QY 2WBNA 4X4VA 2V2VA 2WVEA 2GMHA 4OYMA 1BCOA 2HVHA 3HJFA 1J6ZA 4ZVEA 2K1RA 2YX7A 3RW6A 4FYWB 2GQQA 3VQ4A 1C1BB 1J5EJ 1V3ZA 2XHBA 4KGKA 4IO1A 4J9PA 3CJ1A 2OYQA 2NCKL 4CZHA 4EHUA 5JXSA 3HSGA 1TL1B 1U1NA 3W1YC 3ZYYX 4NLPA 1S9EA 1DTQB 4O0NA 5HRPA 1VQPS 3DCAA 2FJDB 2FVQA 3MCSA 4USIA 3CJ9A 3R3LA 3DXBA 4D3GA 2XS2A 9RUBA 5CYJA 1RLCL 2PEHA 4I64A 3U3YA 1BD6A 1DAXA 4B9NA 1URRA 4NLXA 2ZBCA 4OZLA 4CP5A 1U6ZA 3QMQA 3QDKA 4KR0B 5F0XA 2ITMA 3IC1A 3GP9A 1DBDA 4NA2A 1K47A 3WDOA 2IPOB 5LT5A 2W1BA 4MK8A 2AQ4A 1VQ5S 2ZJQL 1H98A 2AGOA 3KNAA 2HF3A 4AHTA 5MAOA 1FWLA 3CCZA 3CMEN 4YY3K 1GXUA 3JAMO 4NI2A 3ETOA 2FBXA 4P7TA 2AYGA 4DV4F 5ETRA 1S0NA 1MWKA 3KD1E 2QE5A 3UDLA 3AV9A 1WTBA 3U9DA 2QWMA 4M5IA 2BW7A 2V2KA 3DRYA 2RDDA 2ZBIA 4QR1A 2AJFE 2PA8D 1NJYA 5DG9A 3PSFA 1J54A 1QSYA 1NBEB 4LRFA 3EKUA 3T5HA 3AVCA 1S0VA 3NP5A 3OYCA 4KJIA 1WSRA 3ZSWA 2XZTB 1R59O 2R7TA 2Q6BA 2IRXA 2ROGA 3G6EN 4FLUA 1HFEL 4LJMA 4PG7A 2A2DA 1Q8KA 2QLJB 3NCPA 4Q43A 1VQ8N 1D9AA 3IFRA 4J9UE 4IOBA 5HROB 2XLKA 2YY3A 2DYAA 5CYQB 1MW7A 2E5LF 1Z25A 4RW4A 3PIPQ 2B4VA 4RNOA 4FSVA 1VI7A 5HVGA 1KHWA 1B9DA 2NYHA 4A5BA 2BOAA 1OYEA 4FS2A 5D0HA 2ZWHA 2WVCA 1SC4B 3JXOA 3AVFA 3I9ZA 3SPZA 4DL4A 3QIDA 4YORA 4L8RB 2YX4A 2R2RA 3RW7A 4PUOB 5A8WB 3QJPA 2Y1IA 3VEXA 3D2EA 2ZOMA 2IHR1 4A8KA 3T1YJ 3DRRB 3FZKA 1FDBA 3HOTA 2HBLA 1P1LA 3U1NA 4AXIA 4BWJA 4JI1K 4X66K 3CCWA 3CTRA 4CRJA 1BWEA 1V5VA 1G7CB 1WAJA 5C2FA 3R5DA 3DDKA 3DHXA 4FOIA 3KK3A 3KKRA 2DO4A 5DMRA 3S3OA 2MKJA 1S1TB 3TQEA 8ATCB 1EB0A 4DPTA 3F9MA 2WB1D 4JK8A 2MZSA 3MM5A 4WIQA 4CLUA 2A6OA 4H5RA 2E2PA 2ROPA 1KWMA 1RWNB 2EWHA 2IJFA 4F2RA 5BR8K 1YI2S 3MMVA 2F9DA 2FLOA 3TVKA 4ZS6A 4PL8A 4JKGA 1KVBA 3QGPA 1HI8A 2VKRA 3OD2A 2W9AA 3ZSVA 4MH8A 2GA7A 1B0TA 6FDRA 1NGEA 4GKKK 1KLMB 1H2TZ 4JBCA 1U1QA 2V94A 3THXB 4H0XB 1WC6A 2F7TA 5K9FA 3BB5A 2W8LA 3QFPA 3S41A 3CCRN 3I6PA 1YXQA 2KYXA 4LBPA 4WFXA 4QQBA 3GILA 3VQ5A 2MPUA 3LP2B 5LXRA 4FJXA 4USTA 1WOPA 3RAXA 4QIGA 4BREA 1NDLA 5FLXY 1U2VB 3E2EA 4U7BA 5IXUA 4V1Ak 3B54A 3HVTA 1YZ7A 2HVIA 3H1VX 2F9TA 4DX7A 3MAHA 2F7VA 4F2SA 2OMOA 4MDAA 1AFJA 5C42A 3BSAA 1RBAA 3UN5A 3SQ1A 5ETQA 4BR4A 2OLWA 4H0PA 5J2PA 3PV8A 2HNDB 3MX2A 2KQ2A 4DUTA 5FJ4A 4HHTA 3I56N 3J7ZO 1P90A 3QT8A 2R8KA 4IFVA 2X3GA 5HVHA 3IRWP 5ETPA 2BQUA 1EWQA 4CCHA 3TA1A 1FJCA 1WUAA 1CJKA 4KTWA 3P31A 1X4DA 1S7HA 3ZZRA 2V2ZA 2BOPA 4QWBA 4UUXA 4NEYA 4OHXA 3K7RA 2G4BA 2DISA 1WORA 5ITHA 3ZETA 5K20B 1IKXB 1W2BR 1NKEA 4BCAA 1KNZA 2CJYB 3HL8A 2HEKA 1R6VA 1H6KX 1ZAVA 2CGLA 2XY5A 3QICA 1UW4A 4FZYA 1RJJA 4YR2A 3FEXB 3HULA 4P2SA 2U2FA 3ZX0A 4NYFA 2DR9A 4JV0A 1B64A 2WONA 1K8KA 2KKZA 5LMNF 2YWEA 3POTA 1BU6O 1KLMA 4FPIA 4HUFA 3DXKA 4DU1A 5E84A 3I5CA 1CULA 1D9FA 4IH6A 5AQSA 2OKQA 3MN9A 4O3RA 3GFZA 1D1UA 4WTYA 3LANA 4FS1A 1X3NA 1HBNB 5FIIA 3GB0A 2UUAJ 2OPRA 2VPZB 2FDNA 5F0UA 3T9NA 1MWYA 3TO8A 3BYPA 1NBWA 3WIUA 4KH0B 5DM6L 4MIAA 4GV6A 5AQXA 1ASWA 1XMQK 3BGUA 2ZZTA 1SS6A 4C11B 1CLFA 3BGLA 1T03A 3AB2B 3SJJA 5BR8J 2QL7B 4DV5J 1IJEB 2LA6A 3QEPA 1YRUA 3UNGC 4RBTA 2QW9A 2B4OA 3D5MA 4ZPAA 1HNWF 2V63A 2XHWA 4X64J 1QUVA 4FM0A 5AQYA 4W5TA 4USWA 3P5JA 4EGLA 2HWTA 2PGCA 1FW6A 4LF9F 1CVJA 4O44B 1WSFA 4USMA 1T9UA 5KRSA 2M0GB 4JI3K 1GMVA 2FVCA 3GR0A 1WC0A 4PYDA 5KT5A 1R0CB 4O8UA 2UUTA 1ZM4A 2VBYA 5HQ8A 4OZ3A 4O5FA 1SQKA 1KC8T 1EZZB 1V4TA 4CO3A 3OYAA 1U8WA 5ETSA 3UVJA 2LCWA 3DOLB 3TA2A 2VZ9A 4FPRA 1TMJA 1CZAN 5IWAF 5LMUJ 3MDFA 3RJMB 3SCXA 5DETA 2ZH4A 4RNFA 4X65F 4XO0A 3MEEA 1X9SA 2WONB 3TARA 1FKAF 3R1XA 2WB4A 1HBOB 2WHOA 5GAHI 2G8KA 3KJVA 3TAPA 4DTMA 1KVAA 3QRRA 3KK1A 2MQNA 2WOMB 1A7GE 4E1JA 3AVBA 3VZHA 4I6MB 2FSNA 4ED2A 1F9EB 3HMJG 3H0PA 2M4MA 4M5NA 2D0AA 1PJ7A 3OS0A 3PG9A 2V34A 4DL6A 4PKDB 4CH0S 2AJ1A 2ZNYA 5F8HA 2VOPA 3DLRA 2HHHJ 5ADXH 2RDIA 2LLZA 4G1PA 1QQOA 3SCLE 1U4BA 4OFZA 2YJFA 2F1FA 2EI5A 4U9RA 1LWFA 4CF8A 2GNKA 2QSWA 3I0SB 1RDUA 3OLAA 2EX3A 2ZKTA 2UUBF 3QSYB 5HJYA 2YI1A 1VBZA 3C7NA 3WQTA 1HR0K 2N3LA 3RTVA 2H65B 1VIOA 1O6XA 2ZUGA 1NPKA 3A8KA 4ZP7A 2ZD1A 3IMXA 5AQIA 1LWEA 4JI1F 4PPZA 4XIUA 4JI1J 2H4YB 5I3QA 4F3OA 3MAAB 5A8KB 1VQ9S 1YBUA 2W24A 3E1YA 2EW9A 4YB6A 4ZITA 3UR3C 4A57A 2BUPA 1X4EA 3I9V9 4DPOA 2OPPB 3LPEA 5BPMA 2UUAK 2VA3A 2QT7A 4FWPA 3Q8RB 1N4LA 3ISND 4QCLA 2XS5A 2RRNA 2W2MP 2WVBA 4U7UK 1K73O 3L09A 1MSWD 3MM8B 4Z2XA 1DLOA 1NJIT 3GBTA 1YIJS 2ZZMA 5FPNA 3H20A 2WTFA 2EKYA 1H38A 1Q81T 3V6KA 1D8ZA 3HSZA 1PIEA 4U6PA 1QQNA 2PO4A 4QS9A 1RTZA 4F4YA 2ZKUA 3D6HB 2XS7A 3HHLD 4ZPVR 2CPXA 2MQ8A 3F2KA 4NLWA 4WJBA 3GTYX 3BKUA 2NREA 4X64K 3HRGA 3R7NB 1L3VA 2MB0B 5MLCV 2HBRB 4KB1A 5EOYA 2QMUB 1JL1A 2Q6CA 2C3MA 4USUA 5KRTA 2W4CA 3ATVA 2MJNA 3SPYA 2YQ1A 2HQIA 5F9LA 2FLNA 1LFWA 2M8HA 2MSTA 1KQGB 2QWQA 5HROA 1TZ0A 1T9XA 3OQ2A 1HBMB 1FI4A 4DR6K 3NCRA 1N5VA 3VETA 4DTSA 4OZ5A 4ZLJA 2X1AA 1FTRA 3LM9A 2H5JB 3DOKB 2KG1A 4ID8A 1MROB 3V1OA 3P4IA 4P74A 1NAQA 2O8DB 1WSJA 3CCQN 1T0TV 4A62A 2C1EB 3KJNB 3MFIA 2WW4A 3ZZTA 3OPKA 3DXSX 2DIVA 2KH9A 3DRXA 1N5QA 3LOUA 4TXSA 4CZEA 1W25A 3CCLS 1PJ5A 1K9MO 3H5SA 3C15A 1V9OA 1S1WB 4RUHA 5T7BA 3BY5A 4TKTA 1S10A 3QWPA 3PEJA 4ILRA 4A48A 4CJRA 4K43A 3VGMA 5KFOA 5HP1B 2IDLA 5KFKA 4OGCA 2PD1A 4CLTA 1BQNB 1CJTB 3MM9B 4JKFA 1O0PA 2D5RA 1S1TA 2DNNA 2XZDB 3T1HK 4FLVA 4ALZA 1RBTA 5IQ6A 2YNFB 1JLBA 1MDUB 2HBZB 3M8ZA 2IYIA 2ASDA 2BVZA 3NWRA 1RAHB 4B3TF 3RYLA 1GX5A 3O1WA 4DDFA 2HHPA 2MMYA 5D4OA 4FWOA 1VCTA 3MUVP 4LR8A 4CJQA 4CJ7A 4O3SA 1NB7A 5F3TA 4PY5A 4XAKA 1ITGA 3VENA 4HUEA 3IWXA 2IY5B 3K5NA 2JH3A 3GONA 1RT1B 3GOIA 3ET6B 5EX3A 3EXCX 2E8AA 1R6YA 3OUYB 1Q1KA 5L9XA 5CZ2A 1RSCA 2YNIB 4RX6A 1HWJA 2HQGA 2HFNA 3MD1A 5A8RB 1XR7A 4Y65A 4BRDA 4ED4A 2BABA 3NS5A 3PW7A 4RNNA 2W9BB 2KZZA 1KD1O 3AO1A 4FKYA 3RR7A 3EWGA 2V69A 2R2UA 1GLBG 2OFHX 3D3CJ 4A8OA 2MKHA 2FIUA 3VOVA 3HOSA 4GVBB 3D9BA 3RBEA 4MK7A 5G0RB 4ZVTB 3KD5E 1N6QA 1GQEA 3L9ZA 5DM7Q 1I6JA 2P5GA 5DLGA 4ELUA 4CEOA 5M1KA 2GBZA 3FFIA 1HKAA 1RWVB 2X6SA 1HNWK 5M1PA 2DHHA 1JCEA 5B09A 2KM8C 1PBAA 4DR7F 2YKAA 2W2OP 2H4WB 5HOOA 4HYKA 2O67A 4OPHA 1HX1A 3NOCA 1RGVA 1RT7A 1NK4A 3GJTB 4FVCA 2RQ4A 4QWDA 2V50A 2EFPA 4B3TJ 3ZSOA 3QSIA 1XBWA 1CJKB 4QIEA 2F3JA 4FKXA 5ETNA 4RW9B 3ZO7A 1Y64A 5AQGA 1F2GA 5SZTA 2R7UA 5JLHA 2YNHB 3M6GA 1WI6A 1JXEA 2BXJA 2JRSA 2F63A 4Y0FA 3RRHA 1NHKL 4LF8J 4NEZA 3PEHA 3BGFA 2EXUA 2E1ZA 2ZM6K 1U8SA 4WU3A 2WUSA 4OLOA 4QU6A 5D0GA 1R8CA 4ZCIA 5T41A 5D15A 3SUNA 2FJXA 3LAKA 1ZS6A 2PFFB 5EX0A 2OSQA 3VF6A 5KFYA 5AQWA 3VGSA 4C6AA 3KHHA 2GQCA 2CNOB 1YTYA 3ET6A 1Z6RA 2EFGA 1YVUA 5TKYA 5BN8A 1YDLA 4CIGA 3G82A 1J5EF 3VEZA 2Y1RI 2J9CA 5F8GA 5KFSA 1ASUA 3VALA 3CJSA 2BE2A 4G65A 3GIIA 3ZT2A 1NNEA 1N5SA 3FQLA 4DR5F 2Z30B 4DX5A 4M45A 5HI7A 3MCPA 3OFFA 3BEGB 1IBKF 1YJUA 3PX4A 3SAGA 1TKTB 2QKKA 2IJNA 4NYOA 2CQDA 5IT0A 5DO2A 2DY9A 4V19S 3MECA 3UB5A 1JMTA 3AA2A 2DXDA 1YJNN 4E19A 4YDUA 3ZZUA 2AEJA 2ZDPA 2V4QA 3QPIA 5E3AA 1VRTB 3CCEN 3OYJA 2VWBA 1IV0A 4L74A 2A3JA 3W65A 2YQ3A 3V6DA 3ILLA 1U2CA 3SCJE 2CQ2A 4A8XA 3K2PA 2UUAF 4Y34A 3E9OA 3L7PA 4PQAA 2KFZA 2FVPA 1I3AA 3MPVA 3DWLA 4NYPA 1L3UA 4KTQA 2XLJA 3SEOA 1L3KA 3C6UA 3EKSA 3HBTA 2MY8A 2ZH8A 1EJ7L 1RZMA 2VWKA 2IRUA 2OPQA 5F8LA 3UN2A 5LMUK 2I6WA 3FGVA 2QA4G 3OFHA 1IBLK 2QGFB 2V2QA 1OY6A 4LF8F 3GYGA 4URSA 4NLDA 3NNHA 2YCHA 5KG2A 1WC5A 3O9UA 1JJ2M 1FXRA 2UUWA 1OH5A 2IDOA 4FLZA 1QAYA 2BGGA 4B1WB 3CC2N 4Q8FA 1NGGA 4BY9C 3V5RA 5GAEP 3TX8A 4YB5A 2JGUA 3MXMA 3DRSB 2D69A 1RTJB 3FNNA 5KFMA 3HHDA 3UW1A 3NMRA 4A8MP 1HQEA 3OJSA 4H0OA 4DR7J 5ETKA 4ZVQB 3HK2A 5DG7A 3S9HA 2HFOA 4QYZJ 1WACA 3AGRA 2KRBA 1AZSA 4CEEA 3M8QA 3IG1B 1GFWB 4M63A 3CJAA 3PXGa 4JYAF 5KFDA 5DM6Q 3OBIA 5M2UA 3P5BP 3K5MA 2MKCA 4AHVA 4NZ7A 4Z4IA 4ELVA 2XSFA 2NRHA 2GV1A 3W66A 1HHTP 2A6MA 5C5JA 1BUPA 4MDBA 4CD3A 3MMCA 2WSEC 1X9MA 4K25A 1APSA 3BO3A 4OYBA 4CBUA 5G4DA 1XWLA 4ECTA 3KG0A 2ZH6A 3TPQA 1S1UA 3KZBA 3NVMA 1HMVA 3NGTA 5U47A 4OYIA 1WHWA 3TUPA 3OYFA 4KH1B 2M8DB 3SQ0A 3VTHA 4J9LA 4L75A 4JI0F 4TYBA 3C6UB 3CFPA 3H5YA 4DR3F 4NCGA 2C2OB 4HL9A 3MR2A 3CYMA 3O9RA 2R8GA 4PWDB 3NNCA 1KAYA 1RHQB 5A2QU 1RBLA 1C4AA 2NLXA 4MMOA 4B1VA 1DRZA 1RTIB 2DNPA 3DLLL 1NM1A 4AT1B 1MN7A 2J8SA 3FDSA 5C7PA 1Y3JA 1L3TA 2CQ4A 3I4PA 3GSDA 1YT3A 2CQIA 3NH0A 2JLFA 4V19X 2OPSB 3X3UA 1RT6A 5DGBA 3AXKA 4ZHRA 5HL7L 4K4SA 3ZTQA 4UOGA 4G1IA 1GNKA 4X62F 5M1OA 4KKOB 2B4JA 2P51A 1C0UA 4FOEA 1DGKN 1VK8A 3Q8PB 2V68A 3BZQA 3ENWA 2RQCA 2EBGA 3CC7S 2RF2B 1JLQA 1HIYA 4B3RF 1F2HA 4B9VA 2HRTA 3LUYA 4IR9A 1F3FA 3HFVA 1CXQA 4C1NI 3OXLA 3QBWA 4YMEA 2KVQE 2JNJA 3SUOA 5AQOA 2Q97A 1KR4A 2DNRA 4FK4A 2ZF5O 3ZX3A 2AKWB 4U95A 4JKEA 1JJ2R 4XH1A 3D28A 3CQYA 1RISA 3J7AN 4FXDA 3Q8SB 4EBCA 3CJKA 1TGOA 3M6VA 4R8UB 1NGDA 6FD1A 3OLBA 2KO1A 2BE9B 1MROA 3P39A 3V6JA 1QZ6A 3BREA 2FF3B 1S6PB 4B17A 2RN2A 5LMNJ 2DNYA 3PYDA 1HMVB 1S9GB 1UFWA 3I4HX 1AUSL 1JKHA 5B0DA 2BR0A 3ELHA 4WBFA 2E4LA 3HHLB 4DL3A 5BRFA 2V6AA 2BDPA 4DG1B 2PN6A 4BR7A 5D8HB 3JQKA 3VR1A 2VFUA 3IBFB 1R3NA 4EZ9A 4C3LA 3GU0A 3ZZYA 2V8PA 2DPJA 3SSRA 1W0HA 3VQQA 4CF9A 7FDRA 3BF1A 2JFKA 3UCUP 2KJVA 5RUBA 3KLIA 2HQ3A 4N8NA 2F8EX 4EMDA 1RTHB 1X4HA 2JDJA 2YPYA 3JTNA 5L38A 2QLWA 3P49B 3FSIA 2XSJA 4DV4J 2VKZG 2P6SA 5A0YB 4CQ1A 3QERA 4MIWA 4DLGA 1FEHA 4H0TB 1KSPA 3CPWM 2LEPA 2RU3A 4WYWA 1YUWA 2XTJP 2LP4A 5A8KA 1OSCA 3I0RA 1R8HA 2P8IA 3I33A 1RT4A 4Q45A 2VDHA 2AA4A 3J81j 2DGQA 2XCAA 4AH9A 1FT8A 3PW4A 5FROA 3GE1A 1VQON 3ITHA 4JI2F 4KRFA 4YOXA 4PA1A 1U0HA 2OI2A 1RTHA 3KK2B 3FKBA 2AP1A 3CJKB 3J7YI 1NGBA 4IFVB 3TNVA 5LJWA 3U6FA 3T1AA 2ZQBA 2CYYA 1C0GA 2DGWA 2GC8A 1EWRA 4KV8B 3WUHA 2PE8A 2F9WA 1WNSA 4BVOA 1K44A 4NLSA 3JAMY 4X4PA 4WKRA 1KQFB 1JKHB 1RT5B 2O8FB 2DGTA 2P6TA 3QESA 4WFAQ 3MCMA 2FBYA 2H51B 2NYIA 4GC6A 4LSNB 4MYUA 2E1YA 4BC3A 2I1RA 1JLFB 2CNNB 4PUOA 2MKIA 4JV5J 3K8WA 2XG8A 3HF5A 2CDQA 2JC1A 3Q23A 1WF1A 3QLHA 2KI2A 3PRBA 4LF8K 2XYGB 4K0KF 5L1KA 4CF1A 4DB3A 3KIOA 3RSEB 1YTAA 4J9RA 3HP6A 3Q24A 5K14B 3OSPA 4LF7F 4AILC 3MEDB 3BN7A 1TYQB 1MNEA 4PPDA 4KV8A 4DR2J 2CRLA 3F56A 1VQKN 3DLEA 3QT7A 4Q5VA 4QPXA 2LQ5A 4JS4A 4O8KA 3HZGA 3LA0A 4E1MA 5F3ZA 3PR4A 5JS2A 3Q0AA 3T1YF 2HRUA 3MAAA 2G8HA 2JLGA 3MF5A 4CGDA 2F8SA 3A5OC 4E7IA 1ZOTA 5CZXA 2E6LA 1YF5L 3PW0A 2OTJN 3GV5B 1IG9A 3VAMA 1Q9XA 2GVZB 1EQ0A 1F60B 4F02A 4KTZA 3QGHA 4G6VB 3DNCA 1ZPVA 4WXOA 3ENBA 2ADBA 2E5LJ 3C6TA 3CM5A 4ECXA 5BPNA 3PZPA 5B0CA 4CEFA 1T94A 1S1VA 4DSFA 2FZGB 3M7VA 4X4NA 4H5TA 2VGMA 1GTHA 4BR2A 2DT9A 1OH7A 2Z1IA 4CM0A 1ZA2B 4WK1A 3QT5A 2XMMA 2XMKA 3OTOJ 4JI6J 5H9EK 2YHYA 1FRHA 1LW2B 3ZT4A 3V6DB 1VQ4S 4DMNA 4NLCA 1TL4A 1WKJA 4YB7A 3ZNUA 4P6QA 5GMDA 2MJUA 4M42A 1NSQA 4ZN3A 2W4PA 2JX2A 3A4TA 2P9UA 4JHDB 2P9SB 1CJUA 1BXNA 1NNDA 4E2FB 3KLGB 1X5TA 2GIFA 3WC0A 1ZBHA 3TZXA 1SH0A 3CNQP 2N3OA 2VL1A 1RCHA 4OZNA 3UDEA 4Z0UA 4CZIA 3LL3A 4KB0A 1FO1A 3R5CA 3NH2A 4FM1A 5FLXO 2E1MC 3W2VA 2Q79A 2LVWA 3NDKA 5LL6Z 2B7CB 1GMWD 1O5JA 4ZPTR 2CJXB 4CJLA 3MCOA 1NRKA 3VPZA 2V8DA 1U1OA 2V9WA 3CJ2A 2HWIA 2IIRA 3BJYA 4FP9A 1PO6A 3TUIC 2Z1GA 1U48A 4DSJA 4S0MA 4ID1A 3UKUA 2JEJA 4BR9A 2OANA 3TR8A 3M9NB 2W01A 1HYSA 3NCQA 3QBCA 3EM1A 4LC9B 2W9CA 3CIMA 4KQZA 4MJKA 3EPGA 1UOCA 3FBEA 3DXKB 3SBGA 3NCIA 4RWWA 2QRRA 3CVKA 5AQMA 3C6TB 2Q3SA 2V4JA 4EI2A 2QLXA 4CDIA 3DDIA 4OLBA 2BUNA 3F0NA 4DR2K 2ZJQQ 3NGYA 4OZ2A 1C2PA 1OPIA 4PG8A 4CGFA 3GSIA 2GWKA 1MG7A 3PSIA 2ZJPQ 3UDCA 2G1DA 3DMJB 4WZMA 3A2FA 3LO3A 1RHRB 2HQDA 2WW8A 1SQEA 3G71N 4R0JA 4ED7A 2EBEA 1XNQK 2ZZNA 3H7HB 3G82B 2P9KA 4DV2J 2CNLB 4LF5K 4DV3K 2MY7A 2M2BA 5AQQA 4BRHA 5I42A 4OJGA 1BO5O 4LF1A 2KN4A 4DQQA 4A61A 2HSTA 3L2QA 4ZVHA 4QYRA 2DR6A 1G2EA 2DXFA 2KHCA 3NF9A 4LSZB 2DRAA 3V4MA 2HK3A 2VBZA 5KFZA 4CJUA 4OYZA 1WJ9A 4OPJA 2HNZA 2HQFA 4B3MJ 4J91A 4RL1A 5HLFB 1OYDA 3V1QA 3W2WA 4LF6J 3DMJA 3G6VA 3W2VB 1KLNA 3BS9A 2HRYA 3BSNA 1FTCA 2P9LA 1BY9A 2X1BA 4ID5A 2B8PA 4AM6A 1T9WA 1X4GA 3DU6A 3D67A 1W9HA 5AJ3K 3DOLA 4ZTJA 2JC0A 4MYTA 4UQTA 4BG8A 2X74A 4P75A 1B9FA 1KC8O 4KHPK 3E8OA 5L9NA 3KYLA 3HVTB 3OT9A 3UDVA 1P6TA 4KHUA 2EFQA 4HTJA 4UT4A 3FRZA 1SZ2A 1JLAB 2FC0A 3NGKA 3CQXA 4ZVUB 3CXCM 1HD1A 2V67A 4PRFA 4CIOA 2ZJRL 5B7WA 3D6MB 3DLKB 2HURA 2FB0A 2F8TA 2KXFA 4AHCA 4JI0J 2LQJA 5CCLA 1YVFA 3UCGA 2DNZA 4NLTA 1D9DA 1FFWB 1K8AO 3NS7B 1JCGA 2JWKA 2W42A 3CF5Q 4K4ZA 2G1HA 3CD5A 1YITS 3SLCA 3VQPA 3TP2A 1LV5A 3NXZA 1GLLO 1P9YA 1CS4A 1M5VC 1H2VZ 5HSPA 2CJ9A 4F3QA 3MR5A 3OHBA 1TV6A 4CTAA 3B4MA 1PBUA 3DFEA 4U96A 4FJIA 4OYWA 4H4MA 4BE1A 4QS7A 2HBJA 4YOVA 4CI0B 2I7NA 2G8VA 1G99A 4OGEA 5DLFA 1JB0C 1B3TA 4JYAJ 3ID8A 1W2BM 3DLKA 4DUYJ 3FR0A 1AZSB 5EDWA 4UY8O 4EEYA 2JL9A 1TK5A 2L9WA 3DXMB 3MEKA 2I5JB 1Q18A 1T9TA 4F26A 3D1OA 3BR9A 3AODA 4EFHA 1ZZNA 2Y1JA 3W61A 3ULHA 3UQSA 1RKJA 2NZ4A 1PCAA 4YOWA 2C2KB 2CVIA 3OL7A 4OJ3A 2HG4A 4B1UB 2N82B 2DTUA 2CXEA 3M2VA 1P27B 3GLJA 3SDEB 4XDCA 1E4GT 3MM8A 2DH8A 4YOUA 3UE5A 3ULEB 2UVVA 3ID6A 3IAYA 1TL1A 1XMQF 2FQQB 4H4KC 1S4EA 1UZDA 5LSLA 1DFDA 4LQ9A 2XC9A 3NF7A 3D68A 4FN5A 4P2MA 5CABA 1OH8A 4PG5A 2CWKA 4M3RA 4B3SK 5IT9Y 1SKRA 3R27A 5KFHA 5KFLA 1LKZA 2IJRA 2YWGA 5IC4B 3J80U 5K8MA 4WCEL 4C0OC 4IDKA 5M2PA 3AOBA 3AGKA 4XDDA 2L08A 4ZJQA 4WXWA 3D2FB 3CO0P 3U1MA 2H5IB 4BE2A 1NEEA 4LIRA 5AQVA 5KFIA 4TY8A 3BSCA 3SAFA 2FC8A 3MXHP 2EG2A 4H4OA 2QA2A 2HIQA 3U8XA 3EZWA 1X9WA 2VCPA 3JXUA 1Q8IA 4GMJB 3JB9k 2VG7A 1SI9A 3VQBA 4CTAB 2GEMA 2UZAA 1K1SA 2A1BA 1QM9A 4M1KA 1P8ZA 2UV8A 2HIYA 1Q7YO 3C6HA