1RT5A

Hiv-1 reverse transcriptase complexed with uc10
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
542
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 143
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt5A05
2HNZA 1TL1B 3DOLA 4FJ7A 1S49A 3OYLA 4DSJA 3CJ2A 3OL6A 3NAEA 3M8RA 4AH9A 2O4IA 1BHLA 4B8AB 1A5VA 4KHRA 4EZ6A 4IG0A 1X1PA 4KO0B 3H4BA 4K8XA 3MXJA 4E3SA 2D0CA 4WE1B 1BQNB 2R8KA 4M3XA 1VRUB 3HT3A 4DFMA 3LWLA 4JRQA 5KT4A 1WSEA 2RF2A 4IQXA 3VQ9A 4DS5A 1S48A 1HPZA 4FW1A 3OHBA 3L8BA 1TVRB 3BSNA 2VG6B 1HJRA 4DWIA 3VA0A 2BE2B 4WZMA 4Q43A 1SL2A 4KHNA 4FLXA 1RT7B 3HO1A 2JEFA 4W5RA 2IM1A 2I5JB 1BIUA 2EX3A 3ZT1A 5C24B 3SUQA 3TAQA 2ILZA 4CJ4A 2WONA 4FLUA 2UVWA 3DLHA 1EX4A 4RW8A 1HNIA 4CGHA 2HWHA 4CFBA 4KB7A 4IFYB 1YTAA 3GIKA 5DG7A 4TYBA 1Z25A 4CF1A 4KI6A 4DTNA 4CJVA 3DLEB 5DG9A 4JV0A 2R8GA 4F4KA 4Y2AA 5EWFA 4E89A 4F8RA 3SI8A 3LANA 1RDCA 4MKBA 2YKMA 1RT4B 1DTTB 5HLFB 4ZP7A 4ED2A 3DRPA 1B9DA 4FJIA 5I3UB 5KFEA 1JKHA 1JXLA 2AWZA 3V4IB 4RNMA 1HYZA 2ASDA 3T5LA 2BQ3A 4FJ8A 2J6UA 1S1WB 4LSLB 1IKXA 3CQ8A 1IKYB 4B9VA 3KK2B 1CSJA 3H59A 4Z4GA 4CGDA 4ZHRB 1BGXT 3N6LA 3SFUA 1RBTA 3ZSQA 4ZP9A 3SPZA 1TKZB 1HYSA 3TAGA 3DRPB 3GYNA 1JLCA 5FDLA 2XY8A 3LPUA 1RT1B 3UQSA 3AO5A 4XIUA 4KV8B 2HWIA 4KO0A 3OYJA 2J6SA 4FXDA 1RTDB 3RBDA 4KREA 3E01B 4LQ9A 3VQSA 3OYFA 1QAIA 4RW7A 2UUTA 4CJEA 3ICLA 1VSJA 1X9WA 3LDSA 4K4TA 1B92A 2VG6A 4RUCA 1X9SA 3NAHA 2E9TA 4IG3B 4ICLA 1KSPA 4XPEA 3AO4A 4IDKB 2BQRA 5KFBA 4O0JA 2R7YA 3PHEA 3GIJA 3HYFA 2FJXA 2PZSA 5KFJA 3Q8PB 4CHPA 4B08A 4I7FB 2O5DA 4C8OA 3BR9A 1WLJA 3TAMA 4ECXA 4ECSA 4NZ0A 4DTOA 2G8KA 1RT2A 1UA1A 2HVHA 4CEFA 3MXIA 4LSNA 3ZSZA 4YMEA 3SYZA 4GC7A 3IG1A 1TQLA 2W9BA 1WNEA 5KFGA 4I9QA 5KFSA 4Q45A 4CK2A 3B6OA 4BACA 4RW4B 2GV9A 2E9RX 4JLHA 3T5HA 4GW6A 2FVRA 3PV8A 3RRHA 4DLEA 4CHYA 4C8NA 2PY5A 4KAZA 4MK8A 1KCFA 2HHVA 3GILA 4KB0A 3RB6A 4DSLA 2DTUA 3MR6A 2PYLA 4IH6A 2BE2A 4PA1A 1RDRA 2WOMB 4ZPDA 3TI0A 1R0AA 2OPPB 2JC1A 5HRPA 4NLDA 5KFVA 4YFUA 3SCXA 4PUOA 4CEZA 4O55A 4ZVFA 1W9HA 5FDLB 3GV7B 4Q8EA 1RT1A 3LALA 3AVMA 3V9XA 3RBEA 2C28A 4WYLA 3VQCA 1S0NA 3S3MA 4RNNA 1T03A 3NGZA 5KRSA 3SQ2A 2XGQA 5SWMA 1S6QA 4EP5A 4TQSA 4KHYA 3L3VA 1K1QA 3I0RA 2YNGA 3CDEA 2ATQA 3V9WA 4NLVA 3DRSB 4FW2A 4URQU 2XY7A 5F9NA 3OL9A 4U7CA 3DOLB 4WXWA 1S0MA 4RNHA 2X78A 3VQEA 4MK9A 2HNYA 3TANA 3DYAA 1XR7A 5KTQA 2VA2A 5J1EB 4KTZA 2E9ZA 4U6PA 1VSLA 4Y1DA 4CERA 3NF9A 3CFRA 3IRXA 1QUVA 2YNIB 2C2RA 3MEDA 4DU1A 3KOAA 2P5OA 2E4LA 4PWDA 2FBXA 3SQ1A 2BR0A 4RW9A 1TGOA 3I0RB 1TKXA 2OPRB 4ZTJA 3ZCMA 2C22A 3DRRA 3O3GA 2W7OA 2W9AA 4O3NA 4QWAA 2PYJA 1KVAA 5DGBA 4TY8B 4OJRA 1YVFA 4DTRA 3AO2A 2F96A 4F4YA 3ULDA 4DL5A 2RN2A 2I5JA 2AGPA 4CJ3A 2Z1JA 1N6QB 3PZPA 4NLOA 1JLEB 2XHBA 3ZT2A 1Y97A 1KLMA 3TABA 1KRPA 2HMIB 2AJQA 3U6FA 2OPQB 4OLAA 5T14A 1TV6B 3FFIB 3PO4A 5EUHA 3KIOA 4Z4FA 1U4BA 3D0PA 1T8EA 4HVJA 1T05A 3FRZA 3CYMA 4I2QB 5KFQA 3BGRB 1J54A 2G8HA 2AGQA 4H8KA 4DTXA 2QE5A 4IKFA 3NH2A 1NKBA 1FK9B 5L1LA 3MFHA 3OS2A 4EYHB 1NKEA 4I7FA 4ZVGA 4TXSA 2ITGA 4QPXA 4O4GB 3V1RA 4CFCA 1LW2B 1RAJA 1S9EB 1S1WA 3G0ZA 4CHNA 3NF8A 2WTFA 1IKYA 4K4SA 3C6TB 3Q8RB 3AVGA 2QKKA 1RBRA 4I2QA 4TN2A 1NNDA 4DU4A 2FJWA 4HHTA 5F9LA 1L3TA 3PX4A 1HNVB 2G8VA 1REVB 1TKZA 3NL0A 2ZE2B 3HHKA 4CHZA 1U47A 1IO2A 1SKRA 1JL2A 4H4MA 1LW0A 3KHGA 3CM6A 3OY9A 4KAIA 4Z4IA 2FVCA 1JLAA 5KFHA 3OYMA 3QIPA 2C2DA 3MECA 4N41A 2E6MA 1RTJB 3DRRB 3C6TA 4FZXC 3S3NA 3QEXA 4FBUA 3N6NA 3E51A 3SFGA 5JS1A 1BISA 2OA8A 5J2QB 4J9KA 3V9ZA 3KLHA 1VSMA 3LP1A 5JXSA 2HNDA 2X6SA 3KMSA 3PUFA 2IC3A 5KFCA 5C25A 1RYRA 4Z4HA 3CVKA 1KHVA 2A1RA 1ASVA 4C8MA 1FKPB 3ZT4A 2FVPA 3OLBA 4FJJA 2FBTA 2RF2B 4NLUA 2D5RA 1Q9XA 5J2NA 1D0EA 4M3UA 4QCLA 3TAMB 1S1UB 1F21A 1RT2B 3QLHA 2D3UA 1C6VA 2KW4A 3LP2A 3LPTA 4FK2A 1WSGA 4NRTA 4RU9A 4FJLA 3IGVA 3TARA 3DYAB 1UOCA 3QGIA 2VA3A 3DM2A 4DEZA 3HP9A 2FBVA 5C25B 3OYCA 3BSAA 1FK9A 4Q5VA 1S4FA 2IOCA 3SUOA 1CZBA 2A1SA 1DLOB 1IM4A 1VK0A 3Q8QB 3EZUA 3NMAA 5EWEA 4KBIA 1MU2A 3ISND 5EDWA 4DQSA 4O4GA 4FJXA 4IFYA 1BCOA 1LV5A 3SV3A 4IFVB 5HROB 1SV5A 3MEEA 3PVXA 4CK3A 4DL2A 1UWBA 3DLEA 4TY8A 3H98A 3T3FA 2Z1GA 3QGHA 4NLTA 3OHAA 1CLQA 2G8UA 4N5SA 4YR3A 1REVA 4LQ3A 3RRGA 1G15A 4PUOB 2XY5A 2ZKUA 3G6YA 4H4MB 1JXEA 2W7PA 1VSEA 4HUEA 2R2TA 3HVRA 5KFNA 4CESA 1EP4B 1S6QB 1VSKA 2XC9A 3SNNA 2XI3A 5KT2A 3QIPB 3K5MA 3BQ0A 3MEGA 4F4WA 4CJQA 4FJ9A 3KLIA 2G8IA 3BGRA 4AHSA 3QEIA 3NDKA 4KI4A 4J9NA 2BANA 1YT3A 3KLHB 2JC0A 1WSJA 1JLCB 3K5OA 1NK4A 4ELUA 1ASWA 3IRXB 2IM2A 1YTUA 1QSYA 4G1QB 3QO9B 1FKPA 5L9XA 4YQWA 1FKOB 3IAYA 5KT3A 2OPSA 4IRDA 2G8WA 3PO5A 4OKJA 3HKWA 5KT7A 3VQ4A 1C0TB 1S1TA 5KFIA 3C94A 2HNZB 5SZTA 4CGFA 2IM0A 4K50A 4CF2A 3SQ4A 3PY8A 3QGGA 4ID1A 2ZE2A 2Z1IA 5CYMA 3AVHA 4NLPA 1LW0B 1FXXA 2JLEA 3KD5E 1IKVB 3AA3A 3V6KA 3JSMB 3OYAA 4Z4EA 2LSNA 2HW3A 1JLAB 1RT5B 4IH5A 1D9FA 1SUQB 4CEOA 2R2SA 1S9GB 2XRIA 5DQGA 2AQ4A 1QTMA 5CZ1A 4CGJA 2XGPA 1I39A 4KHQA 1GX6A 4ECTA 4XO0A 2IGIA 1S97A 2AGOA 5KFTA 4O3PA 4K8ZA 5J2PB 2JEIA 2W9CA 4W5OA 5K14B 3VQ7A 2Q3SA 5CYQA 4DL7A 2ASLA 3KMQA 4G3IA 3HPGA 1S6PA 1RA6A 4UQGA 1HQUB 1QE1A 3KLGB 1WAJA 3PJWA 5J2MB 4MKAA 2VG5B 3I5BA 2BDPA 1S1XA 3KHHA 4ED0A 3T5KA 4IH7A 4ELTA 4Z4CA 4EP4A 1S1UA 5DG8A 4DFPA 2DY4A 3SZ2A 4ID5B 3K57A 4NLXA 4HCCA 4K4VA 2B4JA 1T3NA 1LWEA 2ILYA 3HSTB 3WNGA 4DMNA 1DTTA 5HLFA 2FJVA 1RTHB 3PJXA 2DFFA 1XWLA 1JLBA 2HHXA 2HB5A 4LH5A 1RA7A 5F8GA 2QXFA 4CEQA 4KKOA 1DLOA 2DPIA 3IS9B 3CJ0A 1X9MA 3V1OA 5KFPA 3CDUA 1S1XB 1KHWA 2P51A 5DGAA 4KPYA 3I0SA 4FJ5A 1GOBA 3NFAA 1FKOA 4DSFA 2WCXA 3PR5B 2FLLA 2F8TA 3DMJA 1RT6B 4MK7A 4Y2CA 4CFDA 3OJSA 1BL3A 3MFIA 5D3GA 3VQAA 5KFUA 4CEBA 2JEJA 1TK8A 1JX4A 3TAPA 3OS0A 1RBSA 4ECYA 4KRFA 3WNHA 1Z26A 1J9AA 1RTDA 4URGA 3QINA 1I6JA 4GC6A 4N47A 4FZYA 4HKQA 4M3TA 4PWDB 4CHQA 1S9GA 3G86A 5KG4A 4ED8A 3DLGA 2FVSA 4MIAA 2FC0A 3Q8SB 1BQMA 2XWYA 1TK5A 4ZMMA 2GUIA 1J5OB 3NGYA 3V1QA 3TR8A 5KG7A 3DM2B 3K2PA 4JS4A 4ZPCA 4H4OA 3OYBA 1L3UA 4CEDA 3H2LA 4IR1A 4HUFA 3AVLA 3ZSOA 3NBPB 4O44B 2GC8A 2C2EA 3QO9A 4WE1A 2IMWP 4F50A 4OL8A 1MU2B 4OKEA 1N5YA 2XY6A 4NYZA 3DLKB 3LP0B 2OPQA 3DLGB 3VQQA 4PY5A 3EY1A 3F73A 4BE1A 3THVA 3IGNA 1BI4B 3VQBA 4E7LA 1RYSA 4F2RA 3OJUA 1XR6A 1LWFA 4AHVA 4W5NA 1U09A 3SPYA 4AHTA 4J9QA 5C24A 1QHTA 1I3AA 2Y1IA 3KLEB 4EYIB 2B5JB 3MXMA 1TVRA 2R8IA 5F8IA 4ED1A 2KZZA 4QW9A 5C42B 1N48A 3SUPA 3AVFA 1SKSA 1SH0A 2CJQA 3L2RA 3SJJA 1ZBFA 3K58A 3RMDA 4IRKA 3I5CA 1QSSA 1ZTTA 1SH2A 2BRKA 1WN7A 1RT6A 4FLYA 4Y1CA 1GOAA 3D5MA 3F9KA 4CK1A 1ZBHA 1RTIA 1S0OA 1HNVA 4RW8B 2W9CB 5CYQB 4K4WA 5F8NA 1NHUA 3KLGA 3MTKA 4W5TA 4RG8A 4TLRA 5KG2A 3RMCA 1L5UA 3WNFA 5C42A 2WHOA 4O4RA 4WXOA 3H5UA 2YKMB 4FJNA 2YNGB 4J9RA 4K4ZA 2OPSB 3UDLA 3H5YA 3VQ5A 1ZBUA 2F8SA 3AVNA 2YNFA 1S1TB 3PW0A 5DLFA 2J6TA 2QKBA 3VA3A 4R0EA 4YR2A 1TAQA 1RTIB 2HHWA 3GIMA 1TKTA 3AVCA 1JLBB 2IA6A 4E7JA 4K4XA 1Q9YA 3K5LA 4LSLA 4DQPA 1NK6A 4XPCA 3OSPA 2YNHB 3I5AA 4IKAA 3QIDA 4O44A 4Q44A 4KSEB 2ALZA 2XI2A 4ZP6A 4K4UA 1NK7A 3AO1A 2NUBA 4DTJA 1OS5A 3V6HA 3TVKA 1HARA 2QV6A 3AO3A 2VG7A 4QWDA 1BI4A 3CDWA 2V0NA 3AVBA 2GIQA 4M3YA 4ICLB 4IG3A 2IBKA 2RPIA 4FZZA 1NJZA 3E01A 2DFHA 1C2PA 4IDKA 1SH3A 4K4YA 1RBUA 4CJPA 5I42B 1NHVA 2ZD1B 5DQIA 4FVMA 2B43A 1XR5A 1TL1A 1VRUA 3KKRA 3FQKA 2WK4A 4DQRA 1IKWA 4BWMA 1RNHA 1JLGB 3TWHA 4O3RA 5HROA 1RCHA 4B9SA 1D8YA 3P5JA 4DSKA 3KD1E 3KKSA 2BGGA 1LWEB 2W9BB 3L2VA 4M41A 4RW6A 3M8SA 4F4ZA 5E41A 4ECUA 1GOCA 4DQQA 3BREA 5F8LA 1SL0A 1NK9A 4CGIA 3BSCA 3QZ8A 4Z0UA 3G6VA 3V9SA 3KJVB 1IKWB 3L2WA 4JV2A 1O1WA 3LP3A 2UVVA 1RT3B 1S9EA 3LAMA 2FBYA 1RDDA 1S1VA 1XHXA 3OYNA 1QSLA 4J9SA 2D0BA 3HK2A 4M95A 3QNOA 3O4NA 1KVCA 4IRCA 4DTPA 3GQCA 4KHMA 4ELVA 1KLNA 5D3GB 1HNIB 2KFNA 3CFOA 3VQPA 4O3SA 3NF7A 4G1QA 3OYIA 4B9UA 2WOMA 3KK1B 3KLFB 2BQUA 3OL8A 3KK3B 3MAQA 1RT4A 1QAJA 1S1VB 1IKXB 3QEPA 3DRSA 4DF8A 4GMJB 3BQ1A 5DMRA 5HRSA 2JGUA 4FLTA 4QAGA 4ZTFA 5KG6A 2KTQA 4RNOA 3OVNA 4J9MA 3ZSYA 3LAKA 3QZ7A 5C5JA 1C1AA 4EZ9A 3CWJA 4BDZA 1JLQB 4HCBA 4RUAA 5KFKA 4CGGA 3HVTB 1IKVA 4ZVEA 1JLFB 3KK1A 1JXBA 4QWCA 4CHOA 5KG5A 1RT5A 1C1BB 1WAFA 3MR5A 1SUQA 3BSOA 1N5YB 1TP7A 1ZBIA 2YNFB 1NJXA 5KFFA 4HTUA 5HP1A 4HUGA 3DOKA 2HAIA 4OVLA 1UA0A 1NJYA 3ZSVA 3H40A 4NCBA 4RW6B 4URSA 2P1JA 2UVRA 1J53A 4YR0A 3CFPA 2CKWA 4FCYA 3UIQA 1JLQA 1TKXB 3GV8B 4ED6A 1N6QA 3D28A 2YNHA 4B9NA 3KLEA 1VRTB 3HVTA 4FLZA 4B3OB 4EBCA 1RDBA 2D41A 1EKEA 3OL7A 4CIFA 5KGXA 2IM3A 3ZSRA 4WFYA 3DDKA 5HP1B 3G10A 4WFXA 4NLSA 1T05B 5FRMA 3VQDA 3NE6A 3IG1B 4J2EA 2VWJA 3DLBA 4EO6A 1U49A 2HMIA 2EC0A 5L1JA 4DFKA 3HVWA 5CZ2A 4CF0A 5L1IA 4E1NA 3ZSXA 1IH7A 2I1RA 3NKYA 4DFJA 2RKIA 3KK3A 4I9LA 4FK0A 3KTQA 2E6LA 3ZSWA 3T1AA 3MEGB 1A5WA 3DMJB 3BQ2A 3S9HA 2R2UA 3NCIA 3QETA 5T7BA 3U3YA 1NOZA 3NF6A 4AHRA 2OYQA 3RB3A 4F3TA 4N56A 4B9LA 3OYKA 2XCAA 3PX6A 1NOYA 2UVUA 2Y1JA 4CJSA 3TAEA 3HPOA 1GX5A 3H4DA 3OYEA 1TKDA 5KFMA 1C1BA 1ITGA 4M3RA 3FQLA 1RTJA 2V4RA 4Q0BB 4NLQA 3GV5B 4Y34A 4ZPBA 3JYTA 3ITHB 1JKHB 4WYWA 4KB1A 4KFBA 4DTUA 3EYZA 3AA4A 3P1GA 3OYGA 1WSFA 3M9MB 2RDJA 3PW5A 4CEEA 1HYVA 3V6DA 4DL4A 2P5GA 2V9WA 4E19A 3MEDB 4MQ3A 3NBPA 3WNEA 4FYDA 5CY4A 3LWMA 3EZ5A 3KK2A 2DFEA 4B3OA 3O3HA 3JSMA 4ED7A 4O3OA 2ETJA 4CJFA 1JIHA 5KFWA 1JLGA 2R8JA 2HNYB 3DLKA 4JV1A 3LP0A 1HYSB 1S9FA 4B9TA 5F8JA 4AILC 4CJWA 2IAJA 3ITHA 4QWBA 4JRPA 3HL8A 2HHSA 3EPGA 2HVIA 4RW9B 5KT5A 5KI6A 3RB4A 2G8FA 1W0HA 3QLHB 4ED3A 2B5JA 4O5BA 4CF8A 2VG5A 4W5QA 1WSHA 4ECVA 4BE2A 3M9NB 2RKIB 4IFVA 5F8HA 3TQ1A 2IAJB 3OSNA 3HVAA 4IG0B 1RILA 2W8LA 4O0IA 1TL3A 4NLRA 4WFZA 3BJYA 1VSFA 5KRTA 3HXMA 4LD0A 1KLMB 3K59A 1QQCA 4WZQA 1CZ9A 1U45A 4IOBA 2D3ZA 3RAXA 5DLGA 4CJKA 4CIEA 1VRTA 3FFIA 4KKOB 4ZVHA 3L3UA 1ZBLA 1W25A 5KFOA 1C0MA 4LSNB 5KG3A 3AA2A 1ZETA 3PR4A 1EETA 3T19A 1Q8IA 3RR7A 4ECRA 3RB0A 4TY9A 4DS4A 4QWEA 1UAXA 4R5PA 4RW4A 4NCGA 4E7KA 4M3WA 3SV4A 2EHGA 4LY7A 1TL3B 4Y3CA 3RR8A 2YHAA 2XCPA 4CCHA 4QW8A 4NYFA 4DTMA 1TKTB 3C6UA 5KFXA 1EP4A 2XO7A 3OYHA 1LW2A 2D7SA 3V6DB 4M94A 3VN5A 2KQ2A 2FLPA 4J2DA 4EEYA 5FRNA 4FLWA 4H54A 3PW4A 3RWUA 5KG0A 3RMAA 4FM1A 3DI6B 3VQ8A 1JLFA 4MFBA 4MIBA 2IS3A 4ZPAA 2V4QA 4OPJA 4C8KA 2RDIA 3M9OB 5KGWA 3CJ4A 3NHGA 4R5PB 3N6MA 1JL1A 4NCGB 3VQ6A 3AVKA 1J5OA 1D9DA 4CJ5A 3KHRA 1T03B 4LH4A 3C6UB 3CJ5A 5J2QA 4HYKA 3P83D 1LWCA 3V6JA 4DQIA 3O3FA 4FBTA 4H4OB 3MECB 4O3QA 4KTWA 4NRUA 2ZD1A 4L8RB 4BDPA 3QEWA 3DI6A 1NJWA 4MFBB 4JUZA 4DU3A 2OH2A 1T94A 1Z4UA 3I8DA 4CECA 5J1EA 1S10A 4ECWA 3LP1B 3A2FA 3ISNC 3RAQA 1D5AA 2HNDB 4BWJA 4DTSA 2YNIA 3H5XA 1NK8A 1K1SA 3ZT3A 2W8KA 4X2BA 3QEVA 3UR0A 5FROA 3M8PB 2WRMA 1LWFB 4DSIA 1U48A 4CJUA 1ZYQA 1HMVB 5K14A 2FLNA 1T7PA 1C0UA 2OPRA 5J2NB 4TYAA 2YKNA 2YV0X 3ALYA 2ASJA 3V81B 4E0DA 3MR3A 5HRRA 4ECZA 2FVQA 2AX1A 4FJKA 1LAVA 1HRHA 1HQEB 4J9OA 1BCMA 1CXUA 4F2SA 4E7IA 1RT3A 1VSDA 1TK0A 2IJFA 4JS5A 1NK5A 4ID5A 4I2PA 4ECQA 3NGDA 4F4XA 4FS1A 3AA5X 1WSIA 2R8HA 2IDOA 1JLEA 1BIZA 3L2UA 5JS2A 4KTQA 1HPZB 3SI6A 3V81A 3QESA 3O4QA 5KFRA 3S3OA 4KE5A 4FS2A 3IS9A 1UWBB 3PW2A 1SL1A 4PQUA 4CJRA 1HQEA 3L2QA 1N56A 3RTVA 3I0SB 2HHQA 1LAWA 4FLVA 2B6AA 4B9MA 4NLGA 5L1KA 1RTHA 4NLYA 4Q0BA 4N76A 2R2RA 5KG1A 4EO8A 3CIZA 4J9PA 3KLIB 4NCAA 3TAFA 1EXQA 1L3SA 2WONB 5KFAA 4CEAA 2GIRA 2BRLA 1LWCB 1KFSA 4M3ZA 3CJ3A 4QOZB 3QYYA 3KLVA 5DQHA 1ZTWA 3HPHA 3HM9A 1R0AB 3OYDA 4R8UB 2BANB 3H08A 3HP6A 3AVAA 4FM0A 3NH1A 1C0TA 3AV9A 3KNAA 2UUWA 5EWGA 2JEGA 3LZJA 5I3UA 5F8MA 2D0AA 1NK0A 2OZSA 2VG7B 3M8QB 2IJNA 3V4IA 5DK5A 2F8EX 4EBDA 2GBZA 3DLRA 4DLGA 3M8PA 1L3VA 5HBMB 2Z1HA 2VWKA 1HMVA 2WB4A 1CXQA 4RNFA 4E1MA 5CYMB 4IR9A 3U3GA 4J9LA 3CO9A 3NGIA 3PW7A 3K5NA 2HHTA 5KFLA 1BQMB 1DTQB 3ZT0A 1XI1A 4FJMA 2KZMA 1XC9A 3QNNA 3KHLA 5KFZA 5KT6A 3CM5A 1XHZA 3RMBA 4B8CA 4MH8A 3MF5A 2IC3B 3LZIA 3UPFA 3M8QA 3BDPA 3OS1A 3SUNA 5HRNA 4CJTA 5HBMA 5JUMA 4C8LA 3MR2A 4RW7B 4FJGA 1S6PB 1QE1B 4FJHA 1KVBA 4OGEA 1D1UA 5J2MA 3KJVA 3B6PA 1DTQA 3LP2B 1KTQA 3AVIA 2HHUA 4OGCA 3H5SA 3OLAA 4DF4A 2W42A 1EETB 3FSIA 4Q8FA 1SKWA 3IN5A 1VSHA 1C1CB 4YNQA 4BDYA 5J2PA 1S5JA 5EU7A 2ATLA 2X74A 1HQUA 3AVJA 4DL6A 4F3OA 4CE9A 3SQ0A 4M45A 4TSXA 4CF9A 1NKCA 4E7HA 4CFAA 1ASUA 2AX0A 4BE0A 1B9FA 4KHUA 2YKNB 4OPKA 1TV6A 1SV5B 3MEEB 3V9UA 2OZMA 3G6XA 3T5JA 2ZQBA 2DPJA 4KHWA 1K6YA 3KLFA 3NH0A 4ZP8A 4ZHRA 4R8UA 3C95A 1C1CA 1RT7A 1KFDA 4NLWA 4I2PB 4KHSA 2AU0A 4CJLA 1QS4A 3CG7A 3JYTB 1YVUA 2YHBA 4KV8A 4KFBB 4DL3A 1RBVA 2O4GA 3FDSA 4NYNA 4J2AA 4DG1A 5KFYA 3ASMA 1TAUA 3NAIA 3GIIA 4FK4A 4AHCA 1A5XA 4J2BA 1U04A 4EBEA 4CIGA 4PQUB 4GVMA 4YP3A 2B6AB 2OPPA 3QERA 2KFZA 1WNSA 3D45A 4RZRA 1RDAA 2QK9A 1VSIA 3DOKB 1IG9A 3QIOA 1MMLA 4OKKA 4AHUA 1BQNA 4OLBA 3HJFA 2X6NA 4DG1B 4TQRA 4FM2A 3PX0A 4IBNA 1C0UB 4M42A 5I42A 1N4LA 3EPIA 4DSEA 5KFDA
chains in the Genus database with same CATH superfamily
1JCEA 4AL6A 2QW9A 2VODA 3HI0A 2FHJD 3DU5A 5ETRA 4MJKA 2OTJS 1EWQA 1VQNN 3O08A 1X1PA 4L3KA 4Z2XA 3ZZUA 4X64J 5BR8F 2U1AA 3MXJA 4E3SA 3IAS9 2R8KA 4M3XA 2QJ3A 2YHXA 4F26A 4DFMA 4WFBL 4KJIA 2CH5A 1NMNA 4DX5A 1RBOB 4IQXA 1ZA2B 5E3QA 4PEOA 4DS5A 1RDWX 1HPZA 3CD5A 3L8BA 1TVRB 2VQEJ 4DWIA 1HJRA 1YI2S 3LPEA 3VEWA 3PXGa 5ETNA 2FUG9 4GKJK 2J0SD 1NPKA 2G1DA 5E84A 3HT0A 5AQMA 3ZT1A 4OFZA 5C24B 1QVGM 1YAGA 1VQ8N 3D2FB 4DV6K 4OMFG 2WONA 2ZVSA 3IAM9 2W4DA 4RW8A 5JVHL 2JWLA 2ZDPA 2MGZB 4CBXA 2HWHA 5ADZA 1W2BR 2YWKA 3MTJA 5DG7A 1H2VZ 3M2UA 2J9CA 4RU2A 1Z25A 2R8GA 4Y2AA 4E89A 4LVOP 1HNZF 2XMAA 5F41A 4P72A 1DTTB 4DR7K 3E1YA 3ENOA 2XWXA 3FCVA 3DRPA 3DKDA 2MHEA 3F56A 4CYUA 1EHWA 2FYXA 1X5PA 2A1BA 3SQGB 1FXRA 1VI7A 2CJBA 2HQCA 2NRZA 1DURA 4RNMA 4CM0A 2DXDA 5IT9O 2KYZA 3T5LA 1M90T 4FJ8A 3J81j 2WBRA 1P27B 4AM7A 1KN6A 3CQ8A 3SBTA 3D3BJ 3ILJA 2H48B 3KG4A 4M5NA 1C4AA 1ZZFA 2V2QA 3BZCA 3NMUA 1RT1B 4ZVRB 4DR1F 2UU9J 4XIUA 2NXJA 2HWIA 1M5OC 4FWPA 2V4JA 3R7BB 3OYJA 4KREA 1ATRA 3E01B 4LQ9A 3KWGA 4UY85 1JJ4A 1QAIA 1BOTO 2Q31A 2UUTA 2AJ2A 2VV5A 1RJJA 3MCAB 3ICLA 1VSJA 1K8AT 5C7PA 3IKMA 3R7SB 2E9TA 4IG3B 4ICLA 3WIVA 2OGUA 2KG1A 4YDXA 3AO4A 2BQRA 3VTIA 5KFBA 4XH5A 2ZH2A 2R7YA 3PHEA 4DUYJ 5K9FA 3QWUA 3Q8PB 3ENWA 4B08A 1K9MT 1VYAA 1ESVA 2R42A 5MLCV 2AYEA 3LPYA 3IM9A 4YMEA 3SYZA 4BRLA 3HI9A 2FHJA 5KFGA 2LFVA 4I9QA 5KFSA 1U1PA 1RWNB 3M30B 3LF0A 4HEA9 2V2ZA 4CYUB 3T5HA 3O6WA 2CNNB 1GXUA 1VQNS 3U4LA 3M2RA 1N33J 2N3LA 3RRHA 3GTYX 4NXMK 4KAZA 4MK8A 1RFQA 3A8YA 4B3MK 1WC4A 3R9LA 2VBWA 4DSLA 3MD3A 4C3LA 2C2MB 1OVQA 1NDPA 3FC9A 4CLWA 1R0AA 4PG6A 2O8DB 3ADAC 4KH0B 5E33A 3SCXA 3HZGA 4IFEA 3QQCD 3DXKB 1R27B 1HBMA 3GV7B 1RT1A 3G25A 1FTRA 1YJRA 2IFXA 3V9XA 3RBEA 1S22A 2Z2YB 3S3MA 3NGZA 1T95A 5SWMA 3CEDA 2D3O1 3EUNA 4EP5A 1OYDA 3L3VA 1MSWD 3N79A 5GADI 3V9WA 4AF1A 2DY1A 2MKIA 3DRSB 2ZZNA 2XY7A 3M2VB 1X7VA 3VQEA 4MK9A 1OQ6A 1RZMA 1CJKB 3K7RA 1DQ8A 1XR7A 4M63C 4KTZA 3O9UA 4U6PA 3IRXA 3M7VA 1V3RA 2YNIB 3MEDA 4DV0J 2FHOB 3KOAA 2LXUA 1LXJA 2E4LA 2FBXA 4B02A 3SQ1A 1WDDA 1WORA 1TGOA 1TKXA 2OUGA 4ZTJA 1CQMA 5L8RC 3O3GA 1R8PA 5K8MA 2DGTA 4QWAA 4UT4A 4PRFA 1VJQA 1X4EA 3V2UC 3E8OA 1NGHA 4OJRA 5EX5A 4K42A 3AO2A 3J81O 1PIEA 3MAAB 5D6GA 3ULDA 3FMBA 3N4QA 3CC7S 4EHTA 2I5JA 1S72N 2AGPA 3C19A 4JI8J 2YXLA 3SQOP 3J7AN 2UUAJ 2GQQA 2B0GA 2OAUA 2KT3A 3TABA 1KRPA 2HMIB 1DEJA 1X3NA 3U6FA 2OPQB 5T14A 1TV6B 4FYWB 1U4BA 3D0PA 3H8YA 1P1TA 4FXWA 1Q86T 4DV1K 1WSVA 4I2QB 3BGRB 3PYGA 4WF9Q 2G8HA 4ZLJA 1HNWJ 2AGQA 3P5BP 2BTFA 2QE5A 2IVNA 4X4QA 5FLXO 3NH2A 1MW7A 1V3ZA 3PRVA 5GADP 5C0YA 1Y3KA 2NSCA 3C15A 3NRBA 1MWZA 2RQKA 4LF1A 5E0OA 3OS2A 4I7FA 5AQYA 4TXSA 3UD3P 1CVJA 4O4GB 3V1RA 4CFCA 1LW2B 4BRFA 2M52A 1S1WA 2CQ4A 3NF8A 1N32K 1IKYA 3CMAS 3Q8RB 3AVGA 3TSPA 2ZF5O 2HS4A 1RBRA 4TN2A 1NNDA 3DJCA 2X7IA 5F9LA 3PX4A 2G8VA 2HRTA 3JAMY 3TA2A 3ZX0A 2ZE2B 4PXEA 1U47A 1OVYA 3A4TA 1IO2A 4X84A 2V5HG 1LW0A 3LDLA 1P8ZA 1SIZA 3KHGA 4JI0J 3CM6A 4LFAK 2L9DA 3QFHA 3L3CA 1KWMA 2PA3A 5EGYA 3GSIA 4FZXC 2LMIA 5B0FA 1VK3A 3LO3A 4WQ5A 3WIUA 3E51A 4C0HA 2OA8A 4DUZF 2X1FA 5J2QB 2CPIA 4J9KA 3V9ZA 3KLHA 3R8YA 5JXSA 2EFQA 2X6SA 2CPJA 3EN9A 3KMSA 3KXDA 4K43A 3SBGA 2QMUB 3SEOA 1RYRA 2JVOA 3PFOA 3AOCA 3KNGA 5GAHU 1M5PC 3OLBA 1YWXA 4FJJA 1VJWA 2FBTA 3UKUA 2MZJA 1Z05A 4NLUA 1Q9XA 1D0EA 3J80Y 3TAMB 2KW4A 3BH6B 3H3NO 3IGVA 3Q7BA 3H20A 3M8YA 2E5LK 1UOCA 3DM2A 1YZ6A 3EE9A 5F3ZA 3VF4A 3HP9A 1VDHA 2FBVA 1F3FA 4ILLA 2RE1A 3SUOA 1CZBA 1IM4A 2H5JB 3FZLA 3GFYA 3D4JA 3EZUA 3EGNA 3QDKA 3ISND 1Q81O 4DQSA 4O4GA 4ZLLA 4IFYA 3C2PA 3KYLA 5B0DA 3PVXA 4CK3A 3M05A 4DL2A 3DLEA 4HACA 3ZZTA 2ZKTA 3H98A 3T3FA 1QQMA 3W64A 4N5SA 1VHIA 5FD1A 3WEEB 1JWWA 5K8OA 3RRGA 1G15A 2W41A 2XY5A 1KOHA 3SQGA 2D1CA 1MMNA 3ZXWA 2I6WA 1VS3A 3POTB 1FWKA 4FWSA 1GFWB 5ETVA 4USUA 3BQ0A 5FIIA 4JK9A 4CJQA 4OQJA 3J80O 4FJ9A 3ATUA 3KLIA 3L4IA 3BGRA 4AHSA 2ZUAA 3SCLE 3MPDA 2ZJRQ 3KLHB 1JLCB 1ASWA 3GFXA 2V4JB 1YRXA 3QO9B 2P9KB 3OXLA 5GMKa 4YQWA 4LRFA 3PO5A 3ZZZA 3HKWA 4LFCF 5KFIA 2HNZB 4MKVA 4L74A 2MQLA 1NGCA 1VQKS 3PY8A 4UF4A 1H7XA 4UUWA 2DH9A 5ETTA 3AXMA 3SXLA 2ZE2A 1FDBA 4LF7K 3D0IE 4AXIA 3NGKA 3KD5E 4X4NA 1WOPA 4DV2K 2D0PA 4Z4EA 1JLAB 1MLAA 1D9FA 1SUQB 2JHEA 5HL7L 1S9GB 3C7NB 5DQGA 2EKYA 4C1NI 3ENBA 5HL7Q 2KJWA 2ZC4A 5KFTA 5CHIA 1FX4A 2XEXA 2W9CA 5K14B 3VQ7A 1WHXA 4LF4F 4UQGA 2XBPA 1TUYA 3UKRA 1ZM3A 2ZWHA 3KLGB 4DR4F 5J2MB 1BQXA 3KHHA 4FPAA 2QRRA 8ATCB 1E6YB 4Z4CA 1N88A 1S1UA 2BE7D 5DG8A 1NGFA 4J5OA 4JI7J 2P9PA 2GMLA 3R6LB 4NLXA 3S41A 2B4JA 1Z2LA 1LWEA 1T3NA 1NH7A 2HK2A 2PFDA 4BRNA 2VZ9A 1B4SA 5KPTA 4DMNA 2VBYA 1UTAA 2DY9A 3PJXA 2DFFA 1TMMA 5AQHA 1JLBA 3HSGA 1URNA 4LH5A 3HM8A 4CEQA 1DLOA 2C3OA 4DR2K 3CJ0A 2Q43A 4WFBQ 5KFPA 1KHWA 2P51A 4PQAA 2DISA 3AT1B 2KRRA 3RAMA 3W1YC 2GVDB 3ETMA 4DPYA 2HSEB 3CJ8A 3UN3A 3DMJA 4HACB 4NO7A 4Y2CA 3S6EA 3HSDA 3OJSA 4IOCL 2WVBA 4LT6A 4CLYA 2UXCF 4LF6J 3VQAA 4PXCA 9ATCB 2XMJA 1TK8A 3OS0A 4KRFA 4B3SJ 3WNHA 2GV1A 1J9AA 1W7AA 4URGA 3EDRB 3KJNB 1IJEB 4J9VA 5AE2A 4N47A 4FZYA 2PIIA 5ETSA 4CBWA 4C97A 4CHQA 1S9GA 3A0IX 5KG4A 4ED8A 4MIAA 3Q8SB 3W9JA 2XWYA 1TK5A 1I94F 1S5ZA 4EAHD 3ENAA 1TL4A 1GLBG 4JS4A 4ZPCA 5F0WA 3NCRA 5B0CA 1LNQA 5A8KA 3H2LA 2ZGYA 3AVLA 3ZSOA 5JMNA 3JSBA 2HHHF 1Y9OA 2C2EA 3QO9A 2BEFA 4JKEA 2IMWP 2AEFA 2MQOA 1MU2B 1RCXB 3FEYB 3VCDA 1NSQA 4X62F 4Y0WA 2KJVA 4J91A 4TLQA 4DR4K 4BE1A 4S0MA 1U1OA 1G4CA 3MMCA 1RYSA 3WDOA 1XR6A 2LA4A 4AHVA 1KC8T 3A5LC 1HNXJ 5C24A 2DNRA 3KLEB 2OFHX 3C15B 2PI4A 3ZZPA 4QS8A 4LIRA 2AHOB 1N48A 1EARA 4BG9A 3M5RA 2R3VA 1B0TA 1G6BA 2ITMA 2E1CA 1ZBFA 4B3SK 1Q5VA 3LQVA 2BRKA 1FRJA 3SAGA 1HW8A 1GOAA 4YB7A 5AQGA 3D5MA 2PI5A 4USJC 1ZBHA 3HFKA 2K1RB 3W5YA 1SBRA 2WBMA 5CYQB 1RACB 1WD6A 2F8MA 1NHUA 1HX1A 2UUCJ 4W5TA 5KG2A 2LU2A 2HGMA 1WF0A 3LL3A 3H5UA 2C3YA 4FJNA 4K4ZA 3SJHA 4PHTX 3UDLA 2DGVA 3PIPQ 1ZBUA 1F2HA 1S1TB 1QHAA 4YR2A 2NRRA 2UUCK 3AOAA 1HNWK 2DEJA 3MDFA 2CPXA 1JLBB 2IA6A 4K4XA 2QL5B 3B6BA 1U24A 4XPCA 4L72B 2H5EA 2CPZA 4P2MA 2M4MA 2VH7A 4RO0A 3AO1A 2D0OA 3B78A 4OYIA 1BG3A 5HANA 3D54A 3V6HA 1APSA 3TVKA 3CUNA 1AA1B 3UVJB 4WKYA 2M8HA 2QLXA 3WQPA 5AQXA 4RCHA 4K8RA 4EU0A 2V0NA 3S1TA 4ICLB 4IG3A 2VASA 2IBKA 2HSTA 4WQ5C 1NJZA 1IN0A 4K4YA 3THWB 2CJYB 4I67A 4QU6A 4A5BA 5A2QY 2MDAA 1XNQF 4OZ5A 4ZJLA 3H1QA 5HJXA 5DETA 3J7YU 5E3AA 5HMYA 1DARA 3BKUA 5D0HA 3DDIA 4E1JA 4JI5F 1R8BA 3WHIA 2LP4A 2FXUA 4DSKA 2Z2LA 5AQQA 2ZOMA 1VQ5N 3CJCA 5DDOC 4OIXA 1UMJA 4MDAA 4ZA1A 3BREA 3A8IA 2Q66A 1BA0A 1VQON 3ET6B 3P96A 4YHHJ 1IKWB 3L2WA 2DPNA 2H54B 4W4MA 2O8EB 5IXUA 2EFPA 3MUVP 1RDDA 3MCOA 1RAEB 3R3TA 2VKRA 3O4NA 3GLJA 3CJSA 2AJFE 4IRCA 5AFUH 4ELVA 1KLNA 3D2WA 5D3GB 2J8SA 3VZHA 1FDAA 2KFNA 1CQNA 3OFGA 1HQ2A 2D74B 2O8FB 4C1NK 2NYIA 3OYIA 1HNWF 1FT8A 1KOOA 1O8BA 2H5IB 3MAQA 1VBKA 1S1VB 2P9LB 4ISEA 3DRSA 5GINA 4DV3J 4GMJB 5IQQA 5DMRA 4QAGA 1XJWB 5KG6A 2F40A 3E3XA 4AL5A 3LAKA 3CWJA 2YX7A 1K8KA 2PMWA 4GV9A 1Y7PA 4RUAA 1VQ9N 4ISGA 4OJGA 1VOMA 3KK1A 1JXBA 4CHOA 4OHXA 4CH0S 1C1BB 1WAFA 1N5YB 2BW2A 2YNFB 1NJXA 4FDFA 2OFGX 3MEKA 1XNQK 2HFOA 4UTGA 2HAIA 3MM5B 1UA0A 2ADCA 4OVLA 4IZ9A 1SZ2A 4GRSA 3CFPA 4FCYA 1FJ7A 2HRUA 4QR1A 4M5KA 3D28A 1SJ3P 1R6YA 3FZBA 1HNXK 3JQMA 2D41A 4A47A 1PBUA 1UEVA 2AYMA 5IS2A 3HHNB 3ZSRA 3CF5L 4WPAA 2QM1A 4NLSA 2P9PB 3P39A 3DOMA 3CJ9A 1SC4B 1YITN 3IRWP 3DXMB 3IG1B 4C3MA 2V7YA 4JI1J 3T1HF 4FWQA 2C2NA 5LMUK 3VQTA 2HMIA 4F3QA 5HAOA 3ZO7A 1V4TA 3CCVN 5L1JA 4DFKA 4CF0A 1FNXH 3ZNUA 4E1NA 1VQLN 4DFJA 3U27A 3VAJA 3MEGB 3T1YF 2MQNA 3BQ2A 4ANDA 3QETA 3R5GA 1F5CA 1T6CA 1KQSM 3VF0B 3AQOA 3U3YA 2XS7A 3WBZA 1NOZA 2VFSA 4F3TA 4HTLA 2MGZA 5L38A 4B9LA 1GK8A 3CC7N 2LQ8A 2XCAA 2F5GA 2L41A 2UVUA 3C65A 2YQ1A 3M2UB 3TAEA 4UZCA 3HPOA 5HQLA 3OYEA 4ZVOB 1C1BA 5IFMA 3FQLA 2V4RA 3UDEA 1YLXA 5ETKA 1HLUA 4XEIA 4Y34A 1VQSA 4WYBA 3FMWA 4EMDA 1NGDA 2R7OA 1C4CA 3W2VB 3A3PB 2A18A 4DTUA 2OANA 2Z8QA 4WCEL 4USWA 3AA4A 4H4KC 3OYGA 2BYCA 3U02A 2ASOA 5D0EA 2V9WA 4E19A 2O8FA 1FF2A 4UQTA 4MQ3A 2VPZB 3EZWA 4B3OA 4ILRA 1F5AA 2N4DA 3FEXB 4CJFA 4DUZJ 2E2OA 3T69A 1EO1A 3RBXA 1HHSA 1SI9A 4AILC 4CJWA 2BJEA 4JRPA 3IP0A 5GAEI 4G1IA 1FRHA 2HHSA 4OHYA 2ZJRL 3TYTA 3UB5A 1GH8A 3RB4A 3L7OA 1O51A 2JSXA 5B09A 5AZJB 3HJVA 3T1HK 2VG5A 5THWA 4W5QA 1U2VB 4ECVA 3DGPB 2MZSA 2FC8A 1TELA 1NSAA 2KM8B 5HMZA 4IG0B 1TL3A 4CNYA 2A41A 5AQFA 3SCKE 5KRTA 3HXMA 3D2EA 4LD0A 3H42A 3K59A 1SAZA 3T1YK 1QQCA 4WZQA 3HOSA 3D6FB 2V94A 4CIEA 2VJVA 4QYZJ 4I6AA 5HSPA 4C11A 4TNOA 3AY0A 1W25A 5KFOA 3CPWM 4LSNB 2RU9A 1NGIA 2KXHA 4ECRA 3D0GE 1G2EA 1T0TV 2AV5A 4AL7A 1K47A 2CQIA 4E7KA 1URRA 3P4IA 3EE8A 4CCHA 3OPKA 1RISA 4QW8A 3ULHA 5LXRA 2Z4PA 4M5MA 3OYHA 2D7SA 3V6DB 2GVZA 1YGYA 4LRCA 3FBFA 2QFIA 2RRAA 4FYXB 4WTOB 3ONQA 3CCMS 3PW4A 5KG0A 3RMAA 1KBRA 1HBOB 4OX9F 1JLFA 4NI2B 4C8KA 4OPJA 4RBUA 3M4XA 3N6MA 2GA7A 4NCGB 1JL1A 3W8PA 2M2BA 1NAQA 5T7LB 3U9ZA 1QQNA 1D9DA 2CQ3A 4ES1A 2P8IA 3C6UB 1WOQA 3NVKA 2W24A 4ZLNA 3V6JA 4DQIA 4JP8A 5D4LA 4H4OB 4ZCIA 4JI3J 1VIOA 3SMPA 3DI6A 1MROA 5ETQA 3CSKA 3OVBA 2IRYA 1FJEB 1J2VA 3W66A 4CECA 1U1LA 2E5LF 3ISNC 2XG8A 1R7IA 1UP1A 4BWJA 4FYVB 1NK8A 3AARA 1JNRB 2A5XA 3ZT3A 2W8KA 3ZTRA 3MPWA 3KVGA 4A5AA 4PXBA 1QVFR 1HMVB 1UAWA 2QYCA 2FLNA 1T7PA 2AKWB 4C7QA 2OPRA 5J2NB 3ALYA 1V4SA 4IJAA 2ZM6J 2CGJA 4ED5A 3PJ9A 1O5JA 4FJKA 2MQMA 1LXNA 2Y9HA 5BYSA 1CXUA 4E7IA 1OH7A 3J81U 2KFYA 2IJFA 3PSIA 1AUSL 2FZGB 3NGDA 4FS1A 4YOXA 2R8HA 1AZSA 2OEMA 1U02A 5HQMA 4FWKA 1YJ9N 2VQFJ 1V3SA 4U7UD 5JS2A 1W97L 1M1GA 1OPZA 2OSQA 2QSFA 2Y3YA 5D78A 1UVNA 2LDYA 3Q8UA 3NWRA 4A2AA 1HQEA 1FNOA 3FR0A 2CPHA 4NX9A 2HHQA 2MKCA 3GE1A 1RTHA 4NLYA 3CMAN 3MN6A 4BRDA 2LEAA 5E2QA 2IIHA 4EO8A 3GJRB 1SJQA 3TAFA 1EXQA 3PEHA 5U47A 4CEAA 2M0GB 4M63A 1KQSR 3A3OB 2HVZA 1KFSA 1SS6A 4Z37A 3CJ3A 4QOZB 1RP5A 1MWQA 1M5VC 5DQHA 5H9FJ 2MKYA 3TOQA 3HM9A 1U6FA 2RAQA 4YDDB 2GHWA 3FCWA 3AVAA 3CIMA 5CQGA 5LMNJ 3R7NB 2UUWA 5C15A 5EWGA 2D0AA 2E2PA 4NXNJ 1M0SA 3GP9A 3M8QB 1DQ9A 5AXMA 3V4IA 1WJ9A 4ZDNA 3KJFB 2F8EX 2WBNA 1KDNA 3O8MA 4N7TA 4BC4A 1RWUA 3VENA 3FBBA 1HMVA 3FSYA 3BN7A 3MMJA 4E1MA 5CYMB 3ZETA 4IR9A 1U1NA 4F67A 3P5TL 2XS2A 3MX5A 2VONA 1GNKA 2W6LA 2FY8A 1HLWA 2G2ZA 3BZKA 1Q16B 2XYPB 5KQDA 3WT0A 4LFBJ 4JOUA 3OA9A 4B8CA 4MH8A 3K8WA 2Q1NA 2IC3B 2RILA 3LZIA 4DV3K 1LCUA 1UEKA 5JLFA 3DNCA 1ATSA 4RJVA 4JI6F 3GCWP 5JUMA 1IQZA 4RW7B 4OI0A 1S6PB 3HHEA 5FPNA 4GKKK 1VBYA 1KVBA 3KJVA 2OD4A 4WK3A 1E6VA 2DNHA 1F9EB 2W42A 3FSIA 5K20B 4ED4A 4N77A 4FVUA 3D9BA 1PBAA 3JTPA 4PYDA 2ZHBA 2YKPA 4ATNA 2ATLA 1HQUA 5G4DA 2DHGA 2XQCA 2DXEA 4CF9A 3D1HA 1ASUA 2ZH1A 4K2JA 4BRCA 4I6WA 3AD8C 1NMDA 3W60A 2QXLA 3H25A 4OPKA 3TR5A 4HLBA 2F1FA 5K8PA 3MN9A 2OZMA 3T5JA 1FJGK 3MXHP 4ZHRA 1C1CA 1RT7A 1M1HA 4ZCMA 4ZPVR 4HTIA 1K9MO 1AZSB 3W2VA 4ES3A 4DL3A 2K7JA 2GJIA 5D4PA 2O4GA 1H3DA 3FDSA 2BXJA 3J80U 3MM6B 4ZVUB 4E8UA 2QWMA 2VUGA 3GIIA 2DGOA 3CCVS 4JHDA 4KH4A 4FK4A 5BYQA 5C2FA 5FJ4A 4A57A 4CIGA 1N34J 2ADBA 4PZVA 2AYGA 1WNSA 2E5IA 1GMUA 3ZX2A 1KP6A 3ZTQA 3DOKB 4KR0B 1IG9A 1NMEB 2DVIA 3NGRA 2CA9A 1MMLA 5BPMA 2MKHA 4YOVA 4AHUA 3HJFA 4OLBA 2HHHK 2VCPA 4TQRA 3CJQA 3GSDA 3CCRS 3K17A 4HDGA 1CJTB 1SL2A 2HNZA 4FJ7A 4KQZA 4DSJA 2ACMA 1UVMA 3VOVA 3KJQB 4GKKJ 2HOEA 1H1VA 4AH9A 2KB2A 2W6KA 3CPWR 4KHRA 3AD9C 1BUXA 3L09A 4KO0B 1OH5A 2ZDOA 3H4BA 4ETXA 4WE1B 1BQNB 2AD9A 1YDLA 1CBKA 2C3PA 4OJHA 4JRQA 4FW1A 2L9NA 3BSNA 1D9AA 3VA0A 3I55N 2A6AA 4CZIA 3J7A1 2QFJA 5E3CA 4KHNA 2G1HA 4K7QA 1U1MA 3HO1A 2JEFA 2I5JB 2EX3A 3SUQA 5AQNA 4CJ4A 3H2VE 2UVWA 4OI6A 3DLHA 1EX4A 4ANEA 3M6XA 2EVZA 4CGHA 4CFBA 2UXCJ 3TEHB 3I6PA 1YTAA 4JI3F 4OYAA 4YY3F 3GIKA 5A8RB 2GW8A 4CF1A 3LOUA 2WVFA 4CJVA 3T1HJ 5HJYA 3LUYA 5DG9A 4F8RA 1C0FA 5BRHA 1P8GA 3LANA 1RDCA 4IOAQ 1RT4B 2FF6A 4L3NA 4RPFA 4KGXB 1B9DA 4FJIA 2AWZA 3I96A 1Q1KA 5JVGL 3ZZYA 1HYZA 1YTYA 2BQ3A 7FD1A 4DV2J 4DR6K 4LSLB 1IKXA 1CJTA 4LR8A 2Q79A 2BKNA 4B9VA 1CSJA 3RYLA 3UDCA 3N6LA 3SFUA 3MPUB 1RBTA 2F7TA 1RHJB 2LQ9A 1TKZB 1HYSA 3DRPB 5HATA 4DN9A 3AO5A 4BROA 5M1FA 1SJRA 3PYEA 2J6SA 4JN4A 2VICA 3RBDA 4R25A 3D3CJ 3OYFA 3D66A 1VQKN 1BY9A 2E7VA 4DL0C 2M3DA 4ZCLA 3TSQA 1Y10A 1B92A 2VG6A 2R7UA 4ZLPA 2XNRA 3OVSA 5A76A 1A0OB 2M5YA 2P9SB 4IDKB 3CO0P 3S7RA 2N7YA 3GIJA 3HYFA 2YWFA 2HLTA 5KFJA 2ZH8A 4CHPA 2KXFA 1U26A 4WF9L 2CDRB 4C8OA 2YQ3A 4USMA 4B17A 4NZ0A 1U25A 1UA1A 4CEFA 2P2CB 3KUGA 1H2UX 3IG1A 1TQLA 2YKQA 2KT2A 1WNEA 3ZZOA 2OO4A 4CK2A 2O8DA 4XH1A 1SVDA 4RW4B 2EBGA 3HTVA 3MM7A 3CJRA 2E9RX 4JYAJ 1N36F 1F9FA 5AZIB 4YHHK 3PV8A 3TJAA 4CHYA 3BPDA 4U67Q 2B8PA 1IVZA 4KGVB 3RB6A 2DTUA 2JRSA 2WOMB 4ZPDA 5CAAA 4FF2A 2ZJQQ 3MCNA 2OPPB 5HRPA 2ZUGA 4H4KA 4F9OA 3M30A 4CEZA 4O55A 4ZVFA 5FDLB 3LALA 3AVMA 2C28A 4WYLA 4H0PA 4RNNA 1T03A 4BY9C 2P9IB 3UE2A 2UU9K 3FRYA 2NZCA 1K1QA 4NA2A 2LKZA 3CDEA 3T9NA 2ATQA 5A8RA 4FW2A 2VQEF 5F9NA 4ZOSA 4U7CA 3DOLB 4WXWA 2X78A 1F0XA 3KG0A 1WC1A 4M5JA 3DYAA 3SMZA 2Q6BA 4JKCA 3P3DA 2E9ZA 4CERA 2CQBA 4LVNP 1FXLA 2RHKA 3H7HB 5AQOA 1SQFA 4JYAK 4HI2A 2E29A 1NGAA 2P5OA 1WEXA 1FRIA 2BR0A 4HHHA 4CW7B 3JSYA 3TWZA 2OTLN 1BE4A 2W9AA 5LJ3Y 3KDOA 2EFNA 5B0GA 2PYJA 2YWGA 2O01C 5DGBA 1U2VA 2B56A 4TY8B 3SBMA 1YVFA 4DTRA 4F4YA 2Z56B 3RJMB 1NDKA 3LM2A 3WUHA 3FGUA 4BVPA 3DLLQ 2Z1JA 3PZPA 2C1EB 4NXNK 2BACA 4GKJJ 1XMOF 1KLMA 2AJQA 3C6AA 4BCAA 4OLAA 3I55S 2RH3A 5F2RA 1I5OB 4F3MA 4HVJA 4H03B 3FRZA 5GAGP 4ZVSB 2E2NA 1XERA 2XS5A 1PGZA 1ZM9A 4DTXA 4IKFA 2XLIA 4DHVA 4ZN1A 2ZM6F 4IEEA 2DNLA 3AODA 4I56A 4A2BA 1NJIO 3QJLA 1K8AO 4QPXA 4DHYA 2O8EA 2XSFA 4CHNA 3NOCA 2KI2A 2QKKA 1VQ6N 1QD1A 4I2QA 4DU4A 2FJWA 1PCAA 4FPIA 1MWKA 4GNIA 1EJ7L 2CPEA 3NL0A 4J37A 1GLCG 4CHZA 2J0XA 1U8WA 3R5DA 2YI1A 1JL2A 4H4MA 2VB6A 5EY4A 3MGJA 2BMBA 3D1QA 3EX7B 2QLWA 4MO4A 1H6KX 2FVCA 3OYMA 1XK8A 2C2DA 3MECA 5JMVA 1RTJB 4UOHA 4YN3B 3DRRB 3ZEUA 3THXB 3C6TA 2XHWA 3BO4A 3QEXA 1HUXA 3UWTA 4FBUA 3AAQA 2GJ2A 4NMLA 2X1BA 4M5HA 5JS1A 2DR7A 1B0VA 2F4VF 2XMVA 1VSMA 2EG1A 3PUFA 1JMTA 5M1OA 4Z4HA 1VISA 3JB9k 1H0HB 3IA0A 3ZT4A 4PAAA 3LGHA 2WW8A 2P9NB 5LY3A 4B1XB 2D5RA 1HKGA 3PTWA 3QLHA 2D3UA 3WC2A 3NNCA 1ZM2A 3WX8A 3CMQA 4NXNF 4NRTA 1NZ8A 1XMOK 4FJLA 2EFGA 1IJJA 3QGIA 1EIYB 4AQYK 4CNZA 3HSZA 2J8AA 2GJFA 3O4WA 5C25B 4CO5A 1FK9A 2B9WA 2A1SA 2ROPA 3NMAA 3HHLD 5EWEA 3NY0A 4OYBA 5EDWA 1O13A 1N0UA 4DPWA 4OI3A 1FFWB 2XMTA 3QFPA 4K2XA 1WTFA 4QR0A 3OHAA 2V9KA 3DLLL 4HI1A 3MN5A 3H45C 1IJFB 5A6WA 4DX6A 4DB3A 1NM1A 2ZKUA 2KU7A 2QI2A 2AA4A 4H4MB 4FXVA 2W7PA 2AT1B 3MWPA 1VSEA 1F6TA 3HVRA 4CESA 3QPIA 2XC9A 3QIPB 2GEMA 1FWPA 4QS7A 2E1RA 1YVNA 1N8RT 3G9CA 2IYGA 4CO4A 2JNJA 1UVLA 1WELA 4KI4A 4JI1K 1R8CA 4ILHA 4HT7A 5EX3A 5A0YB 1YT3A 3E9LA 1WSJA 2CJ9A 2IM2A 3RW6A 1KAZA 4OYOA 5E26A 4G1QB 3C16B 4E2FB 3W3SA 4P74A 3VAMA 4QIVA 3HSCA 3BEXA 1WB9A 3CDAA 3AY9A 1S1TA 3C94A 5SZTA 4CGFA 4U8YA 4XAKA 2CG4A 5C10A 2ASPA 1XEZA 3CMES 4FF1A 4RTFD 3CB4A 3OTOK 4ID1A 2Z1IA 1N36J 5CYMA 3ZNJ1 3L9ZA 1D09B 1FXXA 4X4SA 4OJ1A 4PKHA 3WXIA 1UEUA 1XQIA 3AA3A 3JSMB 3OYAA 1T02A 4NL5A 5AE3A 4CEOA 3QICA 2ZOFA 1NB2A 1UFKA 2FY1A 4RL1A 1Z1ZA 5AJ3K 2ZHOA 1WI8A 2CVEA 4YB5A 5F1XA 4KHQA 2HZAA 3DXBA 2AGOA 1H2TZ 4PCQA 4Y00A 3PFEA 4DL7A 4X66J 4BG8A 3SSQA 3THWA 4AE5A 4ENOA 5HMXA 4G3IA 1S6PA 2P9UB 1HQUB 1QE1A 3D6TB 3HF5A 1WAJA 3PJWA 2VG5B 2BDPA 3LW5C 1MMDA 3T5KA 4FZVA 4USTA 2OLWA 3TUJC 4EP4A 1IQTA 4JKBA 2GVDA 4DFPA 4H0YB 4ID5B 1VGYA 4F7VA 2PDAA 5LJ5Y 2FZKB 4HVZA 3KK7A 4HCCA 4F36A 1XTZA 2VU5A 3HSTB 3KKFA 1Z2ZA 1DTTA 3GWCA 2FJVA 1S59A 4CO3A 1LK5A 2LXIA 1YXQA 2OMOA 2RB7A 3W7BA 3F9MA 2K3IA 1O6XA 4LJMA 1RA7A 5CCMA 1EQYA 2DPIA 3D7EO 3IS9B 1X9MA 3GBTA 3V1OA 3BZQA 4ZPWR 3GOIA 4C6AA 3GL1A 3NLCA 2LEBA 1FKOA 4DSFA 2WC9A 2VOOA 3EMTA 2FLLA 4DCHA 1RAGB 1YI2N 4I6MA 5D77A 4KC5A 4DV4K 4CFDA 3NS7B 3VGVA 2N7CA 5F0UA 5L9NA 1T9TA 2W2NP 3EXCX 3AQPA 4PYAA 4OI1A 3TAPA 1RBSA 4ETZA 2JH3A 1EWRA 1M1KO 5IT9Y 1VR6A 3QINA 4GC6A 1SC6A 4Y0FA 4O23A 1CJVB 2KHOA 2KH9A 4PL8A 2K3KA 5TKWA 3QJJA 3DLGA 1VQ4N 2W4CA 1BQMA 1YBAA 4P7VA 4ZMMA 2IIRA 4CLSA 4A8QA 3DM2B 2RRNA 3UR3C 3DWLA 2W40A 3U9DA 2E1PA 3HCXA 4P2XA 2F9WA 4QQBA 1RWWB 4CEDA 2J7UA 2EEYA 1U6BA 3OFEA 2HQGA 1M5SA 2GC8A 2OSRA 2IVFB 4WE1A 3BO3A 1HA1A 4LFAJ 2CZ9A 2UXBF 1N5YA 4ZN3A 4NYZA 1NSPA 1FERA 3VR1A 1H72C 2RU3A 3LP0B 4CZMA 1B7FA 4DPXA 3J7AP 5AQVA 5KPZA 3B82A 1AXQA 4X4RA 2R7TA 1BI4B 4NYOA 2DITA 2BJ3A 2G2YA 4E7LA 1FD2A 1LFWA 1U09A 3SPYA 3OHRA 4J9QA 2GS8A 4WBFA 4EYIB 4NZ7A 1U6ZA 2R8IA 5F8IA 5J1NA 3SUPA 1FJGF 1FFSB 4XK8C 1Q82O 2OD6A 3RMDA 3MMAA 3DOMB 3I5CA 3W2WB 3PCOB 2VIHA 6FD1A 1ZS6A 1ZBSA 3F9KA 4YB1P 5HK4A 1S0OA 1HNVA 2Z58B 2R7RA 2VHGA 3QT8A 4Z94A 2QG9B 3VEZA 4BQLA 3RMCA 1RGVA 1RWXB 4WXOA 2KO1A 2XMWA 1D4XA 4C9DA 4HWIA 3H5YA 4O0NA 3BV8A 3VQ5A 5GAHP 3AB4B 2ZH5A 4C8YA 1FVQA 3CCJS 5BRDA 3NNHA 2QKBA 2Z2MA 3ZYYX 1TAQA 1N33F 3GIMA 1TKTA 1RTZA 3BN4A 3K5LA 4LSLA 2BH1A 2E5LJ 2Y8WA 1NK6A 2YNHB 2OJ3A 1V6HA 3QIDA 4O44A 2KM8C 4Q44A 4KSEB 2CRLA 2XI2A 4ERDA 2NS1B 4DTJA 3ELHA 5GIPA 2QV6A 3AO3A 2VG7A 3GZ7A 5A2QU 3CDWA 3I8BA 2QA2A 3U8XA 4FZZA 2VDHA 1IV0A 3DFEA 1RBUA 4PG8A 4CJPA 3BGOP 5AR0A 2UYTA 4FVMA 3ZC4A 4LF9F 1TL1A 1VRUA 2EC2A 3KKRA 3FQKA 5ETPA 4DV0K 2MKJA 2RDDA 4DDFA 1IKWA 2J9EA 1RNHA 1BD6A 4DMZA 4JB8B 1VC6A 3V5RA 5A6PA 5HROA 1RCHA 3P8BB 3P5JA 3KD1E 1X4GA 2HFZA 3FZHA 2QMWA 3L2VA 5DDQC 4RW6A 3GYXB 4ECUA 5A2QO 2CJAA 1GOCA 2CNOB 2CADA 4DQQA 4ZIWA 3M1VB 4PWWA 1XMQJ 2MB0B 3OW2R 4LIWA 4OYZA 5E7OB 4QZVB 2WUSA 4P7TA 1WBDA 3LP3A 2UVVA 1RT3B 4FWOA 1S1VA 3PYFA 1XHXA 3OYNA 1VIXA 1QSLA 4J9SA 3VAIA 3HK2A 4M95A 1K0VA 5I3PA 2BZ2A 4UOFA 6AT1B 3GQCA 4W90B 4IYQA 1HNIB 5CXTA 3B8AX 2LECA 4O3SA 2OIHA 1BUPA 1VLOA 2AF6A 5DJBA 2HQ3A 4G1QA 3C16A 1N33K 3HULA 4NEZA 2P9IA 1FVSA 4LRDA 3R1HA 2WOMA 1FX2A 3OL8A 3KK3B 2WSCC 2LQBA 2QGFB 1QAJA 1FEHA 1OJ4A 3ZTSA 1YUWA 3BQ1A 2CGLA 4ZTFA 3MWTA 4LC9B 3G96A 2VF3A 3TA0A 4J9MA 1QQOA 3ZSYA 5C5JA 1C1AA 5M1KA 4BDZA 4Q2LA 4RWWA 1JLQB 1S76D 1NG9A 4CGGA 4ZVEA 3CCJN 1JLFB 3Q8VA 5ETMA 5KG5A 3V4MA 3BSOA 4TU8A 1NGEA 1FE0A 4O8UA 1TP7A 3IWXA 2E1MC 2YKOA 1ITPA 3GPAA 4HUGA 3OFHA 3MDQA 3DOKA 1LWXA 4JKGA 5B0EA 2PE8A 2CQ2A 3H40A 4RW6B 1J53A 1VQMS 3IXQA 5EVZA 4DZ6A 3M1VA 1N6QA 4B9NA 3KLEA 3IC1A 1QJHA 3A5OC 1RDBA 2HIYA 4FWNA 2V69A 3OL7A 4CIFA 5KGXA 2IM3A 3C14A 5HP1B 4DR3K 1KONA 4CQ1A 4KPCA 3N28A 4FKXA 3R1LA 3NE6A 4IWVA 1WWHA 3QT6A 2VWJA 2B3TB 3MX2A 2YBVA 2GQ2A 4EO6A 1U49A 3TW0A 2VJUA 2LXFA 2EG2A 2EC0A 2CZ4A 3AD7C 4B3MJ 4DI6A 4K0KJ 2QMXA 1Q82T 3HKZD 2D1KA 3KK3A 1ZZNA 2YPYA 3KTQA 2G2OA 2ZC3A 3ZSWA 1SJ4P 2AYBA 3VEOA 3D6RA 2HWTA 2V63A 1Y64A 5T7BA 3O2IA 3WXJA 1B99A 1WACA 3QAEA 1QAYA 2VFVA 1VQ7S 3OYKA 1NOYA 4IOXA 4H5NA 2Y1JA 4MO5A 3WXLA 2VQEK 1GX5A 3H4DA 1TKDA 1NSKL 2CQGA 4ER8A 1WDTA 1RLCL 4UOGA 4X64K 1RTJA 4FWRA 2SXLA 4NLQA 5HN0A 4GY2B 3ITHB 1JKHB 1Q7YT 3NCPA 1V5VA 2J9DA 4ZVPB 3UNGC 4A48A 4F0KA 3FZ2A 3PKMA 4OO1J 3EWGA 1CG2A 4Y2IA 4ITSA 3PW5A 4K5RA 2P5GA 1WHVA 2L48A 1EQMA 3MEDB 3ZEUB 3NBPA 3WNEA 5CY4A 3LWMA 5AZJA 3EZ5A 2DFEA 1P9YA 4LF6F 4ED7A 4O3OA 2ETJA 2J5AA 3GYGA 1JIHA 3L95X 4OX7A 2X3DA 5KFWA 4CO2A 2IYIA 3DLKA 5LSRA 3D6HB 1X4HA 4DR5K 4JV5J 1UFWA 4QWBA 3T7ZA 4XH4A 1WF2A 1NBWA 5ADXA 2C3MA 3EPGA 3QT7A 4DR3F 1W0HA 3QLHB 2UV8G 4O5BA 2ZNYA 4C11B 2ZVIA 4OPHA 5AQLA 1E3MA 2NXCA 1WSHA 2UUAF 4DCOB 5EXWA 4NPOA 1LQ9A 4H0TB 4FPRA 1WEYA 2CXEA 2L9WA 4BRMA 5GADU 3TQ1A 4BC2A 4BR5A 3OXGA 1RILA 3RSEA 2W8LA 4G1PA 4WFZA 2Y0SD 1VSFA 4MYUA 3PRBA 3BJYA 1X8DA 4BC9A 3K9KA 2YPZA 2I0XA 1CZ9A 2NLXA 1U45A 3KHYA 3RAXA 1FDDA 1VRTA 3FFIA 4ZVHA 3L3UA 2J7KA 3CD7A 3AA2A 4JNEA 4QIFA 5DO2A 3RB0A 2R4FA 2OEKA 1UAXA 4RW4A 4CLKA 4M3WA 1BO5O 2GUPA 4RUHA 1TL3B 4Y3CA 1FD8A 2XCPA 3ILIA 1SJFA 4X64F 4CD1A 4PKDB 4WIQA 3J81Y 2KQ2A 3LDQA 2O8CA 5FRNA 3RWUA 5IV4A 1RU2A 3VQ8A 1PSDA 3VGUA 5A8WA 3FCHA 2V4QA 2D3OR 3QWPA 2DIUA 4BRKA 4M5IA 1RWMB 4A62A 1JB0C 2YCHA 3OUYA 2OCEA 1T03B 1DJ0A 5J2QA 2NQPA 3P83D 5ETOA 3HHLA 4FBTA 2E1YA 3UNYA 4NRUA 2DHSA 1CS4B 4BDPA 1NJWA 4DU3A 4BQZA 1T94A 2QWPA 4NI2A 5J1PA 3GMGA 1Z4UA 5J1EA 3H2UB 3K89A 4ECWA 2CGKA 3A2FA 1HIYA 2HNDB 5T7LA 1K1SA 2C3UA 2BUPA 3BKTA 2BOPA 4X2BA 5FROA 1AT1B 4V19X 1LWFB 4CJUA 3IUCA 4X66K 1TTHB 4NMXA 3TVYA 1M5KC 2YV0X 4I6YA 2AMCB 3DHWC 1BMQB 3MR3A 2Q97A 3VEXA 3UD4P 1HQEB 4J9OA 2MZRA 3R2DJ 2N82B 3M6UA 1RT3A 4OI2A 5DRKA 1NK5A 4I2PA 3IO1A 2DRAA 1WSIA 2FJEB 2IJRA 2LQ5A 3TX0A 1KVKA 3CD6S 1BC6A 1JLEA 3L2UA 4JI4K 2DNQA 1VQ8S 4LF4K 1VQYA 3WXMB 1NZAA 2HG4A 3SI6A 3S01A 3V81A 3U1NA 1WC3A 4KE5A 3IS9A 1SL1A 3MOJB 4CJRA 2WVCA 2V8PA 2AJ4A 2LA6A 3I0SB 1U0SA 3IWLA 4B9MA 2B6AA 3E2EA 1FJCA 1X9JA 4FLVA 5L1KA 4CBUA 1FI4A 5ITHA 2F3JA 4JKAA 5KG1A 5IM0B 1JJ2M 3CIZA 3KLIB 4D3HA 3BY5A 2XMKA 1SC1B 1L3SA 3UCUP 5KFAA 3OUYB 2CPFA 2YX6A 2BRLA 1LWCB 1NPRA 3A3NB 3QYYA 2COLA 4I6MB 1ZTWA 4Y2MA 1YBUA 1NU0A 2RVJA 3EGZA 1Y5LB 3JXUA 3HP6A 4FM0A 3NH1A 1C0TA 3AV9A 3LZJA 5F8MA 2OZSA 1NK0A 2GAGC 1OKJA 4DUYK 3GONA 2QLJB 5DK5A 2EPIA 4OYMA 4CLFA 3DLRA 3JS6A 4EWTA 2DNKA 2V2KA 2MZTA 3ZTOA 1L3VA 3RGIA 3W65A 3Q23A 4CZKA 4JI8K 1CXQA 3G71N 4RNFA 4WIIA 4LF5J 4B9QA 3THXA 5HOOA 1YKWA 3M2VA 3K5NA 2I2YA 4HDHA 1DTQB 1N8RO 2FZCB 5AJ3F 2DGWA 7FDRA 2IA0A 1XC9A 2KZMA 3QNNA 3KHLA 2QYGA 5KT6A 3CM5A 2HBQB 1XHZA 3O6QA 3MF5A 1SQEA 3FJ2A 4WP8A 2EWSA 3UPFA 1AYEA 2VFUA 3JTOA 1Y3JA 4HHJA 1RWPB 3NVMA 3FZMA 2MY7A 2XSJB 3E66A 3O5TB 4C8LA 4IEIA 4GMKA 1N5QA 3MR2A 2GGPA 4A4JA 2F7VA 5BREA 2DHXA 4DV7F 3L4QA 5CABA 3PIPL 3B6PA 2HHUA 3QBCA 1HBNA 2G0IA 3H5SA 5DS7A 4DF4A 4OGCA 2PFFB 1E4FT 1IBKJ 3A8KA 1C1CB 5J2PA 3EL2A 4CZHA 3W2WA 1Y0HA 4N8OA 1H38A 4F3OA 1FTCA 3SQ0A 4M45A 2R7SA 4ZS6A 1NKCA 4Q7AA 4CFAA 4E7HA 2G0JA 4J7CA 1NBEB 1B9FA 4KHUA 5LMNK 4R0JA 2YKNB 1X31C 1TV6A 4JHDB 3W8GA 4EHUA 1HI1A 4KHWA 1K6YA 4OZNA 4ZP8A 4R8UA 3C95A 4QOTA 1KD1T 1UJ6A 2H1YA 4CJLA 3H90A 4DR5J 1QS4A 5D0GA 2VDIA 1T6DA 2YHBA 1YHQN 4KV8A 4KFBB 3MOZA 3Q24A 3WXKA 5AQZA 5KFYA 1Q18A 3NAIA 1S12A 4AHCA 1A5XA 1U04A 3MCPA 2HPUA 3A1YG 4CM2A 4EBEA 1VQ9S 4FWMA 4GVMA 1KQGB 3W61A 2CH6A 2JLFA 1KAYA 2KFZA 3FEZA 2XLKA 3D45A 1UFLA 2GHPA 2QN6B 1RDAA 1WF1A 1IBKK 1VSIA 4ZJOA 4CVNE 4MT1A 2NR0A 1EX8A 1OPIA 2LU1A 2HZCA 3FNNA 3EKSA 2WSFC 3PX0A 1VQPN 3BM7A 4FVCA 4JD2A 3WZ0A 4BC3A 2AEMA 1NWKA 2ZZMA 2A3JA 4M42A 1H74A 3EPIA 5KFDA 1U0HB 1TL1B 3DOLA 1S49A 3N5BA 5FPMA 2RNEA 1TUWA 3CJ2A 1PKUA 3BUZB 2A40A 2P5VA 3NAEA 2Y1RI 3M8RA 2O4IA 3LGNA 1BHLA 2QWQA 4B8AB 1A5VA 3AAPA 4EZ6A 4USKA 5ADXH 1HKBA 3DXMA 3K0JA 3ID6A 1VRUB 3O44A 1WOSA 4HH0A 3SIPB 3F41A 1J5EK 3FK4A 3RBZA 5KT4A 5DM6L 3M3ZA 3MD1A 1P90A 2P6SA 3OHBA 1FDNA 3HDSA 1NB7A 2B9YA 3CCQS 2XB2D 1Y4ZB 2BE2B 4WZMA 1FXDA 4Q43A 2ZHAA 4KBOA 5LMNF 4J90A 4BC5A 4W5RA 2C2OB 5IZHA 4LRBA 3U1MA 3TAQA 3G82B 5IWAK 4FLUA 1W7WA 1GLLO 1HNIA 3CCES 4FF3A 2R9LA 4KB7A 4IFYB 4UY8T 3CCUN 1V5IB 3SSRA 3QSYB 4TYBA 4KI6A 2CJKA 2IVOA 1JXVA 3DLEB 1NGBA 4F4KA 4MYTA 5EWFA 5IT0A 3SI8A 2RHQB 2UUBJ 4YOTA 3FZKA 4ZP7A 1P6TA 4ED2A 4YS2A 1IWGA 3Q22A 1TYQA 5I3UB 4B3MF 5KFEA 3CCEN 1JXLA 4C0OC 2KT5A 1DGKN 2ZGZA 3M2RB 3V4IB 3QFUA 1JQGA 2ASDA 4DOZA 5HO4A 4G6VB 2EKNA 1T3OA 1S7IA 1F9HA 2NRHA 3H59A 1BGXT 2YX4A 2DNOA 2OEJA 3SPZA 4OZ2A 3TAGA 1JLCA 5CD4H 2R7QA 4KV8B 2NYHA 2VC0A 3X1LB 2ACYA 1PILA 2D4WA 3VQSA 4RW7A 1OQ3A 3HHLC 4CJEA 1AUDA 1QM9A 2VGMA 1VRQC 1X9WA 2PEBA 3LDSA 1GQEA 3AJ1A 3CJBA 1X9SA 1KSPA 4EFHA 1NGGA 3RU0A 4CTAA 1KVJA 4O0JA 3I31A 5GAHI 1GLFO 3CXCR 2HLUA 3F44A 4H0VB 2FJXA 4ZKAA 3D68A 1PYTA 4I7FB 2NZTA 2O5DA 1IBMJ 3BR9A 3I82A 4ECXA 1WLJA 4ECSA 4CLPA 1HNXF 4DTOA 1RT2A 3C14B 4KY3A 4DV6F 1JCFA 1YJTA 2HVHA 2E2QA 4LSNA 2DRBA 1R31A 3LDNA 1M1KT 4BACA 4OHVA 1U1QA 2HBMA 1WC6A 4FP9A 2FF3B 2FVRA 1HNZK 2CPDA 3OTCA 3US5A 2O8BB 2HBRB 5LMUF 2WAQD 4DLEA 2W7AA 4C8NA 4RBVA 2PY5A 2NZ4A 3EGVA 1KCFA 1YHQS 3NMRA 2B9EA 2HHVA 1GMWA 3GILA 4WQ4C 1ZM4A 2B4OA 2ZBPA 2HBZB 3B4DA 2BE2A 4PA1A 1RDRA 1MWYA 3TVZA 2KKZA 1FRLA 2R7VA 3AHPA 1HPMA 5BYRA 1HHTP 3QGPA 5KFVA 4YFUA 4PUOA 2D9PA 3P31A 3G82A 3VQCA 1S0NA 2W2PP 5KRSA 2DH8A 2XGQA 1S6QA 5CZXA 2ZBCA 4YB6A 3UCGA 3I0RA 2YNGA 4DR1K 2W1BA 4NLVA 1IG8A 5CYJA 3BF1A 3EGWB 1WBBA 1QUPA 4BRPA 2HNYA 3NCQA 2A6OA 1IWAA 3OV7A 2VA2A 4LFAF 4BHQA 1XC3A 2RT3A 1TYQB 1VSLA 4Y1DA 3NF9A 1VCTA 3P6YC 5I4MA 4DU1A 4DQ8A 1RBLA 4HL9A 4RW9A 1T9VA 2OPRB 3WC0A 1CULB 4I0WA 2K06A 2UP1A 4HTJA 4GO5X 1R8HA 1KVAA 1HBNB 2NREA 3MMBA 2N4CA 2DBBA 1M90O 2F96A 2L08A 3W62A 4DL5A 1HBUB 2RN2A 3TNVA 2KHCA 4NLBA 4NLOA 1KNZA 2QSWA 4BR7A 2O66A 4FOIA 3ZT2A 2H65B 1Y97A 4JAXA 2R7XA 2Y0BB 1ACMB 1P9QC 4B1WB 3FFIB 5EUHA 3CCLS 3LA0A 3FBCA 2D69A 1T05A 1EQ0A 2JL9A 4BR9A 5KFQA 1J54A 4FPBA 2E5GA 4H8KA 1YIJS 5M1NA 4C23A 2EWHA 1NKBA 2FLOA 4I64A 2HFNA 4H5TA 3KUEA 3EVOA 5BPLA 2DB1A 4QJVA 4EYHB 1NKEA 2IHR1 1KEKA 2DGQA 4ZVGA 2ITGA 1B3TA 3O9SA 1RAJA 4BS2A 5HVHA 2WTFA 4BGAA 4KGZB 3C6TB 2QLBB 8AT1B 1ZPWX 3ATVA 5DM7L 3W5XA 5L39A 1REVB 1A6LA 1TKZA 1HD0A 2BW7A 1DKGD 4KAIA 2GMHA 1JLAA 5KFHA 3IBFB 3VEVA 4E98A 4DR3J 2HFUA 3PNIA 2E6MA 3O3LA 2DR6A 4LR9A 1ZH5A 3S3NA 3HSJA 4DX7A 3N6NA 3G4SS 1RWKB 1BISA 3ILOA 3CJAA 4DPTA 2GHVC 3KG1A 2HNDA 1DFDA 2IC3A 1NRKA 5KFCA 5C25A 1JNZB 3CVKA 2A1RA 3T6BA 5CZVA 1CJVA 1RWOB 2NRTA 5KOXA 2JOQA 1S1UB 1R89A 1OMSA 5CD4A 3LPTA 4PG4A 3VAKA 3EO3A 1X5TA 5I3QA 4DEZA 4OHZA 1PG5B 5GMEA 2BJ9A 2IOCA 1DLOB 3DHXA 3Q8QB 2QLFB 2HFSA 4C2MA 2YWWA 3QNWB 4KBIA 1VQPS 2MZQA 1BCOA 5BR9A 2MHNA 4NOHA 2O1PA 3SV3A 4IFVB 2XYGB 1UWBA 4GVLA 4LRAA 2XZTB 4NLTA 3MR7A 2JDJA 5GAEP 3MAAA 3BGLA 1HBUA 4WK1A 1REVA 4LQ3A 3OW2M 2FIUA 2G0CA 4HUEA 5KFNA 1X4BA 1VSKA 1YF5L 2YWEA 3VTHA 3D67A 3SNNA 2XI3A 5KT2A 4P73A 3K5MA 3PIOQ 3BBCA 4DU7A 2MLZA 4F4WA 3CCSN 4LBIA 5IM0A 1NLVA 1R0BG 2B4PA 2CJXB 1LKZA 2RD5C 4I68A 1NK4A 5HI7A 2OP5A 1R6VA 2FPHX 1YTUA 3Q2SC 2IDLA 3OR2B 1XMOJ 3MMVA 3R5JB 2ZWOA 3IAYA 5KT3A 2OPSA 4IRDA 2G8WA 4RKUC 2P9LA 3OQ2A 2ABYA 3VQ4A 1C0TB 3VZIA 2ZH6A 4K50A 4L75A 1JJCB 3QGGA 3ULEB 3VF2A 2CWXA 4UOCA 3VAHA 4WQ4A 3AVHA 4NLPA 1LW0B 2XZDB 2JLEA 1B64A 1IKVB 4TU9A 3R3LA 1RT5B 2BJ8A 3CERA 4LMZA 2FDNA 2H4WB 2AQ4A 3UO0A 2O3DA 4CGJA 2ZBQA 1XN9A 1I39A 4ECTA 2IGIA 3AH6A 3MK6A 4K0KF 2QT7A 1F60B 4O3PA 5BN8A 5AT1B 4K8ZA 5J2PB 2JEIA 3U1LA 2Q3SA 5CYQA 4JI4F 2ASLA 4B1YB 1RA6A 5D4NA 4LF8K 4N8NA 4ILGB 1S1XA 4JEPA 4ELTA 3HHDA 1S3XA 1KC8O 2EXUA 3GCXP 1RHQB 2WSEC 4GKKF 2IY5B 3FFKB 2GFFA 2DY4A 2XLJA 4NASA 3K57A 4ANCA 4K4VA 2AIRB 1PO6A 3CJKA 4M7YA 3PDNA 2IVYA 1YG0A 5HLFA 1RTHB 1KQKA 1HBMB 4X65F 3HZEA 5F8GA 2M9KA 1U8SA 5BRFA 1BLUA 5L46A 1CPZA 1XNQJ 1GMVA 3NFAA 4YUDA 1RK8A 2WCXA 1I3OB 3PR5B 4BRIA 1RT6B 1JK9B 2MLXA 2H51B 1TUGB 1BL3A 1MWMA 2XYHB 1NNEA 2I38A 1XMQK 1SQKA 5KFUA 1YSJA 4ZVQB 2VKZG 1CJUA 4HR2A 4ECYA 5LJWA 1GXLA 2HAFA 4JI8F 2WW4A 4A8XA 1RTDA 2ZOGA 5AQIA 2A42A 2XULA 4HKQA 4M3TA 1FE4A 4PPZA 3N4WA 3ZETB 1OY9A 1TUVA 2PFUA 4LFBK 2FC0A 3OTBA 3CCWA 2ERRA 1YBTA 3CULA 3V1QA 2YHYA 2GQCA 4CZJA 5KG7A 2BX6A 3K2PA 2PGCA 4DZDA 3GU0A 4CH7A 3CC2N 2CDQA 4F0HA 3BO2A 2MQ8A 5FLXU 1MG7A 4P52A 4DV7K 4Z7YA 2GAHC 4F50A 4OKEA 2XY6A 5KPRA 1QVFM 1J6ZA 2OPQA 3DLGB 2Q1LA 4LF8F 3F73A 1Y11A 3IGNA 4V1Ak 3THVA 1E6VB 3VQBA 3TRGA 2PA8D 2ROEA 1LWFA 2ROGA 3TTCA 4W5NA 1CLFA 4O8KA 4FOEA 1OSCA 5E5NA 5LL6d 1Q8LA 1QHTA 4U7BA 3NNAA 2Y1IA 3QRPA 1I3AA 2H3GX 3MXMA 1TVRA 3MUTP 1SC3B 3W63A 5C42B 2Q6CA 1ZAXA 3AVFA 1SH0A 3NXZA 2CJQA 4X65K 1Y5NB 3SJJA 3QMQA 3K58A 4DCPB 4DR2F 4IRKA 1QSSA 1ZTTA 1B70B 1WN7A 1RT6A 1BA1A 4FLYA 1NO8A 3THPA 1OYEA 3BGUA 4CK1A 4RW8B 4ZPTR 5E3PA 2W9CB 1WSRA 5A0YA 3GG0A 4K4WA 3AB2B 2IPOB 5AQWA 4B3TK 2B51A 3GJTB 3KLGA 3MTKA 4RG8A 4A8FA 4CLZA 2FD2A 3TO8A 4YY3K 3G6EN 1QAXA 2QEXS 4J9RA 2F8SA 2YNFA 3OFFA 4BRHA 2HFVA 1T9WA 3QRQA 1VAZA 3VA3A 4R0EA 3K5PA 1CC7A 4CT9A 1RTIB 2HHWA 2FJAB 1VQLS 4LFBF 3VF6A 4E7JA 3MM6A 1Q9YA 2FC9A 1I94K 1V9OA 3GG4A 3I5AA 3EVMA 4FF4A 2ALZA 4ZP6A 1NK7A 1O0PA 2NUBA 3UKUB 2E20A 2XNQA 1B7YB 3FGVA 2HHPA 4DR6J 1AFIA 2ZJPL 1HARA 3ZFVA 2AEJA 2JFDA 5AJ3J 3G2XA 1HFEL 4M3YA 3IR5B 2KYXA 1XNRK 2V68A 3E01A 3DU6A 2E8AA 3D7SB 2DFHA 3DRYA 1ATNA 1C2PA 4JI2J 4MIWA 5M2PA 1X4AA 2NUUG 2G9OA 1VHXA 3P4UB 2B43A 1XR5A 1E4GT 2WK4A 4BWMA 2LYVA 1RHRB 2BJDA 2LDIA 1RAFB 1JLGB 3TWHA 2MYFA 4C8ZA 3W0LA 4O3RA 2AW0A 4B9SA 3GFZA 1RABB 3KKSA 2GX9A 1BWVA 4LSZB 4F4ZA 5E41A 5SUHA 5KOWA 4B3SF 3WEEA 1SL0A 5IV3A 1YITS 2YY3A 3EZOA 3BSCA 3NOGA 4Z0UA 3TJ8A 3A12A 4GVEA