1RT5A

Hiv-1 reverse transcriptase complexed with uc10
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
542
structure length
536
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 143
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt5A05
3HVWA 2GUIA 4JRQA 3OL7A 3ZT3A 4LQ9A 1S6PA 5J2PA 2J6UA 3MR2A 3BR9A 4NYFA 3ZT4A 4M3RA 1XI1A 4FS2A 2YNGA 5DG9A 1TL1A 3MF5A 4FXDA 4Y1DA 4PWDB 4CFCA 1RT5B 2R8IA 4FJMA 4ID5B 4B9TA 4IFVB 1RCHA 1RDDA 1RNHA 4ED3A 4QW9A 4M3TA 1RTIB 1C0TA 4N47A 5KG0A 1EP4B 3NGYA 5JS1A 3DDKA 1LWFB 3H2LA 1TKXB 3AO3A 4K4VA 1TK8A 5K14A 4F3OA 3H5SA 3NH0A 3MEDB 2D41A 2XY5A 3WNGA 2P5GA 1TVRA 2YNIB 2VG7A 2IJNA 2G8WA 4PUOB 5KG5A 4EBEA 1RBRA 2RKIB 5EUHA 1RTHB 2BR0A 4FK4A 4KHNA 3AA3A 5HROA 2EC0A 4EP4A 1JL1A 2GV9A 3RB6A 4FJXA 3DRRB 1LAWA 1BI4A 3OYMA 1JKHA 4O3OA 3MECB 1T3NA 3NF6A 2ZD1A 3HYFA 4WFXA 2C2DA 3EZUA 4ECUA 3SV4A 1GOCA 1G15A 1Q9XA 3EZ5A 2HNZB 3KLEA 4ECWA 4QWDA 3VQEA 4OKKA 4KE5A 3V1RA 3OS1A 1TK5A 2IC3B 3ZSRA 1X9WA 1JL2A 1JLBA 1A5XA 4W5RA 3I0RA 4O4GB 4NLQA 3OYGA 2DPJA 2JLEA 4CJLA 4KO0A 1F21A 4MK8A 1RT6B 2VA3A 2YNHA 1WAJA 2YKNA 1C0UB 5EDWA 1JLGA 1S9EA 2B5JB 5EWGA 3OYKA 2FBTA 2P1JA 2HHVA 3NFAA 1GOAA 5I3UB 1WN7A 3K5OA 3DI6A 3OS0A 4ED1A 2ZQBA 4YR0A 2OPSB 5KFGA 3KHHA 1LW2B 3ASMA 4U7CA 5KG6A 2Y1JA 4FJIA 4GMJB 3BQ0A 2WB4A 3HKWA 3TANA 4FJ5A 3OSNA 5CYQA 4URGA 4CJTA 3C6TA 4E0DA 4O3NA 3L3UA 5J2NB 3L2WA 1S1WA 4CJ3A 1JLCB 1VSJA 1T8EA 2YNFA 4JS4A 4DFJA 4C8NA 3AV9A 3LZJA 4DLEA 1RBTA 5KFVA 1HNVB 3V6KA 1XHZA 1JLQB 1VSKA 2YV0X 4OLBA 3DMJA 3GV8B 2X74A 3TAMB 2IAJA 2OPQB 4PQUA 3VQAA 4YR3A 3QGHA 2BRKA 2YKMB 4NLYA 3QLHB 3D45A 4AHSA 3OYIA 3ZT2A 3DM2A 4IKFA 1HNIA 5D3GB 1DTQA 4KFBB 4TSXA 1S1VA 4B9MA 1BCMA 1SH3A 2D5RA 4KHUA 4B8CA 3KTQA 1NK6A 4JLHA 1NK0A 4DTRA 2IMWP 4DU3A 2OPPB 3S3OA 2C2EA 2XY8A 4MFBA 4DF4A 3ZSWA 2HNDB 4IR9A 1BQNA 5C25B 3OYLA 2WRMA 1D8YA 3CJ2A 1I3AA 3QNNA 4ZPCA 3L2UA 4W5OA 1S0OA 4CGHA 4HUGA 2FJWA 4IOBA 4B9NA 1U09A 1S1XB 5J2QB 3K5LA 5DLGA 2ZKUA 5F8HA 5KFKA 4NLDA 4Q8EA 3VQ6A 5KFNA 3AVGA 4C8OA 2B4JA 4FLYA 2G8FA 3DRSB 1RA7A 4ECSA 4I2QA 2ZE2B 2BQRA 4LSLA 4FVMA 4OJRA 1O1WA 4EO8A 3HPHA 4R5PA 3TAGA 4KTZA 4J9LA 3PO5A 3DLKA 4ZTJA 3AVJA 3O3FA 2DY4A 5HBMA 3V9UA 1NK5A 5DQHA 3QIDA 4N41A 4DU4A 4Q43A 3OYEA 1N4LA 4M41A 4KAZA 3VN5A 4HVJA 2KFNA 1WSIA 3T1AA 3DRPA 4DFMA 3B6OA 3LWLA 4MKAA 3QEXA 1S6PB 3VQQA 3KHGA 3NF9A 1CZ9A 4NCAA 2I1RA 3NKYA 2UUWA 4DL4A 1BHLA 1J5OB 4M95A 3AVBA 3OHAA 3SUQA 2YNGB 4CESA 1TL1B 3G10A 1REVA 1Z25A 3OS2A 3QERA 5F8MA 3V9ZA 4E7IA 3KJVA 4KPYA 2X6NA 3CJ5A 3QNOA 3FRZA 1D1UA 3V6HA 3AA4A 4HTUA 3GIJA 1S10A 1QSSA 2V4RA 1RTDA 3CO9A 2XHBA 3H4BA 4KBIA 1ZYQA 2XGPA 4OPJA 3OSPA 3CDWA 5DQGA 3M8RA 4E3SA 3LPTA 1TVRB 2VG7B 4OKJA 1KFSA 2RPIA 3KIOA 4NCGA 2RN2A 5HROB 4J9RA 4CJEA 3G86A 2R8JA 2E6LA 4BE1A 3JSMA 1S97A 4RUCA 4ID1A 1BI4B 1BIUA 1JKHB 4ZP8A 4Y3CA 3Q8SB 3NE6A 3NH1A 2ZD1B 4QWCA 4F4YA 1BCOA 5KT3A 5HLFB 4NYNA 3TABA 2ETJA 2IM1A 3KOAA 4OLAA 4IRKA 4CEZA 1D9FA 3M8SA 4YMEA 3MAQA 1B92A 1VSFA 1ZBFA 3KLEB 5C42B 3MR3A 4CJKA 2D0CA 1S9FA 3G6VA 4FZXC 4LSNA 1RBSA 4DS5A 3OYFA 2AGOA 1JLBB 1N5YB 5KFXA 3QIOA 4J9QA 3I0RB 3AVIA 4O55A 3HT3A 3SUOA 4CJ5A 4K4XA 3D28A 4ECTA 3M8QA 2KFZA 4KO0B 3JYTB 4F3TA 4F4XA 1XWLA 4DSFA 4FJ7A 4EO6A 4CJWA 2YNHB 4KHQA 1JLGB 2I5JA 4CHYA 1NJZA 1S9EB 1VSDA 3KK2A 4CF0A 3P5JA 4ZTFA 2G8UA 3DI6B 4FM0A 4OKEA 2LSNA 2FJVA 4HYKA 5DGAA 4DTMA 4WE1B 4IRCA 1HPZB 2D7SA 4PA1A 4DTOA 4KAIA 1IKWA 4AILC 3ZT0A 1VSMA 1D9DA 2FJXA 1TV6A 4DTJA 4J2EA 4DTUA 2V0NA 1IKXA 4KRFA 1QHTA 1FXXA 3C6TB 4KB0A 4K4YA 4E1MA 3RR7A 3BSOA 2YNFB 2HHTA 4DTSA 1RTJB 4DSJA 3PW7A 1KSPA 4NLRA 4R8UB 3KHLA 2VWJA 4H4MB 3T3FA 1JX4A 1DTTA 2IA6A 3DMJB 3MEEA 3MEGA 3DYAA 5T14A 1K1QA 4QOZB 1VRUA 2IAJB 2C22A 4PQUB 1S1UA 5L1KA 1NJWA 3KNAA 4NLPA 5KTQA 1DLOA 1HNIB 4H4OB 1S1VB 5F8GA 3AVHA 3PUFA 4RW6A 1SUQA 3V6DB 2FLLA 1HJRA 4YR2A 3V1QA 4O44A 5KFFA 4MFBB 3VA3A 1CLQA 1UAXA 1QS4A 1BQNB 3RB4A 2UUTA 2AQ4A 4TYAA 2AGQA 4MH8A 4CCHA 2F8EX 4NLGA 1EX4A 4AHTA 3OYBA 4K8XA 5DK5A 1ZBIA 3CG7A 3KLHB 3Q8RB 3KLFB 3ZSXA 2IS3A 1L3UA 3NAIA 2OH2A 3HK2A 3AVNA 2YHAA 4ZPDA 4J9NA 1GX5A 2WOMA 1JLAA 4J9PA 1JIHA 2E4LA 3H40A 1L3VA 3L8BA 2WHOA 4I2QB 1LAVA 4LSLB 3CJ4A 4ECRA 3OYNA 4WFYA 1LWEA 2VG5A 1C0MA 4HCCA 3LP0B 4R5PB 4FJNA 2OPRA 2V9WA 2FVSA 2FBYA 4IRDA 3KKRA 1WSJA 3DLKB 3FSIA 4I9QA 4BDPA 4ZVHA 2RDIA 5HBMB 3NH2A 2HAIA 3SNNA 3RMBA 3IRXA 2P5OA 1IM4A 5KRSA 3AO4A 3DRPB 2FLPA 3TQ1A 1WSHA 3HHKA 3TAPA 3BQ1A 3SCXA 2XI2A 4QWEA 4DMNA 2PY5A 3C6UA 2BE2A 1NHUA 3SV3A 2XRIA 1BL3A 1EETB 4CF8A 4MIAA 4CJ4A 3OY9A 4DQPA 2W7OA 1L3TA 1REVB 3HVAA 1T03A 4URQU 1LW0B 1WSEA 5CYMA 1CZBA 4TYBA 4ZVEA 4IH5A 3KJVB 4ECZA 3I5AA 3M9MB 2O5DA 3GV5B 3I0SB 5KG3A 1SV5A 3KK3A 1RTDB 1C1CA 3HJFA 4TN2A 1NK4A 1TL3A 3CQ8A 4F4KA 3G6YA 4ECYA 1S6QA 1FKPB 4CEDA 4KI6A 4EZ6A 4Y1CA 4CK3A 3SYZA 2EHGA 1KLMA 5E41A 5J2MA 3S9HA 3KK1A 4NCGB 3M9OB 4BE0A 4KKOA 5DLFA 2FLNA 3Q8QB 4B08A 4GW6A 4ED0A 4QCLA 3SI6A 2RF2A 1SH0A 3JSMB 3M8PA 3THVA 3VQSA 4G1QA 3CWJA 1NKCA 4FLUA 2VG6A 4QPXA 4ED8A 4M45A 3CFRA 3VQPA 1KVCA 1UWBA 4FZZA 1W0HA 1VSHA 4DL2A 4KTWA 3V4IA 2KZMA 5KFRA 1LV5A 4XIUA 4LSNB 1N6QB 4KB7A 2HMIB 1JLEA 3QO9A 1QE1A 1K1SA 4E7LA 3TARA 4E7JA 2JEJA 3M9NB 5KT5A 3NL0A 2JEFA 1NNDA 1S9GA 4W5QA 1HMVA 4CJUA 3MR5A 3M8QB 4Q5VA 4TY9A 4WXWA 3OJSA 1BIZA 4HCBA 2HHQA 4KI4A 1KHWA 1A5WA 1WSGA 4ELVA 1KHVA 3PW2A 3VQCA 4RW4A 3E01B 2I5JB 4RW7A 3CDUA 5KFLA 1RT2A 4JRPA 3KLIA 2ILYA 3PR4A 5KI6A 4CEQA 1YVUA 1IG9A 1XC9A 4C8LA 2BQUA 3QEVA 3TAQA 1IKWB 3K5MA 2B43A 4MQ3A 4J2DA 4XPCA 4DFKA 1TV6B 1QAJA 5JUMA 1IKXB 2BANA 1KRPA 2XY7A 2ITGA 3QZ8A 3LAMA 4CJQA 1HARA 4FLTA 1Z26A 4Z4HA 2HHWA 3QIPA 1S49A 4FK0A 5C24A 3L2QA 4DTPA 3CJ3A 1Y97A 4L8RB 4MIBA 2XI3A 4CJVA 1EKEA 4K4WA 1RDCA 3DOKA 4NLOA 4B3OA 3AVCA 5KG7A 3UDLA 3OVNA 4IG3B 4ICLA 4QWBA 1JXEA 3MEEB 2OYQA 2WONA 3DYAB 3NGIA 4CIGA 1VRUB 4AHCA 1UA1A 2WK4A 3BSNA 4CFBA 1SKWA 3HVTA 5J1EA 3EPIA 3RB0A 1RT3A 3KD5E 4F4WA 1DLOB 5KFWA 2AU0A 5KFBA 4CJRA 1U4BA 4GVMA 2KZZA 4RW6B 4HUFA 1SUQB 3HL8A 3I5CA 2UVWA 4DQQA 3PX6A 1RAJA 4ZMMA 3OL9A 3MTKA 4O44B 2J6SA 2ASLA 3NCIA 1ASVA 4CGDA 4E7HA 1IKVA 4E89A 4B9UA 4M3ZA 4FYDA 4JUZA 3T5KA 4CHNA 2XC9A 4KHWA 4DLGA 4J9SA 3KKSA 1VRTB 4OPKA 2G8HA 2OZSA 4E19A 1D5AA 1XR5A 4URSA 1I39A 3EYZA 4CJSA 4O0IA 1SH2A 5KT4A 3WNEA 3H08A 1JLAB 3RMCA 4ED6A 2GC8A 1LWEB 1IH7A 1BQMA 4HUEA 4N56A 2OPRB 4NLSA 4LD0A 4Z0UA 4TXSA 4DL5A 5KFUA 2ASDA 4NLTA 4FW1A 3KLVA 2HB5A 3IRXB 3T5LA 4I2PA 5DQIA 1JLFA 3PJXA 2V4QA 3OYCA 2HHSA 3RMDA 1TQLA 3CIZA 5J2PB 3OJUA 3H98A 3C6UB 4DQRA 5KFAA 5DGBA 2D0BA 2BE2B 4WXOA 4Z4FA 3S3MA 2AX1A 4O4RA 4M3YA 5KFIA 4NRUA 1T03B 3OL6A 4O5BA 4IG0A 4DL7A 3PO4A 2X6SA 5CYMB 4JV2A 1C6VA 4FW2A 2Z1IA 4K4UA 3SI8A 3DLRA 1RBVA 1C0TB 2ILZA 4CGJA 1SV5B 2PYJA 4CJFA 3KK3B 1J54A 4PWDA 4Z4IA 4LQ3A 4J2BA 5K14B 1ZTWA 1C1CB 3BGRA 2IBKA 3PVXA 4IFVA 1TL3B 4K4TA 3AVKA 3NGZA 2W42A 3DLBA 1S6QB 3HP9A 3B6PA 3OLBA 1RA6A 2OZMA 3V9SA 2B6AA 3LAKA 3G0ZA 3ZSYA 5J2MB 4RW9A 3WNHA 1TKXA 3KK1B 1KCFA 3PJWA 1RYRA 4KKOB 3UIQA 4N5SA 4CGIA 2RF2B 3M8PB 5HRSA 3SUNA 2W9CA 1ITGA 4CEEA 3SQ4A 1N56A 2O4GA 5L9XA 3K59A 2VG6B 1BGXT 1QSLA 1ZBLA 2KTQA 1RTHA 1UWBB 5KRTA 1LWCA 4KV8A 4M3WA 1YT3A 4W5TA 3IN5A 3V4IB 1TAUA 3QESA 3AO1A 1HYSA 3FDSA 1JLEB 3QO9B 4CF9A 5KFJA 3N6MA 4ZPBA 2C28A 3DOLA 4BDYA 3BDPA 3TAEA 4RNOA 2D0AA 1S9GB 1HMVB 2JC0A 3PR5B 1KTQA 4C8MA 1NK8A 2D3ZA 3FFIA 2IC3A 4XPEA 4IBNA 5L1IA 4DTNA 4RW4B 2YKNB 3KLGA 3ZSQA 4JV1A 3ZSOA 4FLZA 4RW7B 5F8LA 1MU2A 1U48A 3KLIB 2X78A 3I5BA 2VA2A 3SJJA 4KHMA 2Z1JA 3QEPA 2PYLA 1C0UA 3H5YA 5CYQB 2BANB 1RDBA 5JXSA 3GQCA 2F8SA 4IKAA 4M3XA 1S1WB 5KFSA 5C24B 4O0JA 3BSCA 3CM5A 4ED2A 4TY8A 3HO1A 2VWKA 4B3OB 4YP3A 2KW4A 3O4QA 4ICLB 2HWIA 3BJYA 3RRGA 3IAYA 4NRTA 1HYVA 3PHEA 2WONB 5KT6A 1QQCA 4J2AA 4WFZA 3RWUA 2EX3A 5KG4A 4CHPA 3KD1E 4RU9A 4R0EA 3HVTB 2R2RA 3D5MA 3O3GA 4Y34A 5J1EB 3LANA 4KHYA 4F2RA 2UVRA 1RT3B 4RNHA 5KFQA 1C2PA 1NHVA 4XO0A 3DM2B 1DTQB 2IM0A 4FJ9A 1GX6A 5DMRA 4DS4A 3EPGA 3MXIA 1TGOA 4YNQA 2YKMA 4ZHRA 3PZPA 3LP1A 3QLHA 3N6LA 5FDLA 1TP7A 3GYNA 2W8KA 2FVRA 4OL8A 4QW8A 1IKVB 5D3GA 3KMSA 4KFBA 1CSJA 4ZP7A 1ZBUA 4EP5A 2DFEA 3V9XA 3LZIA 4Q8FA 1QAIA 4DSEA 4CERA 4O3PA 5KFEA 4E7KA 4EYHB 4ZPAA 1HQUA 1Z4UA 4FJLA 2OPPA 3UR0A 4RNMA 4MKBA 1J53A 1TAQA 3GIMA 1C1AA 4F2SA 3I8DA 4FJGA 1MMLA 1K6YA 1RDRA 3RMAA 1B9FA 2XGQA 1HQEA 3QEWA 3PW5A 3IS9A 2HVHA 4WZMA 1S1XA 3A2FA 4ZP6A 2QKBA 1WLJA 2FC0A 4RNFA 3V1OA 3F73A 4DU1A 1KLNA 2HNYA 4I2PB 2R8HA 3DLEA 4MK7A 3PW4A 3N6NA 1S5JA 3T19A 3L2RA 4Q44A 3LWMA 3VQ5A 4M3UA 3AVAA 3PV8A 3QETA 4ECQA 3NAEA 3FQKA 5KFDA 4AH9A 5CZ1A 3KMQA 4Z4GA 3L2VA 4IG0B 3K58A 5KFYA 1IKYA 5EU7A 4IQXA 1J5OA 4OGCA 3OHBA 3S3NA 4DSLA 2A1SA 4C8KA 4FJHA 2JEIA 3RBEA 2XY6A 4EYIB 1UOCA 1W9HA 3IGVA 1QSYA 3BGRB 1RT1A 1T05A 3VQ8A 3HSTB 5EWFA 4DQSA 4TQRA 4AHVA 5HRPA 4DQIA 4BWMA 4CIEA 2B6AB 1S0NA 3OYDA 4FBTA 4RW9B 3HM9A 2AX0A 5KFCA 4E1NA 4JV0A 4HHTA 1A5VA 3T5HA 3AVMA 3HXMA 3TWHA 1U04A 3RTVA 1RYSA 4FBUA 4KB1A 3BSAA 4ECVA 2W9CB 1NJXA 2ATLA 3NHGA 1RDAA 1XR7A 2FVPA 4G3IA 1WSFA 4FM2A 4ED7A 4EBDA 1VSLA 1C1BA 1LWCB 4KV8B 3BREA 2IDOA 2G8VA 4RW8A 2R7YA 1L3SA 2HHXA 1NK7A 4ZP9A 2W9AA 3NMAA 1HYSB 1J9AA 3K2PA 4QWAA 2YHBA 3DOLB 3H5UA 4FM1A 5HLFA 4FS1A 1FKOA 1TKZA 4GC6A 5T7BA 3AO5A 4U6PA 1JXLA 5C42A 2NUBA 3FFIB 3OL8A 3NBPA 5KT7A 5KFPA 1JXBA 2HHUA 1N5YA 4IFYA 3KLGB 5FROA 3KK2B 4FLWA 3DLHA 1MU2B 4CEBA 4ELUA 4M42A 2RDJA 2FBXA 4J9OA 4NLWA 3JYTA 2W8LA 3OYAA 3V81A 3LALA 3OLAA 2A1RA 4FJJA 3VQ9A 4DL3A 1WNEA 1TK0A 3MR6A 4I7FA 2CKWA 1D0EA 1ZETA 2WCXA 4WE1A 5KFZA 3OYJA 4DFPA 1HPZA 3F9KA 2FVCA 4BWJA 4X2BA 4M94A 3PY8A 2QKKA 3SUPA 2R2TA 4LH4A 3TR8A 4TY8B 3GILA 1SL2A 5FRNA 4J9MA 1B9DA 1DTTB 1ZBHA 2P51A 4FLVA 3H59A 1KFDA 1TKDA 3AA5X 1VK0A 4N76A 5HP1A 3MEGB 2W7PA 1U49A 4K4ZA 2JEGA 4CHQA 1RTJA 1S1UB 1ASUA 4R8UA 4TQSA 2Z1GA 4LY7A 5L1LA 4BACA 2DPIA 3MFHA 4H4MA 3O4NA 5HRNA 3RB3A 3HPGA 4FCYA 3CDEA 2IM2A 3CJ0A 4CF2A 4GC7A 2Z1HA 4ZHRB 3IG1A 1T7PA 5EWEA 2PZSA 3LP1B 4CEFA 5FDLB 4AHUA 4QAGA 2CJQA 4NLXA 4YQWA 4B8AB 4IDKA 4H4OA 4TLRA 3BQ2A 5CZ2A 3TAFA 2XCAA 2DFHA 5I42A 1S0MA 1S1TA 3UQSA 3MXMA 1KVAA 4F50A 1UA0A 3ITHA 3V6DA 3CYMA 3ALYA 4Q0BA 1HQUB 2W9BA 1L5UA 2IM3A 3SQ1A 1X9MA 2UVVA 4DG1A 3SPYA 2XWYA 2E9TA 4O3QA 3ZSZA 3T5JA 2GBZA 3QEIA 2R2UA 2WOMB 3SQ0A 5F8JA 3C94A 3PW0A 3VQBA 1RT7A 4CECA 1R0AA 2BGGA 1SKRA 4CGFA 1HQEB 1CXQA 1WAFA 1VSIA 2VG5B 3IS9B 4CF1A 1EXQA 3RR8A 3KLHA 4DSKA 3KLFA 1HYZA 4J9KA 2KQ2A 4B9VA 3H5XA 2BQ3A 2QXFA 3AVLA 4DSIA 5F8NA 1X9SA 2HNYB 4WYLA 3DLEB 2XO7A 4OGEA 4KHRA 3LP0A 1OS5A 4CJPA 2DFFA 3VQDA 4WZQA 4NLVA 1SL1A 1VSEA 3V6JA 4KREA 1TKTA 2J6TA 5KGXA 1S48A 1KVBA 3DLGA 3AA2A 1FK9A 3LP2A 1RT4A 3AVFA 4CFDA 3HVRA 3VQ7A 2R8GA 3C95A 5DG7A 1IKYB 3HPOA 4DWIA 1ASWA 4Y2CA 1IO2A 5KG2A 5KT2A 3VA0A 1SKSA 2E9ZA 3OYHA 3RAQA 1S4FA 3SZ2A 1EETA 1NJYA 4KSEB 2Q3SA 1RT5A 3SFGA 4KTQA 3LP3A 4ZVGA 4ID5A 1LW0A 1I6JA 1RT1B 1T05B 4K8ZA 4KHSA 5KFTA 1CXUA 3NDKA 4CEAA 4LH5A 4NCBA 5SWMA 3CFPA 3RRHA 3I0SA 1RTIA 2F96A 3AO2A 1EP4A 3E51A 2IGIA 1QTMA 1KLMB 1LWFA 3VQ4A 3GIIA 2AWZA 2QK9A 4IH6A 1YVFA 1Q9YA 4JS5A 4CHZA 4CGGA 2IOCA 3MEDA 3U6FA 2AGPA 3Q8PB 1X1PA 5F8IA 4CIFA 1FKPA 3NF7A 4G1QB 2YNIA 3ULDA 4BE2A 5KFMA 2HWHA 4PUOA 2ATQA 4YFUA 2RKIA 3ZSVA 1C1BB 2AJQA 3G6XA 4RW8B 4MK9A 3P83D 4F4ZA 4Y2AA 4BDZA 3DRRA 4B9SA 3RBDA 3V9WA 3MECA 3EY1A 2G8KA 1QE1B 2JC1A 5F9LA 4F8RA 1FKOB 1TKZB 4FZYA 3SFUA 4FLXA 2HNZA 4ELTA 4OVLA 3NF8A 3NBPB 1N6QA 2BDPA 2HMIA 4ECXA 1SL0A 4IFYB 1RT2B 1U47A 2WTFA 4CFAA 5KG1A 2FVQA 4DL6A 3QZ7A 4O4GA 5KFHA 3QINA 1ZTTA 4CHOA 3WNFA 4IR1A 1T94A 4Q45A 3V81B 4ZVFA 4RUAA 3QGGA 4FK2A 1RT6A 1XHXA 3E01A 2D3UA 1BISA 3IGNA 2B5JA 3SPZA 3D0PA 3P1GA 1RILA 2GIRA 5KGWA 5I3UA 4I7FB 4O3RA 3MXJA 3GV7B 3K57A 2OPSA 4RNNA 4DEZA 2E6MA 1YTUA 3QIPB 2QE5A 1LW2A 2HVIA 1NOYA 1QUVA 4H8KA 2QV6A 1U45A 1XR6A 3DOKB 3PX4A 5CY4A 1Q8IA 2G8IA 3QYYA 3TI0A 5J2NA 3SQ2A 5HP1B 2Y1IA 4EEYA 1JLCA 2UVUA 2ASJA 2DTUA 4K4SA 3U3YA 1N48A 5C5JA 1HNVA 4FJKA 3TVKA 4IG3A 5DG8A 3ZCMA 4WYWA 2IJFA 4NLUA 1JLQA 3CM6A 1W25A 3GIKA 4IH7A 1NK9A 4FJ8A 3TAMA 2OPQA 4CK2A 3L3VA 3H4DA 3IG1B 4I9LA 2BRLA 2FBVA 2XCPA 2R8KA 4HKQA 4Z4CA 4IDKB 3CVKA 5I42B 3ISNC 1S1TB 3FQLA 4PY5A 5KFOA 4RG8A 3QGIA 3K5NA 4K50A 3ITHB 4EZ9A 5JS2A 5L1JA 1YTAA 4Q0BB 4UQGA 2O4IA 2W9BB 3ISND 3PX0A 1HRHA 1FK9B 4B9LA 2HNDA 4DG1B 3NGDA 5C25A 3HP6A 2R2SA 2ALZA 3U3GA 2E9RX 2F8TA 3UPFA 3LDSA 4CEOA 2HW3A 5HRRA 1RT7B 1R0AB 4CK1A 1VRTA 3RAXA 1BQMB 5F9NA 5J2QA 3ICLA 4EBCA 3O3HA 1NOZA 4RZRA 4O3SA 3DRSA 2ZE2A 3CFOA 1JLFB 5SZTA 1NKBA 3KHRA 1WNSA 4NYZA 3LPUA 4H54A 4DF8A 2GIQA 2JGUA 4W5NA 3MFIA 1RBUA 2OA8A 4NZ0A 4DTXA 4Z4EA 2C2RA 1GOBA 1TKTB 4CE9A 5FRMA 3DLGB 3ZT1A 4AHRA 1NKEA 3LP2B 1RT4B 3NAHA
chains in the Genus database with same CATH superfamily
3OL7A 1FX2A 4K41A 4D3HA 4OYAA 1Q16B 1OPZA 3W60A 2N4DA 3MR2A 1M5OC 4NYFA 5GAGI 2E5IA 5GVQA 4ILGB 2YNGA 3MF5A 3FSXA 4FXDA 2HQ3A 2B9EA 4OYZA 1RZMA 2GHWA 3CJ8A 5MLCQ 5HSPA 1U24A 2R8IA 2O8FA 2EW9A 4C23A 5IS2A 3EGVA 1RNHA 1HWIA 4ED3A 4QW9A 1IBLF 1RTIB 5KG0A 1EP4B 4RBTA 5JS1A 3QAEA 2VQEK 1W7AA 4K4VA 2QLFB 1X3NA 1W7WA 2HS4A 3UCGA 2GHVC 4WF9Q 3GDQA 4ES3A 2KU7A 4BHQA 1YJWN 4DCOB 3PIOQ 3J7AP 1VGYA 1E6YB 2HVEA 2BR0A 2OKQA 2FZCB 4KHNA 3IMQJ 1JL1A 2XBPA 2RRBA 2ZH7A 3W1YC 2NUUG 4UTGA 2XSJB 1BI4A 4O3OA 2CAJA 2DGVA 4WFXA 5G0RB 3EZUA 1WD6A 1XMOK 2RUGA 2V5HG 1KQSM 4ZOSA 3I6PA 1UEKA 3SCLE 4OKKA 2DO0A 1H7XA 2C2MB 2JDJA 3O5TB 3EKSA 4W5RA 3THWA 3CD6N 3F56A 2YHWA 2DR7A 3VEWA 3QFWA 3B8AX 1RWPB 1F21A 4ZCIA 5IXUA 3ZZUA 2YNHA 2YKNA 5EDWA 1JLGA 3MCNA 1MWQA 4C0HA 2P1JA 3NFAA 3J7YU 3K5OA 3DI6A 1IUJA 3ILIA 5B0GA 5KFGA 3KHHA 5KG6A 1U1KA 3MD3A 1GXLA 4IFEA 2DCUB 4BVOA 1F9FA 2WBNA 3B4MA 3AAWB 3IM8A 3C6TA 1S1WA 3P5TL 2XYHB 1JLCB 1T8EA 1VSJA 1XNRF 2YNFA 4JS4A 4DFJA 2D4WA 1R8HA 1JLQB 4PAAA 2OD4A 2YV0X 1JCGA 4OV6A 1P8GA 1SJQA 3K0JA 4ERDA 2IAJA 3VQAA 1ZA2B 2A41A 3D45A 4BC2A 2ZH3A 3OYIA 1RCOB 3ZT2A 5ETMA 2D9PA 1URNA 5C2CA 1CJUA 5D3GB 1DTQA 2NXCA 1MW7A 4TSXA 1Q78A 1BCMA 1SH3A 5K8MA 3CTRA 4JLHA 1Q53A 4JHDA 2P9GA 2J9EA 3C46A 2XY8A 1YG0A 1XNQJ 4L3KA 3OYLA 5ETPA 1D8YA 2MLXA 3CJ2A 2Z58B 2ERRA 1I3AA 1PCAA 4W5OA 1HIYA 5BR8F 4IOBA 3R5GA 4C3LA 3QB0A 3H1VX 5ELZA 2DT9A 2HSEB 4HWIA 4CH0S 5IOLA 4CLPA 4CD3A 2LDYA 3VQ6A 1GMWA 4C8OA 1A7GE 3AVGA 3QMLA 4UUWA 2V2QA 5GMEA 4EO8A 4KTZA 3EN9A 2EG2A 1X4DA 1YF5L 5AQUA 4ZTJA 1F3VA 4BRKA 2DY4A 3TZWA 1VHIA 1N4LA 3ZXWA 4HVJA 1NJIT 3T1AA 1FEHA 3C7NB 2RQCA 1RWXB 3KG1A 4OQJA 3M6VA 1NBEB 2H65B 3E9LA 3T7ZA 4IO9Q 3NF9A 4A57A 3KG0A 4DL4A 4M95A 3AVBA 3SUQA 2FY1A 3R2CJ 3G10A 4B3SK 3SBGA 5JLHA 3GP9A 3ADAC 2N3LA 3V9ZA 5C2DA 1BD6A 4DR4F 3S7RA 4E7IA 5DS7A 5L38A 2MQNA 1VQOS 3L7UA 2ZUGA 4ANEA 3DJCA 1M5VC 1S10A 1TYQB 3ULEA 4E1JA 1HR0J 4KHPF 4CZFA 1YDLA 3M8RA 4E3SA 5FJ4A 3LPTA 2OLWA 2E1MC 3WEEA 1KFSA 4LF4J 4DCHA 3KIOA 4NCGA 2GIFA 2DHSA 1KD1T 4CJEA 2VPWB 2R8JA 4AYBD 2BM1A 1HHSA 4BE1A 1BIUA 3SMSA 3NE6A 2Q1NA 3CCLS 4QWCA 1BCOA 2IM1A 3SBMA 1NM1A 3ET6A 4IRKA 4OLAA 3A8IA 2AP6A 2NNWA 2BKNA 1FERA 3FCVA 2QA1A 4DS5A 4L3NA 4WBFA 1R8AA 3QIOA 2NRVA 3I0RB 4O8UA 4ZIWA 4CJ5A 5AQVA 4K4XA 2QYGA 5JLFA 2QLBB 4ECTA 4KO0B 4F3TA 2NUHA 4F4XA 2VPYB 2DNLA 4FJ7A 2WUSA 2PO4A 3AY9A 4KHQA 1U25A 1S9EB 4MT1A 2E5GA 2LU2A 4LR8A 4ZTFA 3U27A 4FM0A 2L9WA 4OKEA 5DGAA 4DTMA 4WE1B 1RAHB 5F0UA 3FUYA 5HQMA 4A47A 1BDGA 1CG2A 3LDNA 4XDCA 1VSMA 2B0GA 5FPMA 5GADP 2F1FA 2FDNA 1IKXA 2FC8A 3CPWM 3RU0A 2V63A 1FXXA 2I7NA 3AJ1A 4RUBA 1TUGB 3BS9A 1JCFA 1CULB 4MLEA 1KSPA 4FVCA 4U8YA 4FXVA 3CCSN 2E2NA 4DL0C 5U47A 2RS8A 2ZM6K 1M1KO 3MEEA 1X4HA 3DYAA 3OTOK 1SIWB 3WX8A 1SS6A 3KNAA 4JI6F 1AT1B 1YZ6A 3HZGA 4PPDA 2RQMA 1DLOA 1HNIB 2ITMA 3CCMN 2GMHA 2A2DA 3R1HA 5AXLA 1S1VB 3MPUB 4C3MA 4RW6A 5D0GA 3HSJA 3OQ2A 4LBPA 1HJRA 4DR6K 2O8BB 3V1QA 4NA1A 4YEAA 4DV1K 4MFBB 4BRCA 3VA3A 1CLQA 1HBOB 2HRTA 1FEEA 1HJOA 3H7HB 2OSRA 5EX3A 2F7TA 4NLGA 4OZ0A 1EX4A 2WTUA 4AHTA 3OYBA 2FYXA 4F36A 1LFWA 1ZBIA 3CG7A 3KLHB 4CO5A 3Q8RB 2IS3A 3HK2A 3UKRA 1R8BA 4LFCJ 4J9NA 3J81O 1U1RA 4ID8A 4K0KK 2Z0GA 1Y5IB 1WSRA 2MKHA 1L3VA 1CS4B 3HD1A 1BG3A 4LSLB 3MAAA 4M7YA 3AA9A 3OYNA 5FD1A 1LWEA 2JL9A 4A2BA 2QA4N 1S6OA 3RUBL 2FVSA 3UD4P 4B3MK 3KKRA 3VEVA 2X1FA 1G6BA 3MMJA 1WSJA 3GTYX 4NXMJ 4M7XA 4YORA 4NASA 2CH6A 2HAIA 1NPKA 3CCRS 3RMBA 2DTJA 3R97A 3AO4A 4C0BA 3BKUA 3TQ1A 3M7VA 4RL1A 1SQEA 1QUPA 3BQ1A 4QWEA 1XMQK 3MI7X 1G3OA 3C6UA 3MX5A 4JKHA 1HBMA 5CZVA 5GMKa 1HNWK 1U1PA 5AQJA 4MIAA 4CJ4A 3DHWC 2UUCF 4URQU 4KGMA 3SQGA 1TELA 3I32A 5CYMA 1CZBA 4ZVEA 1F2GA 3MM7B 3SJHA 3M9MB 2O5DA 1VQPS 3CCQN 5KG3A 1SV5A 3OFFA 3KK3A 3O9SA 5BN9A 1K8KA 2DGTA 4HACA 3ZNJ1 5AXNA 3DXKB 4A8WA 1MDUB 1S7IA 1RTDB 4DPWA 4U8VA 4Y00A 4TN2A 4HDGA 3CQ8A 4ECYA 1AZSA 2E1PA 4KI6A 4EZ6A 2GO8A 2Q36A 2YI1A 2Z30B 5AQQA 1RGVA 3M9OB 2BW2A 5AT1B 1NHKL 2F3JA 4B08A 3ISZA 4LBIA 2ZJQQ 5IWAF 2VOPA 3ZETB 1NBWA 4ZCLA 2VG6A 3RBXA 3H0PA 3VQPA 5D4OA 4HDHA 1W0HA 1R43A 2V52B 3SSQA 2P9SA 3TA1A 5E0OA 4ILHA 2CJKA 3TARA 4E7JA 1H72C 5E7OB 4QU6A 3D54A 2MHEA 2JEFA 1NNDA 4WU3A 4GV9A 3MR5A 4WXWA 3TU5A 4HCBA 1RUSA 4WIIA 2J0SD 1JNZB 4ELVA 4HL9A 4RW4A 3HFZB 2Q66A 2I5JB 3OFEA 3TJAA 2GNKA 2QWLA 3EVOA 1J2VA 3KLIA 5GADI 4DZDA 1XQSC 5KI6A 1YVUA 2HHHF 1XC9A 2VV5A 1HBUA 4DR5F 3SCKE 4C8LA 3I82A 3THPA 4MJKA 2BQUA 3OTCA 1RAEB 1OPIA 2B43A 4XPCA 3ZTPA 2NPFA 5AZIA 4IQMA 2OTLN 4MDAA 1KRPA 3HBTA 4X4RA 5BYQA 3QZ8A 1WC0A 5H9FJ 3DGPA 1S49A 1VQ8N 4E98A 3L2QA 4LRAA 2BJ3A 3J7AN 4MIBA 3BO2A 3HZEA 3OXFA 4OX8A 1P9YA 4NLOA 2UXDF 2LQJA 4ICLA 2WONA 1BHNA 1HI1A 1SQGA 3NGIA 4CIGA 1UVMA 1VRUB 4NA3A 1U1LA 4AHCA 1DEJA 3VGLA 2VBYA 2UXBJ 3WXIA 2GJFA 1E6VA 2EEYA 2ASOA 2W4DA 4F4WA 3CHWA 1U0HA 1RWOB 2EK6A 4CJRA 1TFYA 3T1HF 4HI1A 3HL8A 2FSJA 2QLWA 3PX6A 3CCWA 4ZMMA 1FKAF 1MLAA 4CW7B 2PC6A 1TUWA 3OUYA 4E7HA 1E4FT 2CJYB 2P9LB 4B9UA 4H5RA 1S77D 2FC9A 2G0JA 2XC9A 1WJ9A 2A3JA 5AJ3F 4DLGA 3QFPA 3KKSA 5LJ3Y 2NXJA 2DIVA 1Q7LB 1I39A 1LKZA 1SH2A 1LXNA 4CM0A 3TA0A 1SBRA 3H08A 3OVAA 2LFVA 1NDKA 1WKJA 2Z2YB 4Y65A 4ED6A 1REGX 4TVAB 2WBMA 3AOBA 1P8ZA 3H45C 2XYGB 4GKKJ 4HUEA 2B51A 4N56A 4DV4J 1Q79A 2OPRB 3ZTRA 2XO6A 3FZFA 4YDUC 2XULA 4LD0A 3UD5A 2V8VA 1IBKJ 4LF6F 2OCEA 2W2MP 3EZOA 1I51B 4DL5A 2DGOA 5SUHA 1KN6A 1ZPVA 4YOWA 2HB5A 4NZ6A 1A6LA 5GIPA 4WTYA 2HHSA 1TQLA 5J2PB 3J81Y 3OJUA 2XS5A 4DQRA 5DGBA 2BE2B 3IFRA 1YRXA 3BBFA 2AX1A 4M3YA 2DNOA 5KFIA 2ZBRA 4JI5J 1UJ6A 4DL7A 4MO4A 4X64F 1ZAWA 1C6VA 4FW2A 4DR2J 2Z1IA 3IWLA 4K4UA 1RBVA 4JI1J 1XNQK 1I94F 4GV6A 2ILZA 1UMJA 4LF9F 2E8AA 1WC4A 2BMBA 3VEXA 4J2BA 2CADA 1ZAXA 5K14B 1C1CB 6FDRA 2KL8A 4IFVA 1TL3B 2MZTA 3NGZA 2XYPB 3OLBA 3NGRA 2OZMA 1L3KA 3FBBA 2VC0A 1JWWA 3LAKA 3ZSYA 3WNHA 3KK1B 2FPHX 3S1TA 4PG7A 1RFQA 1IV0A 3KK7A 2QMUB 2QTDA 1R59O 2O8CB 4ILJA 2RF2B 4PG5A 3D2FA 3M8PB 4YDDB 3HHDA 2QT7A 4W92B 1ZH5A 1QSLA 1J27A 4UOFA 1RTHA 1K73T 5KRTA 3S8SA 4UOGA 5E3RA 1ATRA 2Y1LB 2L3MA 3VOVA 3R6MA 3HM8A 3G8TA 1JLEB 2HRUA 3M2VB 4ZPBA 5AQPA 4K42A 2CDRB 2AT1B 2JC0A 2PEBA 2B3TB 4C8MA 4L73A 3FFIA 5EXWA 4XPEA 5L1IA 4MTPA 3ZSQA 4RW7B 2NLXA 4CJ7A 5F8LA 4HR2A 2HMPA 3ZX0A 3IUCA 2DEJA 1H73A 2PD1A 4JI7F 3I56S 4USWA 3BPSP 1Q18A 1B7YB 4GVEA 3TZZA 3D2EA 1C0UA 4FO0A 3I4HX 1XEZA 2RRAA 1N36J 2BANB 4JI8J 3VTHA 4LF4K 3M5RA 4P2FA 4FF2A 2YX1A 5KPRA 1RDBA 3GQCA 4IKAA 1CZAN 2VFRA 2BABA 5A8RB 5C24B 2YX6A 1VQKN 2WAQD 2ZGYA 4ED2A 2VGNA 5EOYA 1D9AA 4YP3A 3RRGA 5LT5A 4NRTA 4M5MA 4JOUA 2CJAA 4ZDNA 1QQCA 3HOTA 4J2AA 2ROEA 2BXJA 3G4SS 4C98A 4A8SA 1H0HB 1FJGJ 1YJ9S 2U2FA 3D1OA 3R7BB 3HVTB 3P45B 1KXPA 3LANA 3CF5Q 2M52A 4BR4A 3JXOA 3DM2B 1RQ0A 5DDQC 5CZXA 4BRAA 1RLCL 5E26A 1AB8A 1RWUA 2MKCA 1BQXA 2QGFB 1WC5A 2D69A 3J7ZT 2P9NA 3UKUB 5AQLA 1VOMA 3QLHA 2QA2A 5BRHA 1TP7A 2W8KA 4OL8A 2AMCB 4DV3F 4K25A 1CSJA 3VZIA 4ZP7A 1ZBUA 1Y64A 1DY3A 1U8WA 1U6FA 2RHSB 4KGZB 2PSZA 2XQCA 3LO3A 4DSEA 4CERA 3MN6A 4E7KA 4BC3A 4EYHB 4MKBA 5HJXA 2G1DA 3VAGA 3JAMU 2J7UA 4BQZA 4FJGA 3KWIA 1MMLA 3GLJA 2EFPA 1K6YA 3VF6A 3BF4A 3RMAA 3KNGA 1B9FA 2FZGB 3NCPA 2XGQA 4JNEA 2HVHA 5CR4A 4WZMA 1S1XA 3O8WA 3ZZZA 2RQ4A 4DPTA 3FMWA 4RNFA 3J7Z5 5ETOA 4WFNL 3QJJA 2HNYA 4I2PB 2R8HA 3F9MA 1JQGA 4W98A 3HDSA 3ZTSA 3DXMA 4CYUB 5LMNF 4PZVA 4Q44A 3OHRA 3CDBA 1HW9A 3QETA 3FQKA 3LOUA 2FTRA 1GLJO 4IG0B 5E84A 3ZX3A 2ZKTA 2HFSA 1IBLJ 1H38A 4IQXA 1T44A 2DNMA 2KT5A 2WVBA 4CLKA 5L46A 3D6FB 3RBEA 2XY6A 2WVDA 1UOCA 1QSYA 1KP6A 3C16A 5D6GA 1RT1A 2C2ZB 3D7SB 5EWFA 5HRPA 4FYVB 4WFAL 4CIEA 2H4YB 2CPJA 3OYDA 4LFCK 4RW9B 4WQ4C 4LFBJ 1XJWB 3AVMA 4ES1A 3HF5A 3FCWA 3TRGA 3GWCA 4KB1A 3BSAA 1NJXA 1W2IA 4Q2MA 1XR7A 1U0SA 4K7QA 4NXMK 1KVJA 1WSFA 4EBDA 1Q7YT 2K7KA 1NGAA 4EWTA 1C1BA 2R7YA 2EVZA 2HHXA 4BC7A 1CLFA 3LUYA 3GG1A 3K2PA 4QWAA 4WIQA 1FJ7A 3DOLB 3O6WA 1LFPA 4FM1A 4FS1A 4GC6A 3D9BA 4BR2A 1APSA 2GGPA 4U6PA 4RBVA 1IM6A 3RW6A 3OL8A 2JLGA 4MKVA 2HHUA 2JFKA 1GK8A 3KLGB 5FROA 3H90A 4PG4A 3T6JA 1QLNA 5IM0A 5KQ8A 4OIXA 1AFJA 3EX7B 1MU2B 4H0XB 4G6VB 2RDJA 3P38A 4J9OA 3H42A 3OYAA 2LQ9A 3JQJA 3ILOA 3PYGA 2AP1A 3MCOA 3H1QA 4GO7X 1AA1B 1QVGM 5D15A 1HUXA 4HHJA 2XZWA 3MPVA 4LIRA 4I7FA 1YHQN 3BGOP 3QJLA 4IOAL 3LL3A 5D77A 4DFPA 5GAEU 1HPZA 5L8RC 1UZDA 2CZ4A 2LDIA 5LSRA 1VQLN 2DNQA 4M94A 3PY8A 2OTJN 1UP1A 1UPMB 2ZH8A 2Q31A 2VL1A 3MM6A 2DVIA 1DTTB 3MMBA 4BRDA 2EFVA 2UXCJ 3IR7B 2AHOB 3TSPA 5KPZA 2W7PA 5TKYA 1Q95G 1ASUA 2Z1GA 5L1LA 4H4MA 2HIQA 3MX2A 2GAGC 4ZPTR 2JWLA 3RB3A 5M1KA 4FCYA 3O9TA 2ZZMA 3VALA 4RTFD 4WK1A 3VTIA 5GAGU 4Y0WA 2ALYB 1OO0B 1VHXA 3N9UC 2Z1HA 4ZHRB 5LL6d 1YUWA 4QAGA 4YQWA 2YKQA 4H4OA 3M4XA 2XCAA 5I42A 4F26A 3OBWA 4IJAA 2E66A 5BR8J 1VK3A 3ITHA 3POTA 4Q0BA 4FYYB 1HQUB 1L5UA 3R1LA 3RVCA 2FGOA 3QEIA 4KQZA 2R2UA 2WOMB 2BKPA 3C94A 2CQIA 1RT7A 5H9FK 1CXQA 3LTOA 2G0CA 2ZEJA 2P9CA 1WAFA 3CGIA 3IS9B 3RR8A 1EXQA 3H5XA 3T9ZA 4B1XB 4KH4A 1M90O 3OTBA 4EU0A 5AQIA 3CC4N 3J7YP 2AJFE 4UW2A 2KM8C 4OGEA 1LK5A 4KHRA 4CJPA 3J80U 1N33K 1SL1A 3BGFA 4DBQA 3ENAA 2QSFA 4ES2A 2KKHA 3V6JA 4NE9C 1QQMA 2XLKA 4C11A 4ZS6A 4CZEA 2CZ9A 2P8IA 3R5BA 4DR4J 3O80A 4CFDA 3AT1B 1X0FA 2YKAA 3PEHA 1FVQA 2PT0A 2H51B 2R8GA 1VQ6S 1IKYB 3U9DA 1FNMA 4DWIA 1KKHA 5KT2A 5EHHA 4DN0A 4CDIA 3R9LA 3SZ2A 1EETA 3WHIA 2OFGX 1NJYA 2D0PA 4KSEB 4KHPJ 4KTQA 3LP3A 4ZVGA 1K9MT 1VBZA 1LW0A 1T05B 2H9ZA 4Z7CA 4WFBQ 1C0FA 3JQKA 4KPCA 5KFTA 1CXUA 3NDKA 4CEAA 5SWMA 3RYLA 1RTIA 3AO2A 1EP4A 2IGIA 1KLMB 2AWZA 3GSDA 1YVFA 1NJIO 1Q9YA 4ANDA 3UDVA 4DV7J 2NREA 4GKKK 4DN9A 3JSRA 3JTNA 1X1PA 1Q0NA 2CPFA 1FKPA 3B4DA 2BJDA 4BE2A 1DURA 1E6YA 2MZSA 4HTLA 2VASA 2A6MA 3CCTA 3G6XA 4BRHA 4C4WA 2ADCA 4F4ZA 3VGTA 2XSJA 2AJ0A 4B9SA 5F9LA 1BUXA 1HI0P 4F8RA 5G0RA 3HMJG 4FZYA 1VK8A 1OWXA 4J9VA 4JI5K 5T7LB 1YQHA 2CGLA 1HFEL 4OVLA 1S4EA 4UZCA 3D3CJ 1T3VA 2BDPA 4IFYB 3NGUA 2QWQA 1RT2B 5E3CA 1DGKN 1FRKA 3MGJA 2DYAA 1KD1O 4C1NK 3A3NB 4NOHA 4CHOA 3W2VB 1IWAA 3NEKA 4Q45A 4PG6A 4ZVFA 3R7NB 4DV0F 2D3UA 3I55S 3LF0A 1GTHA 3ILJA 1NMDA 5B0DA 2GEMA 4R0JA 1ROFA 2E6MA 2QE5A 1R8PA 5D78A 3Q2SC 1WF0A 4G1IA 1Y0HA 2MQOA 5IT9Y 2W2OP 3QYYA 1RGIA 2N7CA 4J37A 1VIXA 2Y1IA 4BG9A 4EEYA 1JLCA 4USUA 4JI6J 2EKNA 3TR5A 2RE1A 3A3OB 4F3MA 3ZZYA 1VQ7S 4K4SA 5F3ZA 3M3ZA 2O01C 2M0GB 4ILMA 3CIPA 4IG3A 5DG8A 3ZCMA 2KO1A 1JLQA 3CM6A 3CW2C 1W25A 3VWSA 4PKIA 3D6HB 3OXLA 4FJ8A 4HHUA 4CK2A 1H1VA 3H4DA 3IG1B 2B9WA 1GMVA 1NH7A 3KWMA 3VGKA 3CCUN 3AQOA 4DV2F 2PA3A 4Z4CA 3O3LA 3CVKA 4PXDA 3KDNA 4ETXA 1S1TB 4HVZA 3M6UA 1I5OB 2I9SA 3GJTB 3UWTA 4K50A 4PL7A 1BWVA 4OZ5A 4JI3F 1HNZF 2QWMA 3BB5A 4X4OA 4UQGA 1P27B 1N36K 4JI8K 1KAYA 3LA0A 1NMNA 1MROB 1R0AB 3J7YI 4MLHA 1BQMB 4I4BA 2ZJPL 4H0OA 5BPMA 3IAS9 4ZA1A 1IN0A 4EBCA 2EWSA 1NOZA 5DM6Q 4RZRA 1Y11A 3DCAA 5MLCV 3FGVA 2ZNYA 4V19J 2N82B 4FP9A 1FJGK 1WNSA 1NLVA 4H4KA 4DF8A 2JGUA 2AJ2A 2AYGA 3MFIA 3S41A 2UUCJ 3K7RA 1J5EK 4Z4EA 1GOBA 1EZZB 4CE9A 3VF0B 3QFHA 1GNKA 2DNRA 1CC7A 2FHOB 3LP2B 3QWUA 1MA9B 4JRQA 2HIYA 3C7NA 2Q1LA 4LQ9A 3DNCA 4AL6A 4IOAQ 4FZVA 2HURA 4FS2A 2HBJA 5I3QA 4PWDB 2ZC3A 4CFCA 1RT5B 2MQLA 1Q81T 1BWFO 1KVIA 4DUZJ 4B9TA 1N0UA 1FRIA 1C0TA 4N47A 1FDAA 3NGYA 3H2LA 4CT9A 2H48B 1TYQA 1TUUA 3AO3A 5IWAJ 2UUBF 2G2YA 4F3OA 3MEDB 2D41A 3PIPQ 2XY5A 5B08A 3NMRA 2IJNA 3WXJA 4PUOB 4I68A 3V2UC 4ATNA 1RBRA 2RKIB 5EUHA 2RHQB 4EP4A 1UAWA 3RB6A 3PRBA 2AEMA 3MMAB 4ZITA 1YSJA 2I6WA 3DRRB 1UFWA 1LAWA 3OYMA 3MECB 3I4PA 1T3NA 3NF6A 1VDHA 2DHHA 3C6AA 2IIHA 2CNOB 2BE9B 1GOCA 3EZ5A 2YWHA 2HNZB 4QWDA 4OHXA 1VQ4S 3AOAA 4ZVSB 1TK5A 3OD2A 5AXKA 1A5XA 3I0RA 2MY8A 3C65A 3MN7A 2WVEA 4DR5J 4NLQA 4KH5A 2DPJA 3O1BA 4KO0A 1R8CA 3OVSA 1RT6B 2VA3A 1WAJA 3KDOA 3AB4B 2NLWA 4X4QA 1S9EA 2B5JB 3QGPA 3CMES 2HHVA 2QJ3A 3L3CA 2QO3A 1WN7A 4GY2B 3ETOA 3MCPA 4LFBK 1MWKA 2ZQBA 1N8RO 2EFGA 1X8DA 3TANA 3OR2B 2NZCA 3OSNA 4P9SA 5CYQA 3G87A 3BBBA 3M2UB 4OPHA 4C0OC 4JN4A 1DAXA 2BVZA 4E0DA 3L3UA 5J2NB 3L2WA 4IOCL 5HQ8A 2HBLA 1CULA 3CCZA 5KFVA 1HNVB 2A10A 4PWWA 3FRYA 3UD3P 1VBYA 2CQ2A 4K5SA 1VSKA 4K43A 4OLBA 4DU8A 2DR6A 1MN9A 3AXKA 1QTNB 1C0GA 3TAMB 3IXQA 1V9OA 4YR3A 3QGHA 2BRKA 2YKMB 1VQMS 4KYZA 3VERA 1ELOA 3KHYA 4BRMA 2GQCA 3JAMO 4IKFA 5AJ3J 1HNIA 3FZMA 1S1VA 4B9MA 1SC6A 1YZ7A 1FFSB 4NPOA 5KOWA 3QSIA 1FRJA 1NK6A 3PFEA 4BBYA 3CNQP 2DIUA 1P9QC 2AIRB 3FBFA 1V5IB 4DTRA 4HI2A 2CGKA 4DU3A 3S3OA 4MFBA 2HNDB 2MKJA 1HBOA 1M5SA 2OAUA 3T6BA 2ACMA 3SDEB 3H8YA 2K8GA 1VQ5N 1WG1A 2GW8A 3L2UA 2E2PA 2DISA 1S0OA 2FJWA 4LF6J 5HMWA 5J2QB 2GZOA 3H20A 5ETSA 3EXYA 3UCUP 5F8HA 4Y2MA 1ATSA 2PFUA 2XSFA 4NLDA 4Q8EA 2UXCK 5M1OA 1CS4A 1RA7A 4LSLA 4OJRA 5A8WB 3I9V9 2DR5A 2VDIA 3P5BP 3TAGA 2D74B 4J9LA 1BA1A 3W0LA 2Z4PA 3O3FA 2Q0RA 4A8MP 3J8AA 2VFTA 2HGMA 4A8YA 1NK5A 4N41A 3JB9k 3UO0A 4Q43A 2G4BA 3OYEA 3FEZA 3AA8A 3THYA 4OI0A 2KFNA 1I3OB 1WSIA 2V8GA 4CLTA 3OVBA 1VMBA 4CTAA 3QEXA 1S6PB 2P9PB 1I94J 2I1RA 3OHAA 4B3TF 4CESA 3NS6A 3B54A 3LPEA 2B4OA 2KJVA 1Z25A 3OS2A 3CCLN 1IXKA 3QERA 3ENOA 4P7VA 4DUYJ 3NXZA 3Q7BA 5GADU 3MM7A 3MPYA 1N5SA 4QZVB 4OJHA 2W25A 3CJ5A 1U2VB 4P2MA 4P73A 4QYZJ 3QNOA 4OX9F 1DT9A 2Z56B 3DXKA 1QSSA 1E4GT 1RTDA 2XHBA 1RWKB 3CDWA 2QL7B 4X62J 2UP1A 2JJ4D 1SQKA 1TVRB 4V19S 5AQTA 2O8EB 1EWRA 2WBRA 5CAAA 4ZLLA 1N32F 1WI8A 4JKGA 4EAHD 1TL5A 2OIHA 1S97A 3ZETA 1MMNA 4Y3CA 4FWMA 2Q6CA 2RUSA 4F4YA 4U7UD 3R6GB 5KT3A 5HLFB 1YJTA 2ETJA 4NMXA 4AXJA 4CEZA 1B92A 1ZBFA 3AGRA 1UPPA 3KLEB 5C42B 3EMTA 2D0CA 2F9JA 1S9FA 5KQDA 4FZXC 2IBOA 4F04B 1JLBB 1N5YB 3I9ZA 5KFXA 5AR0A 4J9QA 2NPIA 5HVGA 3AVIA 2F8HA 3RSEB 4H0VB 3SUOA 4JI7J 2CWKA 1EB0A 5D4NA 2QWOA 1RAAB 4KHPK 3Q23A 3JYTB 2QMWA 2JFDA 2IVYA 1RTZA 3RBZA 3V4MA 2F40A 3ATVA 4CIOA 3A5NC 2WB1D 1DQ9A 2I5JA 2IMOA 2KT3A 1KQGB 3W7BA 4CF0A 1JJ4A 4FWSA 3P5JA 2APOA 2V68A 5B0BA 1M1KT 1NGIA 3W3SA 4DV7K 2FJVA 3IBWA 4HYKA 4PHTX 1FWLA 4IRCA 4PA1A 4KAIA 3ZT0A 1SJ3P 1JNRB 2FJXA 1PILA 1RAIB 1WHVA 4KIAA 1K44A 4DTUA 4ZCKA 3NCQA 3MAHA 1KVKA 2NRRA 4M63A 2KXHA 2GQQA 5FPEA 1S72S 3RR7A 2BH1A 2AEFA 3BSOA 5ITHA 5H9EJ 2DNPA 4CLWA 2HHTA 1RTJB 3PW7A 3KHLA 1FD8A 2CVEA 4J7CA 3ZX2A 1RSCA 2VGMA 3TO8A 2XS2A 5M1FA 1VRUA 1OY6A 1YKWA 1S1UA 1NJWA 2HVZA 4G9ZA 1B64A 1FRLA 3Q8UA 1DJ0A 5A2QU 1H3DA 2EI5A 3IAM9 1N54B 4Y6IA 3L09A 1NAQA 2MGZB 3PG9A 4YR2A 1NSAA 2F9DA 1YI2S 4YS2A 3R1XA 1XERA 1BQNB 2P9LA 4JKEA 4M5DB 4EFAC 2DEIA 1RKIA 3PYFA 3TVZA 4ZVRB 4CCHA 3WQPA 1N5QA 1RE1B 3G25A 3JAMY 5A0YB 3GBTA 4BC4A 5CE3A 2W41A 3J80O 2QN6B 2ZVIA 2OH2A 3DU5A 1OYEA 2YHAA 2VQFJ 4CZJA 2E29A 1GX5A 2E7VA 3H40A 4I2QB 2F9WA 2VQEF 3CJ4A 3LH2S 4ECRA 3CJ9A 4WFYA 5LMNJ 1KOOA 4HCCA 4R5PB 2OPRA 2GVZB 2FBYA 4CZGA 3O9RA 2K3KA 4ZVHA 1NO8A 2RDIA 5HBMB 4FDFA 3HKZD 1HBNB 1QVFR 4B3RK 2F63A 5KRSA 4B9QA 3DRPB 3GL1A 2ZH5A 3TAPA 3UB5A 4YUDA 2EG1A 2EFNA 3S6EA 3P31A 1FRHA 1WB9A 2XI2A 1S99A 2BE2A 4CRJA 5GMDA 3QT5A 1UFKA 2HF4A 3R3LA 4CF8A 5ETLA 4DQPA 1SZ2A 5B8HA 4O23A 1WOPA 1FT8A 1XMOF 4DHVA 3KJVB 3I5AA 2QWPA 3FCHA 5K8OA 3I0SB 4MDBA 3KUGA 4FF4A 2DRDA 4XDDA 2HBRB 3SSRA 4C97A 1C1CA 4C2MA 3BEGB 1TL3A 3QICA 4OJGA 5AQRA 4OI4A 2GCFA 1NZAA 5D4LA 4Y1CA 2EHGA 5E41A 2P9EA 3KK1A 4B02A 3W9JA 3PXGa 3Q8QB 4KT0C 4ED0A 4QCLA 3MMVA 3SI6A 2RF2A 3M8PA 4CWBA 3THVA 3HFVA 3KWGA 3TA2A 1PKUA 1EQMA 2UUCK 3CFRA 2BKOA 1KVCA 3RW7A 2B8QA 4FZZA 4QIEA 2E5LJ 1VSHA 2VBZA 1MNEA 2KZMA 1CJKB 1VC6A 4C3KA 2W4PA 3HCXA 1LV5A 3DRYA 3GSIA 4PEOA 1X4GA 4KB7A 1N6QB 2HMIB 1JLEA 1K1SA 2FSNA 3M2VA 2JEJA 3NL0A 1HKAA 3WIUA 5BN8A 3US5A 4FF3A 2UUAJ 5KOXA 6FD1A 5BXIA 4CJUA 4Q5VA 5K9FA 5DZ7A 3OJSA 4KI4A 2PDAA 1A5WA 4NMLA 4DUZK 1KHVA 4OZNA 4RW7A 3CDUA 3N5FA 1YGYA 2ILYA 1EQYA 5IWAK 1FRXA 3VR1A 2V50A 1IKWB 1NM2A 3L95X 4LF8K 4J2DA 4MQ3A 2L41A 4DFKA 3GB0A 1TV6B 3UN5A 2FF6A 3CJSA 2BANA 4LFAJ 2KHOA 2AEJA 4Q2LA 3R27A 1CJTB 1UVKA 3BBCA 1HARA 4FLTA 1Z26A 1OH6A 2AA4A 4Z4HA 4UUXA 3QIPA 4FK0A 5C24A 5L39A 2GWKA 3IBCB 3CJ3A 4WQ5A 3CD6S 1GTEA 2QSWA 4CJVA 3TEHB 1EKEA 4K4WA 1UEVA 3AVCA 4WYBA 5KG7A 1FE0A 4G1PA 3P6YC 4QWBA 1KDNA 4CLUA 4GKJJ 5ETNA 4YOTA 2GA7A 4GVBB 4DX5A 2WK4A 4CFBA 5EX0A 2W6KA 4OHZA 4OI6A 3HVTA 4BRGA 2V2ZA 3M30B 3KD5E 2E1ZA 3TTFA 4BRQA 4YHHJ 2CG4A 4DR5K 5HVHA 4WF9L 4I6AA 1SUQB 3ZZPA 4JKFA 3UKUA 2UVWA 4U9RA 3PIOL 4S0MA 2VWBA 3O44A 3FC9A 4X65F 1S76D 1Q1KA 3CCVN 2FIUA 1YIJN 2HEKA 4NI2B 4O44B 2NYIA 2J6SA 2Y8YA 3NCIA 2X1AA 1HWJA 2VIHA 4E89A 1U02A 1O8BA 4M3ZA 4L75A 4J9SA 4B3SF 2G8HA 1RU2A 4E19A 2OZSA 1XR5A 5IC6B 3EYZA 3EDRB 5KT4A 4CLLA 2ZBIA 4YB1P 3WNEA 2XMUA 1F3FA 1AUSL 2HBKA 3F41A 4JK8A 2ZH1A 3RMCA 4ANCA 2HG4A 1YJUA 2VKRA 4AM6A 2GC8A 4BVPA 1IH7A 5AZJB 2PBDA 1C4AA 4NLSA 2FHJD 3LDQA 1QQNA 3JS9A 4Z0UA 4TXSA 2PGCA 4Z94A 4NLTA 3KLVA 3J80Y 2OP5A 3T5LA 2OSQA 3K8WA 4I2PA 5DQIA 2H4WB 3VENA 2ZNZA 3UR3C 3H98A 2QMXA 3RG6A 4WXOA 5AJ3K 4Z4FA 1M1GA 2LYVA 1FDDA 2FSKA 4W4MA 4O4RA 2F4VJ 4RO0A 4AFFA 4NRUA 1T03B 1RWVB 3WDOA 1ATNA 4IG0A 3M1FA 3RRKA 2PI4A 3FZKA 2GMLA 4CJFA 2EPIA 1J54A 4JV5K 4IEIA 3MXHP 1Z05A 1XTZA 1CEZA 3ZFVA 3PVXA 1RWMB 3RZAA 4QIVA 4K4TA 2W42A 4LF6K 3DLBA 1S6QB 2H54B 2VJUA 3ZEUA 2O8DA 4Y0FA 1WEZA 3G0ZA 4RW9A 2QG9B 2HZVA 1TKXA 2J7WA 2KRBA 1KCFA 1PJ5A 1YJ7A 3PJWA 1RYRA 2GQ2A 3TOQA 2W2QP 3EE9A 4DOZA 1BO5O 4CGIA 1U2FA 3UNGC 1WWHA 2B56A 5HRSA 3I56N 1ITGA 2PMWA 4CEEA 1N56A 1UVJA 2O4GA 3L7PA 1BC6A 2KXFA 3NOGA 1ZBLA 1QHAA 1P6TA 1UWBB 1K9MO 1YT3A 1NSKL 4CVNE 2Q6BA 3V4IB 3EM1A 4MAKA 3MCMA 4DV6K 3ZTQA 3PYEA 2HLUA 4CF9A 3CJKB 5KFJA 2C28A 3DOLA 3THWB 2POKA 2IA0A 3G2XA 1HMVB 2ZM6F 2E2QA 1KTQA 1NK8A 4F4AA 2D3ZA 3OTOF 4DUYK 4PXEA 2IC3A 4ENOA 4G65A 4DX7A 2YKNB 3G4SN 3KLGA 1U1NA 4WWSA 1MU2A 1U48A 2Z2MA 3BR8A 3MM8B 4K5RA 1RKJA 2PYLA 1X60A 4X62K 4CLSA 3H5YA 4DR6F 1RBOB 1RHJB 3U1MA 4DV1F 3N4QA 2F8SA 5C12A 1NGBA 3PM9A 4IO9L 4M3XA 1S1WB 3GJQB 4A46A 4O0JA 3EWGA 3BSCA 3VQTA 2ROPA 1IVZA 4B3OB 3KJFB 2AJ1A 1U26A 1PGZA 2HWIA 2A2CA 2EFOA 1HYVA 3PHEA 4EMDA 3M32B 2QTWA 3RWUA 4OI1A 5KG4A 4K0KF 1U6BA 3NGTA 4DV2J 4R0EA 5D0HA 1R6VA 5LOQA 3O3GA 2MZQA 5J1EB 4Y34A 2Z2LA 4KHYA 2UVRA 1RT3B 8ATCB 5KFQA 1HLWA 4AQYF 2J7KA 4B3MF 1DTQB 2IM0A 1U2CA 4JI7K 1GX6A 2CDQA 4ZVTB 3UVJB 1HNZJ 4IEEA 2IYGA 2AYBA 4DS4A 1KTVA 4FPIA 4ZHRA 3EICA 3PZPA 2ZZTA 3N6LA 4JHDB 4PKGA 2FVRA 3G8QA 4KFBA 1KAXA 4P2SA 1XMQF 2KLAA 3RAMA 3CCJS 3NOCA 3ZC4A 3V9XA 1HNWF 4Q8FA 1VJWA 1QAIA 3IO1A 3A13A 1M0SA 5KFEA 3DOMB 3CCSS 1HQUA 1Z4UA 4FJLA 4H0TB 2OPPA 4RNMA 1J53A 1ZC6A 2IHR1 1WUUA 5H9EK 3PW5A 3IS9A 1UETA 2CNLB 3MPWA 3ATUA 1WHYA 2OEJA 2YWEA 4LF7J 2ASMA 2A1BA 2FC0A 4C8YA 1RU1A 4DU1A 1OSCA 1KLNA 3H2VE 4MK7A 1O5JA 2IDEA 3H46O 3THTA 2J8SA 1HHQA 2QFIA 4B1VA 3T19A 3L2RA 4LT6A 1R0CB 3AVAA 1X7VA 3P3DA 5CZ1A 4Z4GA 4WCEQ 1IKYA 1NG9A 1S79A 2YPYA 1J5OA 1BXNA 3OHBA 1FXLA 4DSLA 3C2PA 2UUBJ 2A1SA 2JEIA 2KVQE 4OHYA 3ULEB 1AFIA 3BGRB 1RISA 2W2PP 1T05A 3BDEA 1OYDA 5AQKA 3VQ8A 1GFWB 2B8PA 1AROP 2CVIA 4AHVA 4DQIA 4BWMA 4JKAA 4FWPA 3C14B 2C2NA 2B6AB 1S0NA 4PYDA 2VQFK 2KT2A 3HM9A 1DHMA 2V8PA 1FI4A 2QEXS 3BN4A 3FEXB 1Q5VA 3HXMA 1RYSA 2GFFA 2W9CB 2ZC4A 3FGUA 4FNHA 2FVPA 3NNAA 1WHXA 2B4UA 1Q81O 1LWCB 4KV8B 3BREA 3GFHA 5AQMA 4ZP9A 2W9AA 3CCQS 3M8WA 3BYRA 4TU7A 2E88A 2J8AA 3AHPA 9RUBA 2BJ9A 1FRMA 2YHBA 5K5MA 1F5AA 1VLYA 2VICA 4AT1B 3H5UA 4LF5J 3WBZA 1OMSA 5GIOA 4AM7A 2BZ2A 4LVNP 3G82B 5T7BA 3HT0A 1BY9A 2C2KB 4ED5A 3HRGA 4IFYA 3PYDA 4CNYA 4HH0A 4FN5A 3O9UA 4CLFA 4M42A 1T9TA 1SB6A 6AT1B 3UW1A 2KG1A 3W2VA 2OUGA 4JYAJ 2VB6A 2A1RA 4JK7A 3TX0A 4DL3A 1WNEA 4YOUA 1Y3KA 2W1BA 2G2ZA 3RJMB 4FOIA 4F0KA 2YQ0A 3DU6A 3Q24A 1D0EA 1D3WA 4QOTA 3OYJA 5D0EA 2HFNA 3DFEA 3VV2B 3FE1A 4BWJA 4X2BA 3K0SA 2QKKA 2R2TA 4LH4A 3IFEA 4TY8B 4J9MA 3LGHA 1B9DA 4EFHA 4MIWA 1CVJA 5A2QO 4I56A 2YWGA 2P51A 5FIIA 4N76A 2K06A 5HATA 2E5LK 4PXBA 4CHQA 4R8UA 1QVFM 4LY7A 4I6WA 3AARA 4BACA 3O1LA 3O4NA 7FD1A 3MURP 1FDBA 1JXVA 3HPGA 2UUAK 5ADZA 4BGAA 1Z2ZA 1VQNS 1BWEA 1YXQA 4CF2A 4GC7A 2HF3A 3IG1A 5EWEA 2PZSA 5FDLB 4PQAA 3H3NO 2OHDA 4B8AB 2RU9A 4TLRA 1M90T 2ZWOA 1S0MA 3VF2A 1S1TA 4QS8A 2ZJQL 2M2BA 3MXMA 1KS2A 1T9UA 1UA0A 2LQ5A 3V6DA 3CYMA 3ALYA 3BGLA 5HN0A 1SC1B 4OFZA 4BS2A 1X9MA 2UVVA 3SK3A 4UY8T 3OFGA 1VQ6N 4O3QA 4LFAK 4P71A 1XNQF 3SIPB 1GMUA 2IRXA 1R0AA 2HFZA 2NSBA 4HT5A 4CF1A 3KLFA 3CT9A 2E7XA 4TU9A 2BQ3A 1YBTA 1F2HA 2W6LA 1SQFA 3AVLA 4GO5X 4X84A 2XNRA 5F8NA 4BR0A 4GKJK 4FPRA 2I38A 1IJJA 1ZM9A 3DLEB 1T11A 3LP0A 1FFWB 3MWBA 2LEAA 2PAVA 3P8BB 2DFFA 3VQDA 4B3TJ 2BYCA 1P1LA 4YHHK 1F1BB 3IR5B 3VEZA 2J5AA 2J6TA 3DLJA 1O13A 3AA2A 3J7A1 3LP2A 1SCJB 1Y4ZB 1B70B 3AVFA 3HVRA 3HI0A 1TL4A 2KHDA 1SJRA 3HPOA 1ASWA 4Y2CA 5KG2A 1NGJA 1YBAA 4KGKA 4OX9J 1PO6A 1B7FA 3RAQA 2EWHA 1K8KB 3DDIA 1RT5A 1RAOA 3R8YA 2ZBQA 4JKBA 4K8ZA 2LXUA 3OW2M 4NCBA 4NO7A 2BX6A 4IH6A 1D8ZA 2E44A 5HL7Q 3UI3A 4WJBA 1QY7A 3MEDA 2DNYA 5F8IA 4CIFA 4TKTA 3PDNA 4CD1A 2DB1A 5KFMA 1HHTP 2HWHA 2LA6A 4PUOA 1IR1A 4OZ1A 1ZA1B 3N01A 3UDEA 3I55N 2LEPA 2RKIA 3N79A 3X1LB 2SXLA 3M6XA 2DNHA 1MN7A 1DQ8A 1RHKB 4LREA 3P83D 3IP0A 2I8EA 1X4CA 3DRRA 1T02A 1TUYA 3WQUA 3RBDA 3V9WA 5FPDA 3D6RA 3MECA 2VUGA 3EY1A 2V34A 1KEKA 1CC8A 1KONA 2DGSA 3C6HA 3B8HA 2R7VA 4H0YB 2F4VK 2HNZA 2HQGA 3ENWA 5F3TA 2WW8A 2C3PA 3MZIA 3FR0A 1WTBA 4U67L 2KHCA 1U47A 4CP5A 3RGIA 4CFAA 1VQ7N 5KG1A 2C3UA 4X4PA 2FUG9 1YAGA 4ZVUB 4IR1A 1T94A 4RUAA 1RT6A 1XHXA 2IVMA 3E01A 4PR6A 3IGNA 2B5JA 1PBAA 4DKWA 3SPZA 3P1GA 2XNQA 3AJDA 1RILA 2X3GA 2R9LA 3MXJA 4PRFA 4DEZA 3DGPB 2HVIA 1QUVA 2JVRA 4C8ZA 4H8KA 2MJUA 4AUKA 1FO1A 1XR6A 3PX4A 2FHKA 2QL5B 2GELA 3M2UA 3TI0A 2DR8A 1ZM2A 5J2NA 3SQ2A 1YRUA 1MG7A 1IBMJ 4JD2B 2B4PA 5LJVA 4LRFA 2DTUA 5LSLA 2JWKA 1N48A 2HBZB 5C5JA 1HNVA 3D67A 3PKMA 4FWQA 4FJKA 2RVJA 5LMUJ 2IJFA 4NLUA 4ED4A 2M8DB 1WOSA 2O1PA 2XMTA 4IH7A 2YX7A 3TAMA 5A2QY 3L3VA 2CQ0A 3QSYB 2X7IA 1RHMB 2GMJA 4XH1A 2XCPA 4NXNF 1ICEB 4RCHA 4K2JA 3ISNC 5KFOA 2ASYA 1RHRB 3O2IA 1YTAA 2W9BB 3PX0A 3EGWB 4B9LA 4J5OA 2HNDA 3NGDA 2R2SA 2ALZA 3U3GA 3SDEA 2E9RX 2EFQA 2F8TA 1MMDA 3LDSA 1OH8A 3MTJA 2HW3A 4CEOA 1GLBG 1F60B 3EEQA 5HRRA 2LU1A 2HPUA 1VRTA 2HFVA 4B1ZA 2HBQB 5F9NA 2P9KB 5DETA 2YWFA 5J2QA 3ICLA 1OIAA 3TX8A 2KXNB 2G13A 2NRHA 4KRWA 4HH1A 2YKOA 4U7UK 1FJEB 2DK2A 4CBUA 1RCXB 4LFCF 3CFOA 5A8WA 2IPOB 3KHRA 4HHHA 3LDLA 3N4PA 4NYZA 3LPUA 4H54A 2GIQA 4OO1J 3GYXB 3G9CA 4JBCA 4DTXA 3GFYA 1TKTB 2XLJA 3DLGB 4QPTA 2HFOA 3ZT1A 4AHRA 1NKEA 1HNZK 1RT4B 3NAHA 2GUIA 2DH7A 3VZHA 3ZT3A 3NGKA 3OT9A 3NVKA 1S6PA 2P9PA 3BR9A 2KKZA 3ZT4A 1PIEA 2FZKB 1XI1A 3CD5A 2FGCA 2NS1B 4P75A 3ZZTA 4KGVB 4YOYA 4Y1DA 4YB5A 3EE3A 4LIWA 3EVWA 2MLYA 3PCOB 3SSSA 1VBKA 4IWVA 4DR3J 4IFVB 1DARA 1RCHA 1RDDA 2DNNA 2J4RA 5C2GA 1GLLO 3EL2A 1T3OA 1YWXA 2O66A 3DDKA 3W9HA 2G2OA 4J9UE 2MY7A 2NRWA 1TK8A 4IO1A 3TTDA 1AYEA 2M5YA 4BRFA 3H5SA 3NH0A 3CF5L 4DR1K 4JI0K 4FKYA 2YPZA 3HSZA 3T9NA 3WNGA 1TVRA 2YNIB 5A76A 1EQ0A 4LF7K 2O8EA 2DD8S 5MAOA 1RTHB 3EJMA 3AA3A 2EC0A 1X5TA 3CMEN 2RB7A 2MZ1A 3QT6A 5GINA 3W5XA 2H5JB 2R7UA 2GV9A 1NGEA 3VAKA 1FFGB 2CPZA 1KQFB 1UVIA 3HI9A 1XN9A 3SQOP 4BRPA 4LUBA 4N77A 2C2DA 4IYQA 3B82A 1G15A 4Y2IA 3VEYA 5K20B 4H4KC 1F0XA 5HAOA 3KLEA 1N8RT 4KE5A 2BV3A 3V1RA 1X9WA 3ZSRA 1JLBA 3GIRA 3HOSA 4O4GB 3OYGA 4AD6A 4CJLA 5HOOA 4O8KA 4MK8A 5F0XA 2CQGA 1S22A 3VGUA 4BLGA 1N5TA 1C0UB 3UE5A 2N7YA 3WQTA 2CJBA 3GFXA 2FBTA 3Q8VA 1VQMN 2ZWPA 5I3UB 3VESA 3OXGA 2P9UB 3OS0A 1VC5A 2OPSB 3ASMA 1FXDA 3MCAB 4FJIA 1OH7A 1PYSB 3BQ0A 2WB4A 1T6CA 1VC0A 1NEEA 1VQYA 5E3AA 3HKWA 3E66A 3QRPA 3LW5C 5LM7E 4FJ5A 2KYZA 4URGA 4CJTA 4U95A 3MPDA 1SXLA 3BGUA 4DHYA 1UTAA 1VRQC 4CJ3A 4EHTA 4CNZA 1WDTA 1N5VA 4C8NA 2KI2A 3LZJA 4DLEA 4YY3J 1RBTA 4LF5K 1XHZA 2VFVA 4TU8A 1BA0A 2YCHA 4X65J 4I1TA 2X74A 4P52A 4CZHA 1SAZA 2CPEA 3VPZA 3QLHB 3N28A 4MMOA 3T1YJ 2C2OB 2HK2A 3KJQB 5IQQA 1N33F 1PAUB 4FOEA 2RHKA 5G4DA 1DRZA 4USMA 1P1TA 2D5RA 3HHLA 2OTJS 4FWKA 4KHUA 4JYAK 2MGZA 1NK0A 1UW9A 2IMWP 3PLAA 1JB0C 3ZSWA 3SMZA 3W5YA 4IR9A 5A6WA 2E5HA 1BQNA 4M5DA 4FKXA 3MD1A 2WRMA 3DRXA 3CDAA 2UU9J 2FLOA 1LEOA 1JJCB 1WDDA 4CGHA 3KJNB 2V8HA 2JNJA 3HSDA 1S1XB 2ROGA 2D1CA 3K5LA 3NP5A 5DLGA 4ZJLA 2ZKUA 5KFNA 1OQ6A 2B4JA 2G8FA 3DRSB 4U67Q 3EUNA 4I2QA 2ZE2B 4FVMA 2BQRA 5DRKA 5A6PA 1XK8A 4DU7A 1IJFB 4R5PA 4JI4F 3TSUA 4EK2A 4NX9A 3L4QA 5AQYA 3PO5A 1N52B 1Y00A 3CIMA 2HK3A 5HBMA 4USJC 1HBNA 5JMNA 5DQHA 1N34J 4I6MB 4M41A 3VN5A 3PACA 3DRPA 3B6OA 3LWLA 4MKAA 1Y5NB 4NCAA 2JX2A 3L4BC 1BHLA 3H6EA 5B0AA 5RUBA 4QIWD 1Y9OA 1TL1B 2L08A 1EKSA 1NB7A 1AW0A 3UFCX 5F8MA 1OH5A 1F6TA 5CD4A 2EBEA 4JI5F 3KJVA 2X6NA 5IC4B 4I0WA 1Q82O 3FRZA 1D1UA 3V6HA 3AA4A 5H1SQ 2R4FA 2V4RA 2NCKL 3CO9A 3F5TA 4KBIA 3OR1B 5AE3A 1MWMA 4OPJA 3OSPA 5DQGA 2QYCA 2VG7B 2DY9A 4A8OA 2RPIA 5HROB 1YJNS 4J9RA 1SC3B 5HQLA 3OBYA 3G86A 2A6OA 2JSXA 2CNNB 4RBUA 4ID1A 1JKHB 2A6AA 3Q8SB 2ZD1B 2N3OA 5B7WA 5CCLA 2CIMA 5DM7Q 1PSDA 3IA0A 3PEJA 3KOAA 3EGZA 3LM2A 1D9FA 1GLDG 4YMEA 2PN6A 3FZLA 2H5EA 1CJKA 4OJ1A 2XMJA 4XEIA 2YTCA 4CJKA 3G6VA 4CH7A 8RUCA 2AGOA 2RIJA 5BYRA 3SMPA 4OX9K 2M70A 5IM0B 1R3NA 4O55A 3BN7A 2GTDA 1GH8A 3D28A 4K2XA 4USVA 3MUTP 5BRFA 2LECA 4RU2A 3MUVP 1XWLA 4DSFA 2O67A 1V6HA 3DKDA 4DV1J 1NJZA 2MPUA 1VSDA 3KK2A 3MM9B 3R7SB 4WKRA 3CE8A 2P2CB 1HR0K 1HPZB 2D7SA 5E3PA 1IKWA 4ILRA 4X4VA 3GJSB 1TV6A 2M4MA 3P49B 2X51A 3MMBB 1YI2N 4KRFA 1O51A 1TR0A 1CJTA 2DNZA 3AQPA 1N36F 4E1MA 2A3ZA 4DTSA 4DSJA 2DCLA 3D6MB 4NLRA 5GAHP 4KY3A 2VWJA 4AQYJ 3VAFA 4H4MB 3T3FA 2HSTA 3R5CA 3C15B 3AD8C 3PKYA 4WFBL 2KVIA 1WOOA 5LY3A 3DMJB 3MEGA 2R7QA 4M8LA 5T14A 1S59A 1K1QA 4QOZB 1Y7PA 1B4SA 4PQUB 4OZ2A 4P6QA 4A5BA 5L1KA 2NRZA 5HMZA 4P2XA 1JJ2R 4R79A 3M30A 4NLPA 3R5AA 3D68A 3DXBA 5IT0A 1FJGF 4FPBA 4XTTA 4H4OB 4BROA 3R9PA 4ISFA 5F8GA 3AVHA 4BRNA 1J5EF 4X4NA 2FJBB 1SUQA 2VYPA 4JI2F 1CBKA 2CWXA 1KQKA 2PEHA 1URRA 4NI2A 4O44A 5IV3A 3RB4A 2UUTA 4DV5F 4MH8A 4CH1A 3CJ7A 1RAGB 4DR7J 1VR6A 4M5JA 4FPAA 2HS3A 2HAFA 1R0BG 3D0HE 1F5CA 1UVNA 1L3UA 3NAIA 4LRBA 3SAGA 2FY8A 4NYPA 1HNXJ 4ZPDA 3HJVA 1JIHA 3L8BA 2WHOA 1LAVA 4UOHA 1FNOA 1S6UA 3I8BA 5BR9A 1C0MA 2VG5A 1IBMK 2GJIA 5AZJA 1GLAG 2YY3A 4ZJQA 4FJNA 2V9WA 3U02A 4M63C 3DLKB 3FSIA 1T9WA 4BDPA 5LMUK 1GXTA 2P5OA 2H3EB 2CH5A 1RABB 1WSHA 3HHKA 1CQMA 2PFDA 3FEYB 1U1OA 4PCQA 3SV3A 2XRIA 1BL3A 1EETB 2FF3B 2ZHOA 3OY9A 2W7AA 2W7OA 3SAHA 1EIYB 1REVB 3HVAA 3ID8A 1T03A 1N0VC 1LW0B 4V1Ak 4FYWB 2V2KA 4TYBA 4OHWA 4ECZA 4YOVA 3GV5B 5B09A 1U1MA 2DHXA 1YTYA 2ADBA 3O8MA 1NK4A 3JQMA 3G6YA 1S6QA 3W65A 1FKPB 1NGFA 4OYIA 2B7BB 1VIOA 2OMLA 3SYZA 5AQXA 2GVDB 3S9HA 4USTA 4BE0A 5AQHA 2MKSA 5DLFA 2MQMA 2PFFB 4LFBF 2MB0B 1ACMB 3JSMB 3TEGA 3FLCO 3VQSA 4G1QA 1NKCA 4FLUA 2UV8G 2DGXA 5JVHQ 4QPXA 4ED8A 4M45A 1UWBA 2OGUA 4KTWA 2HS0A 3V4IA 3TVYA 3GOIA 4IOXA 1Z6RA 4XIUA 5KPTA 2NR0A 4LSNB 2HOEA 1WC1A 1QE1A 1WC3A 3VAIA 3CJKA 5KT5A 3VGVA 1UJ5A 1ZZNA 1HMVA 3M8QB 4TY9A 3UDCA 2MSSA 2HHQA 4DR3K 2HQCA 1KHWA 3W64A 1N88A 3M05A 3DGVA 1WSGA 2L48A 1A9NB 3CJRA 5DM6L 4PKDB 3LGMA 3FZHA 5KFLA 5JVGQ 5C2FA 2UZAA 2HQDA 1YITS 1Q8LA 5LJWA 4W90B 3MM8A 3QEVA 2FHJA 3TAQA 3BH6B 5F0WA 1QAJA 1IQZA 3TW0A 5GAHI 5JUMA 4PWUA 2DKOB 2ITGA 2RAQA 1XNRJ 2WFBA 3MMCB 1M5KC 1NPRA 2HHWA 2VJVA 5BRDA 4KJIA 2J9DE 4DTPA 1RJJA 1Y97A 2W40A 2HQIA 2V8DA 4M1KA 3BO4A 4L8RB 2XI3A 1RDCA 3DOKA 2R7SA 4B3OA 4IG3B 1JXEA 2VZ9A 4P10A 3WIVA 2OYQA 1RP5A 3M32A 5HI7A 2GWJA 2UXCF 3BF3A 2C1EB 4KH1B 3BSNA 4O0NA 2ZHAA 5J1EA 3RB0A 3A4TA 1RT3A 3NVMA 1D4XA 1CJVB 3D7EO 5KFWA 1BE4A 3PIPL 3UVJA 4WP3A 4A62A 3LPYA 3TSQA 3AD9C 2I7PA 3OL9A 4MYUA 2ASLA 1ASVA 4PG8A 4CGDA 1IG8A 2P6TA 4FYDA 2ZH2A 3CUNA 3QT8A 4URSA 3DOMA 4CJSA 1RACB 5E2QA 1JLAB 1RDWX 2CQPA 2I0XA 2OEMA 4ZVOB 3IKMA 1Y5LB 3WC0A 4YY3K 4QYRA 4B1YB 5A8KB 1X4EA 3KFWX 4FW1A 3AD7C 1R89A 1SVDA 3K2YA 3IRXB 4WQ5C 4X65K 3M2RA 1JLFA 2VF3A 3RMDA 1IR0A 1MWYA 2QWNA 5DO2A 3CIZA 2ZITA 2UXBK 1ZM3A 2X1BA 3T1YK 1VQ5S 4UY8O 1V3ZA 5KFAA 2MKKA 2CFXA 3S3MA 5AXMA 4DPUA 1DQAA 3KKFA 4L74A 3E3XA 4HTIA 3E2EA 4EGLA 3BF1A 4JV2A 2CQ3A 3SI8A 1B3TA 3DLRA 1C0TB 3VHQA 2G1HA 2KH9A 5E5NA 1WEXA 3A5MC 2ZBPA 2ZBCA 2UU9K 4N8OA 4LQ3A 1VQ9N 3BGRA 4IZ9A 1NXIA 2IBKA 5JMVA 2DH9A 5AQGA 2MYFA 4RKUC 2IYIA 2YX4A 4JB8B 3HP9A 3B6PA 1G2EA 3C14A 2B6AA 3CJTA 4DZ6A 5J2MB 3L6QA 1D09B 2V94A 2ZJRQ 4OZLA 4KKOB 1G7CB 3GE1A 1IQTA 1ZZFA 4DV7F 4DV4K 4FWOA 3SUNA 2W9CA 2DHAA 1IBKK 3SQ4A 5L9XA 3K59A 1BGXT 2XWXA 1DBDA