1RTJB

Mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
439
structure length
426
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of inhibition of HIV-1 reverse transcriptase by non-nucleoside inhibitors.
pubmed doi rcsb
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
molecule tags Nucleotidyltransferase
source organism Human immunodeficiency virus 1
total genus 117
structure length 426
sequence length 439
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtjB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjB03
1IKVB 3FQKA 3GYNA 3QYYA 2AGQA 2JEFA 4O3QA 1TKZB 3PW4A 3LP2A 1HQEB 4PUOA 5EWGA 4YQWA 2W9CA 4ECQA 2C22A 3FRZA 3MEDB 5KFZA 2BANB 2W9BB 3KMQA 4EO8A 2WOMA 2YNFB 5J2NA 2HMIB 4I7FA 2BE2B 3CVKA 3FDSA 4IG3B 3D5MA 2AWZA 3OL8A 1GX5A 3I0RA 4WFZA 2V9WA 3CDUA 1HYSB 3GQCA 3QIPA 3M8PB 4MIAA 3BREA 5KFTA 4QWEA 1VRUB 5EUHA 4JUZA 5L1KA 3I0SB 4R8UA 2FJVA 1REVB 3NAHA 2HNYA 3E01A 1S6QB 2ALZA 3T1AA 1KLMB 5KFNA 3QO9A 3OL6A 3DDKA 1T3NA 4MH8A 4IRCA 4WXOA 1RT5B 4Q44A 3OL9A 2R8KA 1TKTA 1LW2A 4IKAA 1GX6A 1JLAA 3NBPB 2HNZB 2XGPA 4RW4B 2RKIA 5HLFB 4J9LA 2XI2A 1TL3B 4KV8B 1C0UA 4H4OA 5KFGA 2W9AA 2IJFA 2WRMA 2EC0A 4KO0A 2D3ZA 5F9NA 5F8IA 3MEGB 5F8HA 3MECA 5KFHA 2JEGA 4ID5B 2IMWP 2HNDA 1RTDB 3GV8B 1SH3A 4ECYA 3PW2A 3LANA 5KFSA 4H4MB 4PWDA 3QIDA 4R0EA 5F8JA 2WK4A 5KFBA 4YR0A 3BSNA 2R8IA 3OLAA 2OPPA 4FBUA 3PHEA 3BGRA 4IFYA 2IC3A 1TL1A 1N6QB 1IKWA 4J9NA 1RTHB 1NHUA 1S9GB 2ILZA 4NLDA 4NLXA 3KJVA 5KFDA 2FVSA 3FSIA 2C28A 2VA3A 1S9EA 1SUQA 5C42A 2QE5A 5KT7A 2AU0A 4ZP7A 2UVWA 4Y34A 3H4BA 2XGQA 1S1XA 2VG6A 1R0AA 3D28A 3ISND 3PR4A 3MFIA 3BQ1A 2BQRA 2JC1A 4QWDA 4QW8A 5J2QA 2FLPA 3LP2B 4PUOB 4NRTA 2W9CB 4IG0A 1S6PA 2WB4A 3T5HA 4YP3A 2WOMB 5J2NB 3JYTA 3PJWA 4I7FB 5HP1A 1RT4A 5DGBA 5EDWA 3GIKA 3KLFA 5J2MA 3HKWA 3DOKA 1JLFA 4WFYA 1D1UA 5KFEA 3GILA 3NMAA 1FK9A 2R8HA 1IKYA 3I0RB 4LSLA 2ZKUA 1VRTA 2AGOA 2UVVA 3QIPB 4RUAA 3NL0A 3MR5A 4R8UB 3M8QA 1C1BA 3LP0A 2HNYB 3E01B 2VG7A 3LP1A 4TYBA 3MR2A 2BQ3A 3QO9B 4URQU 3FQLA 1YVFA 2FLLA 1TKTB 1LW2B 4TQSA 4EBCA 1JLQA 5KFXA 1MU2A 1JLAB 3ISNC 4NYZA 4JV2A 4WFXA 3I5AA 1IKXA 4RU9A 2RKIB 3H5UA 5DQHA 4Q8EA 3G86A 3LAKA 1S1TA 4ECSA 4H4OB 1C0UB 4YR2A 1JIHA 4KO0B 5D3GA 3H5SA 4DL6A 2YKMA 3MECB 4IOBA 4KB7A 4NLSA 3BQ2A 3PW5A 2ASJA 4NLTA 2HNDB 3BR9A 3OSPA 5I3UA 2UUWA 5CYMA 3KLEA 4O3RA 3GV7B 3CDWA 5JUMA 4ZPCA 4ED6A 5EWEA 1LWEA 2R8JA 4PWDB 4OL8A 3MF5A 2ATLA 3I5CA 3Q8QB 4K4TA 2OPPB 2XI3A 4U7CA 2B5JA 3DYAA 3HVTA 3BGRB 4IFYB 3RB0A 1U09A 2IC3B 1TL1B 1IKWB 3OSNA 3IS9A 3KJVB 3PJXA 1FKPA 5L9XA 4YR3A 4NLQA 5C24A 2IAJA 3IN5A 3H5YA 1S9EB 1TKXA 1RT7A 1SUQB 3DI6A 3LAMA 5C42B 4NLVA 4J9QA 4O4GA 1TV6A 1NHVA 2BRLA 1S1XB 5KFUA 2VG6B 4IFVA 1R0AB 4U6PA 1S1UA 4Y2AA 4GC6A 4XPEA 1KHWA 2W8KA 2WONA 5J2QB 4EBEA 3ITHA 3M9OB 2OPSA 5DLGA 4IR1A 4IG0B 1S6PB 4J9RA 3ICLA 4DL7A 5KFPA 4KFBA 5I42A 2IJNA 3MR6A 3JYTB 2GC8A 4ECWA 5HP1B 1RT4B 1S0NA 2RF2A 5J2MB 3KLFB 3DOKB 1JLFB 1QAIA 1K1QA 1T94A 2CJQA 1FK9B 4ZP8A 2FVRA 2D3UA 1IKYB 1S48A 3RAXA 4WZQA 4LSLB 3KK1A 1VRTB 4LQ3A 2R8GA 2JEIA 3M8QB 1C1BB 3LP0B 4MKBA 4RNMA 5L1LA 4J9PA 4ECXA 4HYKA 5KG4A 2VG7B 3LP1B 4KAIA 4J9OA 1RT1A 2DPIA 3MEEA 2HWIA 3UR0A 5KFJA 1ZTTA 4J9KA 1JLQB 2V0NA 3PW7A 1MU2B 4WE1A 2AX0A 3OHAA 4Q45A 4K4UA 4QWAA 1HNIA 2OPRA 1IKXB 4IDKA 1IM4A 3C6UA 2JC0A 5KFAA 1S1TB 4M94A 4NLYA 2YNGA 2C2EA 4IRDA 4TXSA 3SFUA 1EETA 2WHOA 5D3GB 4ED2A 2YKMB 2CKWA 3MFHA 1BQMA 2V4RA 2J6TA 4G1QA 4NZ0A 3IRXA 3KNAA 5I3UB 4O3OA 4KSEB 5CYMB 3KLEB 4MK8A 1NNDA 4B3OA 1HMVA 4ICLA 3V4IA 3V6KA 1LWEB 4MK7A 3G6YA 4DL2A 1S0OA 3FFIA 2V4QA 2B5JB 3DYAB 3CDEA 3HVTB 3V81A 1RT2A 1HQUA 1SV5A 1C1CA 3DRSA 1KHVA 4KE5A 2W8LA 3IS9B 4XPCA 1FKPB 3CJ0A 3KHHA 5C24B 2IAJB 4QPXA 2YNIA 3DI6B 1TKXB 1RT7B 3DRPA 2FJWA 1RT3A 3M9NB 4EYHB 3CO9A 4DG1A 1RAJA 4O4GB 1TV6B 2ZE2A 4IFVB 3BQ0A 1S1UB 3DRRA 2B43A 4IQXA 2WONB 4ZHRA 2UVRA 3ITHB 2OPSB 5KFQA 3DLGA 4WYWA 3QZ8A 1T05A 5F9LA 4RNNA 4DL4A 4KFBB 5I42B 3NGDA 4PQUA 2RF2B 3HHKA 3MTKA 3JSMA 4TLRA 3BSOA 4EO6A 5F8GA 5DLFA 3PR5B 3BJYA 5C25A 3QZ7A 4TQRA 4ED8A 3KK1B 2YNHA 4EEYA 2YKNA 2ASLA 1S9FA 4K4YA 1DLOA 3TQ1A 4IH5A 4WZMA 3BSAA 3UPFA 1RT1B 3MEEB 4LSNA 4K4ZA 5L1JA 4RW9A 4O4RA 2I1RA 3V6DA 1TVRA 4ECZA 2BR0A 3SFGA 5DQIA 4K4SA 3KHLA 4F4ZA 4WE1B 4NCGA 3QLHA 1I6JA 5KG0A 5J1EA 1HNIB 2OPRB 1C0TA 4IDKB 2AX1A 1MMLA 3C6UB 5KT2A 2R2UA 2YNGB 4H54A 3NAIA 5KFMA 1EETB 1W25A 3EZUA 3QGGA 1JLBA 3KLGA 3CWJA 4NRUA 1K1SA 1BQMB 2R2TA 3H2LA 4G1QB 5EWFA 4ECUA 3IRXB 1N56A 3PZPA 1LWFA 4M95A 4RW6A 2HAIA 2J6SA 4K4VA 5J2PA 4B3OB 1HMVB 4ICLB 3V4IB 3CJ5A 4O44A 1BQNA 3FFIB 5KFLA 5KG2A 4ECVA 2R2RA 4TYAA 3RB3A 1XR6A 5DGAA 3V81B 4NLPA 4J9SA 1RT2B 1HQUB 1SV5B 1C1CB 3DRSB 3DOLA 4I2PA 2E9ZA 2C2RA 3KMSA 1HNVA 2YNIB 3DRPB 3KK3A 2XCPA 1RT3B 4ED3A 1OS5A 4K4XA 4ECRA 3Q8PB 2VG5A 3UDLA 5KT3A 4DG1B 4RW7A 3G6VA 1RTJA 2ZE2B 2B6AA 3HVAA 1RA7A 1RTIA 3DRRB 3GIJA 4ZHRB 1S97A 3N6MA 3KLIA 3N6NA 3MR3A 2UVUA 3DLGB 4WYLA 1T05B 3CJ3A 4MIBA 5KFIA 2W7OA 4F50A 3C6TA 4F4WA 3T5KA 2DPJA 4I2QA 4PQUB 1J5OA 3JSMB 3CIZA 5T14A 4IR9A 2XC9A 4ZP9A 4TN2A 4TY8A 1T03A 4ZPDA 2XCAA 5C25B 2E9TA 4X2BA 2YNHB 2YKNB 5DQGA 1DLOB 4Q0BA 5HBMA 4ZP6A 3PVXA 4YMEA 3KK2A 4F4XA 3VQSA 3RBEA 2ZD1A 4ED7A 2I5JA 2WTFA 3NKYA 4ED1A 4NLWA 1LW0A 1CSJA 4ED0A 3RB6A 1HARA 4LSNB 1JLEA 1S10A 1DTQA 4K50A 4FS1A 4RW9B 1ZETA 4EYIB 3V6DB 1TVRB 2OPQA 3DLEA 4R5PA 4RW8A 1FKOA 4ZVGA 2BQUA 4NCGB 3QLHB 5J1EB 2FVQA 1C0TB 5KFFA 3RB4A 2AGPA 1HPZA 4DEZA 4RNFA 2C2DA 3M9MB 5KFCA 1ZTWA 1JLBB 3KLGB 3KLHA 3GV5B 4KBIA 5KG5A 1LWCA 1QE1A 1S1WA 4FBTA 4K4WA 1LWFB 1JX4A 4RW6B 3V6HA 5J2PB 3H5XA 4NLOA 3DMJA 5HROA 3H4DA 3KOAA 5KFKA 4ZMMA 4O44B 1BQNB 2IBKA 4F4YA 2WCXA 1XR5A 1SH0A 2HWHA 4TY9A 3RAQA 2FVCA 1QAJA 5KFRA 4LQ9A 1Z4UA 2RDIA 3DOLB 4I2PB 2IM2A 2QV6A 1EP4A 5FDLA 4ZVHA 2O5DA 3TAMA 1N4LA 1HNVB 3KK3B 4NLRA 4EBDA 2OH2A 4J9MA 4KKOA 1RT6A 2VG5B 3GIMA 1UWBA 2IM0A 4RW7B 1JLCA 1RTJB 3DLKA 2B6AB 3H98A 3CJ2A 3HVWA 1RTIB 3DM2A 2GIRA 3IGVA 3KHGA 3EPIA 1RA6A 4IH6A 4WXWA 1JKHA 3KLIB 5DG9A 4HKQA 1JLGA 1TP7A 1N5YA 3C6TB 3KHRA 1DTTA 5KFWA 1S1VA 4I2QB 3OL7A 1J5OB 3G6XA 1N48A 3RBDA 5C5JA 2J6UA 3IG1A 5CYQA 4TY8B 1T03B 2IM3A 5KFYA 2W9BA 3SI8A 3T5JA 5K14A 4MFBA 4MKAA 4Q0BB 5HBMB 5F8MA 1JXLA 3KK2B 3KLVA 2ZD1B 2I5JB 1IKVA 2ILYA 1LW0B 3I5BA 1TKZA 1JLEB 4Y3CA 1DTQB 4DL5A 4KHMA 2VA2A 4ZVFA 1HQEA 3H40A 1QUVA 1XR7A 3Q8SB 5KG6A 2OPQB 3DLEB 2BANA 3MEDA 4RW8B 1FKOB 2YNFA 4R5PB 1D0EA 2HMIA 3E51A 5KFVA 2BE2A 3LALA 4NLGA 2IM1A 4ZPBA 4IG3A 2R2SA 3PW0A 1S0MA 1HPZB 4JV0A 1S49A 5DG8A 3H59A 4GC7A 1WNEA 1HYSA 3KLHB 3V6JA 3M8PA 1LWCB 1QE1B 1S1WB 1VRUA 4IH7A 3I0SA 2RDJA 1RYRA 1REVA 2JLEA 1RYSA 4Q8FA 1S6QA 4O3NA 4JV1A 1KLMA 3IGNA 3DMJB 5HROB 2IA6A 5L1IA 2BRKA 3N6LA 4Q43A 2D41A 2FJXA 2GIQA 3EPGA 5KT5A 5F8NA 3T19A 1RT5A 3OLBA 2FLNA 4QWCA 3UQSA 2E9RX 1TQLA 4Y2CA 1C2PA 3NBPA 2FVPA 1EP4B 3TVKA 5FDLB 2D7SA 2HNZA 4QWBA 4URGA 5KT4A 3TAMB 4DL3A 4RW4A 2ASDA 5HLFA 4RNOA 4ZVEA 1TL3A 4KV8A 4KKOB 5JXSA 1RT6B 3T5LA 4RZRA 1UWBB 2XWYA 2UUTA 3MEGA 1JLCB 3QGHA 3DLKB 3QGIA 3DM2B 4ID5A 4ZPAA 4RUCA 1RTDA 5KFOA 1JKHB 2AQ4A 4IRKA 3CJ4A 1JLGB 1SH2A 4QW9A 1N5YB 2JEJA 4H4MA 4RNHA 4ECTA 4G3IA 1RDRA 1DTTB 4MK9A 5KG3A 1S1VB 4KHRA 5DG7A 4O3PA 2F8EX 3GIIA 1N6QA 1S4FA 3BSCA 1RTHA 3IG1B 1S9GA 5CYQB 5KG7A 2W7PA 3Q8RB 5KG1A 4FS2A 4URSA 5KT6A 4O3SA 4XO0A 5K14B 4MFBB 4NLUA 5F8LA 3OHBA
chains in the Genus database with same CATH superfamily
1UFWA 5HANA 3GG0A 2ZBQA 4YQWA 2A0FB 4TU7A 2W9BB 5J2NA 2BE2B 4M5LA 3AJ1A 4LR8A 2Y8YA 2LQ9A 3MAQA 3O44A 3QJJA 2ALZA 1MSWD 1Q8IA 3OL6A 4ZK7M 1B99A 1DZ5A 2LU2A 4DSLA 4ZN3A 3M6UA 5FLXU 4WP9A 5B0BA 3WC2A 3H25A 4ECYA 1HA1A 1GMVA 3QIDA 4A8WA 2J7UA 4YR0A 4FXDA 5IXUA 2OPPA 1VRQC 5DRKA 4FBUA 2K06A 1NHUA 1IBMJ 5HMWA 4B3SJ 5C42A 1N36F 3BQ1A 1UVJA 4QW8A 2AJ0A 4NXNJ 2DKOB 3GIKA 1N52B 2VFTA 1WDTA 3NMAA 2Z30B 1DURA 2F40A 4OZ1A 2KL8A 1AT1B 3W2WA 1Y9OA 5G4DA 4Y0FA 1LQ9A 1CPZA 4JV2A 1CJTB 4RU9A 3K0JA 2HZVA 4GO5X 2KZZA 2HSEB 3MI7X 2OEMA 5D0EA 4ZPCA 2VOPA 1Z2LA 4WJBA 1OWXA 3IXQA 3HHNB 3DI6A 4GVLA 3CCUS 4OYXA 1U0HB 1F9HA 1H98A 3QT5A 3ICLA 3FNNA 3KLFB 3KDOA 4OFZA 2G0JA 3Q8YA 4DSKA 2R8GA 1GXLA 1X4FA 4RX6A 3VAJA 3PYDA 1HBMB 3EGVA 1QD1A 3CD0A 1JLQB 3PW7A 2XS7A 1U4BA 4B3MF 2NXEA 1XTZA 3MMCB 3GCWP 2FHJA 3R1LA 2PT0A 2V50A 3H90A 2AKWB 2ZZTA 2YWHA 4DL2A 1N5SA 2LQJA 2M52A 4PYAA 1QSYA 1PAEX 2OMOA 4QPXA 2FJWA 1TUVA 2DTJA 5ETQA 1N5TA 4C4WA 3FZ2A 1WOOA 3NLCA 4F0HA 1A7GE 3JSMA 1YSJA 4EEYA 4FNHA 3SXLA 2JVRA 2E7WA 3UPFA 4RBVA 1EKRA 4ILMA 2BKPA 2VBZA 3ILOA 3HT3A 2FHKA 1MMLA 5DDOC 2C2NA 4LBPA 3MM5B 1X4GA 3KLGA 2AYMA 2DHHA 1MLAA 2U2FA 3QRRA 2HAIA 5J2PA 3OR1B 2XLIA 4NL5A 3FFIB 4TYAA 3F73A 1RT2B 2V8DA 2KFNA 2C2RA 2E5HA 1PJ6A 2GFFA 5DETA 5D4LA 4PQAA 4YEAA 2M3DA 4F50A 1BE4A 1R6YA 2QIFA 5FD1A 2DGXA 8RUCA 3L3CA 4LSNB 3BDPA 1DTQA 1HD0A 4NCGB 1OIAA 4DEZA 4WKYA 1TL4A 4K4WA 4M63A 3G6ES 1JJ2R 3SCKE 4LRBA 4F4YA 1SJ3P 2HWHA 3VCDA 1O5JA 4DSJA 4DPOA 4ZLJA 4JI7J 1RTJB 1O8BA 3CJ2A 1RTIB 1N5YA 3KHRA 4P72A 5E7OB 2AZ1A 4NXMF 1S72S 2CQBA 2QYCA 5IT4A 2AD9A 1AZSB 2NXCA 2I5JB 3OTOJ 1L3SA 4NEZA 3UN2A 3LUYA 2W9BA 4OI4A 2F7VA 2BE2A 4DV1J 1P27B 2CVEA 3PHTA 1H7XA 1UCNA 1YRXA 2P5VA 4F02A 1P9YA 4FYVB 1X9MA 1FD2A 4CLLA 2KXHA 1KLNA 4P74A 4LFCF 4QWBA 2E1PA 2DH8A 4LRFA 3IO1A 1B64A 3VR1A 2ZBIA 3MWBA 1WTBA 2XZDB 3W3SA 1S6OA 3OHBA 1Q8BA 2OSQA 4C3LA 4CLYA 3CDAA 3AB4B 1SB6A 2YTCA 4H4KC 4IG3B 3TJAA 1H73A 4MMOA 2Y0BB 3Q24A 3GQCA 4ZVUB 2FJVA 1OMSA 5KFNA 4TKTA 1U48A 5JVGQ 2BJ3A 1R27B 4X4RA 1CJTA 1SQFA 1BGXT 1LXNA 1CC7A 3LANA 1N33J 2RUSA 3F56A 5A2QU 3T1YJ 4DV7F 2F9DA 5KT7A 3CTRA 1VBZA 2DBBA 2MY7A 3ISND 2FGCA 1U0HA 2VD3A 1J5EJ 3T5HA 2GHVC 2BEFA 3KLFA 1IWGA 3W5XA 3D6HB 2E44A 3G96A 1S7IA 1YIJS 1HBMA 4TYBA 5C7PA 4JI0J 4P7VA 1JLQA 3LAKA 3R6LB 2VC1A 3UFCX 3MMCA 4KB7A 3FJ2A 3TI0A 3BR9A 4ES2A 1YGYA 2XI3A 1D8YA 3K5PA 1NB7A 4X66F 4KHPJ 3OXFA 1ZPWX 2DNLA 2B9WA 4HVZA 4B9VA 8ATCB 4DWIA 3P8BB 3N28A 3OJUA 2ZH6A 4ZP8A 4F7VA 2O67A 3R7SB 2B9XA 3O6QA 1GH8A 3EZOA 3M8QB 3HJFA 3A13A 2YKPA 1VC5A 1R8AA 3CCSS 2AX0A 2DR6A 3SFUA 1ZH5A 3MM5A 3CXCR 1HLWA 3TQEA 3OR1A 4JI1J 2HS3A 3TA1A 3FFIA 2HVZA 2GX8A 4LBHA 4PRFA 2DRBA 3SCIE 2B3TB 1RT2A 1KHVA 3IS9B 3CJ8A 3M9NB 2A2DA 1EJ7L 4DUZJ 3HD2A 4RJVA 3NGDA 3HHKA 1WUUA 3MM7B 4DR5F 5F8GA 4ED8A 4CLZA 3FVYA 2P2CB 2OD6A 4LSNA 1KNZA 1NXIA 1NJYA 4QCLA 4NCGA 2R2TA 3THPA 4G1QB 2HRYA 4M95A 4CLTA 3BYPA 2B4PA 1KFDA 3THVA 1B7YB 1BXNA 3M2VB 1PG5B 5F3ZA 3BB5A 3NP5A 4N76A 2LEAA 2XMMA 1RTJA 2V5HG 1RTIA 2A3JA 4B3SF 5IC6B 1D8ZA 3CJ3A 4F4WA 3I31A 2DHSA 4TN2A 4LRCA 5DQGA 2U1AA 4P6QA 1AZSA 2I5JA 4DR7J 1NPRA 4NLWA 5HAOA 3SCLE 2HKEA 5HO4A 4ETXA 3HZEA 4C7QA 1BD6A 1FNXH 5KFCA 3HP6A 1ZM9A 3I9V9 4A8FA 4OI3A 3BO4A 3FCHA 3PO5A 3FK4A 1N4LA 4F3OA 2VG5B 1L3UA 1YG0A 3EXYA 1X5OA 4C3KA 5KOWA 4PEOA 4JP8A 4JBCA 5HJXA 4NE9C 1J5OB 3RBDA 4X4TA 1DAXA 2GMLA 3FEZA 4JYAJ 1EIYB 3O1LA 3W66A 2VZ9A 4USTA 2OLWA 4Y3CA 1F9FA 4ZVFA 2GMHA 1QUVA 2M0GB 4Z2XA 3DU6A 4IG3A 1YQHA 1YWXA 1S49A 3I96A 2V69A 2JLEA 4Q8FA 1DQAA 4O3NA 4CNYA 5KT5A 1O6XA 4QWCA 2ZC3A 2DH7A 2FVPA 4FVMA 2D7SA 3TAMB 3ZO7A 1U26A 1I51B 5LMNJ 5JMNA 2Y1JA 4EGLA 4TLQA 2PE8A 5DG7A 3ET6B 4A47A 4C8MA 1IR0A 5KT6A 3FMWA 4MFBB 1RSCA 5DDPC 3CCWA 3QYYA 2JX2A 1TL5A 2QA4S 3N01A 3WBZA 1RUSA 2XTJP 2ZWOA 2C3UA 2H4YB 3I82A 3ZTOA 2VPWB 2HBQB 4F0MA 5EUHA 3I0SB 1CJKB 3AXKA 1S6QB 4UY85 5IWAJ 2VKZG 2CPZA 2XGPA 3HZGA 2DR8A 2MHEA 1Q5VA 3ZXWA 3IWXA 4USWA 4I64A 5GMKa 2AYBA 1TAQA 3W9JA 4ZCIA 2HEKA 1MWZA 4R0JA 3FSIA 5ETMA 4ZP7A 4GO7X 3W5ZA 3NNAA 4WFNQ 2UXBJ 1NUEA 2AJ1A 2FLPA 5A8WB 4IYQA 4LF4F 4QIFA 4OHWA 3M8QA 5G0RB 1PC5A 1QVGR 2GW8A 4AUKA 2V67A 2DIUA 2V68A 2H1YA 2AJQA 1RU1A 2DGUA 1WEXA 2Y3YA 2RKIB 1WTFA 4ECSA 4LIRA 1JIHA 3HSJA 3JAMY 1ZM2A 4ED6A 2R8JA 3SZ2A 4P2XA 1XMQJ 4K4TA 1V6HA 1H2TZ 1U1LA 2D3OR 3UCUP 3IS9A 3PJXA 2LA6A 4NLQA 1Z1ZA 3RUBL 1F0XA 3OR2B 5CAAA 3QWPA 2HVIA 5HJYA 5KFPA 2VFSA 1NK0A 1HI1A 3D68A 3MM7A 8AT1B 2JFDA 2B9YA 2GAHC 2CQ4A 3GIRA 2CJYB 3CMQA 2NSCA 4HYKA 4TNOA 2HFNA 2UUAF 3OD2A 1FFSB 1ZZNA 4K4UA 3IC1A 3D7SB 3B4DA 4RLEA 1SBRA 1S1TB 2WHOA 4G1QA 2A6MA 1DQ9A 5I3UB 4MK8A 4A46A 5HVFA 3M2VA 5C24B 3R3TA 4OZ5A 2BJDA 1TV6B 2V8PA 3SQOP 4M5GA 4IFVB 5M2RA 3R97A 2FJBB 1V3RA 3LF0A 4KPCA 4QPTA 4WU3A 1NSQA 4J37A 3CB4A 5BR8F 3AA9A 4K4YA 4AD6A 5IFMA 3TQ1A 4FXWA 3KG4A 4O4RA 5DQIA 2QMWA 2VONA 1GMWD 1XN9A 3BYRA 5KFMA 4NRUA 1SC3B 3EDRB 1NH7A 2PA3A 2WZ1A 3NXZA 3M2UB 1S7HA 1KD1T 1UVNA 5KFLA 2MLZA 3S8SA 2Y1IA 3M05A 3DRXA 2A1BA 4YUDA 3T1YF 2VG5A 2NUHA 1RWMB 3VVTA 4X4VA 5DS7A 2PN6A 4Y2MA 1ITPA 1IR1A 1R8HA 1J5OA 4N77A 4F3MA 1WG1A 4LBIA 3CPWR 2LEPA 2IY5B 3SCJE 1WC6A 3D66A 1OJ4A 5HQLA 1KONA 1T9YA 4FKXA 2RRBA 2GGPB 1VBXA 3EZ5A 2YKOA 1M5SA 1UEVA 2KYZA 4EK2A 1JLBB 1WF0A 2GV1A 1YBTA 2IDLA 1R8BA 3CJQA 3S01A 4O44B 4HI2A 1NCLA 4KIAA 1FRKA 3TAMA 2FIUA 3E3XA 4NLRA 4J9MA 4H4KA 3OPKA 3NS5A 3CF5Q 3OW2R 2IFXA 3CMES 1U1MA 4BC9A 3SV3A 1M5PC 1N48A 3ET6A 4YS2A 1T9TA 2DEIA 4MFBA 3TA0A 2KKHA 3H40A 2OPQB 5LJ3Y 4NLGA 4QYRA 5DG8A 2W24A 3U1LA 1F5BA 3KLHB 1SJ1A 3EX7B 1QE1B 3I0SA 1CJKA 2MKIA 1S6QA 4V19J 2CAJA 1KTVA 2GIQA 4ZVQB 4X62F 2FLNA 5C2GA 1WDDA 1C2PA 3GFXA 4A8OA 4L75A 2ASDA 3CC4S 4KKOB 2ZOGA 4DJBA 4KGVB 3QGIA 1LFPA 4UTGA 1YJVA 2C2OB 1JLGB 1DHMA 1PILA 1U0SA 3MUMP 3CJSA 3BSCA 3Q8RB 3V4MA 1FFGB 3VVUA 1IKVB 3EUNA 5H9FJ 2W01A 4NYPA 1R7IA 1FA0A 5A8WA 4Z7CA 3WHIA 6FD1A 1OSDA 2MZSA 1BLUA 3EVWA 1H38A 1SL2A 2W2PP 3Q8UA 5G0RA 1KQGB 4WXOA 1SQGA 5MAOA 5K8MA 2R8KA 2H5IB 1BMQB 2N4DA 2RKIA 2NZ4A 5F9NA 1IXKA 3ZTQA 4ID5B 5AE3A 1RTDB 2OTLS 4DV0J 4ILRA 5KFSA 3MCMA 2IYGA 4IUFA 2EG2A 3IM9A 1RTHB 2XY7A 1NH8A 3LTOA 3OR2A 4DV5J 4Y34A 2UZAA 1HBOB 2IMOA 4QWDA 4U7UD 3W9HA 5LJ5Y 1HHSA 3QSIA 4DPYA 3SIPB 2XNQA 2DISA 2HNYB 2XEXA 3T1HJ 1Y00A 4AL6A 2FLLA 4U96A 4EBCA 5K8OA 2PFFB 2WVCA 2KDOA 4NYZA 2KRBA 1S1TA 4M5DB 4H4OB 3T3FA 4XAKA 4NLSA 3I4PA 2B9EA 5I3UA 3PX6A 3GV7B 5JUMA 3OBIA 4PXBA 4G6VB 1WKJA 3OSNA 2GA7A 5C24A 3H5YA 1HI0P 1TV6A 2BRLA 4IFVA 1AXQA 1U6BA 4JYAF 4IR1A 2KH9A 3BR8A 3I6PA 4X4NA 2IJNA 5D4OA 1Z2ZA 2I38A 4C48A 2CNOB 1S48A 1VRTB 3PRDA 4DLEA 4BBYA 4ECXA 4J9PA 2UU9F 1RWPB 4WU2A 2CPJA 2XZWA 3L4BC 1IM4A 4QYZK 2VBXA 2K2PA 1HI8A 2V4RA 2M8HA 1NJZA 1NAQA 3ZZZA 4NYOA 3JTPA 3M2UA 1LK5A 5LMNF 2CPEA 3M7VA 2I2YA 2A6OA 4LF6J 4ZJOA 3CJ0A 2PC6A 1U1NA 1HBNB 3MGJA 1NKEA 2HZAA 4DHVA 2DYAA 5T41A 3MTKA 2W1BA 5DLFA 3BJYA 1YJRA 2HG4A 1APSA 4PXDA 1E6YB 4IH5A 2EVZA 3BSAA 3AXMA 3VALA 2W2QP 3DGPB 4OHXA 3PIOQ 4C6AA 1XBWA 4ECZA 5IV3A 4WE1B 2GGPA 1FDNA 3HHLD 5IWAF 1MN9A 2W2MP 1JLBA 2EPIA 1SJ4P 2YQ1A 1N56A 4K4VA 4CCHA 3LGMA 4KGKA 3V4IB 3GYGA 2DXEA 4O44A 1NMEB 4BCAA 4ELUA 5E5NA 1G6BA 2RMLA 4DX8H 3PFOA 2IPOB 5HMXA 3R7NB 4WK3A 1HD1A 1RGVA 2DO4A 3AOBA 4A8SA 2XCAA 4F4XA 4ED7A 3RRHA 3AAWB 2HGNA 2XO6A 2M9KA 2OPQA 2Q66A 2QLBB 1FRXA 2CNKB 4B3TJ 2MQNA 3KLHA 3GV5B 1QE1A 2H65B 2E5LJ 4ZMMA 2BM1A 2QRRA 2IBKA 4CM2A 4LJMA 1F9EB 5A8KB 3H20A 2HRUA 3DOLB 5FIIA 1HNVB 3KK3B 4KKOA 5L1JA 2YX1A 1RA6A 4IH6A 1Q1KA 2HVHA 1JLGA 1FJCA 3RRKA 5GMDA 2BBEA 5IZHA 4HHUA 4YB5A 1Q5YA 3ENQA 3Q2TC 1F60B 1IKVA 1LW0B 3G8TA 4DL5A 1KS2A 3N9UC 1I5OB 2R2SA 1HPZB 1XQIA 4PG8A 4TU8A 1H7WA 2QFIA 1LWCB 2GZOA 2MJNA 2MDAA 3OTDA 4W90B 2V2ZA 1U8SA 2VBYA 3LO3A 3PYGA 1PBUA 1EB0A 2KT3A 3A1YG 4KH1B 4DV4J 1RT6B 3T5LA 3OFEA 3DLKB 4ID5A 1RTDA 2EKNA 2DIVA 4IRKA 4DV3F 1N32F 2GCFA 3IFEA 1U1KA 3R2DJ 5A6PA 3PRBA 5E3RA 1HR0F 1RTHA 5KG7A 2FHMA 2W7PA 4X4UA 5K14B 3DU5A 2ASYA 1HBOA 2ZM6F 4OX7A 3GYNA 2AGQA 1KEKA 2VL1A 4ECQA 2DO0A 2MQMA 1LNQA 4W92B 2AWZA 2HQFA 3T6JA 1HYSB 2HHPA 4MIAA 5H9FK 2CQCA 3HULA 3I56S 2HNYA 1WEYA 2ZVIA 2RQ4A 2L9NA 2A2CA 2M88A 3HFVA 2XI2A 4M5DA 4H4OA 1KDNA 4C2MA 3D6FB 3DC2A 1N34J 2BOPA 4MYTA 3GV8B 2GS8A 2WVEA 2RE1A 4RBUA 3UNYA 4F26A 1HFEL 5D8HB 1KC8T 1XK8A 1A9NB 4USMA 1GK8A 2EW9A 4DR3J 2HHWA 2IIHA 4QR2A 3ILJA 4OLOA 2UVWA 2RB7A 1RU2A 2V2KA 4ANCA 1HW8A 3MEKA 4B9UA 1TU0B 3M30B 2M8DB 1OY8A 2V8HA 2ZITA 2P9GA 1F1BB 1VRTA 5KAKA 3A3OB 1EZZB 4KRWA 1GXTA 2ZDPA 2OHDA 1OPIA 2N7YA 5KFXA 2VODA 4X4OA 2G13A 3MURP 4N56A 3VAFA 4MYUA 4DL6A 3PW5A 3FSXA 4DMZA 4ERDA 4L76A 4O3RA 4CWBA 2JDJA 1TL1B 5L9XA 4J91A 5D0GA 3J81U 5CXTA 1HBNA 4Y2AA 2HYIB 2ERRA 4WF9Q 3Q89A 1UMJA 2H3EB 1VQPS 2EFQA 1RT4B 1K1QA 2JSXA 2VUGA 4K5SA 4QOTA 5ETTA 1NDKA 4ELVA 4LQ3A 1E6YA 1VQ5S 3VAMA 5HVHA 2MTLA 4NWBA 4K0KJ 3I9ZA 3DGPA 4RO0A 4LVOP 3UR0A 1ZS6A 3NNCA 1SPBP 4WE1A 3DLJA 4PG4A 2HQ3A 4TXSA 2HHSA 1HNWJ 3DLLQ 2R3VA 4OZNA 2YVSA 3V4IA 1HNXJ 1R31A 5GADU 1TAUA 1TKXB 4ENOA 1KOOA 2R7TA 5I3PA 3TUIC 2OSRA 3W64A 3QZ8A 4DBQA 1Q81T 4DL4A 2DGTA 2IVMA 2DNZA 1XEZA 2DRAA 2CUYA 4PG7A 1FKAF 2ROEA 2M70A 1S9FA 3G71S 2EBEA 2W4CA 2HFZA 3J7Z5 3UD5A 3MMJA 2KHCA 1KR4A 2LECA 3PJ9A 1ACMB 1RWWB 3EZUA 4DQPA 2D69A 2C2MB 1N5VA 2VIHA 2AF6A 3A8JA 4K2JA 3VHQA 2D9OA 4F2SA 3HHDA 4OJHA 5KG2A 4X64F 1P1LA 5A8KA 4DV0F 4A8KA 3DOLA 1HNVA 3KK3A 2MQQA 4DG1B 3HVAA 1RA7A 4DR2J 2B0GA 2MZRA 3DLGB 4DV5F 2HGLA 1RACB 4PQUB 4UUWA 3PKMA 2G0CA 2QFJA 2DXFA 3BN4A 3CD5A 1LW0A 4ED0A 4LF9J 2MKKA 1CG2A 5GAGU 4ER8A 1RI7A 4OYPA 3EVOA 1HPZA 1QTMA 4RNFA 2GQCA 1LWCA 5GADI 4JV5F 1FI4A 3HO1A 2CQPA 2M4MA 2YQ0A 1ZPVA 4FYWB 2RS2A 1WHWA 2OH2A 1RT6A 5M2UA 3IGVA 3DLKA 3HSDA 2L08A 4HEA9 2P6TA 2FPHX 3NOGA 1CULB 5C5JA 4TY8B 5D4PA 3J81j 3SI8A 5K14A 3D9BA 2XY6A 4USHA 5RUBA 4AYBD 4R5PB 3M6WA 3BBFA 3M1VB 4W98A 2GJIA 3P4UB 2NXUA 1S0MA 4DZ6A 3PEHA 2X3DA 3RTVA 1T95A 2B4OA 3NY0A 1NRKA 4DFKA 1HYSA 2L3MA 1TUGB 2Z2ZA 2ZBRA 1Q8LA 4KQZA 3U27A 2Q6BA 3UO0A 1SKWA 2DT9A 1TQLA 1DQ8A 2DNOA 5K8PA 3TJ8A 4LF6F 4OX9J 1L3TA 4QW9A 2WAQD 2O01C 2J9EA 2J0XA 1N8RT 4OX6A 3BF4A 3UD3P 3GIIA 3BPSP 3G9CA 4ZPVR 2ABYA 5GAGI 3EJMA 5F8LA 3HT0A 3DLHA 1SKUB 2KFZA 3PW4A 3M30A 1WC1A 1RBOB 3ZZYA 3QPIA 1HWUA 2ZH1A 1PYSB 5BXIA 4WFZA 4OI6A 3D6TB 3BREA 1X4AA 3X1LB 3L7OA 2VPXB 4PXCA 1T3NA 3OTCA 3WX4A 1TL7B 1VJQA 4KYZA 2NYIA 1KFSA 1IBLJ 3LA0A 2UXDF 5L9NA 2XMAA 2XHCA 1FTRA 4USJC 1TL1A 4NLDA 2V4JB 1PJ5A 2C28A 1Y0HA 3HVRA 4ZIWA 2HHUA 4YOEA 2ROGA 2W9CB 4YP3A 1EHWA 4A4JA 1RT4A 1RAAB 4F25A 3R7BB 3A3NB 3MD3A 1S57A 4B17A 5KTQA 1HWIA 2KRRA 2VH7A 1MWYA 5EGYA 3S6EA 2C3YA 4CO4A 3VGSA 3R5DA 2DH9A 1T9WA 1HHTP 5ETVA 5K20B 3W63A 1YJTA 2CJXB 3NGTA 1QJHA 5LOQA 3CDWA 3CE8A 1FXLA 4PWDB 4OL8A 2AT1B 2CFXA 2HHHF 1U09A 3NWGA 4NMLA 5E2QA 1U47A 1TKXA 4RKUC 4E0DA 4ZA1A 4GC6A 4XPEA 1KHWA 2FC8A 4N47A 2NXNA 3W5YA 4WZQA 1VQYA 4LSLB 1MROB 2RHSB 2V0NA 4FPRA 3F0NA 2PMHA 3BO3A 4FZVA 1FNOA 1FEHA 2YWFA 1P1TA 3U02A 1NJWA 1YJWS 1FF2A 2PMZD 3SSQA 2W8LA 4XPCA 1RKIA 1NLKL 4RL1A 1KQKA 4DG1A 4ES1A 2OEJA 1FRLA 1KSPA 4IQXA 4NA1A 3QBCA 3DLGA 1WF2A 5F41A 4PQUA 4DR4F 3TYTA 1R43A 3L9ZA 3ISZA 2OD4A 3HX9A 3ZTSA 4K4ZA 2ROPA 3IMQJ 1HNIB 1JMTA 5ETNA 3R1HA 1TELA 3EGWB 3CCZA 4ICLB 1X0FA 2VPZB 4B3MJ 4CH1A 3ZZOA 3AT1B 3MOJB 1HQUB 1J27A 2DNGA 4PKDB 3HXMA 3C2PA 1AFJA 3NNHA 1VK8A 2LA4A 4DR1F 4I6WA 3QQCD 4ZPWR 4MIWA 4M1KA 2SXLA 1CULA 1JNZB 3JTOA 3CIZA 4DU8A 4OHZA 4TY8A 4DPUA 5DDQC 1DLOB 3F41A 2G4BA 2EFOA 4NOHA 3FBCA 4EYIB 3B54A 4R5PA 2D74B 3M1VA 1QVFR 4CNZA 2M2BA 2ZUAA 4LF7F 4CI0B 5KFKA 3BKTA 1YK9A 1Y10A 5KFRA 1RADB 2HGMA 2J9CA 4LR9A 1ZA2B 5IQQA 3H98A 3KHGA 4P71A 2OKQA 4LIWA 4I2QB 3S7RA 4DQRA 3NS7B 1CJVB 1K73T 3GWCA 3KK2B 4U7UK 2QO3A 3SBMA 3IWNC 3NEKA 3C46A 2IM1A 4K0KF 2R7QA 3RW6A 4GC7A 4P2MA 1AYEA 2MKJA 3SMZA 2HHXA 4BLGA 4EFAC 5LT5A 2M7SA 3G4SS 2KXFA 1EP4B 1TL7A 2ZBPA 1UWBB 3ZZPA 4RUCA 3CCES 1SH2A 1UW4A 3W7BA 1PKUA 4KC5A 2V4JA 5AE1A 1MG7A 4RR5A 4DU7A 1N0UA 4DSIA 2OJ3A 2W9CA 1GTEA 4D3GA 3N0VA 2J0WA 4UOCA 1AFIA 3TX0A 4DPWA 3BPDA 3DDKA 1SL0A 3AQPA 2PDAA 3K17A 3HI9A 3HM9A 1QLNA 3TRGA 3PM9A 1TL3B 2YX4A 3KXDA 1UA1A 5F8IA 3MEGB 2KG0A 2DGOA 1JQGA 3ILIA 3IM8A 4LFCJ 4PWDA 4DCJB 1RHJB 4J9UE 2QLWA 2V9KA 1YJ7A 2R7OA 2RIJA 2HVDA 2QTWA 2H4WB 3MFIA 2P9EA 2BZ2A 1Q4RA 4GVBB 5CA5A 3UVJB 3C15B 4LSLA 2CG4A 4M5KA 2DNNA 3QATA 4LF2A 1MROA 4Y6IA 3C19A 4DL0C 1NJIT 1NZAA 1LW2B 3JQMA 2QL9B 3G86A 1RJJA 4IOBA 4X4QA 4P73A 1CVJA 1AW0A 2ACYA 5L39A 3RR7A 2CA9A 3W2VB 3VWSA 2CADA 4IFYB 5AXKA 1G7CB 2HK2A 1F5CA 5CZVA 2NREA 2W8KA 5J2QB 4EBEA 2MLYA 4HH1A 2DK2A 4ECWA 1NZ8A 4OI2A 1FRMA 4RUBA 1CQNA 3CCTA 2XMUA 4N7TA 2KN4A 1UJ6A 5H9EK 2XYPB 1X9WA 2G9OA 1URRA 4A8XA 1WI6A 3KG1A 2HWIA 3JSYA 3NGSA 5B0FA 4O0NA 1HNIA 4CT9A 3FUYA 4ETZA 2JC0A 4M94A 2ACMA 1TR0A 4DS5A 3R5BA 5CYMB 4DX5A 1ZBTA 4ICLA 4WPAA 4OYOA 3CDEA 4N5SA 2WBMA 4M5HA 1HQUA 4JI6F 1L5UA 2IAJB 2RSQA 1RB0A 1ZOTA 2DHAA 4C8NA 2KHDA 5DO2A 1N0VC 3AFGA 4WYWA 5F9LA 4DSFA 4X66J 9ATCB 4TLRA 5T7LB 1LV5A 4MKVA 4C3MA 3CW2C 1DLOA 2XLKA 3N79A 3U1MA 1X5SA 1S59A 2CQHA 4F4ZA 3MTJA 2R7VA 2AX1A 3C6UB 4YY3F 5I3QA 5IM0B 4B3OB 1HMVB 1W2BR 2ZJPQ 2BJ1A 1RWUA 1Q95G 1U6ZA 1WC4A 4ED3A 3CC2S 1VQ8S 4LF5F 4DZDA 3FBEA 2JL9A 4CLKA 1JK9B 4WTYA 3MAHA 3GR1A 2QJ3A 1T05B 1VQLS 5KFIA 4I2QA 1CJVA 3IAM9 5C25B 4PWWA 3BS9A 3KK2A 2WTFA 4ED1A 1VBKA 1N5QA 4DR5J 3V6DB 3TA2A 3QLHB 2FVQA 1C0TB 3A8IA 2AGPA 2XHWA 4CTAB 3M6VA 3ULHA 4JOUA 1JX4A 4PG5A 2XULA 2ADBA 5CH7B 3H5XA 1QUPA 3GSDA 2AJ4A 4NA3A 2IVFB 3DNCA 1VHIA 4UQTA 2V2VA 2FVCA 1VGYA 1ZA1B 1EP4A 2O5DA 2CQ0A 2Z2MA 2QMUB 1X9SA 1UWBA 2IM0A 2GIRA 3FSYA 4J9VA 2MKYA 2MQ8A 3C6TB 3ZTRA 1P6TA 2VQEF 1BUXA 1VIXA 4ID8A 2ADCA 4UY8T 3PX0A 1Q16B 1VDHA 1UVIA 4LVNP 5KFYA 1RWOB 1T3OA 2PD1A 5F8MA 2ILYA 2QG9B 2C3OA 4A8QA 1VQOS 5EX0A 1O51A 4ZPBA 2JNJA 1NK9A 4FF4A 2J5AA 3H59A 4XIUA 1Y11A 2E1MC 1JJCB 1RCOB 2MXYA 5L1IA 1NSAA 4DR6F 1N88A 1D3WA 3L7PA 5CD4H 2RQCA 2KFYA 1TL3A 2N3LA 1CJUB 5JXSA 3MEGA 3UD4P 1M1GA 1X4EA 2VKRA 1UJ5A 2EXUA 5IOLA 4WIIA 2CDRB 3RAMA 5B0CA 5AJ3J 4NLUA 1S99A 2EKYA 1UKUA 5E41A 3W8PA 2WVFA 1QTNB 4LUBA 3RJMB 4GVBA 3D1QA 5B0AA 5KFZA 4I4BA 1T8EA 2IBOA 3UVJA 3C15A 3C16B 2V9WA 5KFTA 5C2CA 3BGLA 1R0BG 1X4BA 1KLMB 3R8YA 1GMWA 2KJVA 1RT5B 2RHQB 1LW2A 2MZQA 4IKAA 1RABB 2K1RB 5F8HA 1V5IB 1RAHB 1RAGB 3W2VA 2WK4A 4U95A 3RRGA 2X3GA 4IFYA 1U2RA 3RG6A 2ILZA 4NLXA 4CIOA 4JI5F 2PGCA 4WCEQ 1NDCA 3D2WA 2E66A 1RAIB 5J2QA 4FDFA 4HTIA 2F4VF 2RRAA 1FFWB 3JQKA 5EDWA 2MZTA 2AP6A 2J0QD 1WKKA 3GJSB 4YDDB 1QAXA 3E01B 4DV6F 3FQLA 1KN6A 3HFZB 3B78A 1OYEA 3HHLB 4WFXA 3FC9A 3NG8A 3AJ2A 3AJDA 1MN7A 1OY9A 1NK8A 5CYMA 2XMKA 2ZBCA 3EGNA 4A8YA 2NPIA 2GJ2A 2IAJA 3IN5A 2CZ4A 2DR7A 1XJWB 2C2ZB 2RDDA 1TZ0A 3G8SA 2ZHAA 3IRWP 1YRTA 5LSRA 4QZVB 1IKYB 1V9OA 5T7LA 3RAXA 3CJTA 2H51B 3M32B 3KNGA 4OQJA 4CLUA 4C9DA 3LP1B 2DRDA 4LF4J 4XDDA 4JI2F 4LFBF 3TJ9A 1TMJA 2GQ2A 1I94J 3C6UA 1HW9A 1IWAA 5CABA 5IM0A 4B3OA 2EI5A 1HMVA 5D77A 4CRJA 2V4QA 3HVTB 1S5ZA 5GAEU 1NB2A 3OT9A 3KHHA 4EYHB 1YDLA 3GSIA 1S1UB 2UVRA 1T05A 4KFBB 4QU7A 3P96A 1Q78A 1UW9A 3BSOA 3JAMU 5C25A 4WBFA 4WZMA 2YKAA 1WSVA 1RT1B 1WHVA 3TEGA 4KJIA 3V6DA 4K59A 3SFGA 1WOPA 1IUJA 3ZZ0A 3QLHA 5EN1A 1C0TA 3FBFA 3WC0A 1M5VC 3NAIA 4CTAA 1EETB 1WG5A 3QGGA 4QJVA 2UUAJ 3BN7A 5IT0A 5ETRA 3PIPQ 1RHUB 3RB3A 4MKYA 4FXVA 1LXJA 3UN3A 2PO4A 3LGHA 1OS5A 5J1NA 2DJWA 4K8RA 2ZZMA 2ZE2B 1RHQB 2CJBA 2F3JA 4IOAQ 3C6TA 5HK4A 3NMRA 5HQ8A 2HHVA 4ZPDA 4K5RA 4WWSA 2HFUA 1SVDA 2BDPA 3H0PA 1TVRB 5BR8J 1BC6A 5J1EB 2V6AA 4EU0A 3KKFA 3AY0A 2E5IA 2I6WA 5GAEI 3NRBA 4RW6B 3TAPA 3EYZA 1RAOA 4EMDA 3MM8B 3F44A 2DCLA 4TY9A 4LRAA 2OELA 1MWQA 1CJUA 1NPKA 3QFWA 3W9IA 3KLIB 2FZCB 1F3FA 4CZCA 1VQ4S 1TP7A 5A8RB 1T9VA 1LK7A 4GKJF 3G6XA 2J6UA 1VCTA 1NK5A 3M8RA 3KUGA 3AH6A 1SJRA 5HI7A 2HLTA 2KVIA 1Q86T 1VQ9S 3GJQB 3ZFVA 3DLEB 2XMWA 4UZCA 1FKOB 2APOA 2Q1LA 3C16A 3JB9k 7FDRA 2PA8D 1DARA 1KLMA 1B70B 2HBYB 1P8GA 1RT5A 3D0GE 4Y2CA 2XO7A 3K2YA 2K1RA 4RZRA 2RQKA 5E3QA 1S12A 3G87A 4ECTA 4Q7AA 1WC0A 1G2EA 1RDRA 1DTTB 4DUYF 5CYQB 2VPYB 1U1QA 5GVQA 4DPXA 4O3SA 2ZWPA 2HQDA 3FQKA 1XNQF 4FN5A 1U45A 4UZBA 2DNMA 3ADAC 5L1KA 3SSRA 3E01A 3T1AA 1KWMA 3EDQB 3H2UB 3HHLA 4RW4B 1Y5LB 2HFVA 4J9LA 3VGUA 1VC0A 3FCVA 1FNMA 1FESA 4X62J 4GKKJ 1ZM3A 5CD4A 2OP5A 2ALYB 4GMKA 4HL9A 4DCOB 3Q8VA 1ZAVA 2BV3A 2VA3A 1YBAA 1U2CA 3P45B 1LWXA 2ZNYA 2JC1A 3WQPA 3CMAS 3M8WA 4UF4A 1RZMA 4NCAA 2WB4A 4WK1A 4I7FB 3K8WA 2FHOB 2R7XA 1IKYA 2B8PA 3I0RB 3M32A 2LQ8A 3LP1A 1QY7A 2BQ3A 3A3PB 5IQ6A 3RBXA 5DQHA 3BQ2A 3DXBA 3TEHB 3VAHA 3FKBA 1HWJA 3Q8QB 3HVTA 3CSKA 4LREA 1WG4A 1IN0A 1SUQB 4NLVA 2YX7A 1NHVA 4U6PA 1S1UA 2QL7B 2BXJA 4KFBA 3HDSA 5E3CA 2Z2LA 1CQMA 2C42A 3AB2B 2VBWA 3BGFA 1RWKB 3JXOA 3UWTA 4OI0A 3LP0B 4F36A 2VG7B 2N7CA 2AEJA 1SXLA 1RT1A 2YQ3A 4NA2A 2HS4A 2IHR1 2MSTA 3OFHA 5L8RC 2X1AA 1PGZA 5KFAA 1EETA 3DKDA 1QDUB 3KNAA 2BMBA 1NEEA 3V6KA 1LWEB 1S0OA 1UEUA 4U67Q 2UV8A 1RT7B 2OI2A 2HK3A 2LMIA 2VV5A 3ZC4A 4CO3A 4NZ6A 2RJZA 2ZE2A 3BQ0A 2NLWA 1SQEA 2LDIA 5AJ3F 2MB0B 3CULA 4FNIA 2WVBA 4RNNA 2DHXA 2GMJA 1S77D 2EFGA 4L3KA 4TVAB 2B4VA 1JB0C 4XK8C 2AIRB 5LSLA 3ELHA 1TVRA 1I6JA 5J1EA 5HN0A 2UU9J 2YNGB 4H54A 2NYHA 4RW6A 1H3DA 4JI4F 1S79A 3MM8A 4J5OA 3LWLA 4FKYA 2LLZA 3M6XA 2XCPA 5LMUF 1X8DA 3DRRB 4Y2KA 3KLIA 4WP3A 5A8RA 2BYCA 3T5KA 1E6VB 1HL6A 1KBRA 3PG9A 3HD1A 4K50A 1Q0NA 1ZETA 3DLEA 1IR2A 1FKOA 1AROP 3M9MB 1ZTWA 4ZLLA 2AJ2A 1B0VA 3V6HA 3NS6A 4F3QA 2EFVA 4P2SA 1HNZF 2JWNA 1QAJA 2HIQA 2BA9A 2FJEB 2QA1A 4ZVHA 2ZOMA 3NGUA 2AMCB 1MW7A 5HMZA 3TR5A 1EKSA 1FJEB 1DTTA 3QSYB 1REGX 5SZTA 1VYAA 3AD9C 5CYQA 3X3UA 4ZCLA 2DB1A 2VHGA 3VAIA 2HZCA 5DDRC 1PIEA 3PW0A 2NUUG 3LPEA 4Y00A 1WNEA 1RYRA 1I94F 3P5BP 4JV1A 5F8NA 1XMBA 3CCQS 1V5VA 3TVKA 5ITHA 3ETMA 5K5MA 4RW4A 2DGVA 2UUTA 1WD6A 2XMVA 2LYVA 5GAHI 3D67A 2OIHA 3CCMS 3DDIA 4YHHF 5THWA 1TK5A 1TK8A 4WFBQ 1FCAA 4ZS6A 3UCGA 4E8UA 3E8OA 3AODA 2BANB 4EO8A 2HMIB 4I7FA 3FDSA 4ANEA 3R2CJ 3HMJG 1BWEA 5E33A 1WSRA 4B9LA 3I0RA 3M8PB 2AHOB 5LXYA 3TAQA 3PEJA 4I1TA 3PACA 4IRCA 3C8YA 3ZNUA 2ZUGA 3AOAA 1NKCA 5KFGA 2IJFA 2UUBJ 1VQNS 2JOQA 2Q79A 3P49B 2F1FA 1SH3A 4M5IA 4I6YA 4R0EA 4DV2F 2HBZB 2BW7A 3POTB 1SUQA 1U1OA 4DV3J 1N32J 3MCSA 3PR4A 2Y8WA 3S1TA 4Q2MA 3B6BA 1HR0J 2YBVA 3CD7A 1NDPA 2DVIA 1K47A 2CYYA 2WSEC 1OQ3A 1YZ6A 3VGTA 3Q22A 2VFVA 2ZM6J 2COLA 3E2EA 3HLUA 2AGOA 3QIPB 4N8NA 3LP0A 2XZTB 2VG7A 2ZH9A 2VQFF 1W2IA 2NS1B 4IQMA 1KVKA 3RYLA 4TQSA 4HDHA 4AXIA 3WIVA 3OXGA 2Z4PA 4EWTA 4DFMA 4NLTA 2UUWA 4AQYF 1LWEA 3A12A 3MPVA 3MF5A 2ATLA 2IC3B 2VJVA 1IKWB 2MYFA 1SIWB 3JTNA 3J7ZT 1OSCA 2X1GA 1RT7A 3MDFA 4E2FB 4L73A 1NK4A 3NCQA 3D1HA 1SCJB 4DL7A 1U7LA 3MR6A 4UOHA 1S0NA 1SIZA 3EM1A 1EARA 2FVRA 4DN0A 3MM9B 2R4FA 1RWNB 2WVDA 4ZIVA 1ELOA 4J9OA 4F67A 1F2HA 4J9KA 1XERA 4Q45A 1W7WA 3IA0A 4CO5A 2YNGA 1R0CB 2AEFA 2CKWA 2MZJA 2JH3A 1L3VA 3KLEB 4O0IA 2JVOA 2F63A 2JRSA 2CQ3A 4LF8F 3DGVA 4KE5A 2H5EA 2BOAA 2KYXA 1WACA 3LOUA 1XNRF 3DRRA 2NCKL 3HSZA 2BJ8A 1E6VA 3KUEA 3SEOA 1OO0B 3BO2A 2L48A 1M1HA 1T7PA 3CEDA 2LU1A 3GG1A 2F8MA 4K4SA 3KHLA 3DHWC 4PPDA 3ENVA 3IWLA 4ECUA 3PZPA 2BM0A 2XYGB 5AXMA 4GKKF 1DBDA 1X4HA 1TKDA 2DY1A 1C1CB 4USVA 3T9ZA 1RT3B 3Q8PB 4ILLA 2ZDOA 2FUG9 4MIBA 2HBRB 1VHFA 3TUJC 3QJPA 4RUHA 2PSZA 3GPAA 2CZ9A 3NWRA 1KTQA 5DZ6A 2CWXA 1IJFB 3G82B 4A48A 1KOHA 1S6UA 2DITA 3OVSA 2QLXA 2D9PA 3BZQA 1BWVA 3Q23A 3TX8A 1EX8A 1B4SA 4DQIA 1NSPA 2DNYA 1Q53A 4CT8A 2RU9A 4LQ9A 1Z4UA 3MPYA 2IM2A 1N54B 2FZKB 2KB2A 4MT1A 4X64J 4J90A 1XMOJ 2L9WA 3J7AN 2HFSA 2QC3A 4OV1A 5LL6d 2FJDB 4Q0BB 2HW3A 2CQ2A 1JLEB 2XBPA 2MPUA 3QWUA 2BANA 4RW8B 1X5TA 2HMIA 2W25A 2FB0A 4KR0B 4GRSA 3M8PA 3ZZRA 1RYSA 3BH6B 2WBRA 3M8YA 3IGNA 3KJQB 3JQJA 4IO1A 3UQSA 4AL5A 3RU0A 4JV5J 1RE1B 4ZVEA 1CEZA 4X4SA 3VF0B 2ATCB 2DNQA 1FVQA 4BHQA 2FDNA 2HQIA 2ZJRQ 2YWGA 4YB7A 3MMBB 3MUVP 2GVZB 3POTA 9RUBA 2HQGA 2JEFA 2J7KA 4QIGA 5JJBA 2OAUA 3QIPA 1R89A 2E1CA 3W8GA 2I9SA 1K44A 1PBAA 1NM2A 3CO0P 1RBAA 2LEBA 2DGWA 3K7RA 2FY1A 3M2RB 4KV8B 2RUGA 5KFHA 1FRHA 4QIVA 4P2FA 2W2OP 2CQGA 3BSNA 1C4CA 3BBBA 2IC3A 1IKWA 4I68A 2VDIA 2AYEA 2O3DA 4QIEA 3MOZA 3NCRA 1D1UA 3W61A 2ZKUA 1J2VA 4RUAA 3MM9A 5B0GA 2FY8A 3W62A 1MMNA 4OHYA 4A8MP 3I87A 3WZ0A 5I4MA 2K7KA 2V63A 3ENAA 2YH1A 2GHWA 3H5UA 2R7WA 2KT5A 3FGVA 2OMLA 1Q79A 3CCVS 3KLEA 4C98A 5EWEA 2YPYA 4KY3A 2CZVC 3PFEA 3BGRB 4PXEA 3VTIA 2UXDJ 2G0IA 1S1XB 3BDEA 4B08A 2W4PA 5ETOA 5BYRA 4CYUB 4IG0B 4J9RA 3OXLA 1YITS 2GC8A 2Z58B 4ZCMA 2XG8A 3L09A 3GCXP 3GJTB 3QGPA 1Q82T 3QRPA 4FF2A 4DQQA 3WDOA 1FJ7A 1FWLA 4KAIA 5ETLA 1T11A 4OZ3A 3I32A 3U1NA 3D1OA 4D3HA 2L9DA 2R7SA 4AXJA 3OHAA 4OMFG 4QWAA 2DR5A 1GTHA 3C3LA 1T02A 4Q5VA 5D3GB 3MPWA 4ED2A 2YKMB 2NZCA 1I1GA 4KSEB 1UETA 3J7YU 2J76E 3G6YA 4MK7A 1X60A 3PTWA 3UW1A 1P9QC 3K89A 2CPIA 1C1CA 3KJNB 4XTTA 4LFAF 2ZFHA 3OJSA 1RT3A 4B3RJ 4ED5A 2HHHJ 4RBTA 5DZ7A 2B43A 2WONB 3CCRS 1RKJA 2OPSB 3K5MA 5I42B 3TWZA 4CLPA 4PCQA 2GIFA 2RU3A 4DS4A 4TQRA 2G1HA 3KK1B 1UTAA 4DX6A 2LXFA 4FYDA 4YDXA 4JI8F 2B8QA 2I1RA 3G82A 4C11B 2R2UA 3DXSX 2UUBF 5GMEA 1EQMA 2BKNA 3GB0A 3CC7S 4J9SA 1SV5B 5H1SV 3DRPB 1U6FA 1RLCL 4L6V3 4ZCKA 2KU7A 3BGOP 2QSFA 1FRJA 3PY8A 3THTA 2YNHB 2J9DE 4Q0BA 4YMEA 4LRDA 2BW2A 4ZKAA 3NKYA 3RB6A 4DR4J 1S10A 1JLEA 5F0WA 4DN9A 4FS1A 2FLOA 4RW8A 1NK6A 2BQUA 1T9XA 3RB4A 3J7YI 1R6VA 4PG6A 2X1FA 3QAUA 1VISA 1VMBA 1LWFB 2CRLA 3H4DA 5SUHA 4CLWA 3TW0A 5L38A 1FO1A 2RDIA 4DUTA 2DR9A 3R5GA 2QA2A 3GJRB 1S0VA 1DRZA 3GIMA 2B6AB 1WHXA 3EPIA 3CGIA 4HKQA 1PSDA 3HF5A 3DN9A 3MMBA 2GVZA 2XSJB 4CP5A 4DR1J 4MKAA 3CCJS 3KLVA 2V2QA 2N4CA 1HKAA 5FLXY 1RLDA 1XR7A 5K9FA 1IVZA 2RRNA 3LALA 2G2ZA 2MEWA 3UN5A 4O23A 2RDJA 2EC2A 3KDNA 2B4UA 3DMJB 4B9NA 3FBBA 1IBKJ 3N6LA 4Q43A 3EE3A 3SDEB 5CZXA 2GVDB 5M2PA 5B08A 1NKBA 4LF7J 5KT4A 4FF1A 3M2RA 4KV8A 2AZ3A 3NGKA 5ETPA 4MTPA 1WWHA 3DM2B 2RQMA 5ADZA 1IBMF 3QNWB 5HATA 2MGZB 5HL7Q 2JEJA 3DOMB 2XNRA 1S1VB 2OGUA 1ICEB 2ZEJA 1S4FA 4NXNF 2CQDA 3TZWA 2E7XA 2IDEA 4O3QA 5E3AA 3A8KA 3FRZA 4OYMA 2YNFB 4ALZA 1YKWA 2XSFA 2DD8S 3OL8A 1GX5A 3CDUA 1U1RA 4OYBA 3NAHA 3KG0A 3K5NA 4MH8A 2EK1A 1ZAWA 4Q44A 1JXVA 1GX6A 4U8VA 4CLSA 3G8QA 1UZDA 3K5OA 2JEGA 4B9SA 3QAEA 2CG8A 4HHJA 5F8JA 2BUNA 2R8IA 1U1PA 3BGRA 2FVSA 2XMTA 1TUWA 2AYGA 1Y4ZB 4OX8A 2AU0A 3LW5C 3H4BA 2XGQA 1S1XA 5E3PA 3HHEA 1AB8A 5A6WA 4PUOB 4CYUA 4IG0A 2QX0A 2WOMB 3UDCA 4DQSA 5F0UA 5A0YB 4UT4A 1W26A 2GO9A 4R8UB 1X0PA 4OJ1A 5U47A 3MR2A 4URQU 2FGOA 1F6TA 4ZITA 1ZYQA 3I5AA 3VQTA 1RTZA 4RWWA 4KO0B 5D3GA 4E98A 2K3IA 3H5SA 2YKMA 2ASJA 4HT7A 3UI3A 1TMMA 4OYIA 2F9JA 3BGUA 1SL1A 1IJEB 2LFVA 3PX4A 1FRIA 1XMOF 5D15A 2X51A 3I55S 1NBEB 1VIOA 5KFUA 2VG6B 2WONA 1UFKA 2OPSA 1QSLA 2B7CB 1WF1A 2NQPA 1R3NA 2HHQA 5I42A 1HQ2A 5HP1B 1JLFB 2O66A 3ZNJ1 2CJQA 3T6BA 3KK1A 3QT8A 4RNMA 2BX6A 1CS4B 4NZ7A 1QM9A 2DPIA 4L3NA 5KFJA 1ZTTA 1FJGJ 2Z56B 2LP4A 2LCWA 2YPZA 4ZJLA 4C11A 5LSOA 2C2EA 2UV8G 3D0HE 1FXDA 3MFHA 4O3OA 1NNDA 2XM3A 4JB8B 3DYAB 1SV5A 3OUYB 2A18A 1FKPB 1FVSA 4OYZA 3DRPA 3C14B 3MZIA 1RAJA 4O4GB 4J7CA 1YBUA 2XS5A 2AJFE 4KTQA 3QZ7A 2YNHA 3CJKB 4PYDA 4TU9A 2DNRA 2X7IA 3FEXB 1Y3KA 3AQOA 4IDKB 2K3KA 1L3KA 2ZH7A 5IT9U 1K1SA 5EWFA 1LWFA 7FD1A 2EG1A 4JI7F 2HFOA 5DGAA 3TUZC 3O2IA 2LXUA 2PI4A 2WW8A 5FJ4A 2B6AA 4AFFA 3GIJA 3NCPA 4WYLA 4JI6J 1KP6A 2VOOA 3OTOF 5BJRA 4HT5A 2BE9B 3JSRA 1I3OB 2KVQE 2XSJA 4X2BA 2LKZA 2LXIA 4BWJA 4DV1F 4UOGA 4QYZJ 4BC7A 1CLFA 2HHTA 1B3TA 2CJKA 1HARA 2F5GA 4ZVGA 2FJAB 4ZN1A 3H2VE 4UQGA 4KBIA 4FBTA 1LOUA 1JNRB 3DMJA 3PV8A 1X7VA 1WKLA 1BQNB 3PXGa 3Q86A 4YY3J 3SDEA 2GVDA 1BHNA 1R8PA 4I2PB 3GU0A 3QRQA 2DNPA 3ONQA 1KRPA 4QQBA 2OEKA 2MY8A 3DM2A 2CXEA 3OFGA 5DG9A 2MGZA 3TVYA 1VLYA 3DOMA 5KFWA 1S1VA 3CIMA 3OL7A 4LF5J 3LWMA 4K7QA 2E1AA 1ULRA 5HBMB 2MZ1A 2HVEA 2CQIA 1YJ9S 5J1PA 3H8YA 4KHMA 5KG6A 4W4MA 4P9SA 3E51A 2YNFA 2KT2A 2IJRA 4JV0A 5MLCV 5A2QY 3N4WA 2L41A 3TZZA 1R8CA 1K9MT 2FHJD 3T19A 2POKA 3OLBA 4BS2A 2N3OA 1N33F 4URGA 1GQEA 5CHCB 2ZC4A 3CJ4A 2PFDA 3EXCX 4YB6A 1U24A 4UUXA 2VICA 4B3RF 1OYDA 4KHRA 2DEJA 3UDVA 1J5EF 1OPZA 1G1XA 3DHXA 4FS2A 2MQPA 1ZZFA 2VQEJ 1DFDA 2PEBA 1Y3JA 5EWGA 4PUOA 2CWKA 5AE2A 2WOMA 2QMXA 3CVKA 5A0YA 4JI0F 1K8AT 4QWEA 2VB6A 4R8UA 5B0DA 1REVB 1HBUB 3K5LA 5LXRA 3OL9A 4WP8A 5D78A 4ZDNA 3L7UA 1U02A 2BJEA 2W9AA 4KO0A 2FZGB 2C3PA 1UAWA 4DR6J 3L95X 3M4XA 3K8VA 1FD8A 1VJWA 1B0TA 4KHPF 1TK0A 4L74A 4B02A 3ZZTA 5D4NA 3R5JB 4DF4A 1IQTA 5KFDA 3P6YC 4C97A 4Y65A 1GT8A 2EEYA 2VFRA 2KJWA 2VG6A 3D28A 2XQCA 2BQRA 3LP2B 4NRTA 4I0WA 3PJWA 5HP1A 1WOSA 2VASA 1JLFA 3GILA 2F4FA 2PI5A 1CS4A 4LF1A 4OYAA 1YVFA 1GXUA 2Q6CA 1TKTB 1UVLA 1T9UA 1JLAB 3FZBA 3MAAB 4JI1F 3ZTPA 1G3OA 5E0OA 2HNDB 3D54A 3CD6S 2Z0GA 4NX9A 4U9RA 3P3DA 3JS9A 4U7CA 3DYAA 3BBCA 4DUZF 3OUYA 1FKPA 1RXOB 3LAMA 2CPDA 4USUA 3C14A 4O4GA 2G1DA 3US5A 3M9OB 2KTQA 2ZOFA 1VS3A 3J80U 2MHNA 4JI5J 3JYTB 3R5AA 3TARA 3GYXB 4M5NA 1FK9B 3GLJA 1VQMS 3CJKA 2F4VJ 5BYSA 1KVJA 5BYQA 1LEOA 1JWWA 3AOCA 1PYOB 4ZJQA 1IBKF 1UVMA 4IDKA 2Q43A 4DV6J 3EVMA 2J6TA 4NZ0A 2ZVSA 3UDEA 5DJBA 4P75A 3TANA 3OVAA 5JVHQ 1X31C 2A10A 1GFWB 4F8RA 4USKA 3GMGA 3K59A 2CDQA 4HH0A 5B7WA 4YB1P 4DR7F 2RF2B 1WORA 3LGNA 3PYFA 2ASLA 3CUNA 4LMZA 1DJ0A 3IR7B 3MEEB 1VI7A 2VC0A 4DLGA 4XDCA 4F2RA 4CLFA 2YY3A 5KG0A 2OPRB 2VU5A 5KT2A 3VGVA 3M8SA 4JI2J 4LFBJ 4BWMA 4OZLA 2MQOA 1BQNA 3OFFA 2R2RA 3V81B 4NLPA 3OQ2A 4I2PA 2HURA 1NU4A 4WFAQ 1HWLA 1VK3A 1U8WA 4K4XA 3UDLA 3G6VA 1G4CA 4HDGA 3FCWA 3GFYA 2E9TA 3PVXA 5HBMA 1SC4B 4USIA 2ZJQQ 4NI2B 3TNVA 4NEYA 1IQZA 3UE2A 2MKHA 1JXEA 2E29A 1VR6A 4ZVPB 4JI3J 2ZKTA 2C1EB 4DI6A 1NHKL 3GP9A 2MSSA 1JJ4A 3PRVA 5EX3A 1Q8KA 2QV6A 1M5HA 1SKRA 4NMXA 1HWKA 2IRXA 1X5PA 1FDDA 2BACA 2R9LA 1AUDA 3GE9A 1T03B 4MJKA 2CJAA 4LR7A 1V3ZA 1HIYA 3IR5B 1CC8A 3DFEA 2QA4G 3Q8SB 7AT1B 1QSSA 4ITSA 4DPTA 4KPYA 4DOZA 1LFWA 3LQVA 1A0OB 1FJGF 2YKQA 2EFNA 3Q0AA 1S1WB 1REVA 1HBUA 5HROB 3HCXA 2OFHX 2Z8QA 4KGMA 4EZ9A 1SKSA 3MHYA 4DL3A 4RNOA 3QGHA 4QR1A 2XWXA 1JKHB 3FRYA 2W7AA 2UXCJ 5AT1B 1FX4A 2F8HA 4MK9A 2RVJA 2UXBF 4O3PA 2QLJB 3K57A 2RT3A 3MCOA 2QL5B 4URSA 1UP1A 2HWTA 2RNEA 5HSPA 1WHYA 4OZ2A 4GKJJ 1TKZB 1U2FA 5IT9Y 2N82B 1RHRB 3LP2A 1S76D 4RPFA 3MEDB 2RS8A 1F5AA 3D5MA 2RH3A 3KFWX 4CO0A 1VQSA 1KQFB 2OO4A 1RQ0A 2P8IA 3TOQA 1TKTA 4EI2A 2XY5A 1JLAA 3MAAA 3ILLA 4UOFA 5AXNA 3PNIA 1XMQF 2K7JA 2EC0A 2JJ4D 1OQ6A 2HNDA 4CH0S 4H4MB 3K58A 5KFBA 4ANDA 2HQCA 4Q2LA 2I8EA 4J9NA 3HJVA 3CCLS 2J8SA 2Q3PA 2GNKA 4DUYJ 2C3MA 3R6GB 3JYTA 5DGBA 1UEKA 5EHHA 1FK9A 1XNQJ 3NL0A 3MR5A 2KM8C 3RR8A 2GO8A 2UUCJ 1RWXB 1RP5A 2MMYA 3ISNC 3IBCB 4YR2A 1SC1B 2EWHA 3DCAA 3OSPA 4ZOSA 4AL7A 2CPFA 4DF8A 1Y7PA 3KWMA 4HHHA 1SJFA 3RB0A 1VFJA 3KJVB 4Z7YA 1H6KX 4YR3A 1S9EB 3QT6A 4FYXB 1FXRA 1R0AB 3BKFA 4Y28C 2G2YA 4FYYB 4KGZB 3D6MB 1S6PB 2WB1D 1YZ7A 1ZAXA 4DSEA 2RF2A 5J2MB 1QAIA 1UFLA 2D3UA 3A4TA 3P5TL 5KG4A 2OTJS 1D9AA 1C4AA 2AEMA 3MEEA 3TZYA 2QLFB 4C8ZA 3EMTA 2CIMA 1IBCB 1TFYA 4DFJA 1VQKS 2KXNB 4RWXA 2OPRA 3FEYB 4UW2A 2XS2A 1PAUB 2B5JB 3V81A 1F2GA 2JZ5A 3FMBA 1M5OC 3ITHB 5KFQA 4OZ0A 1PJ7A 3OTBA 3DLBA 5D0HA 4YFUA 3H42A 3R27A 3IP0A 4P10A 3SQGB 4NI2A 2B51A 3DRYA 2XB2D 1BQMB 1NDLA 3BKUA 4DX7A 4CH7A 4ECVA 3PYEA 2CPXA 3DRSB 2LQ5A 3GR0A 3KMSA 3HFKA 1FDBA 3MR7A 2FQQB 4ZHRB 3MR3A 3N6NA 5IC4B 2W7OA 2HLUA 2QZ8A 2OFGX 5ETKA 3EICA 2DHGA 2GHPA 2XC9A 4ZP9A 1F3VA 1T03A 3J7A1 3QJLA 3OVBA 2E5GA 2XMJA 5DM6Q 1Q7LB 2R7UA 2RD5C 4FPIA 4RW9B 4OLPA 2YWWA 2P6SA 2C2DA 3MD1A 4ED4A 1S1WA 2M5YA 2HPUA 4I69A 5HROA 2H54B 3VAKA 4CDIA 3NOCA 2WCXA 2X1BA 1HHQA 3KJFB 3J80Y 4B9TA 2QN6B 4EBDA 4JI4J 4ZVOB 4RW7B 5CCLA 1YTYA 5CCMA 1JKHA 2WW4A 4C8YA 1YI2S 4M5MA 5F3TA 5LMUJ 3V2UC 1FT8A 2IM3A 1X4DA 1GNKA 1UVKA 1TKZA 1M5KC 4RU2A 2CPHA 3H7HB 3MEDA 1D0EA 4U8YA 3KTQA 2KO1A 3D3BJ 3V6JA 1M0SA 2VJUA 1UA0A 2BE7D 4B9MA 2BRKA 3UCZP 1WC5A 3CJRA 2E9RX 3ZZUA 4QBUA 1TTHB 5FDLB 1H0HB 4ZLPA 3LH2S 1JLCB 1RHMB 1LKZA 2D3O1 4ZPAA 1HNZJ 2J0SD 5KFOA 2RILA 5IS2A 4H4MA 2V94A 2YWKA 3GFHA 3AD8C 2I0XA 2YH0A 3M8ZA 2MKCA 5KG1A 3JSBA 2Y9HA 3RGIA 2B56A 1WEZA 5A76A 2W4DA 2V8GA 1HQEB 3VZIA 3T1HF 4NCBA 3KMQA 4WKRA 3SV4A 2FC9A 2XYHB 4OIXA 1VLOA 2EFPA 2VDHA 1UWAA 1VRUB 4JUZA 3IAS9 2PEHA 4PAAA 1NSKL 4LSZB 1U49A 3NBPB 3CDBA 5HLFB 1FTCA 2ZNZA 2WRMA 4OI1A 4PZVA 2NPFA 2IMWP 2JLGA 3N5BA 2OUGA 2KM8B 2KI2A 4KH0B 5L46A 4HLBA 1S9GB 3KJVA 3MPDA 4OZJA 1S9EA 2QYGA 2QE5A 1R0AA 4KT0C 4N41A 1S6PA 1PC4A 1RWVB 5J2MA 5KFEA 4YHHJ 3B4MA 1ZM4A 1K0TA 2R8HA 4KGXB 3QO9B 2NR0A 3TUPA 3KYLA 4Y2IA 4JI3F 4PWUA 3WIUA 5AXLA 5LM7E 1RAEB 2YXLA 2E5JA 4Q8EA 4X65J 1EAYC 1C0UB 2H9ZA 2MLXA 3MECB 3GZ7A 2MKSA 1VQ6S 2B5JA 3OV7A 3IR6B 4ZPTR 5D0RA 3ETOA 4DV2J 2J7WA 3ITHA 5DLGA 4ES3A 2G2OA 3DOKB 3TZXA 3GTYX 2C2KB 1FHTA 2JLFA 1MMDA 3A8EA 1C1BB 1XWLA 2GQQA 5L1LA 3RBZA 4ZVTB 1BQXA 2LQBA 2DNKA 1URNA 1VC6A 3SQGA 3HKZD 1MU2B 5CQGA 1IKXB 2VQFJ 5K8NA 2EK6A 1BQMA 3AD7C 2NXJA 3MM6B 3AA8A 3HPOA 2CVIA 2VF3A 1V3SA 1MNEA 3DRSA 2UXCF 1UPMB 1UZHA 1UJ4A 1SI9A 4AQYJ 3VV2B 2WSCC 3O3LA 1JJHA 3QMQA 1H2VZ 4ZHRA 4G65A 4FF3A 4DCPB 3O8WA 4I6AA 3GONA 1UL3A 3R9LA 1GMUA 3R5CA 3B82A 4EO6A 3I4HX 1H2UX 3AHPA 3TVZA 4B3TF 2B7BB 1XC9A 3PO4A 3VAGA 5HVGA 4RW9A 2QEXS 1IM6A 4CO1A 4HACB 2BR0A 2E5LF 1VBYA 1RCXB 1RK8A 1W25A 3G2XA 2HIYA 2PMWA 3IRXB 1KVIA 2JFKA 1B0PA 3CJ5A 5IV4A 2H48B 3PCOB 1WJ9A 2YNIB 4ECRA 2IRYA 5KT3A 4RW7A 2RAQA 1FE0A 5H9EJ 1S97A 4LF8J 2UVUA 3OTEA 1UPPA 4OYWA 4OJ3A 1M90T 3QFHA 4PR6A 2DPJA 2IVYA 1XNRJ 1N36J 2MQLA 2YKNB 2CPYA 4ZP6A 2YWEA 2R7RA 3VQSA 1CBKA 2JHEA 1CSJA 3CT9A 2CNLB 2E1RA 4PPZA 2UUCF 1NK7A 1K0VA 3WX8A 5KFFA 4IOCQ 2ZHOA 3EGZA 3MPUB 2LDYA 4F04B 1O0PA 2DGQA 4DV4F 4NLOA 1XR5A 1SH0A 1H72C 1D9DA 4FP9A 4F0KA 4C0HA 5FDLA 2V34A 2KG1A 3W65A 3KUHA 1YRUA 1JLCA 1FE4A 2KZMA 3BM7A 4MAKA 3RZAA 4C0BA 1B7FA 2AV5A 1FWPA 4AE5A 2J8AA 5HMYA 3MUTP 2ZD1B 3W60A 6FDRA 2VA2A 1HQEA 3Q83A 2K8GA 1VRUA 4Z37A 1SC6A 4NPOA 5KOXA 3EPGA 2D41A 1PO6A 1KKHA 4ATNA 1N34F 1OY6A 3NBPA 5HLFA 2ZZNA 2XWYA 1VQ7S 2MJUA 4CQ1A 3HK2A 4DR3F 4QU6A 4M5JA 5HQMA 2AW0A 1NO8A 5KG3A 4I56A 2F8EX 3IG1B 1S9GA 2WSFC 4XO0A 4WTOB 3N5FA 2C22A 1FEEA 2DY9A 4ZLNA 1TFWA 3QO9A 3BEGB 1X4CA 5CYJA 3J81Y 1BY9A 2BJ7A 2BJ9A 2HNZB 3MMAB 1C0UA 1VOMA 2D3ZA 3MECA 1FERA 1RBLA 2LVWA 4CO2A 3PW2A 2BKOA 4G1IA 4OHVA 4PABA 3OLAA 2HRTA 3PHEA 4F4AA 1N6QB 3IBWA 2IRUA 2IYIA 3SSSA 1GAOA 4L72B 5J2NB 4WFYA 3HKWA 3DOKA 5ETSA 2UVVA 4YN3B 1C1BA 2J9DA 3TO8A 1HNWF 1MU2A 2ZH4A 1HNXF 1GEHA 1S4EA 1IKXA 4C8KA 1YLXA 4C8OA 2CNNB 4S0MA 3UNGC 4F4KA 2HAFA 2FYXA 3IBFB 3MM6A 3BV8A 3I5CA 2OPPB 1H74A 4HR2A 1RHKB 2D1CA 4EZ6A 4X84A 4J9QA 5C42B 2IA0A 2O1PA 3RW7A 3D3CJ 4NXMJ 1T94A 2Y0SD 4HTJA 2DGSA 2JEIA 3CNQP 4ZVRB 4MKBA 3DDNA 2Z2YB 1RAFB 5GAHU 4IO9Q 1WC3A 3W2WB 4HACA 1PCAA 4BDPA 3GFZA 3TP2A 2V8VA 3T41A 3ENWA 4IRDA 4NLYA 4ZVSB 4V19X 3IRXA 2FTRA 3U7JA 1FDAA 2ZH8A 4DR2F 2EBGA 2HS0A 4CM0A 1AA1B 2W2NP 1Y5NB 3MCNA 2YNIA 3DI6B 3CO9A 1Y5IB 2ZH2A 4HI1A 2QSWA 2P9CA 1YJUA 1DY3A 1D9FA 4LF9F 3V5RA 2Y1LB 4P52A 1EQ0A 3PR5B 4C0OC 2YKNA 1KQSR 1Q7YT 4V1Ak 3NGRA 3PKYA 2CJ9A 4QR0A 4DXLA 2UP1A 2CQ1A 2BABA 3CWJA 3H2LA 3LPYA 1NJXA 2J6SA 3W1YC 2ZHBA 4I67A 1T0TV 2VFUA 1M1KT 1FX2A 1XR6A 1A6LA 2DNHA 1YHQS 2E9ZA 2F65A 3C66A 4LT6A 4DDFA 3MXHP 5B09A 4FVCA 2GAGC 1SJQA 1QAYA 3B8HA 4EUVA 3N6MA 3HHLC 4C8LA 4LFAJ 4QIWD 4NASA 4DV7J 2PIIA 3PDNA 1YJNS 3JSMB 5T14A 4IR9A 4OV6A 4K2XA 3T9NA 1FWKA 4R25A 3RBEA 2ZD1A 3D4JA 3EWGA 3VZHA 3QT7A 1D09B 2GJFA 4P7TA 4AT1B 2QT7A 3KLGB 2H5JB 5KG5A 4JI8J 1XIQA 4X65F 5J2PB 2FD2A 3KOAA 2ZH5A 4OX9F 3RAQA 1WELA 2E7VA 2NSBA 1U25A 2ZH3A 3O5TB 2BVZA 5DM7Q 3HVWA 2XLJA 2Y1RI 4WXWA 4M8LA 1RISA 2DXDA 3D0IE 3IG1A 1NPPA 3BH7B 1YX2A 3T5JA 1JXLA 2Z57B 3I5BA 1DTQB 4X4PA 5KFVA 6AT1B 1PYTA 3HSGA 1WI8A 4IH7A 4DFPA 2IA6A 2QGFB 2FJXA 3Q2SC 1IBLF 2R42A 1AUSL 4G1PA 2HNZA 5D6GA 3MMAA 5B0EA 4N8OA 2DCUB 2AQ4A 1N5YB 4RNHA 4G3IA 1ROFA 1N6QA 3SYZA 4WIQA 4OJGA 4ELTA 3UR3C
chains in the Genus database with same CATH topology
3GYNA 3FQKA 2AGQA 1UFWA 1KEKA 4FN5A 1XNQF 2VL1A 3GG0A 1Y3JA 5EWGA 4PUOA 4YQWA 4ECQA 4TU7A 2DO0A 2W9BB 5AE2A 2WOMA 5J2NA 1U45A 2QMXA 2BE2B 3CVKA 3AJ1A 2MQMA 5A0YA 4JI0F 4W92B 1K8AT 2AWZA 2LQ9A 3T6JA 2DNMA 1HYSB 2HHPA 4MIAA 3MAQA 4QWEA 3O44A 3QJJA 2VB6A 2CQCA 4R8UA 5B0DA 1REVB 1HBUB 3SSRA 3I56S 5L1KA 2HNYA 3E01A 3K5LA 3T1AA 1WEYA 2ALZA 1MSWD 1Q8IA 3OL6A 4ZK7M 3H2UB 2RQ4A 5LXRA 3OL9A 5D78A 2L9NA 4ZDNA 2A2CA 3HHLA 1DZ5A 2LU2A 2BJEA 4DSLA 2M88A 4RW4B 1Y5LB 4J9LA 2XI2A 4M5DA 3M6UA 4H4OA 2W9AA 4KO0A 1VC0A 2C3PA 1UAWA 4C2MA 3L95X 3M4XA 1FNMA 1FESA 5B0BA 3DC2A 3K8VA 1FD8A 1ZM3A 1VJWA 4MYTA 3GV8B 3H25A 2BOPA 3WC2A 1B0TA 4ECYA 2RE1A 1HA1A 2OP5A 4KHPF 4RBUA 1TK0A 3QIDA 4A8WA 4F26A 2J7UA 4GMKA 4YR0A 4FXDA 5IXUA 2OPPA 4B02A 3ZZTA 4HL9A 1HFEL 5D4NA 5DRKA 4FBUA 5D8HB 1KC8T 1XK8A 4DF4A 1ZAVA 1A9NB 1NHUA 2BV3A 1IQTA 5KFDA 2EW9A 3P6YC 4C97A 4Y65A 1YBAA 5HMWA 4QR2A 2VA3A 2HHWA 5C42A 1GT8A 4OLOA 2UVWA 2RB7A 2VFRA 2KJWA 2V2KA 2VG6A 3D28A 1N36F 3BQ1A 2ZNYA 2BQRA 2JC1A 1UVJA 4QW8A 3CMAS 2AJ0A 4NCAA 1HW8A 3LP2B 3MEKA 4NRTA 4B9UA 4I0WA 3M30B 2WB4A 2M8DB 3PJWA 2V8HA 4I7FB 5HP1A 1N52B 2ZITA 4WK1A 2VASA 2P9GA 2VFTA 3GIKA 1JLFA 3GILA 3K8WA 3NMAA 2FHOB 1DURA 1IKYA 2R7XA 3I0RB 1VRTA 2F40A 3M32A 5KAKA 2PI5A 4OZ1A 3LP1A 1QY7A 2BQ3A 4KRWA 1GXTA 2ZDPA 3W2WA 1OPIA 1Y9OA 1YVFA 1GXUA 2Q6CA 2N7YA 1TKTB 5G4DA 4Y0FA 5KFXA 2VODA 1UVLA 5IQ6A 2G13A 4X4OA 1JLAB 3MURP 3FZBA 1LQ9A 4N56A 4JV2A 3VAFA 4JI1F 1CPZA 4RU9A 3K0JA 5DQHA 4MYUA 1G3OA 4DL6A 3BQ2A 4GO5X 3DXBA 3PW5A 3FSXA 5E0OA 4DMZA 2KZZA 2HNDB 4ERDA 3D54A 3CD6S 4O3RA 2Z0GA 3MI7X 4NX9A 4ZPCA 3VAHA 2VOPA 1Z2LA 1HWJA 4U9RA 3P3DA 3Q8QB 4WJBA 4U7CA 3DYAA 2JDJA 3HVTA 1OWXA 3IXQA 1TL1B 4DUZF 3OUYA 3CSKA 3HHNB 5L9XA 1FKPA 1WG4A 1IN0A 3DI6A 1SUQB 3LAMA 2CPDA 4NLVA 3CCUS 2YX7A 4O4GA 1NHVA 2G1DA 3US5A 4U6PA 5CXTA 1S1UA 1HBNA 4Y2AA 2HYIB 2ERRA 3M9OB