1RT5A

Hiv-1 reverse transcriptase complexed with uc10
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
542
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 143
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt5A05
4RNNA 1U04A 3H59A 3TAMA 3ZT4A 4PWDA 3HVTA 4IR1A 2ILYA 1RT7A 4ZP9A 4JS4A 4K4UA 2QK9A 1RBSA 1HQEB 4F50A 4M95A 4H4MB 5KFUA 2WOMA 3PW7A 3DRPA 3MR3A 3BGRA 4CF1A 4XIUA 4AHUA 4E1NA 3QLHB 5DQHA 1YTAA 3T19A 3IRXA 3JYTB 3S3OA 3LALA 3I0SB 3I5CA 5EU7A 3DRSB 3CJ2A 2W8LA 1QE1A 4F4WA 4H4MA 4CEOA 5I3UB 4TY8B 1SH2A 5I42A 4FZXC 1GOAA 3DLKA 3OYGA 3V6HA 4DTNA 3VQQA 2A1RA 4W5TA 4R5PB 1NJZA 1R0AA 2RKIB 2FBYA 2CJQA 3HP6A 3MXIA 2IOCA 1L3TA 1YVFA 4CGDA 3L2UA 1JLCA 3OYKA 4B9TA 4E0DA 4AHRA 4CJTA 4FK0A 3NDKA 3FQKA 2OZMA 2EHGA 4IR9A 4Q43A 5CYMA 5KG6A 5KFOA 4KHYA 2YNHB 4KTQA 1CXUA 4PY5A 3DLGA 4DL2A 2ZE2B 4MFBA 4HCCA 4QOZB 4ZPCA 1VRUA 3O4NA 2W8KA 4G1QB 4N47A 4RUCA 4CF9A 1WAFA 4C8KA 4CJ3A 4OLAA 1HRHA 2HHWA 4OLBA 4CEZA 3GV7B 3AVNA 3I8DA 1ASVA 3TAFA 5C24B 2R2SA 5F9LA 1S1VA 5KT2A 4CK1A 3KOAA 1LW2A 2YNGB 2R8JA 1QSSA 3V4IA 2KTQA 4DU1A 5DG7A 5KFWA 4DSIA 4WXWA 3VA0A 4CJRA 3NBPB 4E7JA 5KFSA 2ASLA 5HP1A 1BI4A 4IQXA 4DL3A 1VSDA 2GBZA 4AHCA 3AVMA 3UDLA 3IS9A 5SZTA 4Y2AA 3BSNA 4Z4EA 1SUQA 2HWHA 3HHKA 4FJKA 1NK8A 3MECB 3C6TB 3IG1B 1Z25A 1QQCA 1S4FA 4QCLA 1LAVA 2FJVA 1RDRA 1S1XB 2VA2A 4OKJA 3CIZA 5E41A 3RR8A 4DQRA 5JUMA 1C1CB 3I5AA 2D3UA 4K4TA 2VWJA 1RBRA 4FM0A 5DK5A 1N6QA 1IKYB 2B6AA 2ZQBA 1BQNA 2QE5A 4IRCA 4B9NA 2D3ZA 4AHVA 1REVB 4MH8A 4ELVA 2HNYA 4NRUA 3G6VA 1VSJA 3DRSA 4OKKA 4JV1A 3VQ4A 5CZ1A 2C2EA 3LP1B 4KTWA 4CEDA 5KT3A 1GX6A 4DQQA 3PW5A 4CF2A 3G10A 4K50A 4O3SA 1I6JA 2VA3A 3DI6B 3LZJA 4EEYA 3LWMA 2BE2B 3QGGA 4LSLA 1GOBA 4CFAA 4TQSA 1RCHA 1VSFA 1RT1B 1DTTA 4Z4HA 3KJVA 2NUBA 3OY9A 2UVUA 5KFXA 1JLBB 5DG8A 4X2BA 3NCIA 3HVRA 4FLYA 3H5XA 2D0CA 5KFEA 3TAGA 3WNHA 3MF5A 1EP4B 4WFZA 3I0RA 3H5UA 3ZSRA 1BISA 5D3GA 1Q8IA 5T14A 4TN2A 1NJWA 2BANA 4FM2A 4I9QA 1QE1B 3OYMA 4FJXA 2YNIA 2C28A 2FVSA 2P5GA 4NCAA 4J9MA 1D9FA 4CIGA 1MU2B 3GV5B 3M8QA 3V9ZA 2YKNA 4RW9B 2E9ZA 3DRRA 4DFJA 4ID1A 4N76A 1S0NA 3MFIA 4GVMA 3QIPB 5EWGA 2RKIA 4ECVA 2E6MA 2PY5A 4IRDA 4CGFA 4CEQA 2Z1IA 2V9WA 1TV6B 4EP4A 4ECZA 3G0ZA 4XO0A 5L9XA 4CGIA 3IAYA 4YR0A 2JEFA 1RA6A 3LZIA 1IKWB 1RDAA 3PV8A 2R8HA 2ZE2A 3NE6A 4FJJA 1IKVA 1LAWA 4B9SA 3HJFA 1RBVA 3WNGA 4DTMA 3Q8SB 4DFMA 1KFSA 3NAHA 3DDKA 3RMAA 4CFBA 4FJIA 4FZZA 3T5JA 3CJ5A 4FLTA 3NAEA 4RNFA 5HP1B 3T5HA 1ZTTA 5K14A 1WSIA 3AA3A 3LP2B 4NLRA 1T05A 4FW2A 2ILZA 2FLPA 2W7PA 5C42B 3HYFA 4BWJA 4RW8A 2B5JB 4CEFA 3MAQA 1TL3B 3M9MB 3B6PA 1DLOA 2WONA 4IBNA 4Y34A 4DU3A 4F4KA 2R8KA 3CO9A 3RB6A 1SUQB 4QW9A 3SFGA 5DG9A 4DTSA 2XGQA 3MXJA 3TANA 2BRKA 4DL6A 4CK3A 4RW7B 5KT4A 1DTTB 3TVKA 4TY8A 4J2BA 1Z4UA 1C1BB 3KHHA 4UQGA 3OLBA 4E89A 4IG0B 1TKXA 5DQIA 3WNFA 4DS4A 4Z4GA 2B6AB 4K4VA 1FKOB 3PVXA 2UVWA 3SNNA 1REVA 5EDWA 4IG3A 5HRPA 4CJWA 2AGOA 3KMSA 4FXDA 4JRQA 2YNHA 2DFFA 3THVA 1NNDA 1Q9XA 4C8NA 4DF8A 2PZSA 2IA6A 1JLBA 3KKRA 3OYHA 1UA1A 3KKSA 3RAXA 1S9GB 3H98A 4RW4A 4RW6A 3NMAA 3JYTA 4I2PA 4CHNA 3KLHB 3VQBA 4EO8A 3K2PA 3AV9A 4Y1CA 2Q3SA 2QKBA 3N6MA 4CF0A 2X74A 4FJ7A 2G8HA 3NGYA 5HROB 1JLFA 5C24A 5D3GB 1RT2B 5J2QB 3MEGA 3SFUA 1BCOA 2KQ2A 1EX4A 4KV8B 4HHTA 4YR2A 4JRPA 1CSJA 4ECSA 2IC3A 5DGAA 4B9MA 3JSMB 1ZBLA 4DMNA 3PX0A 2YHAA 1U49A 4FJHA 2E9TA 2AGPA 3UR0A 4QWBA 4EBEA 4J9NA 3QEIA 1SV5B 3T5LA 2HNZA 4M3UA 4CFCA 2G8WA 3M8QB 3MR6A 5J1EB 4ELTA 4ZHRA 1LW2B 2OYQA 3PX4A 1RNHA 3LAMA 2JC0A 3AVLA 5KRSA 1SV5A 1S1UA 4F4XA 1NHVA 5HLFB 3KHLA 2IS3A 3NFAA 1T8EA 2IJNA 4CHZA 1B92A 2FLLA 5KG4A 4K4WA 3RMBA 3OHAA 4N41A 4J9PA 1VSMA 3D28A 1BIUA 2ATLA 4OGEA 4DL5A 4B8AB 2HHVA 3H2LA 1BCMA 1BI4B 1HMVB 1YVUA 2GIQA 3IN5A 1C0TB 4Q8EA 1WAJA 2D41A 3AVBA 1VSLA 3HSTB 4GC6A 4IH5A 4ED6A 3VN5A 3IRXB 5HRNA 4QW8A 2KFNA 3GYNA 2AJQA 2Y1JA 1KVCA 1HARA 3TAMB 1VSEA 2E4LA 4NLOA 4ECRA 5KFKA 4KHWA 5F8IA 3TAPA 3P1GA 3M8RA 3SZ2A 2XO7A 1FKPA 3AO5A 1HPZB 1QTMA 3ZT1A 3N6NA 2BQ3A 1RT6B 4ED3A 2C2DA 3HK2A 3QLHA 2V4QA 1TL1A 3DOKB 4U7CA 3PR5B 4KTZA 1QSYA 1JL2A 3I0SA 3LP3A 1F21A 2RF2A 4IDKB 1XR6A 1HQEA 5EUHA 3L8BA 4TLRA 3VQ7A 1B9FA 2ATQA 3TI0A 3BGRB 2WHOA 3QZ7A 2W9BA 4MKBA 3GIKA 1HYZA 4DSLA 4KO0A 3FQLA 4KHQA 4F3OA 4DG1A 1ITGA 4KV8A 5I3UA 4ED2A 2R2TA 4OPKA 1U45A 1B9DA 2O4GA 1RTIB 2G8VA 2DFEA 1S6QA 3H4BA 3AA2A 4ECQA 1VSIA 3PJXA 4ED1A 1TGOA 2V4RA 4Q8FA 5KFYA 4BE0A 1RT3B 3AO3A 3HM9A 3CQ8A 4AILC 4KSEB 4Q45A 1X9SA 3FFIB 5KFLA 4EYIB 5HBMA 2Z1GA 2QV6A 4TSXA 1TVRA 3P83D 3O3FA 1S9FA 2HAIA 4R8UA 2YNIB 3U3GA 1RT5A 1N4LA 5J2MA 3ASMA 2OH2A 4C8LA 5KT6A 4Q44A 4F4ZA 3AVGA 3ULDA 3SQ2A 2JGUA 3DLRA 1O1WA 3OYAA 1T3NA 3DYAB 1IM4A 4KFBA 3RB0A 4PQUA 3BSOA 4K8XA 4CJEA 4J9SA 1BIZA 4CHYA 5KFVA 5CYMB 1S9EB 1S1WB 3DLHA 4ZP7A 3DOLA 1BHLA 2YKMA 1XC9A 4E7LA 4KI4A 4WFXA 3NBPA 3QO9B 4LY7A 1TKTA 1X1PA 1L5UA 3OL8A 1KHWA 3NH1A 2YKMB 2JC1A 3O3HA 4ZVHA 3CG7A 3U6FA 1VK0A 5KGXA 4BDZA 3RR7A 4F3TA 4CERA 2D7SA 1FKOA 1A5XA 3NGDA 5CYQB 4WE1A 4ZVEA 4J2DA 4QWDA 2HHTA 2IAJB 1L3SA 2BQRA 4B08A 3SJJA 1DLOB 1L3UA 3EPGA 3MEDA 4ZP8A 3AVFA 1XR7A 2HNYB 4DTOA 2GV9A 4N5SA 4FLXA 3MR5A 3BQ1A 3C94A 1T05B 1NKCA 4DG1B 3DM2B 3C6UB 1RDBA 1Q9YA 3H4DA 1TL3A 3K58A 3V81B 4JV0A 4JLHA 3VQCA 4YNQA 1ZETA 3Q8PB 1ASWA 4CEAA 3TAEA 3QIPA 3M9NB 4CGHA 4YP3A 5I42B 3T5KA 2IC3B 4NLYA 3PR4A 3ISND 4M3TA 1KVBA 4M3ZA 4YMEA 5F8MA 3ZSWA 5L1KA 3CFOA 2WRMA 5KG0A 5KTQA 4C8MA 2VG7A 1LW0A 1JLFB 4JV2A 3MTKA 1RDDA 4GC7A 2LSNA 3HVWA 2J6TA 3V9SA 1T7PA 1RAJA 4KHRA 4RU9A 4CE9A 1TKDA 3V1OA 3F73A 4CJVA 1Y97A 1HYSB 4NLWA 1EETA 4HUEA 1A5VA 5HBMB 3EY1A 3SYZA 2F8SA 3BREA 5T7BA 3VQ5A 4J9RA 5JS2A 5L1JA 2EX3A 3OHBA 4M3WA 3LPUA 1WSFA 3GIIA 5KFCA 4Q5VA 3BSCA 3HPOA 3QEXA 3Q8RB 1KFDA 1JX4A 4KB1A 3M8PB 2D0AA 4DSEA 4QWAA 1CZ9A 3M9OB 4R8UB 2OA8A 4ELUA 1S6PA 3SUPA 3OYFA 1MU2A 2UVVA 4JS5A 1N5YB 4MKAA 2VG6B 2IM3A 1CLQA 2OZSA 4ZVFA 2J6UA 3SUNA 4DEZA 2IJFA 3V1RA 4ECTA 1KLNA 1D9DA 2BDPA 3QETA 1SKWA 3JSMA 1NKEA 3H40A 3GIJA 3KLFA 5KFJA 1XHZA 4KI6A 3P5JA 1ZBIA 4K4XA 1BQNB 3DOLB 1C0TA 2ZKUA 4DU4A 4O4RA 4ZPAA 1S0MA 3K5LA 4KKOB 5J2PB 4IFYA 1MMLA 1OS5A 3EZUA 2PYLA 2ETJA 3QIDA 1L3VA 2XGPA 5F8LA 1XI1A 2ZD1B 5FROA 4DTRA 4M94A 3NF8A 4IKAA 3VQSA 1U47A 2FVCA 1D5AA 3QNNA 4DQIA 4K4SA 3V1QA 4FJGA 3C6UA 2YNFB 2KFZA 5K14B 2XCAA 3EYZA 2BGGA 5FDLA 5KFNA 5KFGA 2AWZA 2A1SA 3KJVB 4IKFA 5DQGA 3LWLA 4CIFA 5HROA 3KHRA 2B5JA 3BQ0A 2E6LA 2FBTA 1T03A 1N6QB 3BDPA 2WONB 2UUTA 3V6DA 3OYJA 4PUOB 2Z1HA 3KK2B 4PWDB 1RT6A 1SKSA 3PUFA 3BQ2A 5KFIA 4KO0B 2D0BA 3LP1A 3CFPA 4R5PA 3DRPB 4M41A 3K5MA 5F8HA 4B3OB 4CJLA 2PYJA 2BRLA 3NF6A 2HNZB 4RW4B 4NLXA 4ZVGA 4WZQA 3GV8B 2WCXA 4J9QA 3MFHA 1TKXB 1WNSA 4ICLA 4ED8A 3SQ4A 5J2NA 1RT1A 4RG8A 3DLGB 1DTQB 5KFAA 4LSNB 4FJ8A 4DL7A 4BE1A 1S97A 4DLEA 3CDWA 3ALYA 3G6XA 4FJMA 1WSEA 4O4GB 4MK8A 3H5SA 4OVLA 4LD0A 1RTIA 4CK2A 2XI2A 3S3MA 2IM0A 4FCYA 5KT5A 1C6VA 1R0AB 1IKWA 3SCXA 1NHUA 1HQUA 4H4OA 5KFPA 4ID5B 1VSKA 2AGQA 1BQMB 1C2PA 3OYCA 3SQ0A 5JXSA 1VSHA 3K5OA 4FS1A 1KTQA 1C0MA 3CFRA 1SKRA 3UPFA 1KLMA 4FJ9A 3K57A 3KLIA 1JLGB 4LH5A 3AVCA 1XWLA 2JLEA 4HCBA 3DMJA 3UIQA 1S1WA 1QHTA 2VWKA 4CCHA 2DPIA 2FVRA 1Z26A 1RTHB 3VQEA 2DY4A 4E7IA 5KFHA 4DLGA 4OL8A 3E01B 3FFIA 1ZBUA 1RTDA 3ZSVA 2IGIA 3OYLA 1QUVA 1QAJA 4L8RB 4NLVA 2WK4A 5DLGA 1NJXA 3OJUA 4M45A 2HW3A 1TKZA 2W9CB 1GX5A 1S6PB 3QERA 5KG2A 3OYEA 3QO9A 3QZ8A 5F9NA 3QNOA 4HTUA 5KGWA 1ASUA 4E19A 3MECA 3KK1B 3UQSA 3HVTB 3SUQA 4NLPA 4IRKA 3OS2A 1FK9A 1JL1A 3S9HA 4IG0A 1NK4A 4OJRA 3T3FA 4DS5A 3PHEA 2O4IA 2YNFA 3RMDA 4C8OA 1KVAA 4IOBA 1FKPB 1ZBHA 4ZP6A 2ZD1A 2W42A 2UUWA 3QEWA 4HVJA 4URGA 4YR3A 4ZPBA 4O44A 4F2RA 2HWIA 1D8YA 1NOYA 5KFTA 2FVQA 2I5JB 2OPQB 4IDKA 4O5BA 2OPSA 4EYHB 3TARA 2HMIA 5KG5A 4N56A 4YFUA 4MK7A 4WE1B 3CWJA 2KW4A 3KLEA 3FRZA 4FK2A 3NF7A 4HUFA 3I5BA 3LDSA 2HMIB 2Y1IA 4CJQA 4W5RA 1VRTA 2B4JA 4DFPA 4I2QB 1W9HA 3KK2A 4ZPDA 1TL1B 3DOKA 2XWYA 3AO4A 3VQAA 3KMQA 3V9WA 3NL0A 2DFHA 3VQDA 5J2QA 3PJWA 1K1SA 3RB3A 4KAZA 5C25B 2XY6A 3PO5A 3M8SA 4DTXA 3SPZA 1LW0B 4AHTA 1EKEA 3RAQA 4FLVA 2IM1A 1J5OB 2FJXA 3KD1E 5FRNA 4M42A 2OPPB 4ECYA 1HNIA 5DMRA 4ZMMA 2E9RX 4NLTA 3TR8A 4ID5A 4EBCA 4PQUB 5EWEA 2FLNA 3BSAA 4O0JA 1RT2A 3NGIA 4Q0BA 4E1MA 3L3VA 1UA0A 3TWHA 4RZRA 2QXFA 1TK0A 4K4YA 3AVIA 4KKOA 3L3UA 1S1UB 3OJSA 2G8FA 1S1VB 5L1LA 1LWEB 1T94A 1WNEA 1HNVA 4IH6A 1K6YA 3DMJB 4CECA 1TV6A 1TVRB 1S9EA 3OL7A 5KI6A 3NH2A 2J6SA 3U3YA 2EC0A 3LP0A 4O3NA 3KLIB 4O3RA 3L2QA 4FBUA 2XY5A 3QESA 1JKHB 4ZTFA 3AO1A 1HMVA 3ZSZA 2YNGA 3LANA 3K5NA 4GMJB 2G8IA 3LP0B 1S0OA 2FC0A 4DWIA 2ITGA 5CYQA 3E01A 1IG9A 4K4ZA 1A5WA 1ZYQA 4URSA 4NRTA 3N6LA 4CJFA 1HPZA 3KIOA 1BL3A 4OGCA 3TABA 2GIRA 4ED7A 4TQRA 2HHQA 1C1AA 1NJYA 2KZMA 2I1RA 1WLJA 2BR0A 4DFKA 3HP9A 5J2PA 1N5YA 3L2VA 1FK9B 3DI6A 1RT4A 3E51A 1TKTB 4CESA 4WFYA 3PX6A 4DTPA 2WTFA 3ZSYA 4LQ9A 2W9BB 3KK1A 3Q8QB 3OS1A 5L1IA 4DF4A 1D0EA 5KFRA 3RTVA 3RB4A 4Z4CA 1J9AA 5F8JA 1J53A 4RW7A 4WXOA 3S3NA 2F8EX 1DTQA 1RTJB 4W5OA 4IFYB 2R8GA 4YQWA 1ZTWA 2HVIA 4HYKA 1JIHA 4CFDA 2I5JA 4K8ZA 2HNDB 1RILA 4NYFA 3V9XA 1K1QA 2BANB 4O3PA 4IFVA 4I9LA 2WOMB 5HRRA 3QEPA 3AVHA 1WSJA 3ZSXA 3GQCA 3IGNA 3AVAA 5C5JA 2HB5A 3RBDA 2RPIA 1S6QB 1S10A 4ICLB 3RRGA 4LSLB 3VQ6A 2XCPA 4OKEA 1ZBFA 3SQ1A 3FDSA 2DPJA 1RT3A 3ZSOA 4RW6B 1CZBA 1JLQB 1G15A 3V81A 2V0NA 4TY9A 1BGXT 4BACA 1YT3A 4B8CA 4H4OB 4BE2A 4WZMA 4CEEA 4J9OA 3CM6A 4FW1A 3OLAA 1RTDB 4I7FA 3OL6A 5SWMA 4ZHRB 4EZ9A 1S5JA 2BQUA 3SV4A 3KLGA 4CIEA 3O3GA 1JLGA 4EZ6A 4TXSA 4DSKA 2VG5A 3CJ4A 4BDYA 1QS4A 4KHUA 4G1QA 3LAKA 3NH0A 4FM1A 1QAIA 3D45A 3VQ8A 4W5NA 3BJYA 2FJWA 2JEIA 1I39A 3BR9A 3HPHA 2CKWA 4CGJA 1JXLA 1NK6A 3RWUA 1XHXA 1NK9A 2RDJA 1JLEB 3AVJA 3PW4A 5FDLB 3AA4A 4AH9A 4E7KA 2OPRA 4XPEA 4LH4A 2ASJA 1UWBB 1HQUB 3V9UA 3V4IB 4DL4A 2ASDA 4F8RA 1NOZA 1BQMA 1CXQA 3D5MA 1JKHA 1LWEA 4TYAA 4EP5A 4Z4IA 1RT4B 1SH3A 1RYRA 4KB0A 3QYYA 5KG3A 4O55A 1XR5A 1W25A 4H8KA 4M3XA 1TQLA 4PA1A 4KPYA 4PUOA 2G8KA 1EXQA 2XC9A 1NK0A 3ZT3A 4F2SA 3G6YA 3O4QA 4CJ4A 4IH7A 4J2EA 2XI3A 3RBEA 2IAJA 1IKYA 5KFDA 3OSNA 1LWFB 4Y3CA 4FJ5A 1S49A 1LWCB 3V6KA 5FRMA 3OL9A 1IKXB 1C1CA 3DLBA 3PZPA 4O3QA 4EO6A 4NYZA 1NK5A 1RA7A 1RBUA 5JS1A 2XHBA 1JLAB 5KG7A 1JLCB 3ITHB 4G3IA 3K59A 4KRFA 1TAUA 4CHOA 4O0IA 1N48A 2B43A 3SI8A 3HKWA 3KLHA 4MQ3A 1S1XA 3KD5E 1WSGA 3B6OA 3H08A 1SL0A 4B3OA 4HKQA 3KHGA 2X6NA 1IO2A 3DLKB 2D5RA 2HNDA 1SL1A 1I3AA 2AX0A 4LQ3A 3C95A 2HHUA 2OPSB 1U09A 4KAIA 1KLMB 3AA5X 3QINA 1EETB 3T1AA 3A2FA 1S48A 3DLEA 4IG3B 4FS2A 1JXBA 4O4GA 2R2UA 4B9VA 1RT7B 5KRTA 4Q0BB 3WNEA 5F8NA 1T03B 4RNHA 3TQ1A 4FK4A 4NCBA 1KSPA 2FBXA 1SH0A 4ECXA 3CM5A 5J2NB 3H5YA 3OYNA 3V6DB 1RYSA 3QIOA 4KBIA 3OYIA 3IGVA 4J2AA 4NZ0A 2O5DA 4URQU 1C0UB 4KE5A 2P1JA 4AHSA 1W0HA 2YV0X 3VA3A 4ZTJA 3QEVA 3MEEB 1IH7A 1LV5A 2XY8A 3RMCA 2VG7B 3DYAA 4MFBB 2P5OA 5KFBA 3ISNC 3KNAA 1WN7A 1JLQA 2F8TA 2AX1A 3M8PA 3CDEA 3HO1A 2HHSA 5DGBA 2GUIA 1HYSA 3GILA 5J2MB 5KFQA 4QWCA 4RW8B 4I7FB 1NK7A 1HYVA 2W7OA 1RTHA 4KFBB 1TK5A 5HLFA 3QGHA 3CJ0A 4KB7A 5EWFA 3VQPA 4FJNA 4CJUA 5F8GA 1TAQA 5HRSA 3ZT0A 2YKNB 4RW9A 4CJKA 4OPJA 4FZYA 3D0PA 3L2RA 4F4YA 1QSLA 2FVPA 4ECWA 4NCGB 1UWBA 4DSFA 3KK3A 4FLZA 3CVKA 3FSIA 3LPTA 2F96A 1WSHA 2W9AA 1RBTA 1UOCA 4M3YA 4E7HA 2IDOA 2Z1JA 1IKVB 3EPIA 1S1TA 3PW0A 3ITHA 2KZZA 5DLFA 1LWCA 3IS9B 4J9LA 3RRHA 4MIAA 1NKBA 1TKZB 2W9CA 4CF8A 3I0RB 3AVKA 4NYNA 4MIBA 4Z4FA 2R8IA 2OPQA 5KFFA 2X78A 4I2PB 1FXXA 2DTUA 4FBTA 1KRPA 4TYBA 1RTJA 4QPXA 3MXMA 4O44B 4CHPA 3L2WA 2JEJA 4RNMA 2P51A 4E3SA 3TAQA 1U4BA 2RF2B 3MEGB 3ZSQA 1TP7A 2YHBA 4FLWA 1EP4A 2FBVA 4IFVB 3F9KA 4LSNA 1U48A 4NLQA 3ZT2A 3OYDA 1VRTB 1UAXA 1S9GA 5CZ2A 5KG1A 1JLAA 3OVNA 1KHVA 1C0UA 4O3OA 3PO4A 4NLDA 4WYWA 3KLEB 2ALZA 3MEEA 4ED0A 3KTQA 4FVMA 3ZCMA 4M3RA 2C2RA 4FLUA 4CGGA 3SUOA 3SI6A 3HT3A 3G86A 4MK9A 1J5OA 4NLGA 5J1EA 3V6JA 4NLUA 3NF9A 5KT7A 4KHSA 4JUZA 1J54A 5C25A 2XY7A 1HJRA 4DTJA 4H54A 4U6PA 3AO2A 2JEGA 3VQ9A 4KHNA 1VRUB 3DLEB 4RNOA 4R0EA 4KREA 1RDCA 4CJPA 4NLSA 5KFMA 2IBKA 3SPYA 2AU0A 4BDPA 3KLVA 2R2RA 1RT5B 1D1UA 4DQPA 4I2QA 1JXEA 3CJ3A 1X9WA 3NGZA 3CDUA 2C22A 1HNVB 3OS0A 4XPCA 2GC8A 4BWMA 4EBDA 3QGIA 1X9MA 4QAGA 3PY8A 2RN2A 3C6TA 3IG1A 4Z0UA 3KK3B 3HPGA 4KHMA 3MR2A 1JLEA 3NKYA 2RDIA 4CHQA 4FYDA 2IMWP 3DRRB 3HL8A 4FJLA 3ICLA 2OPRB 2R7YA 1TK8A 2OPPA 4CJSA 4QWEA 2HHXA 1HNIB 1LWFA 3OYBA 3NHGA 1GOCA 4GW6A 2HVHA 2VG6A 4DSJA 5KFZA 1C1BA 1KCFA 2WB4A 4NCGA 2IM2A 3GIMA 3KLGB 4Y1DA 3OSPA 4ECUA 3HVAA 4B9UA 5C42A 2G8UA 3MEDB 2XRIA 2VG5B 4J9KA 4WYLA 4DQSA 1YTUA 3KLFB 1SL2A 4CEBA 4CJ5A 4Y2CA 3EZ5A 2X6SA 4HUGA 3NAIA 3CYMA 4DTUA 3DM2A 4B9LA 1IKXA 5CY4A 1S1TB 3PW2A 1N56A 3SV3A 3HXMA 3LP2A 2BE2A 2AQ4A 4W5QA 4RUAA 2QKKA 2UVRA
chains in the Genus database with same CATH superfamily
3ENAA 4YOEA 3DCAA 1K73O 2HFVA 2P2CB 3JB9k 4G1IA 2CPFA 2UUCF 2ILYA 3FCWA 4ZP9A 4K4UA 1HQEB 1GK8A 5KFUA 2ZH6A 3PW7A 3MR3A 4CZHA 4PHTX 3IRXA 1X0PA 3AAWB 3WX8A 3T9ZA 4H4MA 3PKYA 1HR0J 1WJ9A 2DNKA 3JAMY 5AT1B 2BOPA 1YJ9N 1ATRA 3GJRB 4UY8T 1WDDA 3VQQA 4R5PB 2NZTA 1R0AA 4KH0B 4CGDA 4CBUA 3W65A 4B9TA 1N5QA 3H25A 4CJTA 4FK0A 3OTBA 2VQEK 1PYTA 2OZMA 5CYMA 4PPDA 2VONA 2CQBA 3QJPA 3R7SB 3CCVN 4C3KA 4C9DA 1VRUA 3CD5A 4P2SA 2W8KA 1RABB 3N79A 4G1QB 4YUDA 4OLAA 1GLAG 1HRHA 4CEZA 4OX9F 1RK8A 2HBLA 3W5YA 3AVNA 4EFHA 4JKBA 5THWA 3TAFA 3OR2B 5F9LA 2R7VA 2GMHA 4CZFA 2BH1A 4CK1A 3ADAC 2YNGB 3ONQA 4ZA1A 2KTQA 1S7IA 4FN5A 3AOBA 5KFWA 4WXWA 4GY2B 1DFDA 3CCLS 2J4RA 1YI2N 4PQAA 3HZEA 3PG9A 3G8TA 2XMMA 3CI5A 3UDLA 1W97L 1HJOA 1SUQA 3HHKA 4ID8A 1NK8A 4ERDA 3C6TB 4A61A 2YQ1A 4NXMF 2Z58B 3TTDA 4MO5A 4Z94A 1K0VA 2QLWA 4G9ZA 1CBKA 2IBOA 3TVYA 2HBYB 5ETRA 4FKXA 1ZAWA 2MLYA 4K4TA 3VF4A 2EFGA 3HI0A 1RBRA 5HMWA 3A5NC 5DK5A 1XUPO 1N6QA 2IVOA 1IKYB 2YXLA 1BQNA 2QE5A 3UR3C 1KQGB 4AHVA 3UFCX 2CQ2A 1MN9A 2HNYA 3VMFB 1VSJA 4ISEA 3TO8A 3VQ4A 1GX6A 2E5IA 1B0VA 5GAEU 4DV3F 1XNQJ 3DI6B 4LT6A 4X66F 3GDQA 1KD1O 4JI5K 2J0QD 2Z8QA 3QPIA 4CW7B 3N4QA 1GOBA 3UN5A 2BJEA 1DTTA 2BXJA 5KFXA 3BZCA 2IYIA 1W2BM 3FZLA 5DG8A 3O3LA 5KFEA 2QWNA 1V6HA 4NYOA 3WNHA 3U1MA 1K47A 3ISZA 2W40A 2MKHA 3UNGC 1QVFM 3NG8A 4Z2XA 4USTA 3EKUA 1YUWA 4FM2A 4M8LA 2ROEA 4NXNJ 2YNIA 3CERA 2FVSA 2Q31A 2VBYA 2B7BB 4J9MA 4WU3A 4CI6A 3M8QA 3RYLA 3CCES 2DHHA 3OA9A 4N76A 4BC7A 3MFIA 4GVMA 2RKIA 1F60B 2E6MA 1KVIA 4KGKA 3G8QA 3A0IX 3PNIA 4CGFA 2V9WA 1TV6B 3CJSA 5L9XA 5FD1A 1YBTA 4F9OA 4YR0A 3HHLB 4BRKA 2ZE2A 5TKWA 1KC8O 1WBBA 2V5HG 5AQOA 3NE6A 1IKVA 4LFCJ 2DNRA 1P8ZA 3TTFA 3T1YF 4ANDA 3RMAA 3MN6A 2ZBCA 4QJVA 1RTZA 1SPBP 2U2FA 2EK6A 5K8PA 3KUGA 3CJ5A 1BWFO 3FZ2A 4K7QA 1NM2A 3K89A 1WSIA 2XYPB 4NLRA 4FW2A 4OX6A 2ILZA 2FLPA 2ZF5O 3GSDA 5AZJA 2YH0A 5M1QA 3HYFA 1RJJA 4BWJA 4RW8A 1GMWD 4YY3F 2Y8WA 4B3SK 3MAQA 1WI6A 5I3PA 1FRIA 3CCUS 4Y34A 4JYAK 2R8KA 4CYUA 2X7IA 4FL9A 5A2QO 1VI7A 1RWKB 3RJMB 4DL6A 4CK3A 4RW7B 1TUUA 1HNZK 2QA4S 2VQFJ 2C3PA 3F41A 2UUCJ 3ZTSA 1N32F 1C1BB 4WWSA 3OLBA 6FD1A 5D4LA 3JS9A 2PMZD 4DS4A 3WNFA 3GJTB 2CADA 2B6AB 4WP9A 1FKOB 4K4VA 2UVWA 5EDWA 1CULA 4JI6F 1Q81O 3KMSA 3TPQA 1JNZB 3KG4A 4FXDA 1JQGA 4AXJA 2YNHA 1OPIA 5DDOC 2MKCA 3THVA 4DF8A 2IA6A 1JLBA 1UA1A 2JWKA 3H98A 4RW4A 2JFKA 3JYTA 1EZZB 4CHNA 3KLHB 4WK1A 3W64A 3F9MA 2QKBA 4CF0A 1JLFA 2VB6A 5D3GB 1RBOB 1EQYA 3LM9A 3NY0A 2KQ2A 1N5TA 1EX4A 4OYBA 3G8SA 3C6AA 5HSPA 1KDNA 4PXCA 5HQLA 4NOHA 4ECSA 4CZKA 2WAQD 4B9MA 1KXPA 4BRCA 3VERA 3JSMB 1FO1A 4DR5J 3O80A 2VGNA 4JAXA 2AGPA 5ETMA 3UR0A 4QWBA 2HVEA 4HACB 2I6WA 2YPYA 2ZH9A 1UETA 3JQJA 4ZVQB 4QIEA 2G8WA 1NGFA 5J1EB 4ELTA 1LW2B 4DKWA 3PX4A 2R7SA 3QAEA 4BQZA 5BR9A 3LAMA 2JC0A 4CVNE 2XHCA 3AVLA 1S1UA 2ZJPL 5HLFB 3KHLA 2IJNA 4CHZA 4PEOA 3BEXA 3KG1A 2KL8A 1XC3A 3UVJA 1WEXA 1YJTA 1VSMA 2FJAB 1CQMA 4DV2K 1OIAA 4H5RA 4DL5A 2HHVA 3H2LA 4WFAL 1FDBA 2ZDPA 4A8FA 1OH5A 4QBUA 2DNMA 1YVUA 2A18A 4BRQA 1Y10A 1BXNA 2IVNA 4JI2F 1WAJA 2PO4A 1NZAA 4JHDA 3MMCB 4IH5A 3U1NA 4ED6A 3TNVA 4A5BA 1X7VA 2Y1JA 3QT6A 2RS8A 1HARA 2R7WA 1SIZA 2RQ4A 2Q97A 3CMAN 5DETA 2CJKA 1WB9A 3TAPA 5IV4A 2AYEA 3C7NA 1FE0A 3BO4A 1FKPA 4OPAA 3AO5A 5IWAJ 4CJ7A 1RT6B 4ED3A 2C2DA 2V4QA 2V8HA 4WQ5C 4EWTA 3BBFA 5GADU 1MMNA 1SC4B 1NDCA 4IDKB 1REGX 1FEEA 5JJBA 1HNXK 2D4WA 4O8UA 3VPZA 4M63C 4DCHA 5I3UA 3ZTQA 2XG8A 4ED2A 3T1HF 4FWOA 2DCUB 2KDOA 1DY3A 4Y00A 1NBEB 2C2ZB 4CLYA 3A3PB 1ILYA 4O5FA 2VDHA 4DZDA 2SXLA 2FD2A 4FWLA 5GVQA 2BOAA 1X9SA 4P74A 4H5NA 2Y9HA 4EYIB 4AE5A 3D7SB 4DDFA 2YNIB 3A8JA 2RQCA 1RT5A 1N4LA 2OH2A 4Q44A 3RRKA 1NPRA 4F4ZA 4Y2KA 4BGBA 1IBCB 4G6VB 4DX7A 2XWXA 2V8GA 5B7WA 1HI0P 3DYAB 1IM4A 4KFBA 2HYIB 2WBRA 3BSOA 2QWPA 4K8XA 5RUBA 1IBLJ 5CYMB 3T41A 3VESA 2DR6A 5CD4A 1KD1T 1R3NA 1S1WB 3DOLA 3N4PA 1GLBG 1GH8A 2YKMA 3GCXP 4M5KA 4WF9Q 3SK3A 3LGNA 3NBPA 2V7YA 1P9YA 3R3LA 2F7TA 4ZIWA 1WWHA 3OL8A 3VF6A 2YKMB 3O3HA 5IWAK 1TFYA 2G1HA 3CF5Q 5KGXA 2ZNYA 3RR7A 2O67A 3KUHA 2HBJA 4CERA 1GXLA 3VCDA 3H0PA 5CYQB 4ZVEA 4KC5A 4QWDA 4M5DB 2HHTA 1DZ5A 1L3KA 2YQ3A 4YOXA 2CQGA 3J81j 2HBMA 4ZVSB 3IR7B 3BYPA 3EXCX 3AVFA 1XR7A 4C4WA 2HNYB 4D3GA 1GMWA 3MMBA 3Q22A 4DTOA 2GV9A 4DR4J 1FFSB 2GVDB 1NKCA 2NPFA 2KRRA 4N7TA 1AFIA 5LY3A 2CQHA 1M1GA 1RDBA 1SJQA 3GONA 1I94F 1YF5L 3V81B 4JV0A 4YNQA 4OX8A 3OTOJ 3LM2A 3TAEA 3L95X 5LJ5Y 3QIPA 2V50A 4RKUC 4BC2A 4GV6A 2IC3B 4NLYA 4YOYA 3HOSA 4M3TA 1KVBA 5F8MA 3ZSWA 5BYRA 1FVQA 3KJFB 4DI6A 2MQQA 1LW0A 2WZ1A 4LFBK 3MTKA 5D0HA 1YJWS 4YDUA 1VBZA 2ZBQA 5A0YB 5CXTA 5CAAA 4EAHD 2D9PA 1RAJA 3QICA 3F73A 3M6GA 3B8AX 2GMLA 1VQ8N 2ZOFA 4BC5A 4PXEA 5LL6d 4K5SA 3GWCA 2IMOA 2UXCJ 1UTAA 1XNQF 1U1QA 3KWMA 3K17A 1FNOA 4RO0A 3ENOA 5T7BA 3JTOA 3M30A 1FA0A 5L1JA 2OEKA 4WQ4C 1WSFA 5KFCA 3BSCA 2KJVA 2VDIA 2UUCK 1KFDA 2WB1D 1S72N 2FHJA 5AE2A 5ETNA 1GLJO 2L9DA 4OX7A 2OFHX 3R1LA 4R8UB 4XTTA 2P9CA 4ELUA 3PACA 1G7CB 1CJVA 1WF0A 1PJ7A 1RHQB 2ADBA 2NRVA 2G9OA 1CLQA 3CCWA 1YX2A 2B8QA 2VGMA 4DEZA 5IFMA 3PRBA 4JKDA 2BABA 4ECTA 1D9DA 2BDPA 3JSMA 1NKEA 3H40A 3KLFA 1BQNB 1C0TA 4O4RA 3NS5A 4CLPA 2D9OA 1S0MA 4A57A 4IFYA 1A6LA 1OS5A 1V3SA 2W2QP 3EZUA 2MQLA 3HDSA 4MO4A 3NF8A 1WUAA 1U47A 2OELA 2ALYB 2DGVA 4PWUA 3QNNA 3ENWA 2GW8A 4YB7A 5A6PA 3A3NB 3C6UA 4CO3A 4HTIA 2YNFB 2ASPA 3M8ZA 2KKZA 2BYCA 2ZZMA 1IBMK 4CDIA 5KFNA 1V9OA 2VCPA 2AWZA 4NA3A 1S77D 5DQGA 3LWLA 5HROA 3D6HB 1BY9A 3JTPA 4DHYA 1RAEB 2QMXA 4FNIA 1XMOJ 4EIAA 3Q2SC 1RGVA 3W63A 3BDPA 3TYTA 4B1ZA 1GXTA 2ZC3A 3V6DA 1VQ7S 4LFBF 4DR1K 4A47A 1FRJA 3BQ2A 4LRCA 4U95A 2ROPA 3LP1A 3VEZA 1AROP 4B3OB 4JI8K 1T44A 1QTNB 2HNZB 2QA2A 3HTVA 2YWFA 1KQSR 5AXNA 4C0HA 3GV8B 2WCXA 2AJ2A 1HD0A 5C2CA 4KBOA 1WNSA 4ED8A 3SQ4A 5HQMA 4RG8A 5E3QA 3CDWA 2ZUAA 1KVKA 4O4GB 2K3KA 3H5SA 5H1SQ 1VQ4S 4FCYA 1QZ6A 1NHUA 1HQUA 3ZX3A 1VSKA 1PBUA 3VGVA 3IXQA 3OYCA 3BN7A 1WELA 3FC9A 3CFRA 2V51B 3UPFA 1KLMA 1M1HA 4OO1J 2LMIA 2ZWOA 1JLGB 2F9WA 3AVCA 3PM9A 1DKGD 3NEKA 1U7LA 3MHYA 3KXDA 3UIQA 2DNYA 2VWKA 4A2BA 2CPJA 4IOAQ 4IFEA 2UUBK 3WXIA 4OZ1A 5DS7A 1NGAA 3DGVA 5K9FA 3U1LA 1WHXA 1QUVA 4OZJA 4L8RB 4I6AA 2VUGA 4TVAB 3ILLA 2IYGA 4OZLA 2VBZA 3EVMA 4IDHA 2F9TA 3MTJA 3OJUA 4M45A 3TTCA 3QERA 2GQCA 2HVZA 1A0OB 1NPKA 2LXUA 4DBQA 3OYEA 5F9NA 3QNOA 4YOTA 4HTUA 5KGWA 3Q83A 4DR7J 3KK1B 2QN6B 3SUQA 3ZNUA 1PAEX 1W7AA 3QSIA 2H1YA 4M5IA 1K44A 4IG0A 1TR0A 3T3FA 2V69A 2H3EB 3PHEA 2ZOMA 2O4IA 3HULA 1UZHA 2DGTA 4CO2A 1TYQA 1Q81T 1EHWA 4ALZA 4C8OA 4GVEA 3MGJA 3QEWA 1CS4A 4ZCMA 1FDNA 2HWIA 3THWA 1U6ZA 5KFTA 1Q86O 2ASYA 1F9EB 2QM1A 5K8OA 2DXDA 3MURP 1AZSB 1UW4A 1IBKK 3TARA 1HBUA 5KG5A 3O1WA 4YFUA 2PFFB 1Q7YT 2NLXA 5M1NA 2KW4A 3FSYA 3FRZA 2HOEA 4C1NI 4HUFA 3I5BA 3LDSA 1UZDA 4Q7AA 2B4JA 4I2QB 4GO5X 2XWYA 1QD1A 2O8FB 2DFHA 3HSCA 2CJAA 1LOTB 3CPEA 4Y0FA 2GVDA 3H90A 3ATVA 1HBMB 3HBTA 4IJNA 2DNGA 2L3MA 2XTJP 1EKEA 3BO2A 1VQPS 3HT0A 2CA9A 4FLVA 3KYLA 2LQ9A 2E2OA 2XBPA 3AY0A 2OPPB 4ECYA 5KOWA 1WOSA 3QJJA 2CQPA 5EHHA 3VEXA 3HD1A 4Q0BA 3L3VA 4HR2A 4I6WA 1UA0A 3TWHA 3CCSS 3EWGA 5GAEP 3NVKA 3FCHA 3RVCA 2RRBA 3OJSA 5ETSA 2I2YA 4B17A 1YIJN 4CECA 2G0CA 1R0CB 4L74A 5IXUA 4ER8A 1VAZA 1F3FA 4DX6A 1FXLA 4I6MB 3WEEB 3KLIB 4KGMA 2BJ7A 1DT9A 4FBUA 4J90A 3QESA 4ZTFA 3AO1A 4JN4A 1HMVA 4X4VA 2N3LA 2J9DA 2FHJD 2YNGA 3LANA 1HNZF 1NGJA 4DWIA 2LKZA 2MY8A 1SJ3P 1A5WA 2Q2RA 1VR6A 1ZYQA 5AQYA 4NRTA 3EE8A 5AXLA 4PCQA 1K73T 4CO4A 1HPZA 1BL3A 2GIRA 2HHQA 3BKUA 2OI2A 2KZMA 2I1RA 1WLJA 1O51A 4AQYF 3HP9A 5D4PA 5EGYA 4QS8A 3J7AP 3NOCA 1M5HA 4C3MA 4WFYA 4NXMJ 3PX6A 4MKYA 2HMPA 4GKJJ 1MWQA 2EG1A 2XZDB 1IVZA 3N0VA 1LOUA 5CZXA 4QYZJ 4DF4A 2AYBA 1D0EA 3K8VA 2P9UB 2ZM6K 1URRA 3D1HA 1YJUA 4KT0C 4JI8F 3JSBA 4Z37A 4W5OA 2WBNA 5AQWA 1QQOA 2R8GA 3W66A 2HVIA 4RBUA 4ZCKA 3HHEA 5CYJA 4HYKA 4JKGA 3I9V9 2ZH7A 4IFVA 5AQIA 5M2UA 2WOMB 5HRRA 1TTHB 3UDEA 3AVAA 3RBDA 2RPIA 1S6QB 3BBCA 3RRGA 3J7ZT 1TMJA 5JMNA 2Q1NA 3VR1A 2HIQA 4RUBA 3NS7B 4ETZA 5ADZA 4RTFD 5M1PA 3VEWA 4JV5K 1G15A 3V81A 4TY9A 1BGXT 2ZBIA 5IT4A 3IBFB 1GAOA 5E3PA 4BACA 3HCXA 4H4OB 4WZMA 1X4HA 2RHKA 3G9CA 4FPBA 2FZGB 3N4WA 4DV2J 5SWMA 3B6BA 1GQEA 2OP5A 4AF1A 1ULRA 4J37A 1HNWF 4FWKA 1AFJA 4EZ6A 3CJ4A 2B56A 3NH0A 1YRXA 4FM1A 3VQ8A 4NMLA 3M2UB 1VMBA 1SB6A 3R6GB 4P2MA 4QQBA 2EPIA 3HPHA 2CKWA 1NK6A 3G6EN 3FMBA 4AH9A 4NB4A 1HQUB 4DL4A 3HSZA 3C14A 3NNHA 3P3DA 3X3UA 4JBCA 1Y5IB 5AR0A 1LWEA 3J7Z5 2E5LF 4KB0A 4BQLA 1H0HB 4LF1A 4H8KA 1SS6A 1TQLA 4MDBA 4PUOA 2G8KA 2XC9A 2DVIA 3V2UC 4JI3K 1NK0A 4Y65A 1CC7A 4F2SA 4FF1A 3G6YA 3CC4S 4IH7A 4J2EA 4QIGA 3CCQN 2IAJA 1IKYA 5KFDA 3TX8A 4FJ5A 3AAQA 3V6KA 4I1TA 1WOOA 3ZLJA 1C1CA 4IWVA 2HRYA 2AKWB 4KGXB 3I96A 1NK5A 3OTOK 4BRGA 1FWPA 1RBAA 3N01A 1UWAA 1JLCB 3W3SA 1TAUA 2OTJN 1JJ2M 4O0IA 1VQMN 1CJUB 2VC0A 1CC8A 3D2FB 2V8PA 5BRDA 2EBEA 3H08A 4B3OA 3KHGA 1M0SA 3UCZP 1SL1A 3O8WA 4L6V3 3C95A 2AIRB 3W7BA 1MA9B 2WVEA 5HK4A 1YKWA 2XO6A 3QINA 2ITMA 1JXBA 4O4GA 4YHHJ 5F8NA 4PG6A 2K1RB 3C16A 1KSPA 2O66A 2FBXA 4LRDA 4JI5F 4X66K 3V6DB 3M6WA 1U2VA 4KBIA 3IGVA 2AA4A 4ZVOB 2DRAA 2VKRA 4KE5A 2FF3B 4JI3F 4BRAA 2IY5B 4ZTJA 1FWKA 1BE4A 4Y28C 4B9QA 4WQ4A 4OHXA 4H4KA 2VG7B 5IQ6A 4B1UB 3ISNC 1KBRA 3C15A 5M1KA 3I56S 2F8TA 2AX1A 4CTAB 1IBKJ 1N34K 2I0XA 4ILLA 2GUIA 3DU6A 2BKNA 4QWCA 4F0MA 4RW8B 3CJKB 1U1OA 1WSVA 1MROB 2O1PA 2XQCA 2BBEA 4O23A 2E5JA 1BD6A 1TK5A 3HX9A 3VENA 5HLFA 2QJ3A 5I9EB 5EWFA 5HRSA 2P9KB 1HWUA 1Y00A 3R5GA 2Q3PA 4OPJA 1X9JA 4FZYA 3L2RA 2KLAA 1RBLA 4ED5A 2FVPA 4DR5K 4KPCA 2CRLA 3SDEB 4W98A 1MLAA 3SQGB 4ZCIA 3BPSP 4NWBA 5MLCQ 3OR2A 3CVKA 5FLXO 3FSIA 4DV6F 3LPTA 1F5AA 3R9LA 3HM8A 1RBTA 1UOCA 4M3YA 1VQYA 1SQEA 3MMCA 1N52B 3EPIA 1QAXA 1WSRA 1U0SA 2E1MC 2AJFE 1VQNN 4JNEA 2KZZA 4LF9J 3D2FA 3RRHA 3DDNA 1TKZB 4B02A 2KVIA 4DV1K 3QGPA 3CPWM 4XDCA 1LEOA 4CZLA 1WC3A 5KFFA 2X78A 2ZITA 1KRPA 1VQSA 1NU0A 3ZZRA 1C0FA 4CHPA 2JEJA 2OTLN 2P9EA 3TAQA 1U4BA 1PIEA 1TP7A 1EP4A 3F9KA 2A2CA 2CG8A 4RBTA 1MW7A 3MPDA 3NCPA 3OYDA 2D69A 2H51B 5CZ2A 5B0BA 3OVNA 1KHVA 4O3OA 1ZPWX 3PO4A 4WYWA 2ZFHA 3VGKA 3IWNC 4E2FB 4A8KA 1T3OA 1CS4B 5GAHI 3TW0A 4KH6A 1RHMB 3RZAA 2C2RA 3CCZA 2WFBA 5C2FA 3RW7A 3HT3A 3G86A 1J5OA 3V6JA 4NLUA 5KT7A 2ZUGA 4JUZA 5C25A 2XY7A 2C2MB 1RAAB 3RUBL 1TUVA 1CEZA 2JEGA 4KHNA 3NNAA 3DLEB 5A8KA 1XQSC 1F5BA 2BTFA 4KREA 4X84A 3SPYA 2AU0A 4BDPA 1VC5A 2VV5A 1D1UA 1RT5B 3K5PA 2OSRA 3CJ3A 3ENBA 4CZCA 2L9NA 2C22A 2O8BB 1XQIA 3PEJA 3OS0A 4XPCA 2WW4A 4PL8A 4EBDA 3QGIA 1X9MA 5FLXU 4QAGA 2MKJA 2QTDA 2IA0A 3L4QA 2ZH4A 2RN2A 3NXZA 4ILJA 1JLEA 1Q78A 3MM8B 2NRZA 2MPUA 4X62J 2IMWP 3HL8A 1RAIB 2OPRB 4F4AA 1HQ2A 3LA0A 4CJSA 1M5VC 1LWFA 1OH6A 2B4UA 4KGVB 4K2JA 4WTYA 1N8RO 1H3DA 2I7PA 4LF6K 1E3MA 5KFZA 1KCFA 2XLJA 2HK3A 3GIMA 1U1LA 2IIHA 4Y1DA 2R7OA 3WQTA 1AW0A 1RKIA 4OHVA 4ZLPA 4KR0B 1SL2A 4FKYA 4DU8A 4CJ5A 1Z05A 3J7YU 1WC0A 3M2UA 2OEMA 3NAIA 2W4PA 2E7WA 3DGPA 2ZWHA 4LF8F 2BE2A 4EHTA 3Q24A 1U04A 2RQMA 4LJMA 2OJ3A 3VGUA 3ZT4A 1SAZA 4PWDA 3HVTA 1LFWA 3OXFA 3MUVP 2DO0A 1RBSA 3P45B 4F50A 4M95A 4H4MB 2WOMA 3DRPA 4LF4K 4AHUA 3QLHB 5DQHA 4YEAA 3S3OA 3IAS9 4OZ5A 4JKGB 3ET6A 3I5CA 5EU7A 3PHTA 3CJ2A 3N5FA 5A6WA 3S8SA 5I3UB 3MUMP 1VLYA 5LMUK 1SH2A 4FZXC 1GOAA 5A8KB 1H2TZ 1E4FT 3C46A 2A1RA 1NJZA 3LPEA 3D66A 2CJQA 3LGMA 1YVFA 1JLCA 4E0DA 5B0FA 2MZQA 2EHGA 4Q43A 5KG6A 4OI6A 4DR5F 1FFWB 4KTQA 3DLGA 4EHUA 4JYAF 2UUBF 4DL2A 4OMFG 1VBYA 2YHXA 3G4SS 4ZVTB 1OQ6A 2GHWA 2QSFA 4C8KA 4CJ3A 3CCJS 2IHR1 3VAMA 1PCAA 1UEVA 2MDAA 2E1CA 4JI1K 3ZC4A 3I8DA 4EK2A 5C24B 1S1VA 3BKFA 3WXMB 5LMUJ 3PXGa 1APSA 1I51B 3OW2R 2K1RA 3C16B 3KOAA 4A62A 2R8JA 1QSSA 5AQMA 3V4IA 1E6YA 4DU1A 4C2MA 1Q7LB 1BA0A 4CJRA 3NBPB 4UUWA 5KFSA 1T9YA 1WEYA 2ASLA 2XS5A 1BI4A 3PDNA 2I7NA 1VSDA 2KM8C 2LQJA 2HQ3A 2DISA 5SZTA 2WVCA 3MECB 3IG1B 3QRQA 3GSIA 1Z25A 3TEGA 4QCLA 2GTDA 2UXDK 3WQUA 3J7YI 4DV5K 5GMEA 3W61A 3CCMN 1RDRA 3DKDA 1S1XB 3CIZA 4FWQA 1I1GA 1IQTA 5JUMA 1NAQA 3FBBA 3SSQA 3Q86A 1Q4RA 1OH7A 2DH8A 3CCEN 5K8NA 1J27A 2ZQBA 4IRCA 1P90A 4IO9L 1REVB 5L9NA 4BRIA 1HI8A 4IOCL 3DRSA 1HNXF 2VPWB 3LP1B 2CVEA 1G6BA 2A6MA 2J8SA 3ULHA 3VV2B 3PW5A 1RISA 3DHXA 4O3SA 1I6JA 4LF6F 5H1SV 5KPRA 3CJ8A 2RQKA 4I68A 2YX4A 3QGGA 3CQYA 3MCNA 1RCHA 1HFEL 2FC9A 1RT1B 4Z4HA 1JLBB 2R7XA 3S1TA 1S0VA 4JD2B 4CZIA 3GPAA 4FLYA 3LF0A 3MF5A 3PIPQ 4K59A 4IJAA 4U7BA 2KYZA 3I0RA 3H5UA 4P2XA 4KHPJ 2JWNA 2P9GA 3CD7A 5D3GA 3VEOA 3F44A 3CIPA 5T14A 4TN2A 2FDNA 4X66J 2BANA 4OI2A 1HX1A 2C28A 3IMQJ 1FF2A 1H98A 2CQ1A 3TZYA 2XYGB 3V9ZA 4RW9B 2Y3YA 1U6FA 1SCJB 2E9ZA 3DRRA 4CZJA 2HKEA 4ID1A 2LLZA 4OLOA 1YVNA 4HHUA 4AL6A 1IWAA 4IRDA 1X5OA 4ECZA 2C3OA 3IRWP 3CPWR 4JK8A 1R27B 1RA6A 2R8HA 4FZVA 3CC2N 1X3NA 2FJBB 2A40A 4B9SA 3HJFA 2V63A 1RBVA 3WNGA 3Q8SB 1YAGA 1KFSA 4X4TA 5CA5A 3ZETB 4DUYK 3MR7A 4FZZA 4H0YB 3T5JA 4M5HA 3B82A 2EFOA 4RNFA 5HP1B 1ZA2B 3TA1A 4A8WA 2NCKL 3HKZD 4LVOP 2HSTA 1T05A 4CIOA 5C42B 2XLIA 2RMLA 3HSJA 3VALA 3EN9A 1XNQK 5LMNK 1HLUA 3BF4A 3EL2A 2J7WA 3B6PA 3SMZA 2EWHA 4DU3A 3FKBA 3QFWA 3CO9A 3DWLA 3ZEUA 4QW9A 1X5SA 2IPOB 3CEDA 5DG9A 4DTSA 2ZJPQ 2VHGA 4IUFA 3MXJA 1CJUA 1NLKL 3TUZC 2BMBA 1PILA 4TY8A 5F3TA 1ZA1B 2FIUA 4FWMA 1WG5A 6FDRA 3DGPB 3VAKA 4IG0B 3EGNA 2FY1A 4Z4GA 3T6BA 4CH0S 3ID6A 4IG3A 3O6QA 3QBWA 4HHJA 3TUIC 4CJWA 3UWTA 1QQMA 3TOQA 4ZPTR 4DN0A 4HTLA 2M5YA 2DFFA 1NNDA 2DXFA 5HMZA 3DXMB 3POTB 3RAXA 1S9GB 3JSYA 3FZMA 3ULEA 4RW6A 3MMBB 3AJ1A 2BE7D 3S01A 1YGYA 1LKZA 3AODA 3A8KA 3L7PA 2YH1A 4FWNA 2VBWA 4WCEQ 3Q7BA 2UXCF 2DR5A 5J2QB 4ZLNA 3MEGA 3SFUA 3QFUA 4B3SF 1IXKA 1WF2A 4KV8B 5AQSA 4GKKK 4YR2A 1VQ6S 2DHSA 3DJCA 3W9HA 3PX0A 9RUBA 5A8WA 1U49A 4FJHA 5IWAF 2E9TA 4Z7CA 5KAKA 4FF4A 2DNLA 4J9NA 3KUEA 3TR5A 1H7WA 1Q95G 2HHHF 2W4DA 4CFCA 1R43A 2DR8A 4YS2A 3MR6A 3P6YC 5AQUA 3FJ2A 2OYQA 2RSQA 2BJDA 3UVJB 2Q6CA 1O13A 1SV5A 1PG5B 5IZHA 3SLCA 3H3OB 4E8UA 4QS7A 2FLLA 5KG4A 4DN9A 5EX0A 3RMBA 3OHAA 4N41A 4J9PA 3SMPA 3TEHB 3J7ZO 2BJ1A 2MXYA 4OGEA 3FEYB 4FDFA 2PI4A 3IBCB 2EVZA 1VSLA 1Y3JA 4GC6A 4CO1A 2HFSA 1FX2A 3TSQA 3VN5A 2KFNA 4AM7A 3O2IA 1HKGA 1TELA 1TL5A 1VSEA 2E4LA 1P1LA 2CPXA 3PYFA 2NYIA 4LFAJ 5KFKA 2XMTA 1JNRB 3SZ2A 3MZIA 2E29A 3MM6B 2WVDA 1HPZB 4HWIA 3SIPB 4UW2A 1TL1A 3WBZA 4U8YA 4ZN1A 3LP3A 1F21A 4CRJA 5JVGQ 4DV6K 1N32J 1PSDA 4ENOA 4USJC 2E5GA 1QM9A 3VQ7A 3PIOL 4ZJLA 3BGRB 2ZJRQ 2MLZA 5B0DA 2WHOA 1N36F 5BR8J 2G2YA 1Y3KA 2V52B 1BWVA 2J9DE 3MCSA 2H3GX 5BYSA 1HYZA 3GOIA 4KO0A 2MJUA 3FQLA 4DU7A 2CIMA 4F3OA 4KV8A 2MQNA 3HMJG 3IUCA 1KVJA 1U45A 5T41A 1B9DA 1RTIB 3FGVA 2BEFA 2RB7A 3UCGA 3PJXA 4PR6A 1TGOA 4TKTA 3ZX2A 2IDLA 2V4RA 2HLUA 3WXJA 4AILC 4KSEB 4Q45A 3FFIB 5KFLA 1NSAA 3TVZA 2Z1GA 3ET6B 2QV6A 4DPOA 3L3CA 4TSXA 2OD6A 1AUDA 1YJNS 2HAIA 2KG0A 4I6MA 3WEEA 5J2MA 1WEZA 5IM0B 2W01A 1Q82O 3FRYA 5KT6A 4TU8A 2C3UA 1TMMA 4UOCA 3PFOA 2O8DA 1O1WA 4OJ3A 1T3NA 4PKGA 3RB0A 5ETKA 2ZEJA 4CJEA 2QA4G 1ZM2A 4J9SA 1M90O 2RH3A 5ETQA 1S9EB 3D4JA 1W26A 3DLHA 5F1XA 1BHLA 3WZ0A 2Q6BA 4CLFA 3CETA 3RU0A 1G2EA 4E7LA 3BPDA 4KI4A 1FRMA 4WFXA 3CQXA 2E5HA 1VLOA 4LY7A 5HL7L 4P52A 4H0PA 4X4UA 3R1HA 3NH1A 3FBEA 1MN7A 2G2OA 3BY5A 3U6FA 4OZNA 2NXJA 5ETPA 1WUUA 1FXRA 4JI7J 1E4GT 2K8GA 3B8HA 3BH7B 5AQGA 2ZVSA 2VASA 1A5XA 2EFNA 1S3XA 2ERRA 2CQ0A 4WE1A 4J2DA 1FNXH 5LT5A 4QR2A 3G87A 2XSFA 1Q8BA 3LTOA 2IAJB 1X0FA 3CJTA 3NMUA 2A6OA 2KB2A 4V19J 5BRFA 2GWJA 3UDCA 1AA1B 3V5RA 5KPTA 3CSKA 1NXIA 3ILIA 1YSJA 2NUHA 4N5SA 4CLZA 1MWZA 3S6EA 3DM2B 3TU5A 3C6UB 4WKRA 3OR1A 5CQGA 2CPEA 4ZCLA 3H4DA 4L76A 3K58A 1G3OA 5KPZA 5A2QY 2AD9A 3AARA 4CEAA 4NA2A 5GAHP 4ETXA 2B0GA 1FJGF 4YP3A 5I42B 4TNOA 3U27A 3ISND 4UUXA 2MSTA 4M3ZA 4U67Q 3NNCA 2WRMA 3C2PA 2CZ4A 5KTQA 1DRZA 2X3GA 1NMEB 2VG7A 3J81U 2LSNA 3T6JA 4C7QA 1T7PA 3V9SA 4IZ9A 4KHRA 5LMNJ 2H5EA 2OANA 2QA4N 4CJVA 2HAFA 4MLHA 4G65A 1Y97A 4IQMA 4DL0C 4HUEA 5HBMB 2JLGA 4CM0A 3UE5A 3VTHA 3SEOA 3BREA 4JI4K 4JI2K 2GGPA 4JI6J 2FJDB 2W7AA 3SBMA 2J0WA 4FVUA 3OHBA 4Q5VA 4ZJOA 3HPOA 1DQ8A 4RBVA 1JX4A 3VGMA 2RU9A 4QWAA 1HD1A 2Z2ZA 1AXQA 2R7TA 1N5YB 4JS5A 4MKAA 4ED4A 2XSJA 2OZSA 3DNCA 3HSDA 3OUYA 3SUNA 3H2VE 3PIOQ 3EGVA 3V1RA 1KLNA 4DZ6A 2B4PA 3CCTA 1SKWA 3GIJA 4LR9A 5KFJA 1B3TA 4K4XA 2ZKUA 4AQYK 2LEBA 1FFGB 2YX7A 3K5LA 4KKOB 3L6QA 4PG5A 4HLBA 2PYLA 2ETJA 1HNWJ 3PSIA 3VOVA 1WBDA 3JXOA 3QIDA 4DV1J 2ZD1B 2XEXA 1GLFO 2FVCA 3ZTPA 1N33J 3EE3A 3H20A 4P9SA 3GCWP 3Q8VA 2KFZA 2BGGA 5FDLA 2L08A 4OZ2A 5KFGA 3KJVB 3IO1A 1H74A 3N28A 3JXUA 4P71A 4FPAA 3KHRA 1F2HA 2HGMA 3BQ0A 2E6LA 2FBTA 1YBAA 1OSDA 5ADXH 1EJ7L 2WONB 2OCEA 2MYFA 4C48A 1RT6A 1NGHA 3P31A 3UE2A 4C0OC 4DR2F 2NYHA 1CJTA 3EDRB 3OT9A 4ZIVA 5KFIA 2D0BA 2CXEA 4R5PA 4M41A 2R4FA 3TSPA 2FPHX 3MM9B 1SJRA 4NLXA 2B4VA 4ZVGA 4WZQA 4DUYJ 5IC6B 2YVSA 4BR2A 3JQMA 2A1BA 5JVGL 3U02A 3J80O 2GGPB 1DTQB 3GE1A 4DL7A 4DLEA 2DH7A 4MYTA 5D0EA 4LD0A 1RTIA 2KO1A 3MPYA 4FWRA 3SCLE 1H6KX 2IM0A 1IKWA 3X1LB 1NMNA 2MY7A 3ULEB 1C2PA 2DXEA 2DGSA 2M52A 2KVQE 1V3RA 1VSHA 3HHDA 3ID8A 4CWBA 3K57A 4L3QA 4UOFA 2MZRA 3UKUB 5BRHA 1XWLA 5AJ3K 4HCBA 5DDRC 3DMJA 1S1WA 2XMUA 2J5AA 1FWLA 4CCHA 1Z26A 1RTHB 3VQEA 2DY4A 4NEYA 5KFHA 2RAQA 4OL8A 3E01B 5CH7B 2BUPA 3CCLN 4QIFA 1WKLA 1K8AO 3PIPL 4NLVA 1NU4A 1Q82T 5AQRA 5FPNA 3SSSA 1TKZA 1GX5A 2F4VJ 3AD8C 2PIIA 3HHLD 1LNQA 3MM8A 2V9KA 2V2KA 5J1PA 1TL4A 2YY3A 4XK8C 2VIHA 2DIVA 1ASUA 1UJ4A 2RE1A 3HVTB 2A0FB 2B51A 1F9FA 2B3TB 3C7NB 4AL7A 3S9HA 3H42A 1F9HA 3DDIA 3M3ZA 2MKYA 4M5NA 4JOUA 2KRBA 4J8FA 3PTWA 1KVAA 3QAUA 1ZBHA 4ZP6A 2W42A 2UUWA 1RUSA 2GVZB 4HVJA 1D3WA 4URGA 1OYEA 2V34A 1NOYA 2DPNA 2JNJA 3I32A 2KHDA 2FVQA 3W62A 3IM9A 4K0KF 2FUG9 4O5BA 2OPSA 1MWMA 2HMIA 3TRGA 3MPUB 4MK7A 4WE1B 2FF6A 1NGBA 1DQ9A 3CWJA 1VJQA 1FTRA 4R25A 3NCQA 3E66A 2HMIB 2LYVA 1VRTA 4DFPA 4B3RF 3KK2A 1D9AA 1TL1B 2GCFA 3AO4A 1M5PC 3NL0A 1S6UA 3M5RA 2KHCA 4ZJQA 2F65A 3RB3A 3VTIA 3MAHA 5C25B 4QZVB 1FJEB 3EEQA 4JI7K 3PCOB 3PO5A 4DTXA 2WVBA 1LW0B 3EGZA 3I55S 5L38A 2B7CB 1HHSA 4W4MA 3RAQA 3I82A 1S72S 3VEYA 2FJXA 4ILMA 3KD1E 2KT2A 5FRNA 3UD5A 1HNIA 3HHLA 1Y11A 2ADCA 1GEHA 4DR2K 4DR6K 1RT2A 2J0XA 1EIYB 3NGIA 3CHWA 1T9WA 4KH5A 5IQQA 3W9JA 2QXFA 4Y2IA 1TK0A 5IT9U 5M1FA 1U1RA 4K4YA 3AVIA 1TV6A 1S9EA 3AFGA 3CDAA 2CQCA 3OL7A 5KI6A 3U3YA 4FWSA 2QEXS 5LSOA 3ZZYA 2EC0A 1UMJA 2QFJA 3DXKB 1YQHA 2Q0RA 4ISGA 2CWKA 1UVKA 3FBCA 2RRAA 3EM1A 4ITSA 3DOMB 3K5NA 1Q8LA 4GMJB 4LR8A 4CBWA 3FVYA 2ITGA 5CYQA 3BB5A 1NGCA 3CD6N 1NGGA 1RGIA 4URSA 3OFFA 3ILJA 4CJFA 3O1BA 3TABA 3EVWA 1FVSA 1U2FA 3D2EA 2ZH1A 2QL9B 1C1AA 4LSZB 3JS6A 2KXHA 4YOUA 2BR0A 1N5YA 3P8BB 3CCSN 4F0KA 3DI6A 1WOQA 6AT1B 3UB5A 5HOOA 3M8YA 4BC4A 2VBXA 2W9BB 3KK1A 1QHAA 2F9JA 4OYPA 3OS1A 5KFRA 3RTVA 1J53A 4RW7A 1UKUA 2DGQA 5E26A 1RTJB 1HBOB 4IFYB 3GE9A 2YKPA 1QZ5A 1ZTWA 1S99A 3UKRB 1JIHA 3IAM9 2I5JA 4A8SA 2XS7A 4K8ZA 2HNDB 2KFYA 4QIVA 1T02A 4NYFA 3V9XA 3J7YP 2BANB 3OW2M 3QEPA 3BZQA 3IGNA 3OBIA 4BRNA 4KY3A 5C5JA 2HB5A 1CJTB 3K9KA 3UI3A 1S10A 1N33K 1NEEA 2NS1B 3VQ6A 4OKEA 2C2OB 3SAFA 1IV0A 1RT3A 5LSRA 2IRUA 1QUPA 2RJZA 4OZ0A 4FYWB 5E0OA 3M30B 1FRKA 1Q53A 3QB0A 1YT3A 3E9PA 4QOTA 2M3DA 2UU9J 1RTDB 3OL6A 2MQPA 5L8RC 2XMWA 1HWKA 4EZ9A 2BQUA 4HTJA 2UUBJ 1S5JA 3SV4A 2LQ5A 4KJIA 1FD8A 1JLGA 2E7VA 4TXSA 4DSKA 1NWKA 1VQOS 2ZH3A 2X1FA 5CR4A 4A8XA 1M1KT 4PXBA 4W5NA 4B3MJ 4P2FA 4DUZK 4C8YA 1ZM9A 4OV1A 2LDIA 2GV1A 1JXLA 3P49B 1XHXA 1RCOB 4I4BA 3H45C 3TZXA 3IBWA 1RAGB 1HW8A 3AA4A 4E7KA 4DR3K 4XPEA 4LH4A 2ASJA 2P5VA 2LDYA 3V9UA 1X4GA 4DHVA 1KQKA 3EE9A 2K2PA 2ROGA 2ASDA 1WG1A 3LQVA 5J1NA 5G0RA 1Z2ZA 1OH8A 5G4DA 1RT4B 1NG9A 1RYRA 3VAIA 3QYYA 1PC4A 1W25A 2MHNA 3LDNA 1YJRA 1LQ9A 2ASMA 3HZ6A 3QATA 2N7CA 1CJKB 2HFNA 2ZJQQ 3CCQS 3O08A 4HHHA 4WPAA 1LWFB 2V2ZA 2F63A 4YHHK 3VF2A 3CW2C 4OYMA 1TYQB 3L9ZA 3WIUA 3U4LA 2F4FA 4EO6A 4NYZA 2F8MA 2KYXA 2P9NB 3CMAS 4CLWA 2R42A 3GG0A 4UZBA 1SVDA 3HD2A 2PMHA 4BC3A 4JI2J 2EFQA 4G3IA 4KRFA 4ZS6A 1VQ4N 2GUPA 1N48A 1GTHA 3SI8A 3HKWA 3SCIE 3KLHA 4ES1A 1YK9A 2ACMA 2VICA 1PJ5A 2QI2A 3DLKB 2GIFA 1NPPA 3W2WA 3ZX0A 4IOXA 1I3AA 2VPXB 1T11A 2AX0A 2ZOGA 2OPSB 1U09A 4KAIA 1KLMB 4XH4A 4BY9C 4X62F 2ZWPA 3A2FA 4IG3B 4FS2A 1FHTA 2R2UA 3MX5A 1FJGK 3MMVA 3QBXA 1SH0A 2UUAK 3OYNA 3JQKA 5A76A 4JI3J 4DV0F 5K5MA 5LSLA 4USHA 4URQU 2E8AA 1XJWB 4LREA 2HG4A 1RAFB 3B54A 4DR3J 5F41A 1VK3A 3LDQA 3RMCA 5M2RA 3DYAA 3A1YG 4F0HA 3EO3A 1WN7A 2XSJB 1JLQA 1CG2A 2CJXB 3M8PA 1U1MA 3O5BA 4FSVA 3THYB 4KGZB 5HMYA 1HYSA 3GILA 3IR6B 2UXBF 4W92B 4I7FB 3W3DA 1ZBSA 4DXLA 1NK7A 2W7OA 2IRXA 1RTHA 1UEKA 2JLFA 2O8CB 1F0XA 3CJ0A 3VQPA 1DJ0A 5F8GA 3NGUA 1UCNA 3G6ES 2ZJRL 4NL5A 4CJKA 3P38A 1FESA 4F4YA 4JI4F 1QSLA 4ECWA 4DSFA 2X1GA 3R5BA 4DR1F 3LOUA 4D3HA 2D74B 4FLZA 1JMTA 1Y9OA 2CUYA 3HFZB 2FQQB 4OI0A 4C11A 4WKYA 2QWQA 5BR8F 3J8AA 2CDRB 4BR4A 5ETTA 2BVZA 1IBMF 3GFYA 4J9LA 2W9CA 2YKQA 1NRKA 2A3ZA 5HMXA 4MIBA 2DTUA 4WTOB 4DV5J 4TYBA 1GMVA 2HVDA 2RHSB 2JFDA 4RNMA 4ZVPB 2UV8G 3MEGB 2YHBA 4YB5A 2J0SD 2C3MA 4FLWA 3THXB 2FBVA 1YI2S 5JLHA 1UAXA 1S9GA 2AJ1A 5KG1A 1WKJA 1JLAA 4NPOA 5LMUF 1SZ2A 4X65J 1C0UA 3R7NB 1VHXA 4LFAK 3KLEB 1NSKL 5ELZA 1SI9A 3THXA 3MEEA 3KTQA 1UEUA 3RG6A 3ZCMA 4M3RA 2IRYA 4FLUA 1RLCL 4CGGA 2UYTA 4MK9A 1CLFA 4I69A 2XHWA 3HLUA 3IA0A 5ITHA 1XMQK 1WF1A 1J54A 1MWKA 4H54A 5K8MA 3E8OA 2C42A 2KT3A 3DU5A 2H4YB 1VRUB 3IR5B 4YOWA 1VISA 2D0OA 1Q5YA 2AZ3A 1RDCA 4IOCQ 4KQZA 4NYPA 3KLVA 4FPIA 3G82A 4DQPA 5TKYA 1JJHA 3L7OA 2XMJA 2N4DA 2GMJA 4DR7F 4JV5J 2JOQA 2DGOA 1H2VZ 8AT1B 5JVHL 2RDDA 3PY8A 1DGKN 2KXFA 2UUAF 2E2NA 2DNZA 2BJ9A 2RDIA 3O9QA 1Q18A 3GFHA 4FYDA 4FJLA 5AQLA 2BUNA 2VPYB 4QWEA 2HHXA 1HNIB 3I8BA 2A41A 1VS3A 1JJ2R 3OYBA 5CZVA 3B78A 5ETOA 3VVUA 2HVHA 2VG6A 3D7EO 3CJKA 2VWBA 4CLLA 1ZM3A 2HHHK 3DXBA 4NCGA 2VQEF 2IM2A 3OSPA 4YDUC 2QFIA 1P9QC 5AZJB 2M8DB 2XRIA 1IJEB 2AZ1A 3AXMA 4GVLA 2GA7A 2KI2A 4Y2CA 3R8EA 3G71N 1VQ9S 3EZ5A 2X6SA 3VEVA 2VL1A 2HHHJ 4DTUA 2DCLA 4B9LA 1XNRF 3OBYA 1IUJA 2VOPA 3PW2A 2EKNA 3CC7N 1HL6A 1N56A 2A5XA 4RUAA 2UVRA 1RQ0A 2KN4A 2QW9A 1NLVA 4HVZA 3H59A 3TAMA 1GLEG 3UKRA 5G0RB 2GJ2A 4KH1B 4LF9F 4JS4A 3IFRA 3NP5A 3M1VA 4CF1A 3BGRA 5FPMA 4XIUA 1R89A 4E1NA 1YTAA 2YWHA 3LALA 3I31A 3H3NO 3I0SB 2J9EA 3DRSB 1QE1A 4F4WA 2LP4A 2HZVA 4TY8B 3NVMA 5I42A 3TZZA 2Z2MA 2VJUA 1WC5A 4DTNA 5LJWA 4W5TA 2RKIB 5D4OA 2OAUA 2FBYA 3MXIA 1XMOF 4YB1P 3OYKA 4HDGA 3NGTA 4P7VA 5HVHA 3O44A 3FZBA 3FQKA 1YDLA 3TZWA 2YNHB 1CXUA 4PY5A 5KQDA 5JLFA 2ZE2B 4MFBA 2UV8A 4HCCA 4ZPCA 2MZTA 3OTEA 3G2XA 5B0GA 4RUCA 4CF9A 2F1FA 5HJYA 1VQLS 2NXUA 3FEZA 1NMDA 4OLBA 1X4CA 4BRDA 3R8YA 1ASVA 3W60A 4AXIA 2KJWA 2NPIA 4WFAQ 3EZWA 5IT0A 1HPMA 2BA9A 2BW2A 4H5WA 2G2ZA 3RBXA 1XK8A 2ZH5A 5DG7A 4DSIA 3VA0A 1OY6A 2MLXA 5HP1A 4IQXA 4A8MP 4DL3A 2GBZA 2ZHOA 3AVMA 3IS9A 1OMSA 1TUGB 4Y2AA 3BSNA 1U1KA 3SQOP 1LAVA 3MMAA 3N9UC 4DV3K 4NASA 2G0JA 5E41A 2XMVA 1C1CB 1I94K 3I5AA 2X1BA 2VWJA 1X60A 4W90B 4FM0A 1VQ9N 1CZAN 2AEFA 3O1LA 2VFSA 2B6AA 4B9NA 1VQPN 1HBOA 3O8MA 1XTZA 4ELVA 2CPDA 3BBBA 3KG0A 1RHRB 4NRUA 2Z2YB 3G6VA 4LF2A 1RFQA 1TU0B 5B8HA 4OKKA 2CQ4A 1V5VA 5CZ1A 2C2EA 4CEDA 2NXNA 3KVGA 3GG1A 4CF2A 3G10A 4K50A 2Z56B 5AQZA 4LFCK 3LWMA 4LSLA 2MKIA 4TQSA 3T69A 3AOCA 1VSFA 5JVHQ 3OY9A 3KJVA 3I87A 2NUBA 2NXCA 3EKSA 5MLCV 3OBWA 2MGZA 4X2BA 3NCIA 3HVRA 3UN2A 3H5XA 2D0CA 4LF5F 5E33A 2LEAA 5D6GA 1EP4B 1EX8A 5EY4A 1HBUB 3O9UA 2IVYA 4OI1A 3ZSRA 2DY9A 1BISA 1LWXA 1NJWA 2NZ4A 4A8OA 2VQFK 2AMCB 4I9QA 4B3TK 4FJXA 2DR7A 3OYMA 1H1VA 4J9UE 2W4CA 2P5GA 1D9FA 1XEZA 3OTOF 7FD1A 4DJBA 1YRUA 4OX9K 3GV5B 4H4KC 2YKNA 3QNWB 1YHQN 5BYQA 2FSNA 4TU7A 3QIPB 5EWGA 1EARA 3VF0B 3BF3A 3ZZ0A 4CEQA 5JICA 1PKUA 1VCTA 4OYXA 4F67A 1VFJA 3OV7A 3G0ZA 1UVNA 4XO0A 2OMLA 4IO1A 4CGIA 3IAYA 4LF7F 2JEFA 3LZIA 1IKWB 3BDEA 3BR8A 4FJJA 1NBWA 1LAWA 1PC5A 5B0CA 3VWSA 5FLXY 4IO9Q 4FJIA 1FT8A 4BG9A 5EXWA 3BGUA 2H48B 4X65F 4FWPA 1RDUA 3SMSA 4OJGA 2ZM6F 1U24A 3FUYA 4PRFA 3UKUA 3NAEA 1ZTTA 5K14A 2O8DB 5M2PA 4NZ6A 2QSWA 3GIRA 3MWBA 2M2BA 4BBYA 1TUYA 2JX2A 4DQ8A 4CEFA 1TL3B 3M9MB 2BX6A 1J5EK 4DPUA 5AQFA 1MG7A 1DLOA 1H73A 2WONA 3AXKA 4DX5A 1N32K 4F4KA 5BPNA 3RB6A 1SUQB 4OX9J 1KNZA 5DJBA 2XGQA 5GAHU 2A6AA 3TANA 1T95A 5KT4A 4LF7J 1S22A 3CULA 2DT9A 1GNKA 2FHKA 4DB3A 3SAHA 2MQMA 4WJBA 2PE8A 4F04B 4UQGA 4E89A 3A5LC 1TKXA 5DQIA 1HBNB 2R7QA 3DXMA 3BGFA 1KOOA 2RD5C 5HRPA 4L3NA 2O8FA 2AGOA 5DDQC 4X64K 3RW6A 1WI8A 2H54B 2W41A 2EFVA 1Q9XA 1NUEA 4C8NA 3W2VB 3OYHA 3KKSA 3QDKA 2AW0A 3AB4B 1U6BA 3SCKE 1RP5A 4EO8A 5EOYA 1H72C 3AV9A 5BJRA 3QQCD 3K0JA 2HHPA 4M5LA 1TZ0A 4HEA9 4OYZA 1R8HA 2X74A 4FJ7A 1ZOTA 3RGIA 2G8HA 2EBGA 3IWXA 3NGYA 5HROB 1N0VC 2OTJS 2E88A 2UU9F 4UT4A 2DNHA 3AQPA 1GLDG 3AH6A 4JI1J 4KHPF 1JCEA 1XBWA 3GLJA 2CYYA 2V4JB 5D0RA 2NLWA 3M6UA 4HHTA 4F26A 1DAXA 2MEWA 3D2WA 3AAPA 2IC3A 4HT7A 3EICA 1HW9A 4DR3F 4DMNA 5EVZA 4B3MF 1HIYA 4P10A 3TQEA 1KR4A 1YITN 2B9WA 2HWTA 1SV5B 2E2QA 2HNZA 4DUYF 4FVCA 4PYAA 2WTUA 1E6VA 2DKOB 3M8QB 4ZHRA 1FDDA 4GKJK 2MQOA 5KRSA 1NB7A 3VGSA 3M2VB 1NHVA 2AHOB 3BEGB 3NFAA 1B92A 4LF5K 3M7VA 2F5GA 1FCAA 3D28A 1BIUA 4X4SA 5M1OA 2E1YA 4BVOA 4B8AB 4M5DA 1BI4B 1UP1A 1HMVB 2CAJA 2ZH2A 2GIQA 2GX8A 1C0TB 4Q8EA 2AEMA 5BR8K 4MMOA 2PC6A 4K42A 3IRXB 3H1VX 2BJ3A 5HRNA 4MDAA 2NRWA 5CE3A 2E7XA 4DPYA 4USVA 3GYNA 2AJQA 5F2RA 5KQ8A 1HWJA 3OPKA 3R6LB 4H0VB 2VU5A 3J81Y 4NLOA 4RLEA 3CC7S 4ECRA 4KHWA 3OHRA 3P1GA 3QWPA 3THPA 2G1DA 2XO7A 4CT8A 2ZKTA 1WHYA 3N6NA 2BQ3A 5DO2A 3QLHA 3DOKB 3ZYYX 3PR5B 3OR1B 3WXKA 4KTZA 1JL2A 3I0SA 1RE1B 5IC4B 1O8BA 1XR6A 4NXNK 1N5SA 3L8BA 1B9FA 3TI0A 2NZCA 1UJ6A 2W9BA 2LVWA 4MKBA 4B3MK 4LF7K 1VJWA 4H5TA 1NH8A 1P1TA 2R2TA 2GEMA 5HATA 4AQYJ 2YPZA 2O4GA 2G8VA 2DFEA 1S6QA 2QX0A 3R6MA 4DR4F 4TLQA 2UU9K 1WD6A 2P9LA 2Q79A 5KFYA 4BE0A 1RT3B 3AO3A 3CQ8A 5HBMA 3L4BC 3O3FA 2ATCB 1S9FA 1Q0NA 3U3GA 3GFXA 4U9RA 4IOAL 4C8LA 2P9SA 4WIIA 3AVGA 4DV7F 4NI2A 3JAMU 2JRSA 2JGUA 3WUHA 4N8NA 4R0JA 4ILHA 4PQUA 2CPIA 2F3JA 2GAHC 2NUUG 1H38A 4CHYA 1X5TA 5KFVA 5A8WB 4GV9A 1YZ7A 4BRPA 3LDPA 5AZIA 2DO4A 2E2PA 1X31C 1XC9A 1OVQA 1NDLA 2HBZB 2VH7A 1B4SA 1KOHA 5L46A 3QO9B 4I6YA 1TKTA 1X1PA 2A2DA 1HHTP 4LIWA 4X4OA 2Y0BB 1KHWA 4HL9A 2XZTB 3IWLA 4ZVHA 1BG3A 1RACB 4I56A 2GHVC 2CNNB 1VK0A 4A59A 4BVPA 1H2UX 1UAWA 1R8AA 2LU2A 3CT9A 4F3TA 1FKOA 4B3RK 3E3XA 5HAOA 3NGDA 3AGRA 4JYAJ 5LM7E 3THTA 4BS2A 1NDPA 1ELOA 2GZOA 4FOIA 1TUWA 1L3SA 4Y6IA 2BQRA 4HI1A 3H7HB 1YG0A 1L3UA 3EPGA 3MEDA 3WXLA 2YWEA 8RUCA 4L75A 3CCMS 1JK9B 2LECA 3C94A 1T05B 2GFFA 3PLAA 4DG1B 3ZZOA 4V19S 4DUZF 2X1AA 4NA1A 1XMQJ 4JD2A 4J5OA 3DFEA 5BXIA 4BRHA 1DURA 1TL3A 1Q79A 1NDKA 3VQCA 4LF4J 2R9LA 4V19X 3TUPA 1ASWA 3MM6A 1AZSA 1FRHA 5AE3A 3M9NB 2M88A 3EMTA 2HK2A 1HNZJ 3B4DA 2BKPA 2NXEA 5L1KA 4XH1A 1JB0C 3PRDA 3WT0A 3BF1A 4ZOSA 1JLFB 2ZDOA 1RDDA 2J6TA 5BPMA 2VC1A 4DR7K 1YIJS 3ZETA 1HBNA 3FCVA 2CGJA 2GAGC 3RAMA 1HYSB 1DARA 2RRNA 2F4VF 3WIVA 3RBZA 4CO5A 3EY1A 1FJGJ 2F8SA 1RDWX 1FERA 3NWRA 3VQ5A 4J9RA 4DR1J 5JS2A 2EX3A 4M3WA 4O8KA 3GIIA 3TJAA 3PKMA 4X4NA 1URNA 3QEXA 2C3YA 1N88A 3M8PB 3O6WA 1YZ6A 3TJ9A 1CZ9A 2PFUA 4BR9A 2OA8A 3SQGA 4JI0J 1S6PA 4JP8A 1MU2A 1IQZA 1VBKA 2IM3A 2HZCA 3R2CJ 3T1HJ 4ZVFA 2J6UA 5D78A 2HQIA 3LW5C 1S59A 2FSJA 2IJFA 1K8KB 4LF9K 2AJ4A 3QETA 2N82B 4LF8J 5H9EK 3QFHA 1B0PA 1ZBIA 3DOLB 4M5JA 3ETOA 4J91A 2PA8D 1SQGA 2O3DA 1XNRK 2X51A 5E3RA 1E6VB 1ZPVA 1RHUB 1L3VA 2XGPA 5F8LA 9ATCB 5FROA 1N5VA 3VQSA 1QVGM 5F3ZA 3V1QA 1VIOA 2M8HA 5K14B 3F2KA 4LFBJ 2F40A 3G71S 2P9NA 4DV7K 4MJKA 2NSBA 3HOTA 4EU0A 1RAHB 4HH1A 1YJNN 4JI0F 1T9XA 4RWXA 1T03A 3UN3A 2HBQB 2MQ8A 1NGEA 2UUTA 3OYJA 4PUOB 4X4RA 4PWDB 1LCUA 1TL7A 1VHIA 1P8GA 3PJ9A 2DHGA 4C97A 4BROA 5DZ6A 4KO0B 3VAJA 3CFPA 3VHQA 4ZN3A 3DRPB 3K5MA 2HRTA 2A3JA 5AJ3J 4NXNF 1UJ5A 1RWMB 4WF9L 3PEHA 4DV5F 4KRWA 1J5EJ 4FYYB 2V2QA 3OXGA 3MFHA 1TKXB 1SBRA 4ICLA 5KFAA 4BE1A 1HR0F 3ALYA 1S79A 4LMZA 4H03B 3G6XA 4FJMA 2CVIA 1WSEA 4OVLA 4MK8A 4CK2A 1ICEB 4JKHA 5KT5A 1C6VA 1R0AB 2KKHA 3SCXA 1RXOB 4MT1A 1SQFA 1K8AT 1KC8T 7FDRA 2AGQA 4B3TJ 1BQMB 1VQLN 1IR2A 3SQ0A 5JXSA 3K5OA 3MI7X 3MEKA 1NSQA 3P4UB 1IM6A 2DK2A 3KLIA 2N7YA 5DRKA 1NHKL 3BGOP 2YTCA 3QT7A 2E1ZA 3I55N 3F5TA 1QHTA 4JB8B 3J81O 2DPIA 2FVRA 4C11B 4E7IA 1FEHA 4DLGA 4OHWA 3FFIA 2JVRA 1ZBUA 1PO6A 4RU2A 2ZH8A 2IGIA 1U1PA 2WK4A 3UDVA 5DLGA 5ETVA 1NJXA 2HW3A 2W9CB