1RTLA

Crystal structure of hcv ns3 protease domain: ns4a peptide complex with covalently bound pyrrolidine-5,5-translactam inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease/helicase
publication title Pyrrolidine-5,5-trans-lactams. 4. Incorporation of a P3/P4 urea leads to potent intracellular inhibitors of hepatitis C virus NS3/4A protease
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein complex
total genus 42
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rtlA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1rtlA01
1K9OE 3O8DA 2TPIZ 1C1MA 1SMFE 3IG6B 3A8DA 3T29A 2VB0A 1B7XB 3RXOA 1EUFA 1V2MT 2R2MB 2A45B 1ZJKA 1NRNH 2ZI2H 3B23B 4CRAA 3GCHC 1LHGH 3SUEA 3P6ZB 3BG4B 4OS1A 3SYJA 3TK9A 2ODYB 3SJ8A 2FM2A 3OY5U 3RLYH 1V2QT 1C9TA 1GMCF 2H9EH 3RXVA 2F9BH 2HOBA 1IQKA 1O2YA 4DGJA 4YTAA 2BM2A 4NFFA 5ETXA 1PFXC 4X8UH 5EU8A 1BJUA 1GVKB 1Z8JB 2RG3A 4ABIA 3EA9A 1P2IA 3V7TA 1AWHB 3U1JB 1P04A 1T32A 2QXJA 3QLPH 1NRSH 5DK1A 2A4QA 1MAYA 2QF3A 4H4FA 1VCQA 4KELA 4B1TA 3VB3A 1UVOA 1ESTA 5DO4H 2BY5X 4D9QA 2BDGA 1BMAA 3LT3A 3UR6A 1C1RA 2JKHA 4INLA 5L6NH 4A1VA 1A0LA 2PHBA 1V2LT 2ZGBH 3RXRA 4XOJA 2BTCE 3H7TA 3M5LA 3ZV9A 1TBRH 1P03A 5GIBA 2XC0A 1L1JA 1SOZA 3LC5A 2ZHWH 5A8ZA 4MQAA 3SUDA 3SV6A 2UUKB 3PO1B 1YCPK 1TX8A 4X1SU 4FUEA 3BTKE 4AB9A 3K2UA 1TNIA 2BDAA 2F9OA 3HK3B 4JZDH 3PTBA 3SQEE 1HB0B 2ZFPH 3VGCC 1C5SA 1MBMA 7KMEH 1AKSB 3GCTF 2OP9A 3T62A 3O8RA 2V0BA 2EA3A 1BRCE 1E35B 1ABIH 1V6DA 1BOQA 4E7RG 1HLTH 4XBDA 4IN2A 3I29A 1MKWH 1GHBF 3S7KB 3Q3KA 1C5LH 1P10A 4PROA 1HDTH 3OSYA 2AS9A 2TGPZ 4FVDA 1Z1IA 2F3CE 2FIRH 2BLWA 3BTQE 5E0JA 4CRGA 3S9AA 1O3OA 1O2RA 4O9VA 2ZEBA 4LXBH 3EA8A 2UUFB 3PWCA 4CHAC 1EB1H 2R3UA 1EZSC 4VGCC 5A2MH 3SNAA 3RUOA 4X8VH 5EODA 1N6YA 3CP7A 1W7XH 3QGJA 4GVUA 3R3GB 4JYUH 3F1SB 2OCVB 4ZKRU 1V2KT 2NU2E 1O2VA 1SHHB 1GMCG 1UTPA 1SGTA 3SUFA 4TY6A 1AUTC 1MTVA 2GVFA 1SFQB 4JZFH 1NZQH 2G5VA 3VFEA 5T6FA 1C1UH 1NT1A 1WTHD 5K0HA 1A5IA 1IQIA 2ZO3H 2FMJA 2BY7X 1YPHC 2HALA 1NC6A 5DP5A 3UIRA 4A92A 4NG9H 1PPGE 4X2VA 1JRTA 1G3EA 1TRNA 1MD7A 3A7ZA 4RKJB 2BD5A 4K1TA 2FO9A 3P70B 1LDTT 1F2SE 5C67A 2LPRA 3GDUA 4H6SB 4AGKA 1P2OA 3RXIA 1AFQC 4FUCA 2ANMH 2GT8A 3KQEA 1DFPA 2BOHB 1QCPA 1C2IA 1QTFA 2C8YB 4FUBA 1Y3YA 3S9BA 4U32A 2GMTB 4B2CA 4J1YA 3S69A 1CGIE 2H5CA 2O8TA 1O2ZA 3SV7A 3KQBA 2VBCA 1JOUB 2WUBA 2OBQA 3NZIA 3GYMA 1ESAA 1C2MA 3GCNA 3MNBA 4WMFA 1DDJA 5CMXH 1WYKA 2Y5FA 3V12A 3M36A 1C4U2 1SLUB 3BF6H 1GBDA 5EQQA 1SVPA 1TPOA 2XC4A 1O32A 5JBAS 6CHAB 5EXLA 1WCZA 4INKA 1HIAA 5FHTA 1OP0A 2VVUA 1XUJA 3GCTG 1UVTH 4WXIA 1ZGIA 4LZ1H 3PV5A 1QB1A 1UJ1A 4MPVA 4KTCA 4A6LA 1QBOA 1THSH 3A7YA 1P2NA 4FXGH 3D65E 5DPAA 1O5GH 3LGTA 2YNAA 3EGKH 5FPTA 4F49A 1GDNA 3SI4H 1GHBG 3FFGA 5A09A 3M5NA 2J38A 1GBTA 1O38A 1QJ6B 1W11U 3SV2H 1LVMA 1HPGA 2ULLA 1BHXB 1QA0A 3G01A 3MOCA 1UTQA 2PR3A 1L4DA 1C2FA 2IJOB 4D7FA 3RXKA 1Z8RA 2W3IA 1AQ7A 2TGAA 5LPFA 5HMAA 4B2BA 1WTGH 3UQOA 1CA8B 3ODFA 5I25A 1HAOH 1ZR0A 1H4WA 2A5AA 3SZEA 2ZTXA 1F7ZA 5DGJA 5TJXA 3RMMH 1DSTA 3D23A 1SOTA 5ABWA 1BCUH 1VR1H 1HAGE 1AD8H 2P95A 3H5CB 2Z3CA 3SO3A 3ZZ3A 1G3DA 1JWTA 3PWBA 1HFDA 4MNVA 4D7GA 3N7OA 4CRBA 1DE7H 1LVOA 2G4UA 3I77A 4ISOA 3U8RH 4GLYA 1T4UH 2OBOA 3M3VA 1O3IA 2BDIA 5GXPA 1YM0A 1LCYA 5FBIA 3GISB 2ZCHP 3QX5H 2CF9H 4X6PA 3AK5A 2A2XH 1SBWA 2P8OC 1ZHMA 1BIOA 1ZTLA 4K2YA 1DXPA 2TGDA 1MQ6A 1Y59T 1KDQB 1F5KU 2AH4X 2ZNKH 1GBMA 1INCA 2UWLA 3RXMA 2QCYA 3LDXH 1WQVH 4Y7BA 2AIQA 3BTDE 5GDSH 1PQ8A 3RXSA 4ZXYH 1GJ8B 3UNQA 2XBYA 3PMAB 1CBWC 1E0FD 1XM1A 3MI4A 2XCFA 2PW8H 2OLGA 1Q31A 4A1TA 1SLWB 1WQSA 1Z1JA 4X8TH 1O2WA 1DUEA 3MO9A 1OS8A 1GJDB 2HNTE 5T3HA 1H9LB 1Y5AT 3BTHE 1LQDB 3MO6A 1FAXA 1TRMA 2ZG0H 1F5LA 2C8ZB 2J92A 4YT7H 3QTOH 3B9FH 3R0FA 1K1JA 3DFLA 1P3CA 2BX4A 5PTPA 2GCTB 5DP3A 1AN1E 1PPCE 3V0XA 3BIVH 5LPRA 3RXLA 1LMWB 4U30A 1O3LA 2XNIA 3M5MA 1G3CA 2HGTH 1OWJA 3SNEA 2F9VA 2XYAA 2STBE 1O3DA 1HAVA 3BEFB 1FZZA 2BLQA 2O8UA 1MAXA 2C4FH 1BRBE 4Y0YE 1H8DH 5AFZH 3TIUA 4LZ4B 4BNRA 1WSSH 5F03A 1PQ5A 1DWDH 1GG6C 1MQ5A 1TMBH 2D26C 4X0WU 1CE5A 2BDHA 1HAHH 1NPMA 3RU4D 3LKWA 4MVNA 3A8CA 2VWNA 1QJ1B 4TWYA 4XFQA 1VGCC 2C93B 1SGFA 2ZFSA 1ARCA 1TBZH 4FVBA 3LJJA 4K3JA 3L3TA 1HJAC 1P02A 1EAXA 1NY22 2JH6D 3SU5A 5DP4A 1GVZA 1V2UT 1SQOA 2BD3A 2RCEA 3LH1A 1FY3A 1QR3E 4HZHA 1Y3WA 1O3MA 5EW1H 3GY2A 2ZP0H 2DUCA 2BVXH 1SGDE 1MH0A 1MKXH 4JMYA 2ASUB 3OTJE 1OYTH 4KP0A 1P8VC 1BMLA 2PUQH 1FY8E 2PUXB 1TYNA 1EZQA 1MTNB 2P3UB 2ZFTA 1DWBH 3ZZAA 1ETRH 1QURH 1HAXB 1ZGVA 4GHTA 4TY7A 2WPJS 1TGNA 2VINA 2TRMA 1RTFB 1V2NT 2O8WA 4JZIA 1OOKB 2GDEH 1O3KA 1QRWA 4H6TA 1P12E 3RC6A 1SC8U 3P8FA 1EX3A 1A3EH 1O5BB 1TA6A 1O39A 1VJAU 3OTPA 3BTME 3KN2A 2FYQA 1TMTH 1A2CH 1O3EA 2VWMA 3HGPA 2VIVA 3ZZ7A 1W0ZU 3SORA 1KXCA 1X7AC 2VIQA 4MNYA 1KY9A 4UD9H 2ZKSA 1O5DH 1K22H 1O34A 1WAYB 2FI3E 5CHAB 2Z9JA 3QGNB 2A2QH 3BV9B 2BZ6H 1O5EH 3DA9B 2CF8H 2FX6A 1EAWA 2PKSC 2OC7A 2ODPA 4NIXA 3EE0B 1O36A 2ZTZA 3TVJB 3M7UA 1SLVB 2P3FH 4Z6AH 1UHBA 4RN6A 8KME2 2VNTA 5EG4A 5H4IB 2FOEA 1ZSLA 4JZEH 1BBRH 4CR9A 1XKAC 1BZXE 3E90B 3FP7E 1HXEH 2A4RA 4NGAH 4ABAA 5JB8S 1WV7H 1E36B 3PM3A 2BHGA 3T2NA 3U1IB 3A84A 1DITH 1KTTB 3MU1A 2G55A 4OGXA 1HAIH 3TJUA 1CA0C 1MTWA 1TPSA 2HLCA 3FZDA 3M35A 3MH4A 1IHTH 3TNSA 4Y11E 4ZH8A 1QBVH 3PMJA 1SGQE 2ANYA 2H2ZA 4HI3A 2OXSA 1TQ7B 3E91A 2FODA 1O5CB 3SGAE 3AW0A 3ITIA 3D49H 3GY5A 1UO6A 1UVPA 3PV2A 5HM9A 1BMMH 1HAPH 1Y5UT 2ZF0H 2OTVA 5JDUB 1FIWA 1HRTH 4Z0KA 1O33A 5C5NA 2QY0B 1W10U 1XMNB 2P59A 5A8XA 1AB9C 4X2YA 1YCPM 3KHVA 4ZHAA 3T25A 2Y7XA 2Z9IA 4JCNA 3B8JA 3MO3A 3EA7A 2XCNA 3ZZ9A 4SGAE 1W12U 3Q00A 1HAZB 1NO9H 2H5DA 2O8LA 1K1MA 4WWYA 2FX4A 1IQMA 1A7SA 2Q6FA 3QK1A 3SV8A 3MHWU 3VGCB 1DVAH 4YLUA 1GWAA 1GBAA 3A7VA 3RP2A 1GHWH 4I8JA 1TIOA 2Y6TA 4NA8A 3F9FA 4THNH 1D6WA 3QZRA 4MPUA 1GI3A 1D3TB 3T28A 1O2MA 2HVXA 3K6YA 2BVSH 1B5GH 3M37A 2A1DB 5DJ7A 2QXHA 5EPNA 5HXFA 3E16B 4K1SA 3QDZB 3U69H 3PYHA 1SGNE 5LGOA 1YPJH 1AWFH 1ELTA 4BOHA 4I8HA 4VGCB 1GL1A 2GP9B 4JZ1A 4M9FA 1C2GA 3SU3A 5DP7A 3VXFH 4K5ZA 1DLEA 2HPPH 2CXVA 1HIAB 3SGBE 2F9UA 3VB7A 4AGJA 4TPIZ 2FOHA 1TMUH 1GHVH 1GHAF 3TGKE 1RTLA 1PPZA 4JK5A 1SGEE 3SU2A 5FAHA 1A3BH 1Y8TA 4IC5A 3ZZ4A 2QGRA 3UR9A 2VVVA 3AAVA 2BXUH 1IHSH 2R9PA 3I78A 4BANB 4O97A 2ZQ2A 1NM6A 1UCYH 1ZLRA 3HK6B 8LPRA 2GKVE 1ZSJA 3T27A 4B73A 1EPTC 6LPRA 4CR5A 1LVBA 1P2KA 3MFJA 5JPMH 4MPXA 1GJCB 1K1IA 1ELBA 2XW9A 1T8MA 1NTPA 5BRRE 1S81A 1ZMJA 3P8GA 3ZZ8A 1AMHA 2J94A 2QAAA 1C5UA 1AFQB 1M9UA 1W2KH 2A7CA 1UK3A 2OC0A 1A61H 1SQTA 2AGEX 4I33A 1CT2E 3URCA 1S0RA 5IYTA 1DY8A 1Z6EA 1YGCH 2ZHFH 2ZCKP 2GZ7A 4TPYA 3TH4H 1GJBB 5C3NA 1H1BA 5C1XA 1ELFA 2B5TB 1TX6A 4TWWA 1C2LA 1BTWA 1PJPA 2H6MA 4DT7B 3BG4C 2OD3B 1ZJDA 4JK6A 2BLVA 2XXLA 1LKBA 2ZHDA 3PLBA 1CSOE 1Q3XA 4MLFB 2FPZA 4Q7YA 3ZZDA 1RS0A 5E2OA 1B0FA 3CS7A 3P8NA 2O9QA 1ANCA 3LH3A 1KXBA 2FI4E 1QHRB 3UPEA 4Y8YA 1AU8A 4UE7H 5FCKA 4Q7XA 3TGJE 1XX9A 1HCGA 1QQUA 2HNTC 1J15A 4NSYA 1MCTA 1SI5H 2G5NA 3TITA 4AFZA 1J16A 4Y71A 1C5PA 5I46H 1FAKH 2ZA5A 1NFXA 4KKDA 4XE4A 1BA8B 4M7GA 1ZPCA 3A81A 1TONA 3TK5A 1A5GH 4UFFH 1MZAA 2FTMA 4WF8A 1C5NH 1FXYA 1OXGA 1O3AA 5AF9H 1EPTA 1QNJA 2BQ6B 3LC3A 3DHKH 2ALPA 1C5VA 3KNXA 1PPHE 4X1NU 4Q80A 5AVDA 2FOFA 1FY1A 1NRQH 1FY4A 3LGWA 5C2ZA 1O2OA 1ZTJA 1EP6A 1EZXC 3ELAH 3NWUA 3GOVB 3BTEE 1UVSH 1L2EA 3ATLA 1A4WH 3QTVH 2C90B 1KXAA 3F9GA 4GPGA 4Y10E 1TLDA 2WZQA 3AVZA 1DXWA 1GHAG 2BD2A 1ZPZA 2PLXA 2GZ8A 1C1QA 1KLJH 3PROA 3SN8A 1G3BA 1AGJA 4AYVB 5BPEA 1G37A 1O3NA 3RU4E 3ATKA 1P2JA 5L30H 5DG6A 2UWPA 2ODQA 1YPGH 4FUDA 2VIOA 1FIZA 1K1OA 1O3CA 2ZGJA 4X2XA 1KLIH 4ZUHA 1HAVB 1EB2A 2STAE 1EOJA 3K65B 1FMGA 3ZZCA 1AI8H 1FY5A 3UOUA 2BY8X 4NIYA 3T5FH 1O2KA 4MG3A 5C20A 1LVYA 1GBFA 3TJNA 1ABJH 2ZTYA 3ZVBA 3RXGA 1V2PT 1AZ8A 4DY7B 3A7TA 1BTYA 5JBTA 1O35A 4ZXXH 1HXFH 2SGPE 3SW2B 1CBWB 3PLKA 4ISHH 4I8KA 4BTIB 4RSPA 2FDAA 1AVGH 5C1UA 2W7SA 3H09A 2AEIH 1TPAE 2HNTF 4CRFA 1EAIA 4Q2KA 4CREA 2CHAB 3F9EA 4WMEA 1FI8A 2PSYA 4B75A 1ZTKA 4FU8A 4NA7A 1TPPA 3RMNH 3ODDA 2WINI 2EEKA 3PV4A 1SPJA 1JRSA 1MU8B 1C5TA 4JYTA 2J9NA 3LJOA 1GBJA 3GYLB 4ZHMU 3EQ0H 1FPCH 4X6OA 5GPIB 4DURA 1LPZB 2OQUA 2ZQ1A 1DT2A 5DP6A 3PB1E 5F8ZA 4WY3A 3S0NA 1W14U 1G36A 1O2LA 4DCDA 2G51A 1ZRBA 3RXUA 4I8GA 1WBGB 1TGTA 1XUIA 2D1JA 1O3JA 4AYYB 1YLDA 5DKMA 2GTBA 4NZLA 1ANBA 4NWKA 1TFXA 1LKAA 1O5AB 4X8SH 3SHAH 1QRZA 4D8NA 2FLRH 1MKWK 1XUKA 3LPRA 1HUTH 3MNXA 4Y7AA 2GMTC 4IGDA 1GJ4H 1V2ST 1EAUA 1DY9A 1GG6B 1C5OH 1SGCA 2ZHQH 2ZGXH 3ESTA 1EJMA 1XKBC 1UVUH 1VGCB 2BQWB 1IQFA 3BTTE 1Z8IB 4OS6A 3ZVFA 1GJ7B 2VGCC 1P9SA 1DOJA 1GI6A 1Q2WA 2H9TH 4A1XA 1BJVA 3S7HB 2BLOA 1HJAB 1UHBB 2ZFQH 2ZU1A 2KAIA 1FONA 4O3TA 4YESB 2VWOA 1BQYA 3MH7A 3E3TA 1IQNA 5SGAE 3RXPA 3A7XA 3SU0A 4CBOA 4X1RU 2AMDA 3SJ9A 1ZMNA 1NN6A 1K1PA 5FPSA 3DD2H 3P95A 4RI0A 2R0KA 2P93A 4AFSA 3C1KA 1C1SA 5C1YA 2Z94A 1LHEH 1T4VH 2GT7A 2OINA 1C2HA 4R0IA 2P3TB 4FU9A 3C27B 1RRKA 1J8AA 2CMYA 4NIVA 4OM9A 1BRAA 1V2TT 3SBKA 3FAOA 2XBVA 1U6QA 2THFB 4FUIA 1O2PA 1TBQH 1QFKH 1OWHA 1UK4A 2VIPA 5K7RA 1O2NA 2A32A 2V3OH 4TYDA 5JYIA 1ZMLA 1XUFA 1YPHE 3L6PA 4X1QU 3SI3H 1WXRA 3URDA 5GWZA 3KQDA 1P01A 3KQCA 4YT6H 2F83A 2WV4A 3STJA 2GV7A 1LTOA 2UWOA 3JZ1B 3JZ2B 1ZPBA 1O2SA 1Y3VA 2AMQA 1QL7A 2I6QA 2WV5A 2Q1JA 1J17T 3SJOA 5FX5A 1QA7A 1S82A 1SSXA 2RA3A 1QIXB 3GCOA 3U9AH 3LGVA 2PKSB 4CH8B 1A5HA 3QN7A 4DOQA 1T8OA 3PLPA 4GHQA 1IOEA 1FJSA 1W8BH 1MZDA 1Y3XA 3ENSB 1GJ9B 2W7UA 2OC1A 5E0HA 1CGJE 1FUJA 1T31A 5TCAA 3AASA 2QV1A 5B6LA 2LNCA 2ZHEH 3EDXB 3M7QA 1DWCH 4OS5A 2NU4E 3K6ZA 3M3SA 1BB0B 1VITH 5EQSA 5T6DA 2PTNA 4YO9A 3BG8A 2A4OA 4BXSA 3ZVAA 1V3XA 2BX3A 2OQ5A 2PV9B 3MTYA 3OY6U 3BTGE 2A4GA 3Q76A 4BAMB 3A7WA 4B76A 1O3PB 4BXWA 1CA0B 3HKIB 1S5SA 1GGDC 3NK8A 2BOKA 3UTUH 1GDQA 1CVWH 3U8OH 3ZZBA 2NU1E 1QRXA 1OWIA 4B2AA 2UUJB 3SJIA 1AZZA 1MTUA 2VJ1A 1DM4B 3DT0H 3HKJB 1GI8B 1QB6A 3SJKA 2QXGA 2OUAA 4I31A 2Z9GA 4I8LA 1C5ZB 1K21H 1NU7B 3GY7A 1V2OT 1YYY1 1THRH 1JIRA 1V2WT 1KYNA 3RXTA 4B71A 5EXNA 1VZQH 3NKKA 1BHXF 3SU6A 4B74A 1D6RA 4DIIH 2VH6A 1L4ZA 2HWLB 2Z6BD 1CT4E 7ESTE 1TX7A 1VITF 1V2VT 2WV9A 3TJVA 3GY3A 1KIGH 1OX1A 1YCPH 1EJAA 1LO6A 3V13A 1ELEE 2XBXA 2WPLS 3MWIU 3SNDA 1RIWC 1OYQA 3A82A 4YOJA 4O3UA 4DVAU 4MDSA 3GCHB 1SHYA 3RM0H 3KGPA 3RXJA 1TRYA 3EAJA 2QYIA 2A7JA 2XTTB 1D9IA 3T26A 5T1VA 1CGHA 4MNXA 2PWXA 1GI5A 2PKAA 1YBWA 5J4QA 1O2JA 2PGQB 3VB4A 4X6NA 5LPEA 1D3PB 1F5RA 4ISIH 2J4IA 4XBBA 2VH0A 3FP6E 5AHGH 1NFWA 2WYJA 4CBNA 1BRUP 3RXAA 3A83A 3MNSA 3STIA 3RXHA 4UFDH 1T8NA 5C5OA 5A0CA 3E1XB 1F0TA 1BDAA 1H9IE 2IOTA 3U8TH 2Z3EA 4U2WA 1OWDA 3RXCA 1IQGA 1MUEB 1A0HB 3LGYA 1PQAA 3BIUH 4AX9H 4D76A 1LHFH 1W13U 1P2QA 1TOMH 3UREA 2SGAA 1ARBA 3CENA 1SGYE 4XBCA 1GBKA 3ZZ6A 7LPRA 1MU6B 1TOCB 1GVLA 1ELCA 1AVXA 2QXIA 1D3QB 3UOPA 2WHXA 2PTCE 1GBIA 1AE8H 2ZDKA 4Y8ZA 3RM2H 1F0RA 1JIMA 1EPTB 2VIWA 4FUHA 2WPKS 1BTUA 1OWEA 1TABE 3ZVDA 2JETC 2M5TA 4ABEA 1OWKA 2PFEA 5EOKA 4NZQA 1KXEA 6GCHF 4ZMAH 2J2UA 3RXDA 1O2IA 4AB8A 2BZAA 2G81E 2FOBA 2ZU3A 2V6NA 2Q6GA 4ABFA 1N8OC 4AN7A 1SB1H 3Q77A 2G8TA 1ZZZA 3CS0A 3GY8A 2FZZA 3ZVCA 1LHDH 1C5YB 2ZGHA 2B9LA 3MU4A 1ZRKA 4BAHB 1GCTC 5B6OA 4CH2B 3Q3XA 1BMNH 1ID5H 5CHAC 4U01A 1EKBB 1QL8A 2R3YA 3TH3H 3A85A 4Y6DA 1W0YH 5LH8A 1O30A 4NIWA 2ZPQA 2OC8A 5F6MA 3TLOA 1BTHH 1EOLA 1T8LA 3P8OA 1VITG 2ILNA 1D3DB 2P94A 3SQHE 2FOAA 4BTUB 1IQHA 1YPKH 4DG4A 2FYRA 1SLXB 1MCVA 1OSSA 1VCWA 3VB6A 1Y5BT 3GDSA 1AUJA 4CHAB 2B8OH 4R8TB 3M5OA 2Q6DA 3QUMP 7GCHF 1YLCA 2BD8A 3W95A 1MKXK 2BYAX 3LIWA 1AHTH 1PPEE 2J95A 4MPWA 5EPYA 1RGQA 4HFPB 3K9XB 1G32B 1L1GA 3FP8E 2ANWA 1BTZA 1GPZA 2Y7ZA 3MNCA 4GSOA 1ETSH 2BDCA 1AE5A 3DUXH 1SGIB 1UK2A 1W7GH 3IITA 1TNKA 1UTLM 4WMDA 2H1UA 1WU1A 3A8AA 1ETTH 2CV3A 4NWLA 5A0AE 2EI8A 2IPHA 5FX6A 2A0QB 3QZQA 1O2TA 4FUGA 1O0DH 1GMHF 1Z8GA 1SGPE 3TJOA 4ESTE 1C1NA 2QF0A 1Z7KA 1AO5A 2SFAA 1GJ6A 5E8EH 3RXBA 2QA9E 2CGAA 2WUCA 2ZFFH 3GDVA 5GJ4B 4AFQA 3FVFB 3AW1A 2BMGB 1O2XA 1HNEE 3MYWA 5L2YH 3S9CA 1HV7A 4LK4A 1Z71A 3A80A 1BBRE 3MU5A 2C8XB 2DE8A 5G4BA 5JBCS 1F0SA 2FTLE 1DS2E 5TCCA 1NS3A 1IQLA 2ZFRH 1ELGA 1GI7B 2IN2A 4OGYA 4WVPE 1DPOA 2CN0H 2B0FA 1K1NA 3GICB 2H9HA 5HYOA 4ABDA 3PMHB 3RXEA 3SGQE 2FEQH 3LONA 2FS9A 3SZNA 1UTKA 1EATA 1S6HA 1BBRK 1FPHH 2NU3E 3E8LA 6GCHG 1A46H 3L33A 1HJ9A 1IQEA 2W5EA 3SUGA 2ZZUH 1YPLH 2TIOA 1K28D 4B6EA 5FXLA 2BQ7B 2FLBH 2F91A 2FP7B 3HGNA 4B6FA 4JYVH 1OPHB 2W26A 3QWCH 1FNIA 3IWMA 4ZHLU 1TA2A 1F0UA 1GI4A 1GBBA 3RMOH 2SGQE 1OKXA 1ELVA 3H7OA 3M3TA 4WH6A 3ZV8A 1DUAA 2QN5T 5FCRA 3GY4A 2AGIX 1TB6H 1GI0A 2KAIB 1P2MA 1TAWA 4IN1A 4RKOB 1C2EA 1D4PB 1FN6A 3RLWH 4Y8XA 1ESBA 1C2JA 3UQVA 1E37B 4BAKB 1C5WB 3FZZA 6ESTA 1QBNA 2AGGX 4MTBA 3MH6A 5FBEA 1CU1A 1LHCH 7GCHG 4ABBA 3TPIZ 2VWLA 4ZKNU 1C2KA 1HYLA 1O3HA 1GBEA 1P06A 1AVWA 2XRCA 2IJD1 3P17H 4HGCA 3PO1C 5HGGA 3M7TA 2FI5E 1FDPA 4AG1A 1GMDF 1RTKA 1EJNA 1TNLA 1P05A 1A0JA 2SNVA 3NUMA 2VU8E 3BTFE 4NSVA 5A0BA 2AMPA 1BUIA 4Q7ZA 1KTSB 1BTPA 1TQ0B 2WPHS 1C4Y2 3ATWA 1ZHPA 2TBSA 1LPKB 5AFYH 2ZU4A 1P09A 4X2WA 5ESTE 2ZCLP 5F8XA 4FU7A 3SNCA 2Y82A 1TGSZ 2ZC9H 1GMHG 4X1PU 1MD8A 2AYWA 2GV6A 5GNDA 1YPEH 3ZVGA 2O8MA 3UNRA 3ATMA 2PSXA 2BVRH 2P8OB 1UTOA 4UONA 4YZUA 2QC2A 3F6UH 1EASA 4IC6A 4D9RA 1O2GH 3PMBB 1JBUH 4OS4A 2SGEE 2RDLA 3A87A 1KXDA 3SU1A 4CRDA 4BTTB 1C1OA 2GZ9A 1DANH 3A8BA 1XXFA 2P16A 2VGCB 1THPB 3SNBA 4KGAA 3KEEA 4ASHA 1IAUA 2ZDAH 3RXFA 1UCYE 1PQ7A 3V3MA 4DW2U 1AFEH 2ZWLH 1YPMH 1XUHA 2FOCA 1CHGA 2GD4B 1BT7A 1GL0E 2FXRA 1DWEH 1O2HA 1O3GA 2AERH 3DFJA 4UFGH 4F4OC 2ZPSA 5IDKA 1UCYK 1S0QA 1QY6A 1KSNA 3E6PH 2NWNA 1RXPA 1ACBE 5EQRA 2AIPA 2F4LA 1SL3A 3OU0A 3VB5A 1ZSKA 5HM2A 1TGCA 1K2I1 1PPFE 4CRCA 3SOSA 3HATH 4Y0ZE 1V2RT 4AZ2B 1DICA 3Q3YA 1GHYH 4ABHA 4ZAEA 1O2QA 1SGRE 2G52A 4IBLH 5JBBS 3U98H 1AKSA 4NA9H 3GY6A 4WH8A 5E0GA 1CHOF 4QT8C 1DX5M 3MMGA 1QGFA 1C1VH 4E05H 1HBTH 1RJXB 1ELDE 2WYGA 3LU9B 1GBCA 2RA0A 4BAQB 1C5QA 1RFNA 4BAOB 2BDBA 4AFUA 2DE9A 1CQQA 1TE0A 2HPQH 3TU7H 3NCLA 1EZUC 5JB9S 3QO6A 3UWJH 2CJIA 1J9CH 2A31A 2Z3DA 2OK5A 1QL9A 1GMDG 2TGTA 4A5TS 4IMQA 3NXPA 1GDUA 2JH0D 2C3SA 1FN8A 1TWXB 5DP9A 2PKAB 3SHCH 4DJZB 3UNSA 4Y76A 1AY6H 3KF2A 3RXQA 6CHAC 4NCYA 2YNBA 1UTNA 5CE1A 2FESH 3MH5A 5E2PA 4ABJA 4FUFA 2ANKH 5DP8A 1S83A 2I6SA 2EI6A 1C1TA 3PTNA 1C2DA 1GGDB 1ANEA 3UFAA 3M61U 4GAWA 4IW4E 1ZOMA 2HRVA 2PGBB 5EXMA 3ZZ5A 1E34B 1NESE 2CHAC 1C5XB 3A89A 2FWWA 4ABGA 3OX7U 3LGUA 4J2YB 1P3EA 1CT0E 2BD7A 2F9PA 1BTXA 5GCHF 2AFQB 4H42U 1DLKB 2YOLA 4KTUA 5EGMA 4AORA 1OP2A 1YC0A 1TGBA 1SR5C 3UY9A 5ESBA 4K60A 2GCHF 3A86A 1S6FA 3RDZA 2ZU5A 1S84A 3TK6A 1SG8B 3BTWE 5EW2H 8GCHF 2A5IA 1NRRH 1ANDA 2BD4A 2XBWA 4GCHF 4YOGA 1XUGA 1O2UA 4NFEA 4UEHH 1N6XA 3WY8A 1RIWB 4ZKOU 1EQ9A 1Y3UA 2R0LA 4FUJA 4WJG2 4I32A 1QQ4A 1GI1A 2XWBI 2ZDLA 1TALA 3SV9A 3ZVEA 3O8CA 4OS2A 1UTMA 4K8YA 2ZDMA 3ATIA 3W94A 2VIDA 1GHZA 1ELAA 1KXFA 4K1EA 1C1PA 2W3KA 2BD9A 1FLEE 3VEQB 2SNWA 1CHOG 1JMOH 1C1WH 2D2DA 1C5MD 1W3CA 1G2LA 3BSQA 4MNWA 2ZDVH 4A7IB 1ZHRA 2A5KA 1PYTD 2GX4A 4LOYH 1RD3B 4GUXA 4AOQA 1OP8A 1QB9A 5L2ZH 1L0ZA 4OS7A 1NROH 3AAUA 2JH5D 4I7YH 1MMJN 2C8WB 1KLTA 1EP5A 3NPSA 1G9IE 2FS8A 4YOIA 3KCGH 3RMLH 1NFYA 3E0PB 5FPYA 4IS5A 3O8BA 4SGBE 1GI9B 1GJ5H 1P11E 1Z6JH 1FV9A 4KTSA 2ZGCA 3EYDA 3RC4A 4K8BA 2G00A 1P9UA 2XC5A 2GDDA 4E06H 4HTCH 1NFUA 2EI7A 1P57B 9LPRA 1C9PA 2SGDE 2V35A 1HJ8A 2Y80A 2GCTC 1AB9B 3LGIA 1ZYOA 2BY6X 2FOMB 1P0SH 4WXVA 2ZU2A 2Y81A 9ESTA 2JETB 2R2WU 4UDWH 1WUNH 1H8IH 1NU9A 1FQ3A 2QIQA 2SGFE 1LPGB 2Z9KA 3VPKA 1N8OB 4XSKU 1A1RA 3ZYDA 4UFEH 4IMZA 1S85A 1WOFA 4X6MA 1GBLA 1GCDA 1EXFA 1ORFA 1TNJA 1GCTB 1YF4A 2FOGA 3OYPA 1UTJA 5GCHG 1J14A 1MBQA 3UWIA 4ISNA 4K69A 2Y5GA 1VCPA 1KDQA 1O31A 2K1QA 4YM9A 1O5FH 4ISLA 2UUYA 2BY9X 3TH2H 1JXPA 1TNGA 2GCHG 5F8TA 2G4TA 1UMAH 5A8YA 4ZKSU 1E38B 4XDEA 2ZPRA 1B0EA 8GCHG 2Z9LA 1SFIA 3E0NB 4GCHG 1C4V2 2J34A 1PPBH 1HAYB 2BXTH 1C5RA 2V3HH 2Y5HA 2BB4A 3RC5A 3BEIB 1AIXH 4YLQH 3P92A 4INHA 2B7DH 4E7NA 2Z7FE 1O3BA 1MTSA 3HPTB 1YKTA 3FANA 5T6GA 3VXEH 1TNHA 1O37A 3KIDU 2BDYA 3A88A 1V2JT 8ESTE 3MU8A 1T7CA 3BN9A 1VJ9U 4Y79A 1XVMA 1SQAA 1MTNC 2ZIQH 1GI2A 1H9HE 4DIHH 1K1LA 2ALVA 1DSUA 1XVOA 1YP9A 2A7HA 2WPIS 3ZYEA 1QJ7B 1NRPH 2ZECA 2ZDNA 3TGIE 1G2MA 3UUZA 2XWAA 3F68H 1G30B 1LQEA 3MU0A 1BITA 1IQJA 2ESTE 2NU0E 3BEUA 3KL6A 2VVCA 1CO7E 1HGTH 1O3FA 1L1NA 3SU4A 3F9HA 1SGFG 2WPMS 3D62A 2GGVB 2EC9H 2D8WA 4AG2A 1XXDA 4ZROA 1PYTC 1GJAB 3LOXA 5J4SA 1N1LA 3RU4T 4O03A 1GBHA 1F92A 3TNTA 2F9NA 1GHXH
chains in the Genus database with same CATH superfamily
1K9OE 3O8DA 2TPIZ 1C1MA 1SMFE 3IG6B 3A8DA 3T29A 2VB0A 1B7XB 3RXOA 1EUFA 1V2MT 2R2MB 2A45B 1ZJKA 1NRNH 2ZI2H 3B23B 4CRAA 3GCHC 1LHGH 3SUEA 3P6ZB 3BG4B 4OS1A 3SYJA 3TK9A 2ODYB 3SJ8A 2FM2A 3OY5U 3RLYH 1V2QT 1C9TA 1GMCF 2H9EH 3RXVA 2F9BH 2HOBA 1IQKA 1O2YA 4DGJA 4YTAA 2BM2A 4NFFA 5ETXA 1PFXC 4X8UH 5EU8A 1BJUA 1GVKB 1Z8JB 2RG3A 2JIZD 4ABIA 3EA9A 1P2IA 3V7TA 1AWHB 3U1JB 1P04A 1T32A 2QXJA 3QLPH 1NRSH 5DK1A 2A4QA 1MAYA 2QF3A 4H4FA 2KZ4A 1VCQA 5EJLA 4KELA 4B1TA 3VB3A 1UVOA 1ESTA 5DO4H 2BY5X 4D9QA 2BDGA 3DSGA 1BMAA 3LT3A 3UR6A 1C1RA 2JKHA 4INLA 5L6NH 4A1VA 1A0LA 2PHBA 1V2LT 2ZGBH 3RXRA 4XOJA 2BTCE 3H7TA 3M5LA 3ZV9A 1TBRH 1P03A 5GIBA 2XC0A 1L1JA 1SOZA 3LC5A 2ZHWH 5A8ZA 4MQAA 3SUDA 3SV6A 2UUKB 3PO1B 1E79D 1YCPK 1TX8A 4X1SU 4FUEA 3BTKE 4AB9A 3K2UA 3OE7D 1TNIA 3DSOA 2BDAA 2F9OA 3HK3B 4JZDH 3PTBA 3SQEE 3PRDA 1HB0B 2W6JD 2ZFPH 3VGCC 1C5SA 1MBMA 7KMEH 1AKSB 3GCTF 2OP9A 3T62A 3O8RA 2V0BA 2EA3A 1BRCE 1E35B 1ABIH 1V6DA 1BOQA 4E7RG 1HLTH 4XBDA 5KEDA 4IN2A 4F48B 3I29A 1MKWH 1GHBF 3S7KB 3Q3KA 1C5LH 1P10A 4PROA 1HDTH 3OSYA 2AS9A 2TGPZ 4FVDA 1Z1IA 2F3CE 2FIRH 2BLWA 4P00A 3BTQE 5E0JA 4CRGA 3S9AA 1O3OA 1O2RA 4O9VA 2ZEBA 4LXBH 2KFWA 3EA8A 2L74A 2UUFB 3PWCA 4CHAC 1EB1H 2R3UA 1EZSC 4VGCC 5A2MH 3SNAA 3RUOA 4X8VH 5EODA 1N6YA 3CP7A 1W7XH 3QGJA 4GVUA 3R3GB 4JYUH 3F1SB 2OCVB 4ZKRU 1V2KT 2NU2E 1O2VA 1SHHB 4XD7D 1GMCG 1UTPA 1SGTA 3SUFA 4TY6A 1AUTC 1MTVA 2GVFA 1SFQB 4JZFH 4FOUC 1NZQH 2G5VA 3VFEA 5HIYA 5T6FA 1C1UH 1NT1A 1WTHD 5K0HA 1A5IA 1IQIA 2ZO3H 2FMJA 2BY7X 1YPHC 2HALA 1NC6A 5DP5A 3UIRA 4A92A 4NG9H 4DT4A 1PPGE 2K0QA 4X2VA 1JRTA 1G3EA 1TRNA 1MD7A 3A7ZA 2AHME 4RKJB 2RFKC 2BD5A 4K1TA 2FO9A 3P70B 1LDTT 1F2SE 5C67A 2LPRA 3GDUA 4H6SB 4AGKA 1P2OA 3RXIA 1AFQC 4FUCA 2ANMH 2GT8A 3KQEA 1DFPA 2BOHB 1QCPA 1C2IA 1QTFA 2C8YB 4FUBA 1Y3YA 3F2GA 3S9BA 4U32A 1NBME 2GMTB 4B2CA 4J1YA 3S69A 1CGIE 2H5CA 2O8TA 1O2ZA 3SV7A 3KQBA 2VBCA 1JOUB 2WUBA 2OBQA 3NZIA 3GYMA 1ESAA 1C2MA 3GCNA 3MNBA 4WMFA 1DDJA 5CMXH 1WYKA 2Y5FA 3V12A 3M36A 1C4U2 3PRBA 1SLUB 3BF6H 4RT1A 2WPDD 1GBDA 5EQQA 1SVPA 1TPOA 2XC4A 1O32A 5JBAS 6CHAB 5EXLA 1WCZA 4INKA 1HIAA 5FHTA 1OP0A 2VVUA 1XUJA 3GCTG 1UVTH 4WXIA 1ZGIA 4LZ1H 3PV5A 1QB1A 1UJ1A 4MPVA 4KTCA 4A6LA 1QBOA 1THSH 3A7YA 1P2NA 4FXGH 3D65E 5DPAA 1O5GH 3LGTA 2YNAA 3EGKH 5FPTA 4F49A 1GDNA 3SI4H 1GHBG 3FFGA 5A09A 3M5NA 2QF5A 2J38A 1GBTA 1O38A 1QJ6B 3W1EA 1W11U 3SV2H 1LVMA 1HPGA 2ULLA 1BHXB 1QA0A 3G01A 3MOCA 1UTQA 2PR3A 2KCAA 1L4DA 1C2FA 2IJOB 4D7FA 3RXKA 1Z8RA 2W3IA 1AQ7A 2TGAA 5LPFA 5HMAA 4B2BA 1WTGH 3UQOA 1CA8B 3ODFA 5I25A 1HAOH 2V3MA 1ZR0A 1H4WA 2A5AA 3SZEA 2ZTXA 1F7ZA 5DGJA 5TJXA 3RMMH 1DSTA 3D23A 1SOTA 5ABWA 1BCUH 1VR1H 1HAGE 1AD8H 2P95A 3H5CB 2Z3CA 3SO3A 3ZZ3A 1G3DA 1JWTA 3PWBA 1HFDA 4MNVA 4D7GA 3N7OA 4CRBA 1DE7H 1LVOA 2G4UA 3I77A 4ISOA 3U8RH 4GLYA 1T4UH 2OBOA 3M3VA 1O3IA 2BDIA 5GXPA 1YM0A 1LCYA 1KMHB 5FBIA 3GISB 2ZCHP 3QX5H 2CF9H 4X6PA 3AK5A 2A2XH 1SBWA 2P8OC 1ZHMA 1BIOA 1ZTLA 4K2YA 1DXPA 2TGDA 1MQ6A 1Y59T 1KDQB 1F5KU 2AH4X 2ZNKH 1GBMA 1INCA 2UWLA 3F0PA 3RXMA 2QCYA 3LDXH 1WQVH 4Y7BA 2XNDD 2AIQA 3BTDE 5GDSH 1PQ8A 3RXSA 4ZXYH 1GJ8B 3UNQA 2XBYA 3PMAB 1CBWC 1E0FD 1XM1A 2J98A 3MI4A 2XCFA 2PW8H 3OAAD 3OEED 2OLGA 1Q31A 4A1TA 1SLWB 1WQSA 1Z1JA 5EJZA 4X8TH 1COWD 1O2WA 1DUEA 3MO9A 1OS8A 1GJDB 2HNTE 5T3HA 1H9LB 1W0KD 1Y5AT 3BTHE 1LQDB 3MO6A 1FAXA 1TRMA 2ZG0H 1F5LA 2C8ZB 2J92A 4YT7H 3QTOH 3B9FH 3R0FA 1K1JA 3DFLA 1P3CA 5CHBA 2BX4A 5PTPA 2GCTB 5DP3A 1AN1E 1PPCE 3V0XA 3BIVH 5LPRA 3RXLA 1LMWB 4Q4LA 4U30A 1O3LA 2XNIA 3M5MA 1G3CA 2HGTH 1OWJA 3SNEA 2F9VA 2YMSB 2XYAA 2STBE 1O3DA 1HAVA 3BEFB 4ACAA 1FZZA 2BLQA 2O8UA 1MAXA 2C4FH 1BRBE 4Y0YE 1H8DH 5AFZH 3TIUA 4LZ4B 4BNRA 1WSSH 5F03A 1PQ5A 1DWDH 1GG6C 1MQ5A 1TMBH 2D26C 4HG6A 1CE5A 4X0WU 2BDHA 1HAHH 1NPMA 4ASUD 5DN6D 3RU4D 2WSSD 3LKWA 4MVNA 3A8CA 2VWNA 1QJ1B 4TWYA 4XFQA 1VGCC 2C93B 1SGFA 2ZFSA 1ARCA 1TBZH 4FVBA 3LJJA 4K3JA 3L3TA 1HJAC 1P02A 5CDFE 1EAXA 1NY22 2JH6D 3SU5A 5DP4A 1GVZA 1V2UT 2KCYA 1SQOA 2BD3A 2RCEA 1FY3A 3LH1A 1QR3E 4HZHA 1Y3WA 1O3MA 5EW1H 3GY2A 2ZP0H 2DUCA 2BVXH 2JJ1D 1SGDE 1MH0A 1MKXH 4JMYA 4TT3D 2ASUB 3OTJE 1OYTH 4KP0A 1P8VC 1BMLA 2PUQH 1FY8E 2PUXB 1TYNA 1EZQA 1MTNB 2P3UB 2ZFTA 1DWBH 3ZZAA 1ETRH 1QURH 1HAXB 1ZGVA 4GHTA 4TY7A 2WPJS 1TGNA 2VINA 2TRMA 1RTFB 1V2NT 2O8WA 4JZIA 1OOKB 3GS9A 2GDEH 1O3KA 4P02A 1QRWA 4H6TA 1P12E 3RC6A 1SC8U 3P8FA 1EX3A 1A3EH 1O5BB 1TA6A 1O39A 1VJAU 3OTPA 3BTME 3KN2A 2FYQA 1TMTH 1A2CH 1O3EA 2VWMA 3HGPA 2VIVA 3ZZ7A 1W0ZU 3SORA 1KXCA 1X7AC 2VIQA 4MNYA 1KY9A 4UD9H 2ZKSA 1O5DH 1K22H 1O34A 1WAYB 2FI3E 5CHAB 2Z9JA 3QGNB 2A2QH 3BV9B 2BZ6H 1O5EH 3DA9B 2CF8H 2FX6A 1EAWA 2PKSC 2OC7A 2ODPA 5HIZA 4NIXA 3EE0B 1O36A 2ZTZA 3TVJB 3M7UA 1SLVB 2P3FH 4Z6AH 1UHBA 4RN6A 8KME2 2VNTA 5EG4A 5H4IB 2FOEA 1ZSLA 4JZEH 1BBRH 4CR9A 1XKAC 1BZXE 3E90B 3FP7E 1HXEH 2A4RA 4NGAH 4ABAA 5JB8S 1WV7H 1E36B 3PM3A 2BHGA 3T2NA 3U1IB 3A84A 1DITH 1KTTB 3MU1A 2G55A 4OGXA 1HAIH 3TJUA 1CA0C 1MTWA 1TPSA 2HLCA 3FZDA 3M35A 2KCOA 3MH4A 1IHTH 3TNSA 4Y11E 4ZH8A 1QBVH 3PMJA 1SGQE 2ANYA 2H2ZA 4HI3A 2OXSA 1TQ7B 3E91A 2FODA 1O5CB 3SGAE 3AW0A 3ITIA 3D49H 5HKKD 3GY5A 1UO6A 1UVPA 3PV2A 5HM9A 1BMMH 1HAPH 1Y5UT 4TSFD 2ZF0H 2OTVA 5JDUB 1FIWA 1HRTH 4Z0KA 1O33A 5C5NA 2QY0B 1W10U 1XMNB 2P59A 5A8XA 1AB9C 4X2YA 1MABB 1YCPM 3KHVA 4ZHAA 3T25A 2Y7XA 2Z9IA 4JCNA 3B8JA 3MO3A 3EA7A 2XCNA 3ZZ9A 4SGAE 1W12U 3Q00A 1HAZB 1NO9H 2H5DA 2O8LA 1K1MA 4WWYA 2FX4A 2KM0A 1IQMA 3NRLA 1A7SA 2Q6FA 3QK1A 3SV8A 3MHWU 3VGCB 1DVAH 4YLUA 2L6OA 1GWAA 1GBAA 3A7VA 2KR7A 3RP2A 5EIYA 1GHWH 4I8JA 1TIOA 2Y6TA 4NA8A 3F9FA 4THNH 1D6WA 3QZRA 4MPUA 1GI3A 1D3TB 3T28A 1O2MA 2HVXA 3K6YA 2BVSH 1B5GH 3M37A 2A1DB 5DJ7A 2QXHA 5EPNA 5HXFA 3E16B 4K1SA 3QDZB 3U69H 3PYHA 1SGNE 5LGOA 3N7DA 1YPJH 1AWFH 1ELTA 4BOHA 4I8HA 4VGCB 1GL1A 2GP9B 4JZ1A 4M9FA 1C2GA 3SU3A 5DP7A 3VXFH 4K5ZA 1DLEA 2HPPH 2CXVA 1HIAB 3SGBE 2F9UA 3VB7A 4AGJA 4TPIZ 2FOHA 1TMUH 1GHVH 1GHAF 3TGKE 1RTLA 3DSPA 1PPZA 4JK5A 1SGEE 3SU2A 5FAHA 1A3BH 1H8ED 1Y8TA 4IC5A 3ZZ4A 2QGRA 3UR9A 2VVVA 3AAVA 2BXUH 1IHSH 2R9PA 3EE7A 3I78A 4BANB 4O97A 2ZQ2A 1NM6A 1UCYH 1ZLRA 3HK6B 8LPRA 2GKVE 1ZSJA 2M2AA 3T27A 4B73A 1EPTC 6LPRA 4CR5A 1LVBA 1P2KA 3ZIAD 3MFJA 3FKSD 5JPMH 4MPXA 1GJCB 3CNRA 1K1IA 1ELBA 2XW9A 1T8MA 1NTPA 5BRRE 1S81A 1ZMJA 3P8GA 3ZZ8A 1AMHA 2J94A 2QAAA 1C5UA 1AFQB 1M9UA 1W2KH 2A7CA 1UK3A 2OC0A 1A61H 1SQTA 2AGEX 4I33A 1CT2E 3URCA 1S0RA 5IYTA 1DY8A 1Z6EA 1YGCH 2ZHFH 2ZCKP 2GZ7A 4TPYA 3TH4H 1GJBB 5C3NA 1H1BA 5C1XA 1ELFA 2B5TB 1TX6A 4TWWA 1C2LA 1BTWA 1EFRD 1PJPA 2H6MA 4DT7B 3BG4C 2OD3B 1ZJDA 4JK6A 2BLVA 2XXLA 1LKBA 2ZHDA 3PLBA 1CSOE 1Q3XA 4MLFB 2FPZA 4Q7YA 3ZZDA 1RS0A 5E2OA 1B0FA 3CS7A 3P8NA 5F53A 2O9QA 1ANCA 3LH3A 1KXBA 2FI4E 1QHRB 3UPEA 4Y8YA 1AU8A 4UE7H 5FCKA 4Q7XA 3TGJE 1XX9A 1HCGA 1QQUA 2HNTC 1J15A 4NSYA 1MCTA 1SI5H 2G5NA 3TITA 4AFZA 1J16A 4Y71A 1C5PA 5I46H 1FAKH 2J98B 2ZA5A 1NFXA 4KKDA 4XE4A 1BA8B 4M7GA 1ZPCA 3A81A 1TONA 3TK5A 1A5GH 4UFFH 1MZAA 2FTMA 4WF8A 1C5NH 1FXYA 1OXGA 1O3AA 5AF9H 1EPTA 1QNJA 2BQ6B 1WDIA 2IPQX 3LC3A 3DHKH 2ALPA 1C5VA 3KNXA 1PPHE 4X1NU 4Q80A 5AVDA 2FOFA 1FY1A 1NRQH 1FY4A 2W6ID 3LGWA 5C2ZA 4AC9A 1O2OA 1ZTJA 1EP6A 1EZXC 3ELAH 3NWUA 3GOVB 3BTEE 1UVSH 4XRNA 1L2EA 3ATLA 1A4WH 3QTVH 2C90B 1KXAA 3F9GA 4GPGA 4Y10E 1TLDA 2WZQA 3AVZA 1DXWA 1GHAG 2BD2A 1ZPZA 2PLXA 2GZ8A 1C1QA 1KLJH 3PROA 3SN8A 1G3BA 1AGJA 2LELA 4AYVB 5BPEA 1G37A 1O3NA 3RU4E 3ATKA 1P2JA 5L30H 5DG6A 2UWPA 2ODQA 1YPGH 4FUDA 2VIOA 1FIZA 1K1OA 1O3CA 2ZGJA 4X2XA 1KLIH 4ZUHA 1HAVB 1EB2A 2STAE 1EOJA 3K65B 1FMGA 3ZZCA 1AI8H 1FY5A 3UOUA 2BY8X 4NIYA 3T5FH 1O2KA 4MG3A 5C20A 1LVYA 1GBFA 3TJNA 1ABJH 2ZTYA 3ZVBA 3RXGA 1V2PT 1AZ8A 4DY7B 3A7TA 1BTYA 5JBTA 1O35A 4ZXXH 1HXFH 2SGPE 3SW2B 1CBWB 3PLKA 4ISHH 4I8KA 4BTIB 4RSPA 1VKYA 2FDAA 1AVGH 5C1UA 2W7SA 3H09A 2AEIH 1TPAE 2HNTF 4CRFA 1EAIA 4Q2KA 4CREA 2CHAB 3F9EA 3KYFA 4WMEA 1FI8A 2PSYA 4B75A 1ZTKA 4FU8A 4NA7A 1TPPA 3RMNH 3ODDA 2WINI 2EEKA 3PV4A 1SPJA 1JRSA 1MU8B 1C5TA 4JYTA 2J9NA 1E1QD 3LJOA 1GBJA 3GYLB 4ZHMU 3EQ0H 1FPCH 4X6OA 5GPIB 4DURA 1LPZB 2OQUA 2ZQ1A 1DT2A 5DP6A 4YXWD 3FOAA 3PB1E 5F8ZA 4WY3A 3S0NA 1W14U 1G36A 1O2LA 4DCDA 2G51A 1ZRBA 3RXUA 4I8GA 1WBGB 1TGTA 1XUIA 2D1JA 1O3JA 4AYYB 1YLDA 5DKMA 2GTBA 4NZLA 1ANBA 4NWKA 1TFXA 1LKAA 1O5AB 4X8SH 3SHAH 1QRZA 4D8NA 2FLRH 1MKWK 1XUKA 3LPRA 1HUTH 3MNXA 4Y7AA 2GMTC 4IGDA 1GJ4H 1V2ST 1EAUA 1DY9A 1GG6B 1C5OH 1SGCA 2ZHQH 2ZGXH 3ESTA 3F3BA 5FL7D 1EJMA 1XKBC 1UVUH 1VGCB 2BQWB 1IQFA 3BTTE 1Z8IB 4OS6A 3ZVFA 1GJ7B 2VGCC 1P9SA 1DOJA 1GI6A 1Q2WA 2H9TH 4A1XA 1BJVA 3S7HB 2BLOA 1HJAB 1UHBB 2V7QD 2ZFQH 2ZU1A 2KAIA 1FONA 4O3TA 4YESB 2VWOA 1BQYA 3MH7A 3E3TA 1IQNA 5SGAE 3RXPA 3A7XA 3SU0A 4CBOA 4X1RU 2AMDA 3SJ9A 1ZMNA 1NN6A 1K1PA 5FPSA 3DD2H 3P95A 4RI0A 2R0KA 2P93A 4AFSA 3C1KA 1C1SA 5C1YA 2Z94A 1LHEH 1T4VH 2GT7A 2OINA 2QE7D 1C2HA 4R0IA 2P3TB 1YWUA 4FU9A 3C27B 1RRKA 1J8AA 2JDID 2CMYA 4NIVA 4OM9A 1BRAA 1V2TT 4I86A 3SBKA 3FO8D 3FAOA 2XBVA 1U6QA 2THFB 4FUIA 1O2PA 1TBQH 1QFKH 1OWHA 1UK4A 2VIPA 5K7RA 1O2NA 2A32A 2V3OH 2HLDD 4TYDA 3MQKC 5JYIA 1ZMLA 1XUFA 1YPHE 3L6PA 4X1QU 3SI3H 1WXRA 3URDA 5GWZA 3KQDA 1P01A 3KQCA 4YT6H 2F83A 2WV4A 3STJA 2GV7A 1LTOA 2UWOA 3JZ1B 3JZ2B 1ZPBA 1O2SA 1Y3VA 2AMQA 1QL7A 2I6QA 2WV5A 2Q1JA 1J17T 3SJOA 5FX5A 4ACBA 1QA7A 1S82A 1SSXA 2RA3A 1QIXB 3GCOA 3U9AH 3LGVA 2PKSB 4CH8B 1A5HA 3QN7A 4DOQA 1T8OA 2J5UA 1H8HD 3PLPA 4GHQA 1IOEA 1FJSA 1W8BH 1MZDA 1Y3XA 3ENSB 1GJ9B 2W7UA 2OC1A 1NBMD 5E0HA 1CGJE 1FUJA 1T31A 5TCAA 3AASA 2QV1A 5B6LA 2LNCA 2ZHEH 3EDXB 3M7QA 1DWCH 4OS5A 2NU4E 3K6ZA 3M3SA 1BB0B 1VITH 5EQSA 5T6DA 2PTNA 4YO9A 3BG8A 2A4OA 4BXSA 3ZVAA 1V3XA 2BX3A 2OQ5A 2PV9B 3MTYA 3OY6U 3BTGE 2A4GA 3Q76A 4BAMB 3A7WA 4B76A 1O3PB 4BXWA 1CA0B 3HKIB 1S5SA 1GGDC 3NK8A 2BOKA 3UTUH 1GDQA 1CVWH 3U8OH 3ZZBA 2NU1E 1QRXA 1OWIA 4B2AA 2UUJB 3SJIA 1AZZA 1MTUA 2VJ1A 1DM4B 3DT0H 3HKJB 1GI8B 1QB6A 3SJKA 2QXGA 2OUAA 4I31A 2Z9GA 4I8LA 1C5ZB 1K21H 1NU7B 5KECA 3GY7A 1V2OT 3UB0A 1YYY1 1THRH 1JIRA 1V2WT 1KYNA 3RXTA 4B71A 5EXNA 1VZQH 3NKKA 1BHXF 3SU6A 4B74A 1D6RA 3OEHD 4DIIH 2VH6A 1L4ZA 2HWLB 2Z6BD 1CT4E 7ESTE 1TX7A 1VITF 1V2VT 2WV9A 3TJVA 1E1RD 3GY3A 1KIGH 1QZ8A 1OX1A 1YCPH 1EJAA 1LO6A 2PP6A 2EQNA 1ELEE 3V13A 2XBXA 2WPLS 3MWIU 3SNDA 1RIWC 1OYQA 3A82A 4YOJA 2YMSC 3N7EA 4O3UA 4DVAU 4MDSA 3GCHB 1SHYA 3RM0H 3KGPA 3RXJA 1TRYA 3EAJA 2QYIA 2A7JA 2XTTB 1D9IA 3T26A 5T1VA 1CGHA 4MNXA 2PWXA 1GI5A 2PKAA 1YBWA 5J4QA 3KQ5A 1O2JA 2PGQB 3VB4A 3VG8A 4X6NA 5LPEA 1D3PB 1F5RA 4ISIH 2J4IA 4XBBA 2VH0A 3FP6E 5AHGH 3FN8A 1NFWA 2WYJA 4CBNA 1BRUP 3RXAA 3A83A 3MNSA 3STIA 3RXHA 4UFDH 1T8NA 5C5OA 5A0CA 3E1XB 1F0TA 1BDAA 2F43B 1H9IE 2IOTA 3U8TH 2Z3EA 4U2WA 1OWDA 3RXCA 1IQGA 1MUEB 1A0HB 3LGYA 1PQAA 3BIUH 4AX9H 4D76A 1LHFH 1W13U 1P2QA 1TOMH 3UREA 2SGAA 1ARBA 3CENA 1SGYE 4XBCA 1GBKA 3ZZ6A 7LPRA 1MU6B 1TOCB 1GVLA 1ELCA 1AVXA 2QXIA 1D3QB 2WHXA 3UOPA 2PTCE 1GBIA 1AE8H 3DCLA 2ZDKA 4Y8ZA 3RM2H 1F0RA 1JIMA 1EPTB 2VIWA 4FUHA 2WPKS 1BTUA 1OWEA 1TABE 3ZVDA 2JETC 2M5TA 4ABEA 1OWKA 2PFEA 5EOKA 4NZQA 1KXEA 6GCHF 4ZMAH 2J2UA 3RXDA 1O2IA 4AB8A 2BZAA 2G81E 2FOBA 2ZU3A 2V6NA 2Q6GA 4ABFA 1N8OC 4AN7A 1BMFD 1SB1H 3Q77A 5DSFA 2G8TA 1ZZZA 3CS0A 3GY8A 2FZZA 4RT0A 3ZVCA 1LHDH 1C5YB 2ZGHA 2B9LA 3MU4A 1ZRKA 4BAHB 1GCTC 2RDEA 5B6OA 4CH2B 3Q3XA 1BMNH 1ID5H 5CHAC 4U01A 1EKBB 1QL8A 2R3YA 3TH3H 3A85A 4Y6DA 1W0YH 5LH8A 1O30A 4NIWA 2ZPQA 2OC8A 5F6MA 3TLOA 1BTHH 1EOLA 1T8LA 3P8OA 1VITG 2ILNA 1D3DB 2P94A 3SQHE 2FOAA 4BTUB 1IQHA 1YPKH 4DG4A 2EY4C 1SLXB 2FYRA 1MCVA 1OSSA 1VCWA 3VB6A 1Y5BT 3GDSA 1AUJA 4CHAB 2B8OH 4R8TB 3M5OA 2Q6DA 3QUMP 7GCHF 1YLCA 2BD8A 3W95A 3WWBA 1MKXK 2BYAX 3LIWA 3F2FA 1AHTH 1PPEE 2J95A 4MPWA 5EPYA 1RGQA 4HFPB 3K9XB 1G32B 1L1GA 3FP8E 2ANWA 1BTZA 1GPZA 2Y7ZA 3MNCA 4GSOA 1ETSH 2BDCA 1AE5A 3DUXH 1SGIB 1UK2A 1W7GH 3IITA 1TNKA 1UTLM 4WMDA 2H1UA 1WU1A 5EJ1A 3A8AA 1ETTH 2CV3A 4NWLA 5A0AE 2EI8A 2IPHA 5FX6A 2A0QB 3QZQA 1O2TA 4FUGA 1O0DH 1GMHF 1Z8GA 1SGPE 3TJOA 4ESTE 1C1NA 2QF0A 1Z7KA 1AO5A 2SFAA 1GJ6A 5E8EH 3RXBA 2QA9E 2CGAA 2WUCA 2ZFFH 3GDVA 5GJ4B 4AFQA 3FVFB 3AW1A 2BMGB 1FX0B 1O2XA 1HNEE 3MYWA 5L2YH 3S9CA 1HV7A 4LK4A 1Z71A 3A80A 1BBRE 3MU5A 2C8XB 2DE8A 5G4BA 5JBCS 1F0SA 2FTLE 1DS2E 5TCCA 1NS3A 1IQLA 2ZFRH 1ELGA 1GI7B 2IN2A 4OGYA 4WVPE 1DPOA 2CN0H 2B0FA 1K1NA 3GICB 4FETA 2H9HA 5HYOA 4ABDA 3PMHB 3RXEA 3SGQE 2FEQH 3LONA 2FS9A 5KGOA 3SZNA 1UTKA 1EATA 1S6HA 1BBRK 5C0UA 1FPHH 2NU3E 3E8LA 6GCHG 1A46H 3L33A 4ZCNA 1HJ9A 1IQEA 2W5EA 3SUGA 2ZZUH 1YPLH 2TIOA 1K28D 4B6EA 5FXLA 2BQ7B 2FLBH 2F91A 2FP7B 3HGNA 4B6FA 4JYVH 1OPHB 2W26A 3QWCH 1FNIA 3IWMA 4ZHLU 1TA2A 1F0UA 1GI4A 1GBBA 3RMOH 2SGQE 1OKXA 2KCPA 1ELVA 3H7OA 5C94A 3M3TA 4WH6A 3ZV8A 1DUAA 2QN5T 5FCRA 3GY4A 2AGIX 1TB6H 1GI0A 2KAIB 1P2MA 1TAWA 4IN1A 4RKOB 1C2EA 1D4PB 1FN6A 2QF4A 3RLWH 4Y8XA 1ESBA 1C2JA 3UQVA 1E37B 4BAKB 1C5WB 3FZZA 6ESTA 1QBNA 2AGGX 4MTBA 1S6LA 3MH6A 5FBEA 1CU1A 1LHCH 7GCHG 4ABBA 3TPIZ 2VWLA 4ZKNU 1C2KA 1HYLA 1O3HA 1GBEA 1P06A 1AVWA 2XRCA 2IJD1 3P17H 4HGCA 3PO1C 5HGGA 3M7TA 2FI5E 1FDPA 4AG1A 1GMDF 1RTKA 1EJNA 1TNLA 1P05A 1A0JA 2SNVA 3NUMA 2VU8E 3BTFE 4NSVA 5A0BA 2AMPA 1BUIA 4Q7ZA 1KTSB 3F2HA 1BTPA 1TQ0B 2WPHS 1C4Y2 3ATWA 1ZHPA 2TBSA 1LPKB 5AFYH 2ZU4A 1P09A 4X2WA 5ESTE 2ZCLP 5F8XA 4FU7A 3SNCA 2Y82A 1TGSZ 2ZC9H 1GMHG 4X1PU 3OFND 4F55A 1MD8A 2AYWA 2GV6A 5GNDA 1YPEH 3ZVGA 2O8MA 3UNRA 3ATMA 2PSXA 2BVRH 2P8OB 1UTOA 4UONA 4YZUA 2QC2A 3F6UH 1EASA 4IC6A 4D9RA 1O2GH 3PMBB 1JBUH 4OS4A 2SGEE 2RDLA 3A87A 1KXDA 3SU1A 4CRDA 4BTTB 1C1OA 2GZ9A 1DANH 3A8BA 1XXFA 2P16A 2VGCB 1THPB 3SNBA 4KGAA 3KEEA 4ASHA 1IAUA 2ZDAH 3RXFA 1UCYE 3KYGA 1PQ7A 3V3MA 4DW2U 1AFEH 2ZWLH 1YPMH 1XUHA 2FOCA 1CHGA 2GD4B 1BT7A 1GL0E 2FXRA 1DWEH 1O2HA 1O3GA 2AERH 3DFJA 4UFGH 4F4OC 2ZPSA 5IDKA 1UCYK 1S0QA 1QY6A 1KSNA 3E6PH 2NWNA 1RXPA 1ACBE 5EQRA 2AIPA 2F4LA 1SL3A 3OU0A 3VB5A 1ZSKA 5HM2A 1TGCA 1K2I1 1PPFE 4CRCA 3SOSA 3HATH 4Y0ZE 1V2RT 4AZ2B 1DICA 3Q3YA 1GHYH 4ABHA 4ZAEA 1O2QA 1SGRE 2G52A 4IBLH 2XOKD 5JBBS 3U98H 1AKSA 4NA9H 3GY6A 4WH8A 5E0GA 1CHOF 4QT8C 1DX5M 3MMGA 2J97A 1QGFA 1C1VH 4E05H 1HBTH 1RJXB 1ELDE 2WYGA 3LU9B 3WWFA 1GBCA 2RA0A 4BAQB 1C5QA 1RFNA 4BAOB 2BDBA 4AFUA 2DE9A 1YLNA 1CQQA 1TE0A 2HPQH 3TU7H 3NCLA 1EZUC 5JB9S 3QO6A 3UWJH 2CJIA 2JJ2D 1J9CH 2A31A 2Z3DA 2OK5A 1QL9A 1GMDG 2TGTA 4A5TS 4IMQA 3NXPA 1GDUA 2JH0D 2C3SA 1FN8A 1TWXB 5DP9A 2PKAB 3SHCH 4DJZB 3UNSA 4Y76A 1AY6H 3KF2A 3RXQA 6CHAC 4NCYA 2YNBA 1UTNA 2YMSD 5CE1A 2FESH 3MH5A 5E2PA 4ABJA 4FUFA 2ANKH 5DP8A 3UAIC 1S83A 2I6SA 2EI6A 3WW7A 1C1TA 3PTNA 1C2DA 1GGDB 1ANEA 3UFAA 3N99A 3M61U 4GAWA 4IW4E 1ZOMA 2HRVA 2PGBB 5EXMA 3ZZ5A 1E34B 1NESE 5C17A 2CHAC 1C5XB 3A89A 2FWWA 4ABGA 3OX7U 3LGUA 4J2YB 1P3EA 1CT0E 2BD7A 2F9PA 1BTXA 5GCHF 2AFQB 4H42U 1DLKB 2YOLA 4KTUA 5EGMA 4AORA 1OP2A 1YC0A 1TGBA 1SR5C 3UY9A 5ESBA 4K60A 2GCHF 3A86A 2HVYB 1S6FA 3RDZA 2ZU5A 1S84A 3TK6A 1SG8B 3BTWE 5EW2H 8GCHF 2A5IA 1NRRH 1ANDA 2BD4A 2XBWA 4GCHF 4YOGA 1XUGA 1O2UA 4NFEA 4UEHH 1N6XA 3WY8A 1RIWB 4ZKOU 1EQ9A 1Y3UA 2R0LA 4FUJA 4WJG2 4I32A 1QQ4A 1GI1A 2XWBI 2ZDLA 1K0HA 1TALA 3SV9A 3ZVEA 3O8CA 4OS2A 1UTMA 4K8YA 2ZDMA 3ATIA 3W94A 5C0TA 2VIDA 1GHZA 1ELAA 1KXFA 4K1EA 1C1PA 2W3KA 2BD9A 1FLEE 3VEQB 2SNWA 1CHOG 1JMOH 1C1WH 2D2DA 2KX4A 1C5MD 1W3CA 1G2LA 3BSQA 4MNWA 2ZDVH 4A7IB 1ZHRA 2A5KA 1PYTD 2GX4A 4LOYH 1RD3B 4GUXA 4AOQA 1OP8A 1QB9A 1W0JD 5L2ZH 1L0ZA 1SKYE 4OS7A 1NROH 3AAUA 2JH5D 4I7YH 1MMJN 2C8WB 1KLTA 1EP5A 4Z1MD 3NPSA 1G9IE 2FS8A 4YOIA 3KCGH 3RMLH 1NFYA 3E0PB 2LP6A 5FPYA 4IS5A 3O8BA 4SGBE 1GI9B 1OHHD 1GJ5H 1P11E 1SQRA 1FV9A 1Z6JH 2GJGA 4KTSA 2ZGCA 3EYDA 3RC4A 4K8BA 2G00A 1P9UA 2XC5A 2GDDA 4E06H 4HTCH 1NFUA 2EI7A 1P57B 9LPRA 1C9PA 2SGDE 2V35A 1HJ8A 5IK2D 2Y80A 2GCTC 1AB9B 3LGIA 1ZYOA 2BY6X 2FOMB 1P0SH 4WXVA 2ZU2A 2Y81A 9ESTA 2JETB 2R2WU 4UDWH 1WUNH 1H8IH 4Q63A 1NU9A 1FQ3A 2QIQA 2SGFE 1LPGB 2Z9KA 3VPKA 1N8OB 4XSKU 1A1RA 3ZYDA 4UFEH 4IMZA 1S85A 1WOFA 4X6MA 1GBLA 1GCDA 1EXFA 1ORFA 1TNJA 1GCTB 1YF4A 2FOGA 3OYPA 1UTJA 5GCHG 1J14A 1MBQA 3UWIA 4ISNA 4K69A 2Y5GA 1VCPA 1KDQA 1O31A 2K1QA 4YM9A 1O5FH 4ISLA 2UUYA 2BY9X 3TH2H 1JXPA 1TNGA 2GCHG 5F8TA 2G4TA 1UMAH 5A8YA 4ZKSU 1E38B 4XDEA 2ZPRA 1B0EA 8GCHG 2Z9LA 1SFIA 3E0NB 4GCHG 1C4V2 2J34A 1PPBH 1HAYB 2BXTH 1C5RA 2V3HH 2Y5HA 2BB4A 3RC5A 3BEIB 1AIXH 4YLQH 3P92A 4INHA 2B7DH 4E7NA 2Z7FE 1O3BA 1MTSA 3HPTB 1YKTA 1YY3A 3FANA 5T6GA 3VXEH 1TNHA 1O37A 3KIDU 2BDYA 2CK3D 3A88A 1V2JT 8ESTE 3MU8A 1T7CA 3BN9A 1VJ9U 4Y79A 1XVMA 1SQAA 3F0OA 1MTNC 2ZIQH 1GI2A 1H9HE 4DIHH 1K1LA 2ALVA 1DSUA 1XVOA 1YP9A 2A7HA 2WPIS 3ZYEA 1QJ7B 2K8IA 1NRPH 2ZECA 2ZDNA 3TGIE 1G2MA 3UUZA 2XWAA 3F68H 1G30B 1LQEA 3MU0A 1UW7A 1BITA 1IQJA 2ESTE 2NU0E 3U28C 3BEUA 3KL6A 2VVCA 1CO7E 1HGTH 1O3FA 1L1NA 3SU4A 3F9HA 1SGFG 2WPMS 3D62A 2GGVB 2EC9H 2D8WA 4AG2A 1XXDA 4ZROA 1PYTC 1GJAB 3LOXA 5J4SA 1N1LA 3RU4T 4O03A 1GBHA 1F92A 3TNTA 2F9NA 1GHXH
chains in the Genus database with same CATH topology
1K9OE 3O8DA 2TPIZ 1C1MA 1SMFE 3IG6B 3A8DA 3T29A 2VB0A 1B7XB 3RXOA 1EUFA 1V2MT 2R2MB 2A45B 1ZJKA 1NRNH 2ZI2H 3B23B 4CRAA 3GCHC 1LHGH 3SUEA 3P6ZB 3BG4B 4OS1A 3SYJA 3TK9A 2ODYB 3SJ8A 2FM2A 3OY5U 3RLYH 1V2QT 1C9TA 1GMCF 2H9EH 3RXVA 2F9BH 2HOBA 1IQKA 1O2YA 4DGJA 4YTAA 2BM2A 4NFFA 5ETXA 1PFXC 4X8UH 5EU8A 1BJUA 1GVKB 1Z8JB 2RG3A 2JIZD 4ABIA 3EA9A 1P2IA 3V7TA 1AWHB 3U1JB 1P04A 1T32A 2QXJA 3QLPH 1NRSH 5DK1A 2A4QA 1MAYA 2QF3A 4H4FA 2KZ4A 1VCQA 4KELA 4B1TA 3VB3A 1UVOA 1ESTA 5DO4H 2BY5X 4D9QA 2BDGA 1BMAA 3LT3A 3UR6A 1C1RA 2JKHA 4INLA 5L6NH 4A1VA 1A0LA 2PHBA 1V2LT 2ZGBH 3RXRA 4XOJA 2BTCE 3H7TA 3M5LA 3ZV9A 1TBRH 1P03A 5GIBA 2XC0A 1L1JA 1SOZA 3LC5A 2ZHWH 5A8ZA 4MQAA 3SUDA 3SV6A 2UUKB 3PO1B 1E79D 1YCPK 1TX8A 4X1SU 4FUEA 3BTKE 4AB9A 3K2UA 3OE7D 1TNIA 3DSOA 2BDAA 2F9OA 3HK3B 4JZDH 3PTBA 3SQEE 3PRDA 1HB0B 2W6JD 2ZFPH 3VGCC 1C5SA 1MBMA 7KMEH 1AKSB 3GCTF 2OP9A 3T62A 3O8RA 2V0BA 2EA3A 1BRCE 1E35B 1ABIH 1V6DA 1BOQA 4E7RG 1HLTH 4XBDA 4IN2A 3I29A 1MKWH 1GHBF 3S7KB 3Q3KA 1C5LH 1P10A 4PROA 1HDTH 3OSYA 2AS9A 2TGPZ 4FVDA 1Z1IA 2F3CE 2FIRH 2BLWA 3BTQE 5E0JA 4CRGA 3S9AA 1O3OA 1O2RA 4O9VA 2ZEBA 4LXBH 2KFWA 3EA8A 2UUFB 3PWCA 4CHAC 1EB1H 2R3UA 1EZSC 4VGCC 5A2MH 3SNAA 3RUOA 4X8VH 5EODA 1N6YA 3CP7A 1W7XH 3QGJA 4GVUA 3R3GB 4JYUH 3F1SB 2OCVB 4ZKRU 1V2KT 2NU2E 1O2VA 1SHHB 4XD7D 1GMCG 1UTPA 1SGTA 3SUFA 4TY6A 1AUTC 1MTVA 2GVFA 1SFQB 4JZFH 1NZQH 2G5VA 3VFEA 5T6FA 1C1UH 1NT1A 1WTHD 5K0HA 1A5IA 1IQIA 2ZO3H 2FMJA 2BY7X 1YPHC 2HALA 1NC6A 5DP5A 3UIRA 4A92A 4NG9H 4DT4A 1PPGE 2K0QA 4X2VA 1JRTA 1G3EA 1TRNA 1MD7A 3A7ZA 4RKJB 2AHME 2BD5A 4K1TA 2FO9A 3P70B 1LDTT 1F2SE 5C67A 2LPRA 3GDUA 4H6SB 4AGKA 1P2OA 3RXIA 1AFQC 4FUCA 2ANMH 2GT8A 3KQEA 1DFPA 2BOHB 1QCPA 1C2IA 1QTFA 2C8YB 4FUBA 1Y3YA 3S9BA 3F2GA 4U32A 1NBME 2GMTB 4B2CA 4J1YA 3S69A 1CGIE 2H5CA 2O8TA 1O2ZA 3SV7A 3KQBA 2VBCA 1JOUB 2WUBA 2OBQA 3NZIA 3GYMA 1ESAA 1C2MA 3GCNA 3MNBA 4WMFA 1DDJA 5CMXH 1WYKA 2Y5FA 3V12A 3M36A 1C4U2 3PRBA 1SLUB 3BF6H 2WPDD 1GBDA 5EQQA 1SVPA 1TPOA 2XC4A 1O32A 5JBAS 6CHAB 5EXLA 1WCZA 4INKA 1HIAA 5FHTA 1OP0A 2VVUA 1XUJA 3GCTG 1UVTH 4WXIA 1ZGIA 4LZ1H 3PV5A 1QB1A 1UJ1A 4MPVA 4KTCA 4A6LA 1QBOA 1THSH 3A7YA 1P2NA 4FXGH 3D65E 5DPAA 1O5GH 3LGTA 2YNAA 3EGKH 5FPTA 4F49A 1GDNA 3SI4H 1GHBG 3FFGA 5A09A 3M5NA 2QF5A 2J38A 1GBTA 1O38A 1QJ6B 3W1EA 1W11U 3SV2H 1LVMA 1HPGA 2ULLA 1BHXB 1QA0A 3G01A 3MOCA 1UTQA 2PR3A 2KCAA 1L4DA 1C2FA 2IJOB 4D7FA 3RXKA 1Z8RA 2W3IA 1AQ7A 2TGAA 5LPFA 5HMAA 4B2BA 1WTGH 3UQOA 1CA8B 3ODFA 5I25A 1HAOH 1ZR0A 1H4WA 2A5AA 3SZEA 2ZTXA 1F7ZA 5DGJA 5TJXA 3RMMH 1DSTA 3D23A 1SOTA 5ABWA 1BCUH 1VR1H 1HAGE 1AD8H 2P95A 3H5CB 2Z3CA 3SO3A 3ZZ3A 1G3DA 1JWTA 3PWBA 1HFDA 4MNVA 4D7GA 3N7OA 4CRBA 1DE7H 1LVOA 2G4UA 3I77A 4ISOA 3U8RH 4GLYA 1T4UH 2OBOA 3M3VA 1O3IA 2BDIA 5GXPA 1YM0A 1LCYA 1KMHB 5FBIA 3GISB 2ZCHP 3QX5H 2CF9H 4X6PA 3AK5A 2A2XH 1SBWA 2P8OC 1ZHMA 1BIOA 1ZTLA 4K2YA 1DXPA 2TGDA 1MQ6A 1Y59T 1KDQB 1F5KU 2AH4X 2ZNKH 1GBMA 1INCA 2UWLA 3F0PA 3RXMA 2QCYA 3LDXH 1WQVH 4Y7BA 2XNDD 2AIQA 3BTDE 5GDSH 1PQ8A 3RXSA 4ZXYH 1GJ8B 3UNQA 2XBYA 3PMAB 1CBWC 1E0FD 1XM1A 3MI4A 2XCFA 2PW8H 3OAAD 3OEED 2OLGA 1Q31A 4A1TA 1SLWB 1WQSA 1Z1JA 4X8TH 1COWD 1O2WA 1DUEA 3MO9A 1OS8A 1GJDB 2HNTE 5T3HA 1H9LB 1W0KD 1Y5AT 3BTHE 1LQDB 3MO6A 1FAXA 1TRMA 2ZG0H 1F5LA 2C8ZB 2J92A 4YT7H 3QTOH 3B9FH 3R0FA 1K1JA 3DFLA 1P3CA 5CHBA 2BX4A 5PTPA 2GCTB 5DP3A 1AN1E 1PPCE 3V0XA 3BIVH 5LPRA 3RXLA 1LMWB 4Q4LA 4U30A 1O3LA 2XNIA 3M5MA 1G3CA 2HGTH 1OWJA 3SNEA 2F9VA 2YMSB 2XYAA 2STBE 1O3DA 1HAVA 3BEFB 1FZZA 2BLQA 2O8UA 1MAXA 2C4FH 1BRBE 4Y0YE 1H8DH 5AFZH 3TIUA 4LZ4B 4BNRA 1WSSH 5F03A 1PQ5A 1DWDH 1GG6C 1MQ5A 1TMBH 2D26C 4X0WU 1CE5A 2BDHA 1HAHH 1NPMA 4ASUD 5DN6D 3RU4D 3LKWA 2WSSD 4MVNA 3A8CA 2VWNA 1QJ1B 4TWYA 4XFQA 1VGCC 2C93B 1SGFA 2ZFSA 1ARCA 1TBZH 4FVBA 3LJJA 4K3JA 3L3TA 1HJAC 1P02A 5CDFE 1EAXA 1NY22 2JH6D 3SU5A 5DP4A 1GVZA 1V2UT 1SQOA 2BD3A 2RCEA 3LH1A 1FY3A 2KCYA 1QR3E 4HZHA 1Y3WA 1O3MA 5EW1H 3GY2A 2ZP0H 2DUCA 2BVXH 1SGDE 2JJ1D 1MH0A 1MKXH 4JMYA 4TT3D 2ASUB 3OTJE 1OYTH 4KP0A 1P8VC 1BMLA 2PUQH 1FY8E 2PUXB 1TYNA 1EZQA 1MTNB 2P3UB 2ZFTA 1DWBH 3ZZAA 1ETRH 1QURH 1HAXB 1ZGVA 4GHTA 4TY7A 2WPJS 1TGNA 2VINA 2TRMA 1RTFB 1V2NT 2O8WA 4JZIA 1OOKB 3GS9A 2GDEH 1O3KA 1QRWA 4H6TA 1P12E 3RC6A 1SC8U 3P8FA 1EX3A 1A3EH 1O5BB 1TA6A 1O39A 1VJAU 3OTPA 3BTME 3KN2A 2FYQA 1TMTH 1A2CH 1O3EA 2VWMA 3HGPA 2VIVA 3ZZ7A 1W0ZU 3SORA 1KXCA 1X7AC 2VIQA 4MNYA 1KY9A 4UD9H 2ZKSA 1O5DH 1K22H 1O34A 1WAYB 2FI3E 5CHAB 2Z9JA 3QGNB 2A2QH 3BV9B 2BZ6H 1O5EH 3DA9B 2CF8H 2FX6A 1EAWA 2PKSC 2OC7A 2ODPA 4NIXA 3EE0B 1O36A 2ZTZA 3TVJB 3M7UA 1SLVB 2P3FH 4Z6AH 1UHBA 4RN6A 8KME2 2VNTA 5EG4A 5H4IB 2FOEA 1ZSLA 4JZEH 1BBRH 4CR9A 1XKAC 1BZXE 3E90B 3FP7E 1HXEH 2A4RA 4NGAH 4ABAA 5JB8S 1WV7H 1E36B 3PM3A 2BHGA 3T2NA 3U1IB 3A84A 1DITH 1KTTB 3MU1A 2G55A 4OGXA 1HAIH 3TJUA 1CA0C 1MTWA 1TPSA 2HLCA 3FZDA 3M35A 3MH4A 2KCOA 1IHTH 3TNSA 4Y11E 4ZH8A 1QBVH 3PMJA 1SGQE 2ANYA 2H2ZA 4HI3A 2OXSA 1TQ7B 3E91A 2FODA 1O5CB 3SGAE 3AW0A 3ITIA 3D49H 5HKKD 3GY5A 1UO6A 1UVPA 3PV2A 5HM9A 1BMMH 1HAPH 1Y5UT 4TSFD 2ZF0H 2OTVA 5JDUB 1FIWA 1HRTH 4Z0KA 1O33A 5C5NA 2QY0B 1W10U 1XMNB 2P59A 5A8XA 1AB9C 4X2YA 1MABB 1YCPM 3KHVA 4ZHAA 3T25A 2Y7XA 2Z9IA 4JCNA 3B8JA 3MO3A 3EA7A 2XCNA 3ZZ9A 4SGAE 1W12U 3Q00A 1HAZB 1NO9H 2H5DA 2O8LA 1K1MA 4WWYA 2FX4A 2KM0A 1IQMA 3NRLA 1A7SA 2Q6FA 3QK1A 3SV8A 3MHWU 3VGCB 1DVAH 4YLUA 2L6OA 1GWAA 1GBAA 3A7VA 2KR7A 3RP2A 1GHWH 4I8JA 1TIOA 2Y6TA 4NA8A 3F9FA 4THNH 1D6WA 3QZRA 4MPUA 1GI3A 1D3TB 3T28A 1O2MA 2HVXA 3K6YA 2BVSH 1B5GH 3M37A 2A1DB 5DJ7A 2QXHA 5EPNA 5HXFA 3E16B 4K1SA 3QDZB 3U69H 3PYHA 1SGNE 5LGOA 3N7DA 1YPJH 1AWFH 1ELTA 4BOHA 4I8HA 4VGCB 1GL1A 2GP9B 4JZ1A 4M9FA 1C2GA 3SU3A 5DP7A 3VXFH 4K5ZA 1DLEA 2HPPH 2CXVA 1HIAB 3SGBE 2F9UA 3VB7A 4AGJA 4TPIZ 2FOHA 1TMUH 1GHVH 1GHAF 3TGKE 1RTLA 3DSPA 1PPZA 4JK5A 1SGEE 3SU2A 5FAHA 1A3BH 1H8ED 1Y8TA 4IC5A 3ZZ4A 2QGRA 3UR9A 2VVVA 3AAVA 2BXUH 1IHSH 2R9PA 3I78A 4BANB 4O97A 2ZQ2A 1NM6A 1UCYH 1ZLRA 3HK6B 8LPRA 2GKVE 1ZSJA 2M2AA 3T27A 4B73A 1EPTC 6LPRA 4CR5A 1LVBA 1P2KA 3ZIAD 3MFJA 5JPMH 3FKSD 4MPXA 1GJCB 1K1IA 1ELBA 2XW9A 1T8MA 1NTPA 5BRRE 1S81A 1ZMJA 3P8GA 3ZZ8A 1AMHA 2J94A 2QAAA 1C5UA 1AFQB 1M9UA 1W2KH 2A7CA 1UK3A 2OC0A 1A61H 1SQTA 2AGEX 4I33A 1CT2E 3URCA 1S0RA 5IYTA 1DY8A 1Z6EA 1YGCH 2ZHFH 2ZCKP 2GZ7A 4TPYA 3TH4H 1GJBB 5C3NA 1H1BA 5C1XA 1ELFA 2B5TB 1TX6A 4TWWA 1C2LA 1BTWA 1PJPA 1EFRD 2H6MA 4DT7B 3BG4C 2OD3B 1ZJDA 4JK6A 2BLVA 2XXLA 1LKBA 2ZHDA 3PLBA 1CSOE 1Q3XA 4MLFB 2FPZA 4Q7YA 3ZZDA 1RS0A 5E2OA 1B0FA 3CS7A 3P8NA 5F53A 2O9QA 1ANCA 3LH3A 1KXBA 2FI4E 1QHRB 3UPEA 4Y8YA 1AU8A 4UE7H 5FCKA 4Q7XA 3TGJE 1XX9A 1HCGA 1QQUA 2HNTC 1J15A 4NSYA 1MCTA 1SI5H 2G5NA 3TITA 4AFZA 1J16A 4Y71A 1C5PA 5I46H 1FAKH 2ZA5A 1NFXA 4KKDA 4XE4A 1BA8B 4M7GA 1ZPCA 3A81A 1TONA 3TK5A 1A5GH 4UFFH 1MZAA 2FTMA 4WF8A 1C5NH 1FXYA 1OXGA 1O3AA 5AF9H 1EPTA 1QNJA 2BQ6B 3LC3A 3DHKH 2ALPA 1C5VA 3KNXA 1PPHE 4X1NU 4Q80A 5AVDA 2FOFA 1FY1A 1NRQH 1FY4A 3LGWA 5C2ZA 2W6ID 1O2OA 1ZTJA 1EP6A 1EZXC 3ELAH 3NWUA 3GOVB 3BTEE 1UVSH 1L2EA 3ATLA 1A4WH 3QTVH 2C90B 1KXAA 3F9GA 4GPGA 4Y10E 1TLDA 2WZQA 3AVZA 1DXWA 1GHAG 2BD2A 1ZPZA 2PLXA 2GZ8A 1C1QA 1KLJH 3PROA 3SN8A 1G3BA 1AGJA 2LELA 4AYVB 5BPEA 1G37A 1O3NA 3RU4E 3ATKA 1P2JA 5L30H 5DG6A 2UWPA 2ODQA 1YPGH 4FUDA 2VIOA 1FIZA 1K1OA 1O3CA 2ZGJA 4X2XA 1KLIH 4ZUHA 1HAVB 1EB2A 2STAE 1EOJA 3K65B 1FMGA 3ZZCA 1AI8H 1FY5A 3UOUA 2BY8X 4NIYA 3T5FH 1O2KA 4MG3A 5C20A 1LVYA 1GBFA 3TJNA 1ABJH 2ZTYA 3ZVBA 3RXGA 1V2PT 1AZ8A 4DY7B 3A7TA 1BTYA 5JBTA 1O35A 4ZXXH 1HXFH 2SGPE 3SW2B 1CBWB 3PLKA 4ISHH 4I8KA 4BTIB 4RSPA 2FDAA 1AVGH 5C1UA 2W7SA 3H09A 2AEIH 1TPAE 2HNTF 4CRFA 1EAIA 4Q2KA 4CREA 2CHAB 3F9EA 4WMEA 1FI8A 2PSYA 4B75A 1ZTKA 4FU8A 4NA7A 1TPPA 3RMNH 3ODDA 2WINI 2EEKA 3PV4A 1SPJA 1JRSA 1MU8B 1C5TA 4JYTA 2J9NA