1RTJB

Mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
439
structure length
426
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Mechanism of inhibition of HIV-1 reverse transcriptase by non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 117
structure length 426
sequence length 439
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtjB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjB03
1C1CA 3I0RA 1RA6A 3DRRA 1JLQB 4KO0B 3CJ5A 4ECYA 3UDLA 1LW2A 4LSLA 1UWBA 1TL3A 3I0SB 3OL8A 3JYTB 4IRKA 4NLVA 5EDWA 2FLNA 1HNIA 1IKVB 1JLQA 4TXSA 5KFZA 1VRUB 1IKWA 3QGHA 4O3QA 4K4WA 3JSMB 2R8KA 4J9SA 1C1BB 3I0SA 5D3GB 3T1AA 5F8IA 4ED3A 1S0MA 3IGNA 4TY9A 5JXSA 5L1KA 3QO9B 3FSIA 1VRTA 5HP1A 5KFYA 3NGDA 5KG0A 2YNFA 3LAMA 1N4LA 4Y2CA 4H4OB 3JSMA 4XO0A 2GIQA 2WK4A 1C1BA 2IC3B 3CJ3A 3H59A 4TYAA 5T14A 2BQRA 5I42A 5KFRA 3QO9A 1RT3B 4XPEA 1N6QB 4QWCA 5KFAA 4FS1A 2ZE2B 3I5CA 5DQHA 2VA3A 4I7FB 1S49A 2WONB 4MH8A 4NLQA 4TYBA 4IG0A 3MF5A 1JLGA 1RT2B 1RT3A 3HKWA 2V0NA 1KHVA 3KHGA 2EC0A 3FFIB 2WRMA 3LP0A 4ECSA 3DI6B 3PW0A 1SH0A 1S1TB 3MR5A 1JLFB 2BANB 3QYYA 4I7FA 2WONA 4QPXA 2JC0A 5KG7A 2W9AA 5F8MA 2UVUA 1T94A 1S1VB 3H5SA 1JKHA 3KNAA 5C5JA 3RBDA 4WFYA 5KFWA 4F4XA 1D1UA 3M9MB 1IKYA 3FFIA 2YNGA 2O5DA 4YQWA 1RTJA 4DG1A 1W25A 1S1TA 4YP3A 1JLFA 2BANA 3IG1B 4K4VA 2FVQA 2DPJA 2RKIB 5CYQB 4WYLA 2ATLA 4IKAA 5KFCA 1S1VA 5J2NB 2W8KA 2HMIB 3Q8RB 3Q8SB 4JV0A 4MKBA 1RT6B 4RNNA 3H4DA 2OPRB 4Q0BA 3LAKA 4RW4B 1S1UA 2XWYA 4ZP9A 2D41A 4EO8A 4RUAA 1ZTTA 3C6TA 4YMEA 2V9WA 2RKIA 5CYQA 2I5JB 5KFJA 5F8HA 1C0UA 3BSAA 1FK9B 5K14B 2HMIA 4MIBA 4NLXA 3NAHA 2B5JB 2OPRA 3GV7B 1JLAB 3G86A 4NYZA 1K1QA 4WFZA 4ZVHA 3KK1A 4O44B 1S1WB 4KAIA 3N6NA 3H4BA 1NHUA 5F8NA 4DL3A 2I5JA 1S0OA 4ECUA 1S9GA 1HQUB 1FK9A 1RT7B 5K14A 3BSCA 4ED8A 3DRPB 3DRSB 4ZVEA 4QW8A 1JLAA 2FJWA 2R2RA 3C6UB 5KFDA 2B6AA 3RAXA 4O44A 1S1WA 1RTHA 4PUOA 4H4MA 3N6MA 3CIZA 3PW7A 1DTQA 4NLGA 2HNDA 4WFXA 3DRSA 3LP1B 4ED2A 4ECQA 3DMJB 3C6UA 3BSNA 1JLEB 4ZVFA 3DLEA 4TLRA 3OLBA 1WNEA 3KLIB 2OPQB 4MFBA 3DLKA 3GV5B 3BSOA 3T5KA 3OL9A 5KG6A 3I5BA 3IRXA 4O3PA 3LP1A 5I3UB 3DMJA 3BQ2A 4J9KA 4DEZA 2D3ZA 2AGQA 2ZKUA 3RB0A 3RB4A 3ISNC 3KLIA 2I1RA 2OPQA 4G1QB 2BE2B 3D28A 5KFHA 5KFFA 2FLPA 5C25A 2AX0A 3IN5A 4O3RA 4KV8B 5I3UA 4KSEB 1HPZB 1TP7A 5KT5A 3M9OB 1IKXB 2YKNB 1CSJA 3H5YA 2R8JA 3KHLA 2J6TA 4MKAA 1LWFB 1GX6A 2C2DA 1C0TB 1T3NA 4G1QA 4KBIA 4IH6A 4WXWA 3HVTB 2XCAA 4LSNB 4KV8A 1HNVB 1DLOB 3I0RB 3FDSA 2IJFA 1IKXA 2YKNA 3PVXA 3EZUA 1ZTWA 3FRZA 4IQXA 1SV5A 4ZPAA 4O3NA 1IM4A 1LW2B 1C0TA 4Y3CA 1RT1B 1TL3B 2JLEA 3KK3B 3BQ1A 5L1LA 3V6JA 2HWHA 4QWAA 1TKZA 3HVTA 4LSNA 3G6XA 1HNVA 4ECTA 1DLOA 3BGRA 5C42A 1HNIB 4R5PB 1IKWB 1SH2A 1LW0A 4RNHA 4K4UA 3CO9A 1QAIA 1TV6B 2W7PA 2UVWA 1RT1A 2CJQA 4IFVB 2W7OA 3KK3A 1GX5A 3N6LA 1RA7A 2CKWA 5J1EA 4FS2A 1VRTB 2HWIA 3PR5B 5HP1B 3V4IA 4NLRA 4R5PA 4WYWA 3QGIA 2YNFB 3TAMA 5J2PB 3BJYA 1TV6A 1FKPB 1S48A 4IFVA 4K4TA 4NRTA 2E9TA 1N5YA 5I42B 2YNIA 3CJ4A 5J2MB 2D7SA 4ECVA 5KT4A 2BQUA 4M95A 4NRUA 5J2PA 4NZ0A 5HBMB 5DQIA 1FKPA 3BREA 4EYHB 5KG3A 3PHEA 4URSA 2UUTA 4IG0B 3I5AA 1JLGB 1EP4A 2VG5A 4MK7A 1S6QA 4M94A 3RBEA 2BR0A 1QE1B 5J2MA 2AGPA 1TKTB 3MEDB 1XR7A 1RAJA 3LP0B 4ZPBA 4ZPDA 4NLDA 4ED1A 5HBMA 5KFUA 2IAJB 3MR3A 3UPFA 1JKHB 1MMLA 4HKQA 5EUHA 2IBKA 1K1SA 1QE1A 4OL8A 5L1JA 2IA6A 3H2LA 4K4ZA 1TKTA 3MEDA 2FJVA 1IKYB 4B3OB 2YNGB 4TQSA 3GIJA 4NLOA 1RTJB 4DG1B 4R8UB 2W9CA 2RDJA 1Z4UA 3CJ2A 1EETB 3MR2A 5CYMB 4YR2A 3BQ0A 5EWGA 2IAJA 4RW8B 4Q8FA 3GIKA 4DL6A 4NLUA 3MEGB 4MIAA 2FVCA 4IG3B 4B3OA 4H54A 4Q0BB 2UVRA 1OS5A 1S1UB 4JUZA 3DM2B 4WXOA 4R8UA 4U7CA 4LQ3A 5L9XA 1EETA 3C6TB 4KKOA 2RF2B 3GQCA 5CYMA 5KFLA 1NNDA 1RT5A 4RW8A 1C0UB 4WZQA 5KT6A 3MEGA 4YR3A 3QGGA 4IG3A 2D3UA 3DM2A 2JEGA 3KK1B 2IMWP 2BRLA 4LQ9A 5J2QB 2RF2A 3NKYA 4EBEA 2J6UA 3D5MA 3HVAA 4Q45A 3V81B 1S9GB 4IRCA 1T03A 2V4QA 2BQ3A 4XPCA 1RYRA 4RNOA 4EBDA 2B6AB 5EWFA 4ZP6A 4NLTA 5KFTA 4F50A 5J2QA 1RTHB 4URQU 4PUOB 4H4MB 3V81A 1TKXA 3LANA 3FQKA 2VG7B 2V4RA 3ITHB 1DTQB 4ID5B 5KFBA 2HNDB 3IS9B 2ASDA 4RW7A 2R8GA 2BRKA 1R0AA 3OHBA 4WE1B 3DLEB 3DOKB 5F8LA 3T5HA 2UUWA 2AWZA 2JEJA 1KLMB 4MFBB 2JEFA 3DLKB 3GIMA 3DLGB 2VG7A 1SUQA 3ITHA 3QLHB 4ID5A 3IRXB 3IS9A 3NBPA 2R8HA 1YVFA 3V6KA 5L1IA 5KT2A 4WE1A 2B43A 3KK2A 3DOKA 2WHOA 4IR1A 1KLMA 2XGPA 2XI3A 4TN2A 3KLEA 3PZPA 3DLGA 5KT3A 4KFBA 4URGA 3QLHA 5DG8A 5C25B 4EBCA 4DL5A 4DL2A 1ZETA 4Y2AA 2QE5A 1I6JA 4EYIB 2IM0A 1REVA 2R2SA 4U6PA 3KLVA 4I2PB 5DLGA 2W9BA 3NL0A 1FKOB 4Y34A 1BQNA 1SV5B 1JIHA 1RYSA 4PWDA 4NCGB 4GC7A 4O3SA 2ASLA 3KLHB 1C2PA 3ICLA 2C28A 3HHKA 1TKZB 4I2PA 1HMVA 2HNZB 4K4YA 3BGRB 1FKOA 3E01B 5C42B 3TVKA 3GIIA 2AX1A 4RW6B 4ECXA 4EEYA 1LW0B 4ED0A 5HROB 1HYSB 4KB7A 4NCGA 3ISND 3RB6A 4Q44A 3KLHA 4QWBA 3DYAA 1T05A 5J1EB 4IFYA 5KG2A 2HNZA 3E01A 5KFQA 2ZD1A 1RT4A 3V4IB 4IRDA 4RW6A 2IJNA 4ZVGA 3UQSA 4NLWA 3T5LA 3TAMB 4DL7A 5HROA 1HYSA 2ALZA 5F8JA 1SH3A 2UVVA 1MU2B 2WB4A 5DQGA 2C2RA 5F9NA 4ZP8A 1LWCB 4RW9A 3V6DB 1N5YB 2ILYA 5F9LA 2E9RX 2YNIB 1TVRB 3KLFB 1RTDB 4PQUA 3GILA 1S4FA 4F4YA 3HVWA 2WOMA 3QZ7A 4RNFA 3PW5A 4ZHRA 2C22A 4J9LA 1MU2A 5JUMA 1LWCA 3V6DA 1EP4B 2VG5B 1S6QB 1TVRA 3KLFA 5KG4A 3KMSA 1RTDA 4MK9A 2XGQA 4K50A 2AGOA 4FBTA 5HLFB 3SFGA 3Q8PB 4J9OA 1JLBA 3NMAA 5DGBA 4ED6A 2FVRA 4NLPA 3DDKA 2W8LA 1HARA 4ICLB 4NLYA 5KFXA 2QV6A 4IDKB 2WCXA 5HLFA 2W9CB 5KFEA 4KO0A 5C24B 3LP2B 3KMQA 2AQ4A 2JEIA 4Q8EA 4ZPCA 4ECRA 3LALA 3VQSA 4ECZA 4DL4A 2GIRA 1QUVA 3JYTA 4KHRA 4ICLA 5F8GA 4TQRA 2FVSA 4IDKA 4FBUA 3RB3A 3CDUA 1IKVA 3LP2A 5C24A 3Q8QB 1VRUA 2IM2A 2OPPB 3T5JA 4KKOB 3UR0A 4RZRA 2IM1A 3RAQA 2GC8A 3FQLA 1RT5B 4MK8A 2R2TA 5D3GA 3E51A 3M9NB 1S6PB 2R8IA 3QIPB 3MFIA 3OLAA 2JC1A 4ZP7A 1S9FA 4RUCA 4X2BA 2OPSB 2OPPA 3NAIA 2DPIA 4H4OA 3CDWA 3QZ8A 2FVPA 2IC3A 1JXLA 1S6PA 1T03B 3QIPA 3EPGA 1N6QA 5FDLB 2R2UA 2AU0A 2E9ZA 2OPSA 2ILZA 2ZE2A 2F8EX 3PW4A 4O3OA 4IH7A 1TKXB 1S9EB 3CDEA 3M8PB 1RT2A 5EWEA 3PW2A 1QAJA 5FDLA 3DOLB 2WTFA 4RW7B 5KFSA 1N48A 4J9PA 1S0NA 1R0AB 4KHMA 3MFHA 3KLGB 5KFVA 1J5OB 3DI6A 1D0EA 5KFMA 4Q43A 4JV1A 3BR9A 4K4XA 1TL1B 4KE5A 2XCPA 3SI8A 3H5UA 1S9EA 1RDRA 3OL6A 3M8PA 1SUQB 3TQ1A 5DGAA 5KFKA 1N56A 1S97A 3NBPB 3DOLA 2HAIA 3SFUA 3KLGA 1XR6A 1J5OA 3KHHA 2J6SA 3KK2B 3IG1A 3OSPA 2YKMB 1RTIB 1TL1A 3GV8B 1S10A 2RDIA 4IOBA 2YNHB 4O4GB 3M8QB 3KLEB 3KJVB 5J2NA 4KFBB 3MTKA 4TY8B 1DTTB 2ASJA 4QWDA 5DLFA 1RT6A 4JV2A 3CJ0A 3H5XA 2XI2A 4RW4A 3KHRA 4IH5A 4QW9A 3OHAA 3V6HA 2YKMA 1RTIA 1REVB 2YNHA 4O4GA 3M8QA 3KJVA 4IR9A 4TY8A 1XR5A 5KFOA 4J9MA 1DTTA 2W9BB 2B5JA 4J9QA 1BQNB 2C2EA 3MECB 3T19A 3MEEB 4J9RA 4PWDB 3GYNA 3CWJA 4F4WA 2IM3A 1TQLA 1HQUA 5KFNA 4F4ZA 1RT7A 1S1XB 4ED7A 1HMVB 4K4SA 1BQMB 3DRPA 4GC6A 2VA2A 3EPIA 4WZMA 3MECA 4EO6A 3MEEA 2OH2A 1JX4A 2FJXA 4ECWA 4HYKA 1JLCB 5KG1A 4ZMMA 4RNMA 3PJXA 3KOAA 3DYAB 1T05B 2VG6B 1S1XA 5KG5A 4IFYB 1BQMA 1LWEB 5DG7A 2ZD1B 1RT4B 1KHWA 1U09A 4NLSA 3H98A 1JLEA 5KFIA 3OSNA 2FLLA 1HQEB 1JLCA 4RW9B 3PJWA 2XC9A 2HNYB 4O4RA 2VG6A 4I2QB 5DG9A 3H40A 3QIDA 4G3IA 1LWEA 4R0EA 4PQUB 2WOMB 4RU9A 3MR6A 5KFGA 4ZHRB 1HQEA 3G6YA 3PR4A 2HNYA 2BE2A 4I2QA 5KT7A 3OL7A 3G6VA 1HPZA 1C1CB 3DRRB 3CVKA 5KFPA 1LWFA 1JLBB 4LSLB 1UWBB 1NHVA 4YR0A 4QWEA 3IGVA 4J9NA
chains in the Genus database with same CATH superfamily
1V5IB 1AW0A 1RA6A 3PFEA 4I6WA 2BUNA 1Z2LA 1F0XA 1IKVB 1NH7A 2M2BA 2CPYA 2QEXS 2HHQA 4LR8A 5E3RA 1OY9A 3I0SA 2A6OA 1S0MA 4X84A 5KFYA 5H1SV 2FZGB 5KG0A 3KUEA 1NHKL 3H59A 5HK4A 2EBGA 5I42A 3CCSS 2DNOA 2Y0BB 2POKA 3DU5A 2DNRA 1S12A 4ECSA 2N7CA 3PW0A 2BANB 2WONA 2YWHA 3HLUA 4YP3A 3NNAA 2CQHA 2IA0A 1LK7A 3SSSA 2E7VA 2I0XA 2C2KB 3POTB 5CYQA 4RO0A 4KYZA 2XZWA 4OI2A 1TFWA 3H90A 4ZCLA 4D3HA 1RT7B 4B3MF 3CCRS 2XMKA 2CPDA 1YITS 1S1WA 3GU0A 4DQIA 4EI2A 3CIZA 2CJ9A 3M1VB 2Y1JA 2VC0A 3T1YF 2YH0A 3IXQA 3VF0B 1N5QA 2ZKUA 3RB4A 1CC8A 2MLZA 3QT6A 5C25A 5HMXA 4CIOA 4V1Ak 3QFHA 5GMDA 1C0TB 3Q2TC 1JMTA 3O6QA 1HNVB 4PAAA 3CO0P 2DCLA 3OPKA 4UW2A 4EZ6A 5LJ3Y 4ZJOA 2JNJA 1JJ2R 1U48A 2FGCA 4GRSA 4YN3B 1UPPA 4C48A 4IFVA 1AT1B 2DR6A 2YVSA 2QLWA 1N33F 2VD3A 2JFKA 4CM0A 1FKPA 1HQ2A 1BUXA 4MK7A 3HD1A 3LP0B 2ACYA 4ED1A 3MR3A 1OY8A 1JKHB 1SC1B 2FHMA 3H2LA 2F1FA 3CJ2A 5A2QU 2AD9A 3NOGA 4MIAA 1CJUA 2UVRA 4NA2A 3GYGA 2DNPA 4KKOA 4ZPWR 4RW8A 1CULB 4WZQA 2EG1A 4NASA 2OP5A 1MNEA 4Z2XA 4HEA9 2OD4A 3H2VE 1EZZB 1EB0A 3GR0A 2HZCA 4F50A 4OJHA 3M32A 1VRQC 3MM5B 4WPAA 4RW7A 1KONA 3T5HA 1YJ9S 4CNYA 2U2FA 5GADU 3K5PA 1UKUA 2WHOA 2LQJA 2DNQA 2GVZB 3D0IE 3SV4A 2UU9F 2H4WB 3QSYB 1QY7A 3O5TB 3LPEA 4LF4F 1HMVA 3J81Y 3TVKA 4EEYA 2EBEA 2DHGA 1OSCA 4Q44A 1YIJS 4M5GA 2Q66A 2E1RA 1HFEL 2VB6A 4PXBA 2VJVA 1N5YB 3BKTA 2KXFA 1IR1A 2E5HA 5E0OA 2QIFA 1LWCA 2VG5B 3Q23A 1PAEX 4MJKA 1U2RA 3Q8PB 1U0HA 3GJQB 2GMJA 4ICLB 5DO2A 4LFCF 3ONQA 4KO0A 1YGYA 1NCLA 1IWAA 1S77D 1QAXA 4M5LA 3KTQA 1HI1A 3LF0A 1WHVA 3M9NB 3U1LA 3KFWX 1TL7A 1XMOJ 1KTVA 1YKWA 2B4VA 5D8HB 4KJIA 2LXUA 4CO5A 1G2EA 1S9EB 3DDIA 2N4DA 2QTWA 4KE5A 3OL6A 3TJ9A 4XTTA 2WSCC 2HAIA 4W90B 3ETMA 3OSPA 1MN7A 1X0FA 3H5XA 2DNMA 2X1FA 2Y0SD 4FYWB 2NXNA 4OI0A 4B3MJ 3M8QA 4TY8A 2W9BB 3PO4A 3C14A 3MEEB 2B7CB 2ZUGA 1HQUA 2VPZB 3T1YJ 1JX4A 3N01A 2KM8C 3BM7A 3EVMA 1U09A 2V8VA 1Y3JA 1JNRB 1YJTA 3S1TA 3SZ2A 4CQ1A 3PX6A 5CABA 1X4AA 4OX8A 2HSEB 3AOCA 3SQOP 2DT9A 2NPIA 4N41A 3EE3A 2YKAA 4EGLA 1MG7A 2DIVA 2JLFA 8RUCA 2L9WA 4AXJA 1NAQA 1N33J 6FD1A 5ETOA 3QO9B 1VRTA 4PCQA 3LAMA 2QLJB 3CJ3A 4OI4A 3KXDA 4ILMA 4N8OA 3OJSA 1KKHA 5KFAA 4DV0J 1YRUA 3PRBA 2FJDB 1JXVA 2XS7A 3ET6A 1PO6A 4PXCA 2F3JA 4YB6A 3W3SA 1FXLA 1KHVA 3F0NA 4AE5A 2G4BA 2DXFA 2JC0A 4WFNQ 1D1UA 4PPZA 2VBZA 2RKIB 2ATLA 5J2NB 3Q8SB 4LBPA 2ZC3A 5B0AA 4ELUA 3MAAB 3LAKA 2HS4A 2I5JB 5F8HA 3NEKA 4I0WA 2OLWA 1S99A 3DOMB 3JAMY 2HS3A 2A18A 4ALZA 4WU2A 2XSFA 1VDHA 1RBAA 3RAXA 3D6TB 1HA1A 1RTHA 3I87A 1EJ7L 1Y5NB 2VONA 2W4DA 1JLEB 3G8SA 2E29A 2GCFA 2UU9J 1N5SA 3S7RA 1ZM9A 3CDBA 3D28A 3T41A 5IXUA 3BO3A 2RHQB 2MKKA 1VQSA 1GX6A 1U4BA 2ZHBA 3D9BA 1DLOB 1RWMB 4O3NA 2C2NA 2BABA 5L1LA 3IAM9 2E1CA 3OXFA 2XY7A 5DDQC 1NB2A 5A0YA 3OTOF 4ZLPA 1Q8IA 4NZ0A 1XNQF 2VOOA 4EYHB 4WU3A 2V4JA 4UY85 1VMBA 4LFCJ 3RGIA 1QE1B 2MQ8A 3J7YU 2H5JB 4NLDA 1ZZFA 1NK4A 1OSDA 5L1JA 2BJ7A 4NMLA 3K5LA 1TKTA 2RU9A 4DG1B 4HVZA 4ZPVR 3OUYB 3QT7A 3S6EA 2NREA 1NU4A 2XULA 3BN4A 1ITPA 4IRCA 1KFDA 1WF2A 4WCEQ 2FYXA 5K8OA 3C3LA 2PC6A 2GQ2A 4F2RA 4CO0A 4WE1A 3KK2A 3D1HA 4P72A 2YPYA 2OEJA 2PT0A 2VFUA 2QE5A 1H2UX 4TLQA 1DJ0A 4CT8A 2HHVA 3G96A 3MD3A 4I2PB 2UUBJ 1RUSA 4KC5A 4I69A 1AA1B 2CNOB 3BGRB 3FSYA 1RWOB 2F63A 2M8HA 1LW0B 3L7OA 5CZVA 4WKRA 3P49B 5A8RB 2UUAF 1WC4A 4ZVGA 4M5JA 1R31A 1HYSA 1FJCA 5F8JA 4P75A 2ILYA 1GH8A 1F60B 2WOMA 2VQEF 3A8JA 2VIHA 3NMAA 4KGVB 3I6PA 1HARA 3DC2A 4UTGA 4DOZA 1Y0HA 4UY8T 4C0OC 4ECRA 3LALA 2OGUA 3JYTA 4KHRA 3OR1B 3MPDA 1BLUA 3GSIA 4P6QA 4WP8A 4CRJA 4MKYA 2EWHA 4H4OA 1S6PA 1V3SA 3NLCA 4OYBA 1NDPA 1TKXB 3H2UB 3W2WA 3PW2A 5KFSA 1R0AB 3DI6A 2WBRA 3RTVA 1RDRA 2A6MA 1ZYQA 1UAWA 2C3YA 1GMWD 1X9SA 3NBPB 1CVJA 3TR5A 4G1IA 4B08A 3AA9A 2RDIA 1A9NB 4DR3F 4JV2A 5A2QY 2CJYB 3HJVA 2O67A 1B99A 2OD6A 4F25A 4A8FA 2DR7A 2HKEA 4C8ZA 3GYNA 2XSJB 1TQLA 1S1XB 3DRPA 4GC6A 4ATNA 1RCOB 1AFJA 1RWWB 2OMLA 5IT4A 5KFIA 3W65A 2DD8S 2VG6A 5DG9A 4R0EA 3A8KA 1UMJA 1YRTA 3UN3A 4ZHRB 4QIVA 1QM9A 1RCXB 3G6VA 4JYAF 1S57A 1LWFA 4LSLB 1NHVA 4YR0A 4HACB 2LQ9A 4J9NA 4RBVA 3D6MB 4ECYA 4QR0A 1U8SA 4R0JA 2XY5A 4MKVA 4ES2A 3JS9A 3OTOJ 4WP9A 2VBXA 3AD9C 1XNQJ 1F5AA 2R7OA 4XPEA 4ED4A 2PI4A 2GAHC 1S49A 4DUZF 1NDLA 2F40A 3VV2B 3MF5A 1RAOA 1LOUA 1O6XA 2X3DA 3SSRA 4FYVB 1NH8A 2HVEA 2ZC4A 2F8HA 2XLJA 2BKNA 2W8KA 4ZCKA 1KQKA 1S1UA 4ZP9A 2Q1LA 2JHEA 1B64A 2M52A 5KFJA 2IY5B 4MIBA 1NBEB 1M5KC 3BDEA 4DV3F 1C4CA 1JLAA 2R2RA 3NNCA 3HO1A 4WFXA 2LDYA 3HDSA 1BQXA 3OL9A 1ZM2A 4J7CA 1SPBP 5HAOA 4USMA 4FF1A 2HHSA 2A2CA 2WVDA 1FERA 2ROGA 2RT3A 3D67A 1FFGB 1TP7A 2YKNB 4LIWA 4UQTA 1N36F 3TAQA 4ELTA 2BW2A 3FRZA 2JOQA 1RT1B 3R6GB 2HWHA 2UUAJ 4RNHA 4LF8F 1MN9A 2A3JA 4DSFA 3N6LA 4KTQA 2P9GA 1R8CA 2C3MA 2KT3A 4DLGA 1TV6A 4ECVA 5HL7Q 3TZXA 3RRKA 2LU1A 2MTLA 3S01A 1S6QA 3UNGC 5J2MA 2MZQA 3AQPA 4MAKA 4F4AA 4C4WA 4B3OB 2B9EA 3IM8A 2B4UA 2FY8A 4N7TA 2MLXA 3PRDA 1E6VB 2CDRB 3M2RB 3QGGA 3DRXA 2YKOA 4LRAA 3KK1B 5H9EJ 3M2UA 3OD2A 3V81B 1FEHA 2ZVIA 1T03A 2HS0A 1WELA 2OSQA 3EGVA 2B6AB 3FSXA 4ANDA 1ZPVA 2DY1A 3FQKA 1FWKA 1DTQB 3OHBA 1T9VA 3DLKB 2WVEA 4DR3J 3KKFA 4YHHF 3FEYB 4F3OA 4TN2A 2WVFA 4DL5A 4EBCA 2FZCB 1O8BA 2R2SA 3KLVA 3JSBA 2MZTA 1HKAA 2A2DA 3JTPA 1GQEA 3KLHB 3IAS9 4ZCMA 3E01B 4B9NA 1EKSA 3UNYA 4DX6A 2IJNA 4ZKAA 4DX7A 2WB4A 4JYAJ 2YNIB 3SQGB 3BPSP 2GGPA 3G8QA 3V6DA 4LF9F 1TVRA 2KB2A 1TK8A 2ZJRQ 1DAXA 4ZPTR 2CG8A 3MMAA 1IKVA 1IJFB 1FEEA 2IM2A 1XTZA 3E51A 2V2QA 3ZTRA 5CCMA 4U8VA 4DUZJ 4F0HA 3QJLA 7FDRA 4GO5X 2PN6A 1RADB 3DKDA 3EPGA 3MOJB 3GJSB 2VDIA 2KH9A 4DU7A 2XZDB 4CO4A 1UVNA 4USKA 2LXIA 1YX2A 3KJFB 4W4MA 3OFGA 5KFMA 1A0OB 1EKRA 1G3OA 3HFZB 5DGAA 2MY8A 2CPFA 3SFUA 3K5MA 1P9YA 1N88A 3HFKA 3QATA 2WZ1A 1TUVA 2CA9A 2DRDA 5I4MA 2NZCA 4UOFA 2HBQB 3BO4A 2C3OA 3MM9A 5F3ZA 4F4WA 1RT7A 1JJCB 1YLXA 3UW1A 1VGYA 1PSDA 2RQKA 4DPWA 4ZMMA 3NCRA 3UD4P 3DYAB 2VDHA 1BQMA 4OZ5A 4TKTA 5MAOA 2LU2A 1EX8A 2HLUA 4K59A 3E2EA 1BHNA 3AXKA 4RU9A 5ETQA 3B78A 1HWIA 3BGOP 3CCZA 1DURA 1TK0A 1IQZA 2DY9A 2VQFF 3EX7B 3QQCD 4JB8B 1QTMA 1SJ1A 1WOOA 3RBXA 2WSFC 3NGDA 3F56A 4Y2CA 5T14A 3K0JA 1UFKA 2Q6CA 2C3UA 5IM0B 1Y5LB 4KGZB 1KEKA 3N0VA 1YJVA 3LP0A 1SH0A 2IJRA 1JKHA 2OEKA 4E2FB 1K9MT 1H74A 4A48A 2DPJA 1ZBTA 2CG4A 2AIRB 3BSAA 2B4PA 1K1QA 4J9VA 1WTBA 1T0TV 3MTJA 2DKOB 4O44A 2CJAA 4UUXA 4U7UK 1OJ4A 3C6UA 2HURA 2OPQB 3O3LA 4NMXA 5I3UB 3SCLE 2AGQA 3RB0A 2GVZA 1HI0P 4A47A 4X4SA 1IKXB 1URRA 3IWXA 2GO8A 1T3NA 3EJMA 3CJTA 3TARA 1B70B 3I0RB 3UCZP 4N77A 4CLKA 1VFJA 2JLEA 3KK3B 3NG8A 1RHQB 3V6JA 1ZS6A 2CQGA 1NK7A 1HNIB 1VQ8S 1Q5YA 2VZ9A 2KYZA 4FS2A 5CYJA 2MZ1A 1Q8BA 1XN9A 2CZVC 4LF9J 2GHWA 1TFYA 1N5YA 3HM9A 3TANA 1WDDA 5L46A 4USWA 5HBMB 2HVZA 8AT1B 2VG5A 5IT0A 3GFHA 5J1PA 2HFOA 1FVSA 4CH1A 3NMRA 4ZJQA 3LUYA 3JTOA 4R8UB 4PR6A 5GAHI 3VAHA 1NJZA 2CVEA 1TUWA 3AXMA 1ZPWX 1OS5A 2NYHA 4LQ3A 3PM9A 5CYMA 2QA2A 5RUBA 5KT6A 4USUA 3R8YA 4I6YA 4NXMF 3M2VA 2BQ3A 2DHHA 4DJBA 1R8BA 4ANCA 4PUOB 2LA6A 3LANA 3R6LB 3E3XA 2FGOA 4OZNA 1IM6A 2EEYA 3DLGB 2VG7A 3T3FA 3CCVS 4ETXA 1X4BA 5K20B 4RUHA 2XHWA 3I4PA 4OJGA 3HHLD 3OQ2A 1HNZF 2FHOB 2W9BA 1FX4A 4CLPA 1NZ8A 4ZJLA 5GMKa 4JI8F 2AYGA 2ZBIA 2ZVSA 3UO0A 1FKOA 3Q8VA 4DXLA 1FWLA 2DNLA 4ED0A 2N7YA 2KZMA 1SL1A 3OTBA 1XNRF 3W63A 5FD1A 1U6BA 5AXNA 2HYIB 1MWQA 1RAGB 2UXDJ 2RVJA 2LFVA 1RHKB 3KWMA 1VK3A 2VQFJ 1VBXA 4QYZJ 1S79A 4WJBA 5KFXA 2QV6A 5KFEA 5C24B 2JRSA 2JEIA 1OY6A 1NSKL 2GIRA 5G4DA 4TQRA 2XWXA 4P2FA 5MLCV 1Q8LA 3RAQA 3UR0A 4MK8A 2EFGA 1UVMA 3DGPB 2H51B 1H73A 1WC1A 1NSPA 1YRXA 5DDRC 1UCNA 4BLGA 4UOHA 3VAIA 3CDEA 4ETZA 4Q43A 1XWLA 4DSKA 1N56A 2LDIA 2XHCA 2HK2A 4A8KA 1J5OA 1CS4B 3GV8B 3K8WA 2NXEA 5J2NA 2EVZA 2B8PA 1DTTA 3DOMA 1VJQA 1M1GA 3EZ5A 1WEZA 3VTIA 1Q86T 1ZM3A 1WEYA 1WUUA 1SCJB 4LT6A 3CJ8A 5KG1A 2VFSA 1LWEB 1JLEA 4X4TA 4QJVA 3VZIA 1JLCA 2PMHA 3DHWC 2P2CB 5SUHA 1F2GA 3DRYA 2QMXA 1LQ9A 4U96A 1YZ6A 4OYAA 3OL7A 1WDTA 3NGRA 4HHJA 5AJ3F 1KOHA 2V63A 3ZZUA 5CXTA 2HIQA 4NXNF 3WIUA 3I0SB 4JI0J 1CEZA 3BBFA 2V6AA 2AMCB 3K2YA 2MZSA 4TYAA 2GIQA 1H38A 1T9YA 5IT9U 2WONB 2DGUA 3B6BA 3H20A 3F73A 2G2OA 5F8MA 2UVUA 4LFBF 1NM2A 4DG1A 5CYQB 1VJWA 4K2XA 2DR9A 2EPIA 3BZQA 4NXMJ 1QSYA 4RUAA 4KH0B 2ZBQA 4WFBQ 4YMEA 2D3O1 1U7LA 4NLXA 1KOOA 5DM6Q 1HBNB 2JVOA 2OPRA 4NYZA 1H7WA 4WFZA 1S1WB 1AROP 2CWKA 5F8NA 4DX8H 4HDGA 3R7SB 2ZHAA 1GTEA 4N47A 1ZA2B 3MD1A 5LSOA 4DV2J 1PBAA 4RX6A 2DNZA 3AODA 3CD7A 2HQDA 3T5KA 3GCXP 2PA8D 4O3PA 2NXJA 2RIJA 1OWXA 3GMGA 1HNZJ 3UDVA 4IO9Q 1T9XA 1S4EA 1ELOA 3ZTOA 2XO7A 2RUSA 3VZHA 4ECTA 3BGRA 2BBEA 2HRUA 1LW0A 1TTHB 4IFVB 1Q7YT 4C3MA 5A8RA 1U1PA 2HWIA 1KVJA 4WYWA 4NZ6A 1L3VA 3N5FA 1FKPB 1S48A 1SJ3P 4Z37A 1HI8A 4HHHA 5GAHU 3FCVA 1LXJA 1PBUA 5J2PA 2K7KA 2M4MA 5CH7B 4URSA 5E3CA 5BR8F 4C6AA 2AGPA 6FDRA 3KG1A 4PG7A 4HKQA 2Y1IA 1RTJB 4Q2LA 4RW8B 4NLUA 3FCWA 2KZZA 3R9LA 3D66A 5AXMA 2KHCA 2EFVA 2W2NP 2YWGA 3Q8YA 3M32B 3W61A 3AY0A 3A1YG 4V19J 2HHUA 4NOHA 5HQ8A 1TKXA 2NCKL 4F04B 4JBCA 1R0AA 2PEBA 3GFZA 1KNZA 4LBIA 2AWZA 3HD2A 3W8GA 3NBPA 4Y6IA 4F2SA 3DOKA 2KN4A 2VOPA 2GHVC 1NZAA 1KVKA 2DXDA 1ULRA 3FK4A 2D9PA 3W2VA 1SIWB 4U6PA 3NL0A 5B0BA 4JI3F 4M5KA 1OIAA 4PABA 3HSGA 2R7SA 2XSJA 4C8MA 4A46A 1PG5B 3NGSA 1IBLF 4RL1A 4QWBA 1UEUA 2EK1A 2EFNA 1HNXJ 4OIXA 2NQPA 4L6V3 1H6KX 2UVVA 1F6TA 5F9NA 1LWCB 4A8OA 3DXBA 5AJ3J 1S4FA 4ZHRA 5JVHQ 1U0HB 4Y28C 1RTDA 2HG4A 3MUMP 4NXNJ 3AB2B 4ED6A 4NLPA 4O23A 2E1MC 4NLYA 1BWEA 2ZHOA 2DXEA 1RWVB 4OJ3A 5B0GA 3QPIA 1QUVA 5D4LA 4JV5J 1WHXA 2HBYB 2ZFHA 1VC6A 2R8IA 1S9FA 4ZP7A 1AFIA 1UEVA 2V8HA 4OV1A 3SDEA 5E2QA 2J5AA 4OI6A 1XERA 2W24A 3PW4A 5IV4A 1X4CA 1VC0A 4LFBJ 4K5RA 2HLTA 1SKSA 3BKUA 1F9EB 2YPZA 2LYVA 2ROEA 2DBBA 3R5BA 3I82A 2E7WA 2GZOA 1F3VA 3M8QB 4TY8B 1M5SA 4E8UA 3CJ0A 1VYAA 1QD1A 3FCHA 5GVQA 4I6AA 3T19A 5C7PA 3A13A 2LECA 4QR1A 4LF2A 2KRRA 3MECA 5KG5A 2GIFA 2Y8WA 1N54B 2YQ1A 1FE4A 1HQEA 1HWUA 1XJWB 1DBDA 1HHTP 4B9VA 1O0PA 2BX6A 3I9V9 5IWAF 1D09B 4QCLA 4MMOA 2BE7D 5EDWA 2P6SA 2I2YA 2Z2YB 5KFZA 4P7TA 5D3GB 2EI5A 5IFMA 4ED3A 1VHIA 5L1KA 4IOAQ 2HHPA 4QIFA 2M5YA 2ROPA 2XNQA 2R7WA 1Y3KA 1UVKA 5BR8J 3ET6B 5ETMA 3P5TL 1PC4A 4NLQA 2HHXA 1XK8A 1L5UA 2EC0A 1P9QC 3CCQS 1VBZA 3QYYA 3CJSA 3M9MB 2O5DA 4LMZA 1NRKA 1GEHA 5KFCA 1X5PA 3GJRB 3TUJC 4N8NA 3TNVA 3B54A 2B5JB 1UL3A 4NEZA 4ZVHA 3KK1A 5HMYA 1WC6A 2BOAA 1FK9A 4RPFA 2B6AA 3HHLC 1RE1B 4OYPA 2HBZB 1DTQA 4HI1A 5HANA 5AE2A 3DLKA 1RP5A 1X4EA 2NR0A 4OYOA 3KLIA 2W01A 3KYLA 3H5YA 2BA9A 2AEFA 2X7IA 4LRDA 3FDSA 1IBLJ 1ZTWA 4OX6A 1PGZA 5F3TA 2IDLA 1SC4B 3TRGA 2V2ZA 4OZJA 4LF6F 3L95X 3TZYA 5A0YB 2H4YB 4FDFA 4P73A 3VGVA 3TI0A 3OXLA 2KDOA 2YNIA 1VS3A 2AJFE 1W2IA 2R42A 3PHEA 2QG9B 3RBEA 3FNNA 1TKTB 1QUPA 2VKZG 2V2VA 2VU5A 2ZBCA 1I3OB 2FJVA 2IRYA 1FF2A 2IIHA 2OO4A 4U7CA 2H54B 2M9KA 1KP6A 3MEGA 2KJVA 3GZ7A 2RF2A 2APOA 2UUCF 4P74A 2HW3A 1UPMB 4NLTA 3ZTSA 1FFWB 3FBEA 4LF7J 2VPWB 4WE1B 4L76A 2JEFA 3ZZOA 4Z7CA 2XS5A 3IRXB 2R8HA 2CWXA 1VQPS 4ZVOB 3X1LB 1NSQA 4HH0A 2F4VF 4KT0C 3ZZTA 3C66A 1I6JA 4QOTA 4EYIB 2PFDA 1U1MA 3TO8A 3NGTA 3BS9A 4FN5A 2HQCA 2SXLA 2RRAA 5CCLA 1SC3B 1HYSB 3DLLQ 3ZC4A 4TVAB 3DYAA 3FZBA 1NK0A 2MQOA 1N52B 3RR8A 3MR7A 2XMMA 2FHJD 3TAMB 4NL5A 2R9LA 5F9LA 3MZIA 3R5DA 2MYFA 3Q24A 1RHJB 4ZLNA 1DQ8A 1RAIB 2MKHA 4ZVSB 5IWAJ 4USJC 3OT9A 3E8OA 2PE8A 3ENWA 3W64A 3T6BA 1TR0A 5HJXA 3S8SA 4PQAA 3VQSA 4DL4A 4XK8C 5GAGI 4DR5F 4FBUA 2YWFA 3T5JA 3Q8QB 5LOQA 1X9WA 2Q79A 1S6PB 3A3PB 3OLAA 2HZVA 2KYXA 2FVPA 2HVHA 3QIPA 2OPSA 1KDNA 2NUHA 1FJGF 5FDLA 3M8RA 1NUEA 3M7VA 2L9NA 4K4XA 1M5OC 2LLZA 1SI9A 3BF4A 2D3OR 2MJNA 2ZOGA 2J76E 5I3QA 4G65A 1TL1A 2CQ2A 3THVA 4BWMA 2F4FA 4IH5A 3J81U 4ER8A 1I1GA 1REVB 3GG0A 5KFOA 2JZ5A 3U7JA 3M6VA 2GS8A 4PWDB 2C3PA 2IVFB 5KFNA 1JWWA 1E6YB 2FC9A 4BWJA 4ECWA 2VG6B 1RT4B 2JDJA 3P5BP 2QFIA 1XQIA 2PDAA 2FLLA 2HRYA 4DSEA 1FNXH 1UA0A 4O4RA 2AV5A 2RQMA 1LNQA 3SEOA 4CLLA 3MR6A 5KFGA 1UETA 5L38A 4DFPA 2HNYA 1FE0A 2CQ0A 1N0UA 2PEHA 4ZS6A 2MZJA 4ZCIA 4LF6J 3I0RA 4DUYJ 1KLNA 4CLSA 1T8EA 1HNIA 2FY1A 3ZNUA 1NKEA 1SQFA 4J9SA 1C4AA 3IGNA 1SIZA 1IBMJ 4X4RA 3QSIA 3J81j 1GMWA 3I32A 4DR4F 4DFMA 1FRMA 3NWRA 3PFOA 3NCPA 3RRHA 4B9UA 4FP9A 2YWKA 2GVDA 3GFXA 3GG1A 1YTYA 3Q0AA 4JI7F 3BV8A 2C42A 3GP9A 3W60A 4OI3A 3DGVA 2Q43A 1S1VA 4C8OA 4EUVA 3W9IA 2D41A 4DQRA 2UUCJ 1D8YA 5AE1A 1JLAB 2AW0A 3Q2SC 3TEGA 1F9FA 4IQMA 1NK9A 2NSCA 4MTPA 3PYDA 4KPYA 1WG1A 4PUOA 3QWUA 3N6MA 4ECQA 4ZVFA 2XO6A 2F4VJ 3MM6A 1YI2S 3DMJA 2BEFA 4ZIVA 3ILIA 1K0VA 3PO5A 4O3RA 1WKLA 5KT5A 3BO2A 4DMZA 4KV8A 4JI5J 1LW2B 3GPAA 1TUGB 7AT1B 2FTRA 1RK8A 1QAIA 1TV6B 1UP1A 2QZ8A 3PR5B 4CLYA 3QGIA 1IUJA 4WTOB 4GKKJ 4NRTA 2WVCA 3D7SB 5J2MB 4NRUA 5KG3A 2O3DA 3I5AA 1Y00A 4KPCA 3IA0A 1UW4A 1RKIA 4B17A 4DR5J 4OL8A 3Q86A 1F2HA 4PEOA 3R1LA 5EWGA 3W1YC 3JAMU 3MM7B 2QL5B 4S0MA 1TAQA 3THPA 2FDNA 3DGPA 3QAEA 2MHNA 3ISZA 2IMWP 3UCUP 1BY9A 2KT2A 3HSDA 2V4QA 1IR0A 2VL1A 4H4MB 2G2YA 4P7VA 2CJKA 2DH7A 5F8LA 1V6HA 1RB0A 1YVFA 2B43A 2DO0A 4IR1A 3MCOA 1CS4A 1KLMA 2XGPA 2ZM6J 5T41A 3Q22A 1TZ0A 3HCXA 3A8IA 2IM0A 3HKZD 2NPFA 2Z30B 3WC0A 3BPDA 4Y34A 4KGMA 3DDNA 1ZAVA 4C8KA 4C3KA 4L72B 3UN5A 2XQCA 4ZK7M 1X4DA 4CO1A 3HF5A 2GGPB 3TX8A 4RW6A 2RS8A 3PV8A 4DL7A 2DH8A 3V6DB 1TVRB 5HVGA 5LMNF 3GILA 3OVAA 5GAGU 3PKMA 1TMMA 5BYRA 1EP4B 1HBMB 3I31A 2XGQA 2AGOA 3VAJA 5FLXY 4LRFA 2FVRA 3MMAB 3KG0A 2FLOA 2VPXB 4J5OA 2FJAB 2IRUA 3FQLA 2P5VA 2Z58B 2CJBA 3SCKE 2MMYA 4HTIA 3FBBA 2DHSA 2ZH6A 2MGZA 2AU0A 3WDOA 1YDLA 1LWXA 4JI7J 5H9EK 3D0GE 2E5LF 5HATA 4JV1A 4NA1A 2CFXA 2XCPA 1R0CB 2QL7B 1NJIT 1X60A 1XR6A 4LVNP 3KLEB 4KFBB 1KS2A 3MM9B 1KWMA 4QW9A 1RTIA 4LR7A 4DR1F 2M70A 1U8WA 1GMUA 2QA4G 1BQNB 1HBNA 3HT3A 2AKWB 4LFAF 4K4SA 1BQMB 4NCBA 3EPIA 1J27A 2BKPA 4RNMA 4B3RJ 4ZLJA 2ZD1B 1T11A 4NLSA 4DLEA 3P96A 2DGVA 3OFEA 3PJWA 1FD2A 4G3IA 3GYXB 4AUKA 2QYCA 5ADZA 4DFJA 2F8MA 2QX0A 2OI2A 3MPYA 2N4CA 1SJRA 1ZAXA 2YQ0A 2HQGA 2FLNA 1VRUB 4K4WA 2R8KA 4JI4F 2AJ0A 4TY9A 2R7VA 3MDFA 2WK4A 1C1BA 4U9RA 2F65A 3MGJA 2DITA 2Z4PA 3TW0A 3PIPQ 3WIVA 2CPEA 5IC4B 1R89A 2V0NA 4Q2MA 3FMWA 2JSXA 4EFAC 3R5GA 4DPTA 1RTJA 2Z56B 1NKBA 4UZBA 1S59A 4XDDA 2DNKA 4MKBA 4RNNA 4P71A 2DGXA 2ZOFA 1R3NA 3NAHA 1VLOA 4O44B 3CEDA 4YB1P 3U27A 1RAHB 3C6UB 1X31C 1FCAA 2BJ3A 4PZVA 2Z2MA 3IR5B 4P52A 4NYOA 4M63A 4J9KA 3TA1A 2B9XA 4DCJB 1SBRA 4JI2J 1LFWA 4QIWD 1U6FA 4WXWA 2E7XA 3CMAS 1UW9A 2D9OA 2DR5A 4B9SA 4WTYA 3OFFA 2AP6A 4LSNA 3TZWA 1ZZNA 3H0PA 5EX0A 1B3TA 2RJZA 1RA7A 4HHUA 2J7UA 5HP1B 2YNFB 3T1HF 1N8RT 2XLKA 4DU8A 2CQPA 2GA7A 2NLWA 3AOBA 3P8BB 3CCMS 4M94A 3NP5A 2DGWA 4ZPDA 1WC5A 3B4MA 2QYGA 1TU0B 2IBKA 2UXBF 4K0KF 3TUZC 4DF4A 3MMJA 2D74B 1FNMA 5CYMB 2HHTA 4X4VA 4I68A 4WXOA 2ZBPA 3C6TB 3GQCA 2NS1B 2OAUA 3TQEA 3M2VB 2CZ4A 5CA5A 3OFHA 2IYGA 4GKJF 2MKJA 2E5LJ 2HQ3A 2WW4A 4EBDA 3TVZA 5J2QA 3DXSX 2KM8B 2MQLA 2VG7B 2HNDB 1WKJA 5B08A 3DLEB 1DY3A 1NK6A 4DR1J 3PZPA 2J8SA 4URGA 3US5A 2E1PA 2QFJA 4EK2A 4DPOA 1FXRA 4LFAJ 3OTDA 4I1TA 3W8PA 4C3LA 3ZTPA 5C2CA 1FKOB 5M2RA 1XIQA 3V4MA 1H0HB 1FRKA 3LQVA 3QJPA 4QU7A 2W4CA 2BJ9A 2ALZA 1GXUA 2C2RA 2CQ1A 3I56S 2W7AA 2PMZD 2BW7A 3TOQA 4DI6A 3OJUA 1AZSA 3H7HB 4N76A 3M8ZA 1B4SA 1IVZA 1RGVA 2W8LA 3OR2A 1TELA 5HLFA 5B7WA 1HD0A 4IDKA 4P10A 1R43A 2R2TA 5D3GA 3MFIA 1RBLA 3VGTA 2OPPA 3QBCA 1GNKA 2EW9A 4E98A 1I94F 4DV7F 2X1GA 1Y9OA 1FTCA 3PHTA 2P9CA 2P8IA 4DPUA 1J5OB 3HI9A 1LFPA 2LXFA 2G0IA 2HZAA 2W2OP 1SUQB 4QQBA 3P45B 2X1AA 5DZ7A 2ZH7A 1BWVA 3PRVA 1VQ9S 1DTTB 4Z7YA 2KG0A 3V6HA 2DEIA 1X9MA 4CLWA 4IR9A 2B5JA 3FZ2A 4J9RA 1D3WA 1H98A 1QVGR 4WZMA 5H9FK 2FJXA 1JLCB 3PJXA 1T05B 3K89A 2OTLS 2CIMA 1BMQB 2M7SA 1F3FA 4LF4J 2MSTA 2B4OA 5DZ6A 4OZ1A 4C8NA 4NZ7A 1JLBB 3EVWA 2XM3A 2L08A 1LEOA 1B7YB 3CJ5A 1AUSL 2DRBA 1PIEA 1OQ3A 1UWBA 1IQTA 2LVWA 3OL8A 9ATCB 3UN2A 4NLVA 2CDQA 4O3QA 4QYZK 4RUBA 1M5VC 1P1TA 1V3ZA 2W1BA 2PA3A 2DGQA 1CJTA 1UJ5A 1YJ7A 3GLJA 3LOUA 1FESA 2FD2A 1TK5A 4A8YA 3L7UA 4XO0A 2BQRA 1M90T 4DR7F 1FDBA 2JVRA 3DLJA 1S72S 1M5PC 1RXOB 1VLYA 4DV4F 4K0KJ 3VAMA 2HFSA 1NPPA 4Y0FA 4CH0S 1CBKA 3GIRA 2W9AA 2QJ3A 1EAYC 5JMNA 5C5JA 2BZ2A 2YKPA 1WI6A 5HQMA 4YY3F 1W25A 1S1TA 2FVQA 4N56A 4IKAA 2KJWA 3GCWP 3PACA 3SMZA 2OPRB 4DPXA 4GKJJ 1YHQS 2V9WA 2H65B 3CC4S 2HMIA 4DV1F 1WWHA 1S0OA 5K14A 3BSCA 2MDAA 2RHSB 3R5CA 3PIOQ 4BC7A 5ETLA 4UQGA 1WNEA 4KGXB 3TUIC 3IRXA 3MM8B 1YWXA 1VR6A 4V19X 4FPRA 1KC8T 2MXYA 3R27A 3C15A 4LF5F 3AFGA 1JK9B 4KBIA 4IH6A 1YJWS 3AT1B 2YX4A 2R7XA 3EXYA 3PVXA 1PC5A 1M1KT 2HQFA 3EVOA 4FF4A 1Y11A 2NUUG 1SH2A 4CTAA 3LA0A 5LM7E 5BJRA 1FT8A 2ZZTA 2D1CA 2HAFA 3TAMA 5J2PB 5E3AA 1L3TA 2E9TA 2F7VA 1HL6A 1U2FA 5KT4A 3NS7B 1MWZA 1EQMA 4H4KC 2HHWA 2BVZA 4P2SA 3ZTQA 4ZPBA 2B0GA 3V5RA 2XMJA 2DGOA 3IBWA 5K8MA 2IFXA 1IKYB 4TQSA 2J9EA 1T9WA 4YR2A 2IAJA 5G0RA 2FVCA 1UA1A 1L3UA 1SJ4P 1KSPA 2ZH4A 3NRBA 4DV7J 1APSA 5D15A 1EARA 3DM2A 3BGLA 3I4HX 3VR1A 1FFSB 3P6YC 2FC8A 3R5AA 4URQU 3TJ8A 1X5SA 4AL7A 5KFBA 1QSSA 4MT1A 3DOKB 4ID5A 4BS2A 1GFWB 3RZAA 3W2VB 2ZH9A 3QLHA 4PPDA 1H3DA 3CE8A 2V69A 2CPIA 2OKQA 2R4FA 1REVA 3MMCA 4I67A 1NDCA 4GO7X 2EG2A 2IYIA 4PWDA 4HT7A 3MMBA 1FDAA 1F5CA 5K8PA 4K4YA 2HGLA 1E6YA 5C42B 3O2IA 4ECXA 3CULA 4OHVA 4OX9F 5E7OB 3PTWA 3EMTA 1NJYA 2HNZA 1Q81T 1M0SA 5KFQA 1RT4A 4WBFA 2ZH2A 4U7UD 4NLWA 4P2MA 1UFLA 2E9RX 4OJ1A 1Q4RA 2DH9A 1RTDB 3CGIA 4RNFA 3IWNC 3ETOA 1KR4A 1FJEB 3KLFA 3KMSA 4FBTA 1FRIA 1NMEB 3QNWB 3F44A 3T9ZA 2VODA 4AD6A 3KMQA 1GXLA 4U67Q 2KKHA 2R3VA 3SDEB 2GC8A 1RT5B 4DR7J 1R8PA 4OYXA 4DV4J 4USIA 1PAUB 2CPXA 1WJ9A 4YY3J 2MHEA 3VCDA 2AZ1A 3NCQA 1MWYA 2CQ3A 2ZOMA 1JQGA 3M8PA 1SVDA 3DLHA 5KFKA 3DOLA 3RW6A 1BXNA 1SB6A 4DS4A 4J9UE 4AFFA 4HR2A 3MHYA 3BH6B 2C2EA 3MECB 4CZCA 3CWJA 2AYBA 3Q8UA 4RBTA 1Q0NA 5D77A 4HYKA 1CJKA 5LL6d 3ADAC 5CQGA 4FXWA 4OYWA 2V68A 1REGX 3ILJA 1QTNB 1HQEB 4RW9B 3MPVA 2MJUA 4ED5A 2OHDA 1HNWF 3BN7A 2B56A 2K3KA 1XBWA 4I2QA 5D0EA 1VBKA 4DR6F 3AA8A 2ADCA 4X64F 4DQPA 3F41A 1Z2ZA 2GO9A 1JXLA 4A8SA 2I38A 2YKQA 5A8KA 3DRRA 4GVLA 1OPZA 3UDLA 3TA2A 3LGMA 5SZTA 1LW2A 2M3DA 1YQHA 3JQKA 2VQEJ 4YB5A 5JXSA 3OXGA 1W26A 3VWSA 2GX8A 1N4LA 3JSMA 3AAWB 1NJXA 2ZE2B 3CF5Q 1HWKA 2O1PA 3I96A 1MROB 3EDQB 3IFEA 3WZ0A 2KT5A 1B0PA 2B7BB 4I7FA 1X0PA 1PYTA 1T94A 4WFYA 4F4XA 2WVBA 3TEHB 2J0XA 3MPWA 4OFZA 1BE4A 4WYLA 4PWUA 3V2UC 3Q8RB 2I9SA 1RT6B 3MM7A 3AH6A 1KTQA 1FK9B 5KOWA 2F5GA 5ETRA 3H4BA 3UD5A 1NHUA 3VQTA 2Z0GA 4ZVEA 4OZ3A 1FJ7A 4H4MA 3PW7A 2EKYA 5IZHA 4NLGA 4P2XA 3JB9k 1Q95G 4FXVA 1D8ZA 3KLIB 1U2CA 5KG6A 2WBMA 3SBMA 1CC7A 2I1RA 1OMSA 1NK5A 3ZZYA 4DDFA 3KHLA 2X3GA 4G1QA 3UDCA 1JJHA 4OX9J 2XNRA 2IJFA 4KR0B 4IQXA 1T3OA 3HVTA 3HK2A 3G6XA 4C7QA 4OHWA 3CCJS 3WC2A 2XMUA 2BJDA 3NOCA 3ENQA 5EX3A 1BD6A 5ETPA 4XAKA 3JQJA 4IG0B 1JLGB 1EP4A 1HBMA 3TX0A 5CZXA 3G4SS 1XMOF 3LO3A 2DB1A 2FHKA 1Z1ZA 3D3CJ 3GIJA 3J80Y 2YNGB 3AD8C 3CCLS 4NLOA 2AJ1A 3GTYX 4BC9A 2QGFB 3MEGB 1PJ6A 4JUZA 2RF2B 5THWA 4FXDA 2D3UA 4FZVA 2J6UA 5HJYA 4YFUA 3NY0A 3SIPB 2V4RA 5DETA 4IUFA 2QMUB 2BRKA 2Z2ZA 4F0KA 4PKDB 4PG5A 5FJ4A 3QT8A 1YBTA 4M8LA 3ITHA 1R8AA 3LH2S 4NWBA 4Y2IA 1LK5A 3KLEA 4DV3J 4KFBA 1SKRA 1G4CA 3UR3C 2QN6B 1QSLA 2V8DA 1RACB 1UJ6A 3UVJA 5DLGA 1BQNA 8ATCB 3CXCR 4O3SA 2EK6A 1JB0C 4KH1B 3ISND 1RSCA 3MCNA 4X4PA 4D3GA 3IR7B 1HNWJ 2ZD1A 3V4IB 2YXLA 1N36J 4DR6J 1WACA 4X64J 3QZ7A 1SKWA 1MU2A 5KG4A 5KOXA 4FF2A 4CYUB 4WWSA 2YH1A 4LF8J 5D4NA 1WTFA 1SL0A 2GQQA 3SV3A 2DGSA 2WCXA 2LA4A 4BCAA 4DV0F 3LTOA 3KG4A 3FMBA 3CDUA 3OTCA 1VRUA 2RRBA 5T7LB 2J0SD 1DRZA 1FRXA 3QIPB 3ZZPA 3MUVP 1VQNS 3M8WA 2OPSB 2DPIA 1ACMB 1V3RA 3J7YI 5FDLB 3N5BA 1WF1A 2KL8A 3TVYA 4X4QA 1QLNA 3VHQA 2CRLA 2HFNA 1D0EA 1FKAF 5EN1A 1TL1B 3D1OA 5JJBA 3KHHA 3LPYA 5A6PA 1FD8A 2O01C 3MCSA 2CQ4A 2YNHA 4USTA 2FQQB 3ZZRA 1FXDA 2FHJA 4DX5A 3TYTA 2XB2D 4ED7A 3VAGA 4LREA 1U47A 4YHHJ 4M5IA 3NGKA 1VQKS 4B3TF 3H98A 4U95A 4TU9A 4K7QA 4ZVPB 2HNYB 1AUDA 3QIDA 2XYHB 2A10A 4PQUB 5B0FA 3G6YA 2XMAA 4X4NA 3CVKA 3G8TA 5HN0A 5KTQA 2V8GA 1U1OA 2RSQA 1J2VA 5IS2A 1C1CA 3GWCA 2XLIA 1OYDA 5D0HA 3MEKA 1NPKA 6AT1B 2JH3A 1JLQA 3QGHA 3BKFA 1B0VA 5HP1A 2YNFA 2H5IB 2XBPA 2HVDA 4ZA1A 4ELVA 1KVIA 2GVDB 5M2PA 5DQHA 3C16A 4DV6F 2CYYA 1U1QA 2VASA 4RR5A 2EXUA 4TYBA 3R1HA 1VQ6S 1RT3A 4DQQA 3UD3P 2KI2A 1L3KA 4W98A 2Y1LB 3SCIE 4A8QA 4QPTA 1S1VB 4B02A 1ZA1B 3IG1B 4K4VA 3I55S 5ETTA 3RRGA 3QFWA 3CIMA 4PG8A 5D0GA 2BDPA 1RLCL 4RW4B 3C6TA 2JJ4D 2VHGA 1VIOA 3LWMA 5LMUF 4FYDA 1Y10A 2M0GB 4UUWA 3GV7B 2ABYA 3G86A 2ZZMA 2W2PP 3W5ZA 2RB7A 4ZITA 4YDXA 1ZOTA 2GJIA 1V5VA 2HK3A 1RISA 2HNDA 3MM6B 3HFVA 4NPOA 3DMJB 2UUBF 2QA4S 3DLEA 4B9LA 2CUYA 2EFQA 2KFZA 2K1RB 1K73T 1XEZA 3T9NA 2RU3A 2BE2B 3KJQB 1HWLA 1RKJA 4LUBA 4KV8B 2G9OA 4KSEB 2C2DA 1K44A 3HHDA 3O44A 4ZVQB 2RMLA 4HDHA 1VOMA 1NK8A 3BBBA 2RD5C 1IKWB 4AXIA 2UVWA 5CAAA 1S0VA 2CKWA 1HBUB 1VQOS 5D6GA 4DR2F 3CCES 1FA0A 5A8WA 4R5PA 3G71S 3M8YA 1O5JA 2HGMA 2C2ZB 5DQIA 1ZH5A 1EHWA 4O0IA 2J7KA 4TU7A 2RUGA 3NXZA 4DZDA 3R2DJ 1VQYA 4MYTA 1RHRB 2KVIA 1Z4UA 1T7PA 3SCJE 1X8DA 2HEKA 4BBYA 1CLFA 5HMWA 1YK9A 2KVQE 3RJMB 5HVHA 4W92B 3HVAA 4IOCQ 4OZLA 5DRKA 4X62F 2F9JA 4ZP6A 2HGNA 5E3PA 3CPWR 5K9FA 1UFWA 5DJBA 2CPZA 4QYRA 4DZ6A 1KLMB 4MFBB 5CD4A 5M2UA 1SUQA 3IS9A 1WKKA 3GSDA 5KT2A 5B0CA 5ITHA 2JFDA 3IBCB 1R27B 1IXKA 2NSBA 1NKCA 3R5JB 1YG0A 4F3MA 2P6TA 3K59A 2LP4A 3CUNA 1U25A 2KXNB 5IQQA 1SV5B 5F41A 2IHR1 4L75A 4WIIA 4B3TJ 1RAAB 2KFYA 4RW6B 4DS5A 2QL9B 1HHSA 2OUGA 4NCGA 3MAQA 1ZAWA 1T05A 1FRLA 2ZNYA 5HROA 2FJEB 1DHMA 3AJDA 2ZJPQ 4DFKA 4WIQA 1K47A 5IQ6A 5JUMA 1DQAA 4FYYB 3BB5A 2GW8A 4K50A 2PSZA 1HR0F 1JLBA 3UFCX 2K8GA 4ERDA 3DDKA 2MQQA 1PILA 3ENAA 2QSWA 4ZPCA 7FD1A 3WHIA 3QRRA 4UF4A 2MQMA 3LP2A 4RZRA 4HTJA 2MGZB 4DV6J 1YJUA 1AB8A 1Q5VA 2YY3A 3A4TA 3L09A 1YZ7A 1FTRA 3C2PA 2E9ZA 3R7NB 1XMBA 2YX1A 3LGHA 3PY8A 3CB4A 4Y2KA 2WTFA 1WHWA 3PCOB 5KFVA 4ZN1A 3BR9A 3SXLA 4DSLA 1BGXT 1IJEB 2LEBA 4DN0A 2J6SA 4KIAA 2GNKA 5LMUJ 2MEWA 1RTIB 3CJKB 3NS6A 4IOBA 2CPJA 3OVBA 2ASJA 5DLFA 2MLYA 2XI2A 1RZMA 1YBUA 3N4WA 1WI8A 1RLDA 4F4ZA 1X5TA 4JOUA 2VA2A 1VQ4S 1S6OA 2OH2A 3WX8A 2HFUA 3D6FB 4IFYB 4DHVA 2KG1A 1UJ4A 4ZOSA 3OSNA 2NXCA 2ZDPA 1CQMA 3K58A 1FRJA 3MM8A 4JI8J 2G1HA 2DCUB 5E41A 3QWPA 3W66A 2GJFA 5KFPA 4H4KA 4F4KA 1XNRJ 3PG9A 1T02A 2LQ8A 2ASYA 1JNZB 4DR2J 1VBYA 4IRKA 2DRAA 3PKYA 1C1BB 1KN6A 1S7HA 3IWLA 2Y9HA 1IBCB 1N6QB 3QMQA 4QWCA 1P6TA 3B8HA 2ZH3A 5F0WA 2PIIA 4M5DA 1PYOB 3MR5A 1CPZA 4YEAA 3H5SA 2IBOA 1IKYA 3FFIA 1JLFA 3G9CA 3RUBL 4JV0A 2WW8A 4NI2B 3RG6A 2YWEA 3KUHA 1N32F 1GXTA 4C11A 3CMQA 4ZVRB 1NXIA 4X62J 4OYMA 3LGNA 2YQ3A 3W5YA 1VCTA 3DRSA 2OSRA 4WFAQ 3LP1A 4DUTA 4KY3A 1RWPB 4NCAA 3G2XA 2D3ZA 4CLZA 2UXCF 3ISNC 2FLPA 2KFNA 2J6TA 3VALA 1NPRA 4EWTA 4LSNB 3EZUA 3K7RA 4Y3CA 2ZH8A 2PI5A 3BQ1A 2DNGA 5C42A 1KQGB 3UWTA 2W7OA 4UOGA 2G1DA 3BYPA 1FDDA 2DHXA 4GMKA 4USHA 3VVTA 1RWKB 2FJBB 2AYMA 1UVJA 1HR0J 3AOAA 3EXCX 4BDPA 2UUTA 4ES1A 1M1HA 4KHPF 1OO0B 1K1SA 1JXEA 3MEDA 2VV5A 3D54A 2CQBA 3BQ0A 4DL6A 2BJ8A 4XIUA 4HL9A 4Q0BB 2G0CA 1EETA 2HFZA 4C0BA 1RT5A 2XMTA 3OW2R 4IG3A 3QGPA 4C2MA 2UV8G 2Y8YA 5J2QB 3JTNA 4Q45A 2VBYA 1S9GB 2V50A 2QLFB 4QIEA 1MSWD 4RNOA 5EWFA 3FGVA 1Q82T 5LXYA 1WSRA 2VH7A 1Y5IB 2ASDA 3MUTP 2G2ZA 2QO3A 3GIMA 4DCPB 1UVLA 2DNHA 3V6KA 5L1IA 5AT1B 4NA3A 3BYRA 3VVUA 5DG8A 4OYIA 4PXEA 3EUNA 2DYAA 1JIHA 4DQSA 4GC7A 3WX4A 4OHZA 1TKZB 1NDKA 2GJ2A 5D78A 4OMFG 5J1EB 1JJ4A 1KRPA 1AZSB 4RW9A 2RILA 3FEZA 1KD1T 1PKUA 3OR2B 3HMJG 2EC2A 5HLFB 4PYDA 2WSEC 3FJ2A 4QR2A 5DGBA 3WBZA 2ALYB 4IDKB 2PD1A 2W9CB 1SC6A 3CC2S 2PFFB 5FIIA 5F8GA 2DJWA 2FVSA 3ZXWA 2OPPB 2YX7A 4C8YA 5U47A 1N0VC 3PYEA 5D4PA 3R97A 2BOPA 3G82A 1PYSB 3RBZA 4M5HA 3QZ8A 2P9EA 3DFEA 4B9TA 3HHLB 2ZE2A 1B7FA 2MKYA 2ZWPA 2VC1A 5BYSA 1MROA 2VBWA 1QAJA 2GV1A 4ILRA 5HI7A 4HLBA 4J9PA 3DU6A 3AD7C 2Q6BA 1GAOA 1RBOB 1CJVB 3M30A 1RQ0A 2HFVA 1N32J 3KLGA 2GMHA 1Q79A 2I8EA 2GAGC 5LXRA 4OZ2A 3VGUA 1RT6A 2VF3A 2YKMA 3HVRA 4O4GA 3KJVA 4J9MA 4J9QA 1WHYA 3A3OB 3CC7S 2IM3A 2OFHX 4QU6A 4ITSA 3RW7A 2UXCJ 2E5JA 2CXEA 1UVIA 4JI3J 3PEJA 5FLXU 3AHPA 4CDIA 2L3MA 3CMES 1P8GA 4LBHA 2CVIA 1UWBB 3M6WA 4RWWA 2ZKTA 1G7CB 4OHYA 1U1NA 5A76A 2W2QP 4Y2MA 4F7VA 1CJTB 3CSKA 3JSRA 3T6JA 1OPIA 1QAYA 3FSIA 3M05A 2E44A 2IC3B 4P9SA 1PJ5A 4FS1A 4KHPJ 2M88A 2A1BA 4IG0A 1JLGA 2FPHX 1ROFA 4KQZA 2MKSA 1A7GE 2WRMA 1S1TB 2EFPA 2UP1A 4DN9A 2AJ2A 1RWUA 4DCOB 3KUGA 2YNGA 2BACA 2BANA 4IO1A 2FB0A 2HMIB 1RABB 3H4DA 4PG6A 4YUDA 1H2VZ 2J7WA 2DIUA 3FKBA 5K14B 4AYBD 1U1LA 3EGZA 4KAIA 2F9DA 3N6NA 3POTA 1IN0A 3ZO7A 4ECUA 2C1EB 2R7UA 3J7A1 2LEPA 4QW8A 5KFDA 2HQIA 4DL0C 1WG5A 5GAEI 4ED2A 4WK3A 1SJQA 4DBQA 3C15B 3GJTB 3I5BA 3DLBA 2DNYA 3M1VA 3N79A 2QSFA 4DEZA 3ELHA 5AE3A 1NJWA 2ZITA 1HPZB 3NGUA 1CSJA 2JWNA 3IC1A 4MIWA 3DNCA 2XCAA 2ZZNA 1VK8A 2CPHA 4ZPAA 5CHCB 4CTAB 1C0TA 2UXDF 1TL3B 4FF3A 1HNVA 4YB7A 1BC6A 3V4IA 1FO1A 3BJYA 5BXIA 1VQLS 4DPYA 4FYXB 1VQ7S 2BQUA 4R25A 1X4GA 1NLKL 3TJAA 1VQMS 2RAQA 1XR7A 1RAJA 3DCAA 2YBVA 4CYUA 1FX2A 2IAJB 2ERRA 5G0RB 2QMWA 2VUGA 4RKUC 3HXMA 4M1KA 3GIKA 4ILLA 1EQ0A 2CNKB 4H54A 3DM2B 5T7LA 5L9XA 1NSAA 1C0UB 4X4OA 3C8YA 3BGUA 1WC3A 2COLA 1R0BG 1CULA 2OTJS 3BR8A 4XPCA 3ENVA 3IM9A 2ZUAA 1Y4ZB 2BJEA 4ID5B 2GQCA 3D3BJ 1WSVA 5IV3A 1F5BA 3QLHB 2J0WA 4HT5A 3MM5A 1X4FA 3MMCB 1S76D 1S5ZA 2CZ9A 1DFDA 3GR1A 4DL2A 4Y2AA 2ZEJA 3MMBB 1RTZA 2MQNA 1AXQA 5IOLA 1Y7PA 4XDCA 2QC3A 1C2PA 3ICLA 2C28A 5J1NA 2HNZB 3W7BA 1CG2A 3RB6A 2R7RA 4DWIA 4IRDA 1RU2A 1SH3A 1Q53A 5DQGA 4F3QA 3KLFB 2K06A 3FEXB 4JI0F 4PQUA 4F4YA 3HVWA 4J9LA 3L7PA 5A6WA 2E5IA 2MPUA 2DVIA 1WORA 5L8RC 4J9OA 4RU2A 5I3PA 2AQ4A 3D1QA 3RAMA 4ICLA 3RB3A 1RYSA 2X51A 4X2BA 2W4PA 3CJQA 3CDWA 1XMQF 1HD1A 1SQEA 1A6LA 1MMDA 3MWBA 3NS5A 3M8PB 2MB0B 3A3NB 3DOLB 2X1BA 4J90A 3MFHA 1D9DA 2G13A 3SI8A 2AF6A 1S9EA 1MLAA 3IG1A 4ANEA 2ZDOA 5E3QA 4A8WA 1P27B 3ZFVA 4DV2F 4RW4A 2GMLA 5C2GA 1WF0A 5H9FJ 1CJKB 2XMWA 1U45A 2CNLB 1OYEA 3MEEA 3VAKA 1HBOB 1KHWA 2BM1A 1K8AT 1I51B 5LSLA 3HZGA 4I2QB 5CD4H 5D4OA 3U1MA 4NX9A 3CD5A 2K1RA 2BE2A 5KT7A 1ZM4A 2W25A 4I4BA 5A8KB 3DRRB 4ES3A 2AJQA 1IWGA 3UI3A 2HBRB 3H25A 1R8HA 1DQ9A 3U02A 4CO3A 3PX0A 4TXSA 1IKWA 3JSMB 1HBUA 2H48B 1U26A 5KFRA 3KDNA 3QO9A 1U1RA 4M5NA 4Q5VA 3IMQJ 2VA3A 4I7FB 4CP5A 1RT2B 2J9DA 3KHGA 4Y00A 3IR6B 1TL4A 2U1AA 4QPXA 3HSJA 4OLPA 4L3KA 2RNEA 4YQWA 2K2PA 3KDOA 1U0SA 5IC6B 2ZH5A 4FKYA 4A8XA 2LKZA 4F36A 2XWYA 5GAEU 1ZTTA 2RKIA 1FJGJ 2B3TB 4JI6F 1PCAA 3MAAA 2XTJP 2I5JA 4I64A 3A12A 4AQYF 4ED8A 2FJWA 2KTQA 1HLWA 3HJFA 3L4BC 2OIHA 3BSNA 1VQ5S 3CW2C 3OLBA 1AYEA 4MFBA 2WAQD 4GVBB 2HHHF 3BDPA 3W9JA 4G1QB 3W62A 5KFFA 2R8JA 2V5HG 1HNXF 4MKAA 2QT7A 3MXHP 3HT0A 1U49A 4TU8A 4PRFA 4U8YA 3HVTB 1R7IA 1SV5A 4A4JA 2BKOA 4OI1A 1V9OA 1X5OA 3BEGB 1DLOA 3FC9A 4BHQA 4K4UA 3CO9A 5LSRA 2CJQA 3FBFA 1F1BB 3ILLA 2UV8A 4NLRA 3N28A 4K4TA 5I42B 3TA0A 4NYPA 4JV5F 1W7WA 4UOCA 4B3SF 2XYPB 4YOEA 3K5NA 4ZDNA 2BR0A 2Y3YA 1UWAA 2L41A 2VPYB 1MMLA 4OYZA 1QE1A 4K4ZA 2FZKB 4CT9A 1RAEB 1N34F 4DR4J 1QJHA 1RAFB 2IVMA 1XMQJ 1NNDA 4I56A 4YR3A 3OUYA 3JQMA 2JEGA 4LQ9A 3D5MA 2HWTA 2B9YA 3CTRA 2EFOA 4F67A 4KGKA 4LIRA 3HSZA 1DARA 3ITHB 2AYEA 3HULA 1RHUB 4AL6A 4M5MA 3CJKA 1D9AA 1PJ7A 3FUYA 3UVJB 5C25B 3HPOA 2IDEA 1X4HA 3DN9A 2N82B 4CO2A 1HW9A 1IR2A 1QVFR 2LMIA 2E5GA 2GFFA 4I2PA 3WQPA 2VKRA 2AX1A 3SSQA 4KB7A 3PNIA 3C19A 2DISA 4QZVB 4IFYA 5KG2A 2KHDA 2XG8A 1MU2B 2QLBB 4ZP8A 2DHAA 3TUPA 2KXHA 3PW5A 2C22A 4O0NA 1IBKF 4MK9A 1I5OB 2L9DA 2XZTB 2PO4A 2HIYA 3FVYA 4ECZA 3R7BB 4LRCA 4FNIA 1CJUB 2IVYA 2IMOA 4CWBA 5BYQA 4KKOB 3U1NA 3KNGA 1WD6A 2D69A 1FWPA 3OR1A 3VAFA 4LSZB 2LQ5A 2W2MP 3HHEA 1N6QA 2R2UA 2KU7A 3JXOA 4CI0B 1KQFB 4ZVTB 1MMNA 2LEAA 3OV7A 3ZNJ1 4C0HA 3AJ1A 1S0NA 4RW7B 4KHMA 1M5HA 3M6XA 1S97A 1U1KA 1S10A 2YNHB 2A0FB 4JI6J 4QWDA 4NI2A 3KHRA 3OHAA 3H42A 4AQYJ 1FDNA 2DTJA 2FUG9 1O51A 3MI7X 4K5SA 4QIGA 1HMVB 3RYLA 2C2OB 2ZWOA 2HHHJ 1S1XA 3D0HE 3QAUA 3K8VA 3AB4B 4ENOA 5EHHA 2RDDA 2DK2A 3D6HB 4F8RA 3PR4A 4LJMA 5LJ5Y 3IP0A 1C1CB 4UZCA 4C9DA 3PYFA 4JI1F 4KO0B 1JLQB 4PWWA 5F0UA 2B9WA 4LSLA 2J8AA 4HACA 5LMNJ 1Q7LB 3PX4A 1TKDA 3T1AA 5F8IA 1TL7B 2VFRA 4B3SJ 3C16B 4WF9Q 2BE9B 3CD0A 1RT3B 4TNOA 3C46A 3HX9A 1SQGA 2JX2A 1WC0A 4MH8A 4C8LA 5EGYA 4ZN3A 3TAPA 4YDDB 5KG7A 1N34J 3THTA 2J9DE 2N3LA 4C97A 1FHTA 4QBUA 1TMJA 4J91A 3CCTA 4LF7F 2Y1RI 4Q0BA 2H5EA 4EO8A 3LWLA 3EWGA 4N5SA 2R7TA 2CNNB 3EM1A 3C14B 3MPUB 1GTHA 2V8PA 1FI4A 3QRPA 1S9GA 1HQUB 3BH7B 1J5EF 5ETNA 3M8SA 2IPOB 4OV6A 4HI2A 2ADBA 1SKUB 2RQ4A 3B82A 1FVQA 2R7QA 3NWGA 2RRNA 4RJVA 3PDNA 1L3SA 3MOZA 1Q8KA 2V2KA 3D2WA 2VFVA 3IN5A 3M9OB 4CNZA 2O66A 4LF1A 2YKNA 4QWAA 1TKZA 5A8WB 4R5PB 4KRWA 1RT1A 5K8NA 5J1EA 1U6ZA 5AXLA 1VRTB 1H7XA 1IBKJ 4A8MP 1UZHA 2AJ4A 3O1LA 5L39A 3W9HA 4OHXA 5D0RA 1CQNA 2CQDA 3HHNB 4JI4J 1ICEB 2IA6A 1OQ6A 2W9CA 2OJ3A 2RDJA 4Q8FA 3H8YA 4B3OA 2CAJA 5KFLA 4J37A 1YSJA 1E6VA 3NKYA 4EBEA 2CADA 1FRHA 3M2RA 3UDEA 3ILOA 4NEYA 1YJRA 2OMOA 3HHLA 5ETSA 1RYRA 4X66F 1RTHB 3V81A 3IS9B 3LW5C 2UUWA 2JEJA 5DM7Q 1CJVA 2KO1A 2BM0A 4X65F 2XI3A 5KT3A 3RU0A 2QRRA 5HQLA 2C2MB 1ZETA 3IO1A 1NB7A 3EGWB 3PEHA 3AJ2A 4DSIA 5HSPA 4NCGB 2ASLA 2Z57B 3K5OA 4PG4A 4ZLLA 2RE1A 3GIIA 5HROB 1NO8A 2GHPA 3KLHA 4FPIA 4CLFA 3E01A 3UQSA 4DUYF 3CCWA 3VGSA 2OEMA 3RR7A 1VIXA 2V4JB 3J80U 3SQGA 1GT8A 4JI1J 1G1XA 4F0MA 1IBMF 2RQCA 2LCWA 3G6ES 1HWJA 3ZZZA 2V94A 3T1HJ 3LP2B 4OZ0A 4FVMA 2BMBA 2DNNA 3P3DA 4B9MA 1HW8A 1MW7A 4EU0A 1RWXB 1RU1A 3NNHA 2JC1A 2CJXB 4OQJA 4RUCA 1SXLA 3NAIA 2H1YA 2IC3A 3JSYA 2UXBJ 2DGTA 2ZBRA 4LVOP 3AQOA 4CCHA 4AT1B 2F8EX 3EGNA 3CDAA 1N48A 2AEMA 3K17A 1S7IA 4MYUA 2QA1A 5IT9Y 3KK2B 4DSJA 4ZIWA 1HIYA 3M4XA 3MTKA 5B09A 2OFGX 1F9HA 1XR5A 1J5EJ 4CH7A 4K2JA 2ZJQQ 1KFSA 1YBAA 1RJJA 1UZDA 5HO4A 4E0DA 4EO6A 5E5NA 2VICA 1G6BA 4USVA 3KOAA 3EICA 5DG7A 4JI5F 1H2TZ 2XC9A 2N3OA 2YTCA 2BV3A 1KQSR 2WOMB 1KBRA 2XMVA 4AL5A 3X3UA 1HPZA 3M6UA 1NEEA 4EMDA 2RH3A 3EZOA 1WG4A 4GKKF 2E66A 2V67A 3IGVA 4CLTA 2NYIA 3MCMA 3L3CA 4DF8A 2VJUA 1TL3A 3JYTB 3CCUS 1W2BR 2AEJA 3ZZ0A 2YWWA 4Y65A 4DV5F 1P1LA 2BXJA 2J0QD 1D9FA 3R3TA 4H4OB 3HP6A 5AXKA 3Q83A 4M5DB 2HRTA 3I5CA 1TAUA 2K3IA 2NZ4A 2BYCA 4NE9C 1QDUB 4FVCA 3W2WB 3HKWA 3CJRA 3FFIB 3IBFB 3DI6B 2NXUA 1JLFB 3EDRB 3KNAA 2HPUA 3RBDA 5IM0A 5KFWA 3CNQP 1DZ5A 3PYGA 2XEXA 4C11B 2WB1D 1I94J 5ETVA 1X7VA 4G1PA 1C0UA 2DR8A 4WKYA 4X66J 4OX7A 3GE9A 1K0TA 3GFYA 1UTAA 1LV5A 5HMZA 4DL3A 3QJJA 3PXGa 1N5TA 3K57A 2ZM6F 2MSSA 3DRPB 2K7JA 3DRSB 4PYAA 4FNHA 1HHQA 3A8EA 4LRBA 3LP1B 4X65J 2AT1B 4TLRA 3GV5B 3BSOA 1VISA 1WEXA 3L9ZA 3BQ2A 2H3EB 4EZ9A 2OPQA 5KFHA 2AX0A 5I3UA 3GB0A 5GMEA 1LWFB 2ZNZA 4L73A 1IKXA 2E1AA 1IM4A 2MKCA 4LR9A 2V34A 2L48A 2W7PA 2XS2A 3SYZA 3KK3A 4PXDA 1GX5A 2AHOB 4RLEA 4WK1A 3CJ4A 1U24A 2D7SA 4M95A 1U02A 3BREA 2J9CA 3HZEA 3I9ZA 4CLUA 3J7Z5 3MEDB 5L9NA 1RWNB 5HBMA 5KFUA 1TL5A 3UPFA 1RI7A 2MZRA 5EUHA 1R6VA 3TWZA 3CD6S 3ULHA 1EETB 3MR2A 2I6WA 2JLGA 4JP8A 3BGFA 4IG3B 1S1UB 4R8UA 4C98A 2H9ZA 5K5MA 3OVSA 4X4UA 1H72C 2BRLA 4FKXA 4OLOA 1YJNS 4Q7AA 5E33A 2XY6A 5KFTA 1T9UA 2KRBA 1SL2A 2R8GA 2DEJA 3GONA 2MY7A 4DV1J 1EIYB 3FRYA 2LQBA 4G6VB 3DLGA 4B3RF 1RHMB 3CT9A 2ACMA 2B8QA 2G0JA 1LKZA 1URNA 3D4JA 2BJ1A 4RWXA 1Q78A 5DS7A 1VHFA 5GADI 3HHKA 1GMVA 4LF5J 1HBOA 1GK8A 5B0DA 5LT5A 2Z8QA 4UT4A 3EYZA 3T5LA 2IRXA 3QT5A 3R2CJ 1N5VA 1VC5A 2XYGB 2M8DB 4RBUA 2QLXA 2MQPA 4ZVUB 1S6QB 5DDPC 3SFGA 1T9TA 2PMWA 3Q89A 2V9KA 5B0EA 5KAKA 2RS2A 3KJNB 3OBIA 1FNOA 3UE2A 2Q3PA 3QRQA 2EKNA 4DV5J 4Q8EA 3MAHA 3J7ZT 3DHXA 5C24A 3G82B 4CM2A 3J7AN 2IM1A 3O8WA 3TZZA 3G87A 3W5XA 3M2UB 1Q1KA 3FBCA 1T03B 3B4DA 3MURP 3TP2A 4IYQA 2ILZA 2VFTA 4O3OA 4HH1A 4IH7A 2OELA 2FIUA 5EWEA 1RT2A 3M30B 5ETKA 5DDOC 3BBCA 3KLGB 4F26A 2UZAA 3H5UA 3TQ1A 4YS2A 1T95A 4WP3A 1VI7A 2YKMB 4O4GB 3KJVB 4F02A 4ID8A 2ATCB 1WOPA 5JVGQ 3IRWP 3OTEA 2MKIA 1LXNA 2Z2LA 4L74A 3N9UC 2CQCA 4JI2F 2HVIA 2ZH1A 1WOSA 4K8RA 3UCGA 2DO4A 3P4UB 2B51A 3D68A 1R6YA 1S6UA 3H40A 1Q16B 1LWEA 3PJ9A 4GVBA 2CQIA 9RUBA 4L3NA 1UEKA 1SJFA 2PGCA 2AZ3A 1XC9A 1B0TA 5HVFA 4QWEA 2JL9A
chains in the Genus database with same CATH topology
3ZZUA 5CXTA 4K4ZA 1G7CB 1AW0A 1RA6A 3CJ5A 2HIQA 3PFEA 4I6WA 2DRBA 4OHYA 1OQ3A 4NXNF 2BUNA 1Z2LA 1UWBA 3I0SB 1IQTA 1U1NA 2LVWA 3OL8A 1F0XA 4Y2MA 4NLVA 1CEZA 3CSKA 1IKVB 1NH7A 2M2BA 2CDQA 3JSRA 4O3QA 3T6JA 2CPYA 1M5VC 1OPIA 1QAYA 2QEXS 2HHQA 1P1TA 5E3RA 3I0SA 3K2YA 1V3ZA 1S0MA 2PA3A 2MZSA 2DGQA 4X84A 3FSIA 1UJ5A 3M05A 3LOUA 5KFYA 1FESA 5H1SV 5KG0A 2FD2A 1TK5A 2E44A 4A8YA 3H59A 4XO0A 2GIQA 4TYAA 2BQRA 2IC3B 1H38A 1M90T 2EBGA 5I42A 4DR7F 3CCSS 2DNOA 1FDBA 2JVRA 4FS1A 3DLJA 1S72S 1M5PC 1VLYA 2M88A 2POKA 2A1BA 4DV4F 2WONB 4IG0A 2DGUA 3DU5A 1JLGA 2FPHX 1ROFA 4KQZA 2DNRA 2MKSA 1A7GE 3VAMA 2WRMA 4ECSA 3H20A 2N7CA 3PW0A 1S1TB 3F73A 2BANB 4Y0FA 2EFPA 4CH0S 2WONA 2W9AA 5F8MA 2UP1A 2UVUA 2YWHA 4DN9A 5C5JA 1RWUA 2BZ2A 2YKPA 1WI6A 3HLUA 4LFBF 4YY3F 2YNGA 1W25A 4DG1A 4YP3A 1S1TA 2CQHA 3NNAA 2BACA 2BANA 2IA0A 1LK7A 2FVQA 4IO1A 5CYQB 1VJWA 2FB0A 4K2XA 4IKAA 4N56A 2KJWA 2HMIB 2DR9A 2EPIA 3H4DA 3SSSA 3PACA 4PG6A 3SMZA 2OPRB 4YUDA 1H2VZ 3BZQA 1QSYA 2I0XA 4WFBQ 2J7WA 4RUAA 1YHQS 4YMEA 3POTB 2V9WA 5CYQA 2DIUA 3CC4S 1U7LA 5K14B 2HMIA 1KOOA 4NLXA 5DM6Q 2XZWA 4OI2A 1HBNB 2JVOA 2OPRA 4AYBD 4DV1F 1U1LA 4NYZA 1TFWA 1H7WA 1WWHA 4WFZA 4ZCLA 4KAIA 3EGZA 1S1WB 2F9DA 3N6NA 3POTA 1AROP 5F8NA 1IN0A 4D3HA 4DX8H 1S0OA 4ECUA 2R7UA 1RT7B 5K14A 4B3MF 3BSCA 4HDGA 2MDAA 3CCRS 2LEPA 2XMKA 3J7A1 2CPDA 4QW8A 5KFDA 2ZHAA 1S1WA 2HQIA 1YITS 1GTEA 3R5CA 4N47A 4DL0C 4DQIA 3MD1A 5LSOA 3CIZA 1WG5A 5GAEI 3PIOQ 4BC7A 4ED2A 4WK3A 1SJQA 2CJ9A 4RX6A 3M1VB 2Y1JA 2VC0A 4DBQA 2DNZA 4UQGA 3T1YF 1WNEA 3CD7A 2YH0A 3IXQA 3T5KA 3DLBA 3I5BA 3VF0B 2PA8D 3IRXA 3TUIC 4O3PA 3MM8B 2DNYA 1N5QA 1YWXA 2RIJA 3M1VA 1OWXA 4V19X 3GMGA 2QSFA 3N79A 4FPRA 4DEZA 1KC8T 2MXYA 2ZKUA 3RB4A 1CC8A 5AE3A 1NJWA 3R27A 4LF5F 5C25A 2ZITA 1HPZB 5HMXA 4CIOA 1CSJA 2JWNA 3IC1A 4MIWA 4IO9Q 1C0TB 3DNCA 1JK9B 4KBIA 4IH6A 1YJWS 2XCAA 3Q2TC 1JMTA