1RTQA

The 0.95 angstrom resolution crystal structure of the aminopeptidase from aeromonas proteolytica
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title The high-resolution structures of the neutral and the low pH crystals of aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 101
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1rtqA00
3LWUA 4ZX9A 4Z65A 2Q4ZA 3I1UA 2QJ8A 1XFOA 5LRGA 4UF4A 4NJRA 3VATA 2WYRA 1AYEA 4MMOA 2ZELA 4MHYA 3VARA 1H8LA 2C6CA 5J1QA 4UEZA 3TC8A 2ZEOA 3NH5A 4OC3A 1ARLA 2PIZA 4TWEA 2XEGA 3FF3A 1IY7A 1Z2LA 1YLOA 1CBXA 1TKFA 4ZI6A 5JH9A 4F8ZA 2RFHA 4OC5A 4O23A 2BO9A 1ARMA 2WZNA 2PJ6A 3B7IA 4MCPA 3QNVA 1F2OA 3KHZA 4P6YA 4H2KA 2F8HA 2JBKA 4ZY2A 3VH9A 2PJ0A 3BI1A 2AFOA 4AXVA 4IAVA 3SJXA 2PVVA 4OC4A 3S9MA 1PYTB 3N5FA 4K3NA 1Z5RA 5D8NA 1YW6A 3D68A 2XEIA 4OC0A 1VIXA 4EFDA 1ZG7A 1TKHA 1XJOA 4P4EA 4B6ZA 2GREA 2ZEHA 3ISZA 3PB4X 2O53A 4WJBA 3T8WA 3RZAA 4Q7AA 4A38A 2PJ8A 3B3CA 5F09A 1R43A 2ZENA 3D7FA 4PXCA 1F2PA 2POKA 4OC1A 5ELYA 1HEEA 4MHNA 2DEAA 2BOAA 4ONWA 2PJ9A 2XEJA 3B3WA 4KSIA 4YU9A 4NGTA 4P44A 2ZEDA 3B3VA 3KASA 1QQ9A 3WC7A 3FECA 2V77A 2V8DA 4JYWA 4F9VA 2G9DA 5LYDA 2AFSA 2PVWA 2PJ7A 3FVLA 4MRIA 3RBUA 8CPAA 1XBUA 2PJ5A 2Q43A 4FUUA 3D66A 3NH4A 3PB7X 4MCRA 1M4LA 1F57A 1UWYA 1CP6A 1VHEA 4DUKA 2JEWA 3PB6X 4OIWA 2OR4A 1BAVA 3JRUA 5LRJA 3PB9X 4A37A 1LAPA 3CT9A 4CPAA 1Z8LA 3RAMA 1XMBA 4IHMA 2C6GA 4OKOA 2BCOA 2PJAA 3FEDA 3CDXA 3IIBA 3PBEA 1LAMA 6CPAA 5I4MA 2EK8A 3WT4A 2I3CA 5CBMA 4MXUA 4X2TA 1BLLE 4P4FA 4GM5A 2NSMA 4UEEA 3H8GA 4NGSA 4DJLA 3PBBA 4MHZA 3PFOA 3IEHA 1TKJA 2AFZA 4R7MA 1IGBA 2CF4A 1CPXA 4ZX8A 3TX8A 1BPNA 1VGYA 4PXEA 4ZYQA 1CG2A 3D7HA 1TF9A 2CTCA 4DYOA 4FBEA 4NFRA 3K2KA 3KHXA 1FT7A 5LYLA 1YMEA 4PXDA 2IMOA 3DLJA 3SJGA 1LANA 3V7ZA 4YWYA 3KZWA 1Q7LA 4OMEA 3SI1A 3HUVA 4PPZA 2AFWA 3K9TA 1ZG8A 3D7GA 4R76A 2XEFA 1Y0RA 2GLFA 2PJ3A 1LCPA 1OBRA 5LRKA 3PRTA 5K8PA 3BHXA 1CX8A 1DTDA 3H8EA 3WC5A 3FH4A 3KQZA 3B35A 3KR4A 5JGFA 3GB0A 2JBJA 1JQGA 1CPSA 1LOKA 3GLJA 2GLJA 4W9YA 5DS0A 4P10A 3KL9A 2V8GA 4P4JA 1XRYA 2PJ1A 2HB6A 5HVHA 1TXRA 4RUHA 4ZY0A 3FX6A 2PIYA 4A39A 2EK9A 5D29A 4MHPA 2O4HA 1TF8A 4NGPA 1RTQA 3IC1A 3D7DA 3KR5A 2NYQA 2VL1A 4P4DA 2PE3A 4NGMA 3B3SA 2AFXA 2ZEFA 3B2YA 3HLPA 3S9NA 3GUXA 2V8HA 4TNUA 1CP7A 2V8VA 3BI0A 3IJ3A 3WABA 2ZEPA 4UIBA 3SJFA 4UIAA 5K8NA 5IB9A 4G1PA 3KI9A 3FMCA 2PRQA 2ABZA 1KWMA 2IQ6A 4MCQA 4X3RA 1PCAA 2FVGA 2PJ4A 1ELLP 4R6TA 3NFZA 1ZG9A 3H8FA 5K8OA 3D4UA 2IJZA 3PB8X 4A94A 3S9LA 4ZY1A 4NGRA 3B3TA 3D67A 3IFEA 1AMPA 1ELMP 3KGQA 3IO1A 4EMEA 4EWTA 1HDQA 3FJUA 2F7VA 4PXBA 3PEIA 1YSJA 3LMSA 5HXDA 2AFUA 2RB7A 4MCSA 3L2NA 1BPMA 2ZOGA 4NJQA 4IK2A 2ANPA 2PJ2A 5JM6A 1HDUA 3MN8A 3MRUA 2ZEMA 1LFWA 3V38A 3DGVA 2QYVA 4OIDA 1FNOA 5LYIA 3WC6A 4BD9A 4X8IA 3BXMA 4UEFA 5HVGA 3SI0A 4JZ0A 3FEEA 3NA6A 2CIJA 4WWVA 3ISXA 2C1CA 5LYFA 2PJBA 1NSAA 3NH8A 4P45A 2PJCA 1ZLHA 4OP4A 3IWWA 4OC2A 2HC9A 1EE3P 2AFMA 1GYTA 2C6PA 4F9UA 4FWUA 2ZEGA 1R3NA 2OOTA 3SI2A 5K8MA 2J9AA 2ZEEA 4NGNA 7CPAA 1YW4A 1VHOA 1ZLIA 2EWBA 1QMUA 3PFEA 4P4BA 5CPAA 2ZOFA 4LQGA 2QVPA 3CPAA 2GU2A 4NGQA 3SJEA 4P4IA 4PQAA 1DE4C 2Q51A 4R8FA 4FAIA 1Y7EA 2CTBA 5HVFA 5THWA 3CPXA 1Y0YA 3KQXA 2PCUA
chains in the Genus database with same CATH superfamily
1S60A 4MI4A 4XNHC 4K30A 3TO7A 3LWUA 4ZX9A 5AGEA 4Z65A 4RS2A 2ODFA 1KUYA 2Q4ZA 1NMTA 3I1UA 2QJ8A 1X10A 1XF8A 1XFOA 2ZW5A 4UF4A 5LRGA 2QECA 4QB9A 4NJRA 3VATA 2WYRA 4QC6A 4AVAA 2VBQA 2K5TA 1AYEA 3A9LA 4KLVA 5E96A 2R98A 3I3GA 2B4DA 2QMLA 2ZELA 4MHYA 4MMOA 3VARA 3EC4A 1H8LA 2C6CA 1S3ZA 2OZUA 3LACA 4UBRA 5J1QA 5H84A 4R57A 4C2ZA 4UEZA 3TC8A 2ZEOA 3NH5A 1BO4A 3JUWA 4OC3A 3FXTA 1ARLA 3W6XA 2P6FA 2PIZA 2IL4A 5G1ZA 4KS9A 1QSRA 2B3UA 4MHDA 4TWEA 4XPKA 2XEGA 3FF3A 3LD2A 1KUVA 4QBJA 2OZGA 2JDDA 4YRHA 5A28A 3FB3A 3EXNA 2F5IA 1IOIA 1IY7A 4HNYB 1Z2LA 1YLOA 4IUSA 3TCVA 1CBXA 1TKFA 4YGOA 4IF5A 4ZI6A 2X7BA 5JH9A 4F8ZA 3FIXA 4F6AA 2RFHA 4OC5A 4KOUA 1S5KA 4O23A 2BO9A 1ARMA 2WPWA 2WZNA 4B10A 3QAYA 2PJ6A 3B7IA 5AG4A 4KOTA 3QNVA 4MCPA 1F2OA 3KHZA 4OLLA 3BLNA 4P6YA 1XMTA 4QVTA 3VWEA 4H2KA 2F8HA 4XPDB 2JBKA 4FD4A 4PK3A 2REFA 4CAWA 4ZY2A 3VH9A 1MJ9A 2PJ0A 2YNEA 4B11A 4BBHA 4UWIA 3H4QA 3BI1A 2AFOA 4AXVA 4C7HA 3R9EA 3D8PA 4IAVA 3SJXA 2PVVA 3IU2A 4OC4A 3S9MA 1PYTB 4MFJA 3N5FA 2DXQA 3PGPA 2VZYA 4K3NA 4CAXA 1Z5RA 5D8NA 4AVBA 4Y49C 5HMNA 3EO4A 3GIUA 4MFPA 1YW6A 1KZFA 3D68A 2XEIA 4KOSA 4OC0A 1VIXA 4OADA 2Z11A 5F46A 5EC4A 4EFDA 3P2HA 1ZG7A 2Y0MA 2BUEA 1TKHA 1XJOA 4P4EA 1Z4RA 4B6ZA 2GREA 2ZEHA 1IICA 1WK4A 3ISZA 3PB4X 5G21A 2O53A 4WJBA 3T8WA 2BSWA 4CAFA 2VZZA 3RZAA 4KOVA 4Q7AA 4A38A 5EMIA 2PJ8A 3B3CA 4C7IA 2ZXVA 2ZPAA 3TO9A 4JXRA 1SQHA 5F09A 4CYNA 2C27A 3D2PA 4ZBGA 1QSTA 2FS5A 4MFKA 4R9MA 4UFVA 1R43A 2PC1A 4L89A 4UA3A 1UFHA 2ZENA 3D7FA 4PXCA 2J8MA 1F2PA 2POKA 4OC1A 5ELYA 1HEEA 4MHNA 5DWNA 2DEAA 2BOAA 3KKWA 4ONWA 2PR1A 4UFWA 2PJ9A 2XEJA 3B3WA 4KSIA 4C2YA 2DF5A 4YU9A 3VWDA 2CNMA 1RXTA 1TIQA 1CM0A 4KOWA 4NGTA 3C26A 4P44A 3ZJ0A 4U9ZA 1I12A 2ZEDA 3DR8A 3FNCA 3B3VA 5FVJA 1MK4A 2VXKA 3CXPA 3W91A 3KASA 5KTDA 4AG9A 1QQ9A 2Q4VA 4KOYA 3WC7A 3FECA 2EBJA 2V77A 2V8DA 1NE9A 3TTHA 2RC4A 3F5BA 4JYWA 2OU2A 4F9VA 5C82A 2G9DA 2ZW7A 5LYDA 2AFSA 2PVWA 2PJ7A 4CYQA 3FVLA 2FXFA 3S6HA 4MRIA 3RBUA 2OZHA 8CPAA 1XBUA 4B14A 1AUGA 2PJ5A 2Q43A 3FYNA 4FUUA 3D66A 4I49A 3NH4A 3EY5A 3PB7X 2PR8A 2YNCC 4MCRA 1M4LA 1F57A 1UWYA 1CP6A 3FBUA 1VHEA 3CXSA 1YGHA 4DUKA 3K9UA 2WPXA 5JQ4A 4CGLA 2NMTA 4KSFA 2JEWA 2CXAA 1GHEA 2PDOA 3PB6X 4M6HA 4OIWA 4MFZA 2OR4A 1BAVA 4KVME 1Q2DA 3JRUA 4JJXA 4BINA 5J8CA 5LRJA 3PB9X 4JD6A 3GY9A 4A37A 2EUIA 5EBVA 4HPSA 4U5YA 4X5KA 2B4DB 4Q36A 3F8KA 1LAPA 3TE4A 2B4BA 3CT9A 1WWZA 4CPAA 2Q7BA 2Z3PA 2P0WA 4MFQA 1Z8LA 2G0BA 3RAMA 1XMBA 3DDDA 4IHMA 1YVKA 4MFLA 4CGPA 2C6GA 4OKOA 2BCOA 2PJAA 3FEDA 2JLMA 2ZW4A 3CDXA 3IIBA 3PBEA 1I1DA 3RNZA 1LAMA 1S7FA 6CPAA 2G3TA 5I4MA 4UFXA 2EK8A 3WT4A 3TOAA 2I3CA 5CBMA 4KOXA 4EVYA 4MXUA 4MJ8A 3DR6A 4X2TA 2CY2A 2KCWA 1BLLE 4P4FA 1LRZA 3CXQA 1M1DA 4HNWB 4M6GA 4B13A 1RO5A 4GM5A 2NSMA 4UEEA 2B5GA 3H8GA 4H6UA 4NGSA 1YQEA 3RO0A 1S7NA 4DJLA 2D4OA 4CS0B 3PBBA 3S6FA 4MHZA 3PFOA 4A2ZA 4GXHA 3IEHA 4RN7A 4QUSA 1OZPA 1TKJA 2AFZA 1YK3A 4DNCA 4R7MA 4KSAA 1IGBA 1M4DA 2CF4A 2GFQA 1QSOA 1CPXA 3MGDA 4ZX8A 3TX8A 1BPNA 1JWQA 2BEIA 4NXYA 1VGYA 4PXEA 5ISVA 3BJ8A 4ZYQA 4MBUA 4LX9A 4CGOA 1CG2A 3D7HA 3JVNA 4F0XA 1A2ZA 3GYAA 2DPSA 1TF9A 3IWGA 2CTCA 4KUAA 3NE7A 4NF1A 4DYOA 4FBEA 4B5PA 4NFRA 3K2KA 2Q04A 3KHXA 1FT7A 5LYLA 1YMEA 4PXDA 2IMOA 3DLJA 4ORFA 1Y9WA 1KUXA 3SJGA 1LANA 5IV0A 5H86A 3V7ZA 1XEBA 3KZWA 4YWYA 1Q7LA 4B5PB 4OMEA 4XNHB 4A32A 3SI1A 3E0KA 3HUVA 1M4GA 4PPZA 2AFWA 5G20A 1Z8XA 3K9TA 1ZG8A 2WUUA 3D7GA 2YGWA 3R1KA 2XEFA 2P6GA 4R76A 1Y0RA 2GLFA 2PJ3A 4AG7A 4F0YA 1LCPA 3TT2A 1OBRA 3TOBA 5LRKA 3PRTA 5K8PA 1B87A 1XE4A 1IU8A 3G8WA 5AG5A 3BHXA 4C68A 4LQ6A 1CX8A 2Q44A 2J8NA 5BWAB 4XPLA 1DTDA 3H8EA 3WC5A 4XPDC 3FH4A 3EFAA 3KQZA 3B35A 3KR4A 3SXOA 5JGFA 3GB0A 2JBJA 1JQGA 1YREA 1CPSA 1LOKA 4MY0A 1NSLA 3GLJA 2GLJA 4W9YA 1YLEA 5DS0A 4P10A 2P6EA 3KL9A 4R87A 3RYOA 4UWJA 2V8GA 2VEZA 2VI7A 4P4JA 1XRYA 2HUZA 2CNSA 1YR0A 2PJ1A 3OWCA 2HB6A 2OB0A 5HVHA 1TXRA 2Z0ZA 2Z3NA 4UCPA 4RUHA 2Q7SA 2R1IA 3FX6A 5CNPA 2PIYA 4ZY0A 1U6MA 2REEA 4A39A 2Z3LA 4CAVA 2EK9A 5D29A 4MHPA 3I9SA 4OAEA 4M6IA 2O4HA 1TF8A 2D4PA 3PZJA 3R9FA 3D3SA 1XOVA 1RTQA 4NGPA 3IC1A 4LUAA 1J4JA 4E0AA 3D7DA 3DSBA 3KR5A 2NYQA 2FSRA 2FCKA 2Z3KA 2VL1A 4P4DA 2PE3A 1K4JA 4NGMA 5IB0A 4C2XA 2ARHA 3B3SA 3LODA 2AFXA 2GIVA 2ZEFA 3B2YA 3HLPA 3S9NA 2AE6A 3GUXA 2V8HA 1I21A 4TNUA 1CP7A 2V8VA 3BI0A 3IJ3A 3V8IA 4CRZB 2DPTA 1P0HA 1MJAA 3WABA 4KVOE 2VQYA 2ZEPA 4UIBA 3SJFA 4UIAA 5I0CA 5KTCA 5K8NA 1Q2YA 3PP9A 2I79A 4G1PA 5IB9A 5J8FA 1S7KA 2OH1A 1BOBA 2B3VA 2J8RA 3KI9A 3FMCA 1R57A 1VKCA 2PRQA 4NEXA 4Y49B 2ABZA 2ATRA 1KWMA 2IQ6A 4MCQA 4X3RA 2ZW6A 5F47A 2PQ8A 3T90A 2FT0A 4ZGYB 1PCAA 2FVGA 5JPHA 1P4NA 2PJ4A 1ELLP 4GS4A 4R6TA 2R8VA 1ZG9A 3NFZA 3H8FA 5K8OA 4B12A 4L8AA 4ONUA 3D4UA 2I00A 3W6SA 3TFYA 2IJZA 4A30A 3PB8X 4A94A 3H5ZA 1ON0A 4HKFA 3S9LA 1B6BA 4HNXB 2EVNA 1V0CA 4UCMA 4ZY1A 1Z8TA 4NGRA 3B3TA 5C88A 2FE7A 3D67A 3IFEA 2FIWA 4II9A 1AMPA 1ELMP 3KGQA 1PU9A 3IO1A 1CJWA 1PUAA 1HDQA 3FJUA 3S6GA 3WR7A 4EMEA 4EWTA 3IWEA 2F7VA 4PXBA 1IYLA 4KVXA 1X12A 1YSJA 2GANA 3PEIA 4AB7A 4FD7A 3LMSA 1YVOA 5HXDA 4YFJA 2AFUA 4PK2A 2RB7A 2B5GB 3CZXA 4MCSA 3L2NA 4FD5A 4UCNA 2YNDA 1BPMA 1IIDA 2ZOGA 4NJQA 4J3GA 1MJBA 3F0AA 4IK2A 2QIRA 1ZO0A 2ANPA 2PJ2A 2Z10A 4R3KA 4CRYB 5JM6A 1HDUA 4A95A 3MN8A 3G3SA 3IU1A 3MRUA 5F49A 2ZEMA 2O28A 1LFWA 4PSXA 3V38A 2Q0YA 3DGVA 4FD6A 4Q38A 2QYVA 4OIDA 1FNOA 1Y9KA 5LYIA 3WC6A 2JDCA 3DNSA 4BD9A 1M44A 4X8IA 4JLYA 4JXQA 1Q2CA 3BXMA 4UEFA 4CGNA 3SXNA 2YNCA 3SHPA 5HVGA 3SI0A 4A33A 3R9GA 1QSNA 4BMHA 4JZ0A 2A4NA 3FEEA 4B5OA 3UY5A 3NA6A 4CGMA 2CIJA 4A31A 4WWVA 3ISXA 2C1CA 2B58A 5LYFA 4PSWA 3D2MA 2PJBA 3B8GA 1NSAA 3NH8A 4NSQA 4P45A 4U9YA 5IX3A 1Z8WA 5KTAA 4H89A 2PJCA 1QSMA 1ZLHA 2BL1A 2JEVA 4OP4A 3IWWA 2FIAA 4RI1A 1M4IA 4OC2A 2HC9A 3IGRA 5HH1A 1EE3P 3T9YA 2AFMA 1GYTA 1VHSA 2C6PA 5F48A 5GCNA 4FWUA 4F9UA 2R7HA 4R3LA 1IYKA 2ZEGA 1R3NA 3P2FA 2OOTA 1IB1E 3SI2A 2CNTA 2EO8A 2AJ6A 2J9AA 2HQYA 2PRBA 2ZEEA 4KORA 5AG7A 3ZZIA 4NCZA 4NGNA 3R95A 4CAEA 7CPAA 5A27A 2H5MA 2Q4YA 1YX0A 3QAHA 4M3SA 1FY7A 1YW4A 4CYPA 1VHOA 1ZLIA 3S6KA 5K8MA 2EWBA 1L0CA 3BJ7A 4E8OA 1QMUA 2GE3A 2Z3OA 3PFEA 4P4BA 5CPAA 2ZOFA 4E2AA 4H6ZA 3JTKA 5AG6A 4LQGA 1N71A 2QVPA 3CPAA 4AVCA 1S7LA 2GU2A 3FRMA 4JWPA 4NGQA 3SJEA 2PCUA 4P4IA 3NE8A 4PQAA 1DE4C 4M85A 3QB8A 3GKRA 4KUBA 2Q51A 2Z3MA 2G3AA 4R8FA 3R96A 4CYOA 2FL4A 4KLWA 4FAIA 3N7ZA 2HV2A 5DWMA 1Y7EA 4MY3A 2CTBA 5G22A 5HVFA 3TO6A 1IOFA 1Z4EA 2PSWA 2WSAA 1Z9UA 5THWA 3CPXA 4KZTA 4PV6A 1Y0YA 3KQXA 1XIXA 1Y7RA
chains in the Genus database with same CATH topology
3LWUA 4ZX9A 4Z65A 2Q4ZA 3I1UA 2QJ8A 1XFOA 5LRGA 4UF4A 4NJRA 3VATA 2WYRA 1AYEA 4MMOA 2ZELA 4MHYA 3VARA 1H8LA 2C6CA 5J1QA 4UEZA 3TC8A 2ZEOA 3NH5A 4OC3A 1ARLA 2PIZA 4TWEA 2XEGA 3FF3A 1IY7A 1Z2LA 1YLOA 1CBXA 1TKFA 4ZI6A 5JH9A 4F8ZA 2RFHA 4OC5A 4O23A 2BO9A 1ARMA 2WZNA 2PJ6A 3B7IA 4MCPA 3QNVA 1F2OA 3KHZA 4P6YA 4H2KA 2F8HA 2JBKA 4ZY2A 3VH9A 2PJ0A 3BI1A 2AFOA 4AXVA 4IAVA 3SJXA 2PVVA 4OC4A 3S9MA 1PYTB 3N5FA 4K3NA 1Z5RA 5D8NA 1YW6A 3D68A 2XEIA 4OC0A 1VIXA 4EFDA 1ZG7A 1TKHA 1XJOA 4P4EA 4B6ZA 2GREA 2ZEHA 3ISZA 3PB4X 2O53A 4WJBA 3T8WA 3RZAA 4Q7AA 4A38A 2PJ8A 3B3CA 5F09A 1R43A 2ZENA 3D7FA 4PXCA 1F2PA 2POKA 4OC1A 5ELYA 1HEEA 4MHNA 2DEAA 2BOAA 4ONWA 2PJ9A 2XEJA 3B3WA 4KSIA 4YU9A 4NGTA 4P44A 2ZEDA 3B3VA 3KASA 1QQ9A 3WC7A 3FECA 2V77A 2V8DA 4JYWA 4F9VA 2G9DA 5LYDA 2AFSA 2PVWA 2PJ7A 3FVLA 4MRIA 3RBUA 8CPAA 1XBUA 2PJ5A 2Q43A 4FUUA 3D66A 3NH4A 3PB7X 4MCRA 1M4LA 1F57A 1UWYA 1CP6A 1VHEA 4DUKA 2JEWA 3PB6X 4OIWA 2OR4A 1BAVA 3JRUA 5LRJA 3PB9X 4A37A 1LAPA 3CT9A 4CPAA 1Z8LA 3RAMA 1XMBA 4IHMA 2C6GA 4OKOA 2BCOA 2PJAA 3FEDA 3CDXA 3IIBA 3PBEA 1LAMA 6CPAA 5I4MA 2EK8A 3WT4A 2I3CA 5CBMA 4MXUA 4X2TA 1BLLE 4P4FA 4GM5A 2NSMA 4UEEA 3H8GA 4NGSA 4DJLA 3PBBA 4MHZA 3PFOA 3IEHA 1TKJA 2AFZA 4R7MA 1IGBA 2CF4A 1CPXA 4ZX8A 3TX8A 1BPNA 1VGYA 4PXEA 4ZYQA 1CG2A 3D7HA 1TF9A 2CTCA 4DYOA 4FBEA 4NFRA 3K2KA 3KHXA 1FT7A 5LYLA 1YMEA 4PXDA 2IMOA 3DLJA 3SJGA 1LANA 3V7ZA 4YWYA 3KZWA 1Q7LA 4OMEA 3SI1A 3HUVA 4PPZA 2AFWA 3K9TA 1ZG8A 3D7GA 4R76A 2XEFA 1Y0RA 2GLFA 2PJ3A 1LCPA 1OBRA 5LRKA 3PRTA 5K8PA 3BHXA 1CX8A 1DTDA 3H8EA 3WC5A 3FH4A 3KQZA 3B35A 3KR4A 5JGFA 3GB0A 2JBJA 1JQGA 1CPSA 1LOKA 3GLJA 2GLJA 4W9YA 5DS0A 4P10A 3KL9A 2V8GA 4P4JA 1XRYA 2PJ1A 2HB6A 5HVHA 1TXRA 4RUHA 4ZY0A 3FX6A 2PIYA 4A39A 2EK9A 5D29A 4MHPA 2O4HA 1TF8A 4NGPA 1RTQA 3IC1A 3D7DA 3KR5A 2NYQA 2VL1A 4P4DA 2PE3A 4NGMA 3B3SA 2AFXA 2ZEFA 3B2YA 3HLPA 3S9NA 3GUXA 2V8HA 4TNUA 1CP7A 2V8VA 3BI0A 3IJ3A 3WABA 2ZEPA 4UIBA 3SJFA 4UIAA 5K8NA 5IB9A 4G1PA 3KI9A 3FMCA 2PRQA 2ABZA 1KWMA 2IQ6A 4MCQA 4X3RA 1PCAA 2FVGA 2PJ4A 1ELLP 4R6TA 3NFZA 1ZG9A 3H8FA 5K8OA 3D4UA 2IJZA 3PB8X 4A94A 3S9LA 4ZY1A 4NGRA 3B3TA 3D67A 3IFEA 1AMPA 1ELMP 3KGQA 3IO1A 4EMEA 4EWTA 1HDQA 3FJUA 2F7VA 4PXBA 3PEIA 1YSJA 3LMSA 5HXDA 2AFUA 2RB7A 4MCSA 3L2NA 1BPMA 2ZOGA 4NJQA 4IK2A 2ANPA 2PJ2A 5JM6A 1HDUA 3MN8A 3MRUA 2ZEMA 1LFWA 3V38A 3DGVA 2QYVA 4OIDA 1FNOA 5LYIA 3WC6A 4BD9A 4X8IA 3BXMA 4UEFA 5HVGA 3SI0A 4JZ0A 3FEEA 3NA6A 2CIJA 4WWVA 3ISXA 2C1CA 5LYFA 2PJBA 1NSAA 3NH8A 4P45A 2PJCA 1ZLHA 4OP4A 3IWWA 4OC2A 2HC9A 1EE3P 2AFMA 1GYTA 2C6PA 4F9UA 4FWUA 2ZEGA 1R3NA 2OOTA 3SI2A 5K8MA 2J9AA 2ZEEA 4NGNA 7CPAA 1YW4A 1VHOA 1ZLIA 2EWBA 1QMUA 3PFEA 4P4BA 5CPAA 2ZOFA 4LQGA 2QVPA 3CPAA 2GU2A 4NGQA 3SJEA 4P4IA 4PQAA 1DE4C 2Q51A 4R8FA 4FAIA 1Y7EA 2CTBA 5HVFA 5THWA 3CPXA 1Y0YA 3KQXA 2PCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWU A;  4ZX9 A;  4Z65 A;  2Q4Z A;  3I1U A;  2QJ8 A;  1XFO A;  5LRG A;  4UF4 A;  4NJR A;  3VAT A;  2WYR A;  1AYE A;  4MMO A;  2ZEL A;  4MHY A;  3VAR A;  1H8L A;  2C6C A;  5J1Q A;  4UEZ A;  3TC8 A;  2ZEO A;  3NH5 A;  4OC3 A;  1ARL A;  2PIZ A;  4TWE A;  2XEG A;  3FF3 A;  1IY7 A;  1Z2L A;  1YLO A;  1CBX A;  1TKF A;  4ZI6 A;  5JH9 A;  4F8Z A;  2RFH A;  4OC5 A;  4O23 A;  2BO9 A;  1ARM A;  2WZN A;  2PJ6 A;  3B7I A;  4MCP A;  3QNV A;  1F2O A;  3KHZ A;  4P6Y A;  4H2K A;  2F8H A;  2JBK A;  4ZY2 A;  3VH9 A;  2PJ0 A;  3BI1 A;  2AFO A;  4AXV A;  4IAV A;  3SJX A;  2PVV A;  4OC4 A;  3S9M A;  1PYT B;  3N5F A;  4K3N A;  1Z5R A;  5D8N A;  1YW6 A;  3D68 A;  2XEI A;  4OC0 A;  1VIX A;  4EFD A;  1ZG7 A;  1TKH A;  1XJO A;  4P4E A;  4B6Z A;  2GRE A;  2ZEH A;  3ISZ A;  3PB4 X;  2O53 A;  4WJB A;  3T8W A;  3RZA A;  4Q7A A;  4A38 A;  2PJ8 A;  3B3C A;  5F09 A;  1R43 A;  2ZEN A;  3D7F A;  4PXC A;  1F2P A;  2POK A;  4OC1 A;  5ELY A;  1HEE A;  4MHN A;  2DEA A;  2BOA A;  4ONW A;  2PJ9 A;  2XEJ A;  3B3W A;  4KSI A;  4YU9 A;  4NGT A;  4P44 A;  2ZED A;  3B3V A;  3KAS A;  1QQ9 A;  3WC7 A;  3FEC A;  2V77 A;  2V8D A;  4JYW A;  4F9V A;  2G9D A;  5LYD A;  2AFS A;  2PVW A;  2PJ7 A;  3FVL A;  4MRI A;  3RBU A;  8CPA A;  1XBU A;  2PJ5 A;  2Q43 A;  4FUU A;  3D66 A;  3NH4 A;  3PB7 X;  4MCR A;  1M4L A;  1F57 A;  1UWY A;  1CP6 A;  1VHE A;  4DUK A;  2JEW A;  3PB6 X;  4OIW A;  2OR4 A;  1BAV A;  3JRU A;  5LRJ A;  3PB9 X;  4A37 A;  1LAP A;  3CT9 A;  4CPA A;  1Z8L A;  3RAM A;  1XMB A;  4IHM A;  2C6G A;  4OKO A;  2BCO A;  2PJA A;  3FED A;  3CDX A;  3IIB A;  3PBE A;  1LAM A;  6CPA A;  5I4M A;  2EK8 A;  3WT4 A;  2I3C A;  5CBM A;  4MXU A;  4X2T A;  1BLL E;  4P4F A;  4GM5 A;  2NSM A;  4UEE A;  3H8G A;  4NGS A;  4DJL A;  3PBB A;  4MHZ A;  3PFO A;  3IEH A;  1TKJ A;  2AFZ A;  4R7M A;  1IGB A;  2CF4 A;  1CPX A;  4ZX8 A;  3TX8 A;  1BPN A;  1VGY A;  4PXE A;  4ZYQ A;  1CG2 A;  3D7H A;  1TF9 A;  2CTC A;  4DYO A;  4FBE A;  4NFR A;  3K2K A;  3KHX A;  1FT7 A;  5LYL A;  1YME A;  4PXD A;  2IMO A;  3DLJ A;  3SJG A;  1LAN A;  3V7Z A;  4YWY A;  3KZW A;  1Q7L A;  4OME A;  3SI1 A;  3HUV A;  4PPZ A;  2AFW A;  3K9T A;  1ZG8 A;  3D7G A;  4R76 A;  2XEF A;  1Y0R A;  2GLF A;  2PJ3 A;  1LCP A;  1OBR A;  5LRK A;  3PRT A;  5K8P A;  3BHX A;  1CX8 A;  1DTD A;  3H8E A;  3WC5 A;  3FH4 A;  3KQZ A;  3B35 A;  3KR4 A;  5JGF A;  3GB0 A;  2JBJ A;  1JQG A;  1CPS A;  1LOK A;  3GLJ A;  2GLJ A;  4W9Y A;  5DS0 A;  4P10 A;  3KL9 A;  2V8G A;  4P4J A;  1XRY A;  2PJ1 A;  2HB6 A;  5HVH A;  1TXR A;  4RUH A;  4ZY0 A;  3FX6 A;  2PIY A;  4A39 A;  2EK9 A;  5D29 A;  4MHP A;  2O4H A;  1TF8 A;  4NGP A;  1RTQ A;  3IC1 A;  3D7D A;  3KR5 A;  2NYQ A;  2VL1 A;  4P4D A;  2PE3 A;  4NGM A;  3B3S A;  2AFX A;  2ZEF A;  3B2Y A;  3HLP A;  3S9N A;  3GUX A;  2V8H A;  4TNU A;  1CP7 A;  2V8V A;  3BI0 A;  3IJ3 A;  3WAB A;  2ZEP A;  4UIB A;  3SJF A;  4UIA A;  5K8N A;  5IB9 A;  4G1P A;  3KI9 A;  3FMC A;  2PRQ A;  2ABZ A;  1KWM A;  2IQ6 A;  4MCQ A;  4X3R A;  1PCA A;  2FVG A;  2PJ4 A;  1ELL P;  4R6T A;  3NFZ A;  1ZG9 A;  3H8F A;  5K8O A;  3D4U A;  2IJZ A;  3PB8 X;  4A94 A;  3S9L A;  4ZY1 A;  4NGR A;  3B3T A;  3D67 A;  3IFE A;  1AMP A;  1ELM P;  3KGQ A;  3IO1 A;  4EME A;  4EWT A;  1HDQ A;  3FJU A;  2F7V A;  4PXB A;  3PEI A;  1YSJ A;  3LMS A;  5HXD A;  2AFU A;  2RB7 A;  4MCS A;  3L2N A;  1BPM A;  2ZOG A;  4NJQ A;  4IK2 A;  2ANP A;  2PJ2 A;  5JM6 A;  1HDU A;  3MN8 A;  3MRU A;  2ZEM A;  1LFW A;  3V38 A;  3DGV A;  2QYV A;  4OID A;  1FNO A;  5LYI A;  3WC6 A;  4BD9 A;  4X8I A;  3BXM A;  4UEF A;  5HVG A;  3SI0 A;  4JZ0 A;  3FEE A;  3NA6 A;  2CIJ A;  4WWV A;  3ISX A;  2C1C A;  5LYF A;  2PJB A;  1NSA A;  3NH8 A;  4P45 A;  2PJC A;  1ZLH A;  4OP4 A;  3IWW A;  4OC2 A;  2HC9 A;  1EE3 P;  2AFM A;  1GYT A;  2C6P A;  4F9U A;  4FWU A;  2ZEG A;  1R3N A;  2OOT A;  3SI2 A;  5K8M A;  2J9A A;  2ZEE A;  4NGN A;  7CPA A;  1YW4 A;  1VHO A;  1ZLI A;  2EWB A;  1QMU A;  3PFE A;  4P4B A;  5CPA A;  2ZOF A;  4LQG A;  2QVP A;  3CPA A;  2GU2 A;  4NGQ A;  3SJE A;  4P4I A;  4PQA A;  1DE4 C;  2Q51 A;  4R8F A;  4FAI A;  1Y7E A;  2CTB A;  5HVF A;  5THW A;  3CPX A;  1Y0Y A;  3KQX A;  2PCU A; 
#chains in the Genus database with same CATH topology
 1S60 A;  4MI4 A;  4XNH C;  4K30 A;  3TO7 A;  3LWU A;  4ZX9 A;  5AGE A;  4Z65 A;  4RS2 A;  2ODF A;  1KUY A;  2Q4Z A;  1NMT A;  3I1U A;  2QJ8 A;  1X10 A;  1XF8 A;  1XFO A;  2ZW5 A;  4UF4 A;  5LRG A;  2QEC A;  4QB9 A;  4NJR A;  3VAT A;  2WYR A;  4QC6 A;  4AVA A;  2VBQ A;  2K5T A;  1AYE A;  3A9L A;  4KLV A;  5E96 A;  2R98 A;  3I3G A;  2B4D A;  2QML A;  2ZEL A;  4MHY A;  4MMO A;  3VAR A;  3EC4 A;  1H8L A;  2C6C A;  1S3Z A;  2OZU A;  3LAC A;  4UBR A;  5J1Q A;  5H84 A;  4R57 A;  4C2Z A;  4UEZ A;  3TC8 A;  2ZEO A;  3NH5 A;  1BO4 A;  3JUW A;  4OC3 A;  3FXT A;  1ARL A;  3W6X A;  2P6F A;  2PIZ A;  2IL4 A;  5G1Z A;  4KS9 A;  1QSR A;  2B3U A;  4MHD A;  4TWE A;  4XPK A;  2XEG A;  3FF3 A;  3LD2 A;  1KUV A;  4QBJ A;  2OZG A;  2JDD A;  4YRH A;  5A28 A;  3FB3 A;  3EXN A;  2F5I A;  1IOI A;  1IY7 A;  4HNY B;  1Z2L A;  1YLO A;  4IUS A;  3TCV A;  1CBX A;  1TKF A;  4YGO A;  4IF5 A;  4ZI6 A;  2X7B A;  5JH9 A;  4F8Z A;  3FIX A;  4F6A A;  2RFH A;  4OC5 A;  4KOU A;  1S5K A;  4O23 A;  2BO9 A;  1ARM A;  2WPW A;  2WZN A;  4B10 A;  3QAY A;  2PJ6 A;  3B7I A;  5AG4 A;  4KOT A;  3QNV A;  4MCP A;  1F2O A;  3KHZ A;  4OLL A;  3BLN A;  4P6Y A;  1XMT A;  4QVT A;  3VWE A;  4H2K A;  2F8H A;  4XPD B;  2JBK A;  4FD4 A;  4PK3 A;  2REF A;  4CAW A;  4ZY2 A;  3VH9 A;  1MJ9 A;  2PJ0 A;  2YNE A;  4B11 A;  4BBH A;  4UWI A;  3H4Q A;  3BI1 A;  2AFO A;  4AXV A;  4C7H A;  3R9E A;  3D8P A;  4IAV A;  3SJX A;  2PVV A;  3IU2 A;  4OC4 A;  3S9M A;  1PYT B;  4MFJ A;  3N5F A;  2DXQ A;  3PGP A;  2VZY A;  4K3N A;  4CAX A;  1Z5R A;  5D8N A;  4AVB A;  4Y49 C;  5HMN A;  3EO4 A;  3GIU A;  4MFP A;  1YW6 A;  1KZF A;  3D68 A;  2XEI A;  4KOS A;  4OC0 A;  1VIX A;  4OAD A;  2Z11 A;  5F46 A;  5EC4 A;  4EFD A;  3P2H A;  1ZG7 A;  2Y0M A;  2BUE A;  1TKH A;  1XJO A;  4P4E A;  1Z4R A;  4B6Z A;  2GRE A;  2ZEH A;  1IIC A;  1WK4 A;  3ISZ A;  3PB4 X;  5G21 A;  2O53 A;  4WJB A;  3T8W A;  2BSW A;  4CAF A;  2VZZ A;  3RZA A;  4KOV A;  4Q7A A;  4A38 A;  5EMI A;  2PJ8 A;  3B3C A;  4C7I A;  2ZXV A;  2ZPA A;  3TO9 A;  4JXR A;  1SQH A;  5F09 A;  4CYN A;  2C27 A;  3D2P A;  4ZBG A;  1QST A;  2FS5 A;  4MFK A;  4R9M A;  4UFV A;  1R43 A;  2PC1 A;  4L89 A;  4UA3 A;  1UFH A;  2ZEN A;  3D7F A;  4PXC A;  2J8M A;  1F2P A;  2POK A;  4OC1 A;  5ELY A;  1HEE A;  4MHN A;  5DWN A;  2DEA A;  2BOA A;  3KKW A;  4ONW A;  2PR1 A;  4UFW A;  2PJ9 A;  2XEJ A;  3B3W A;  4KSI A;  4C2Y A;  2DF5 A;  4YU9 A;  3VWD A;  2CNM A;  1RXT A;  1TIQ A;  1CM0 A;  4KOW A;  4NGT A;  3C26 A;  4P44 A;  3ZJ0 A;  4U9Z A;  1I12 A;  2ZED A;  3DR8 A;  3FNC A;  3B3V A;  5FVJ A;  1MK4 A;  2VXK A;  3CXP A;  3W91 A;  3KAS A;  5KTD A;  4AG9 A;  1QQ9 A;  2Q4V A;  4KOY A;  3WC7 A;  3FEC A;  2EBJ A;  2V77 A;  2V8D A;  1NE9 A;  3TTH A;  2RC4 A;  3F5B A;  4JYW A;  2OU2 A;  4F9V A;  5C82 A;  2G9D A;  2ZW7 A;  5LYD A;  2AFS A;  2PVW A;  2PJ7 A;  4CYQ A;  3FVL A;  2FXF A;  3S6H A;  4MRI A;  3RBU A;  2OZH A;  8CPA A;  1XBU A;  4B14 A;  1AUG A;  2PJ5 A;  2Q43 A;  3FYN A;  4FUU A;  3D66 A;  4I49 A;  3NH4 A;  3EY5 A;  3PB7 X;  2PR8 A;  2YNC C;  4MCR A;  1M4L A;  1F57 A;  1UWY A;  1CP6 A;  3FBU A;  1VHE A;  3CXS A;  1YGH A;  4DUK A;  3K9U A;  2WPX A;  5JQ4 A;  4CGL A;  2NMT A;  4KSF A;  2JEW A;  2CXA A;  1GHE A;  2PDO A;  3PB6 X;  4M6H A;  4OIW A;  4MFZ A;  2OR4 A;  1BAV A;  4KVM E;  1Q2D A;  3JRU A;  4JJX A;  4BIN A;  5J8C A;  5LRJ A;  3PB9 X;  4JD6 A;  3GY9 A;  4A37 A;  2EUI A;  5EBV A;  4HPS A;  4U5Y A;  4X5K A;  2B4D B;  4Q36 A;  3F8K A;  1LAP A;  3TE4 A;  2B4B A;  3CT9 A;  1WWZ A;  4CPA A;  2Q7B A;  2Z3P A;  2P0W A;  4MFQ A;  1Z8L A;  2G0B A;  3RAM A;  1XMB A;  3DDD A;  4IHM A;  1YVK A;  4MFL A;  4CGP A;  2C6G A;  4OKO A;  2BCO A;  2PJA A;  3FED A;  2JLM A;  2ZW4 A;  3CDX A;  3IIB A;  3PBE A;  1I1D A;  3RNZ A;  1LAM A;  1S7F A;  6CPA A;  2G3T A;  5I4M A;  4UFX A;  2EK8 A;  3WT4 A;  3TOA A;  2I3C A;  5CBM A;  4KOX A;  4EVY A;  4MXU A;  4MJ8 A;  3DR6 A;  4X2T A;  2CY2 A;  2KCW A;  1BLL E;  4P4F A;  1LRZ A;  3CXQ A;  1M1D A;  4HNW B;  4M6G A;  4B13 A;  1RO5 A;  4GM5 A;  2NSM A;  4UEE A;  2B5G A;  3H8G A;  4H6U A;  4NGS A;  1YQE A;  3RO0 A;  1S7N A;  4DJL A;  2D4O A;  4CS0 B;  3PBB A;  3S6F A;  4MHZ A;  3PFO A;  4A2Z A;  4GXH A;  3IEH A;  4RN7 A;  4QUS A;  1OZP A;  1TKJ A;  2AFZ A;  1YK3 A;  4DNC A;  4R7M A;  4KSA A;  1IGB A;  1M4D A;  2CF4 A;  2GFQ A;  1QSO A;  1CPX A;  3MGD A;  4ZX8 A;  3TX8 A;  1BPN A;  1JWQ A;  2BEI A;  4NXY A;  1VGY A;  4PXE A;  5ISV A;  3BJ8 A;  4ZYQ A;  4MBU A;  4LX9 A;  4CGO A;  1CG2 A;  3D7H A;  3JVN A;  4F0X A;  1A2Z A;  3GYA A;  2DPS A;  1TF9 A;  3IWG A;  2CTC A;  4KUA A;  3NE7 A;  4NF1 A;  4DYO A;  4FBE A;  4B5P A;  4NFR A;  3K2K A;  2Q04 A;  3KHX A;  1FT7 A;  5LYL A;  1YME A;  4PXD A;  2IMO A;  3DLJ A;  4ORF A;  1Y9W A;  1KUX A;  3SJG A;  1LAN A;  5IV0 A;  5H86 A;  3V7Z A;  1XEB A;  3KZW A;  4YWY A;  1Q7L A;  4B5P B;  4OME A;  4XNH B;  4A32 A;  3SI1 A;  3E0K A;  3HUV A;  1M4G A;  4PPZ A;  2AFW A;  5G20 A;  1Z8X A;  3K9T A;  1ZG8 A;  2WUU A;  3D7G A;  2YGW A;  3R1K A;  2XEF A;  2P6G A;  4R76 A;  1Y0R A;  2GLF A;  2PJ3 A;  4AG7 A;  4F0Y A;  1LCP A;  3TT2 A;  1OBR A;  3TOB A;  5LRK A;  3PRT A;  5K8P A;  1B87 A;  1XE4 A;  1IU8 A;  3G8W A;  5AG5 A;  3BHX A;  4C68 A;  4LQ6 A;  1CX8 A;  2Q44 A;  2J8N A;  5BWA B;  4XPL A;  1DTD A;  3H8E A;  3WC5 A;  4XPD C;  3FH4 A;  3EFA A;  3KQZ A;  3B35 A;  3KR4 A;  3SXO A;  5JGF A;  3GB0 A;  2JBJ A;  1JQG A;  1YRE A;  1CPS A;  1LOK A;  4MY0 A;  1NSL A;  3GLJ A;  2GLJ A;  4W9Y A;  1YLE A;  5DS0 A;  4P10 A;  2P6E A;  3KL9 A;  4R87 A;  3RYO A;  4UWJ A;  2V8G A;  2VEZ A;  2VI7 A;  4P4J A;  1XRY A;  2HUZ A;  2CNS A;  1YR0 A;  2PJ1 A;  3OWC A;  2HB6 A;  2OB0 A;  5HVH A;  1TXR A;  2Z0Z A;  2Z3N A;  4UCP A;  4RUH A;  2Q7S A;  2R1I A;  3FX6 A;  5CNP A;  2PIY A;  4ZY0 A;  1U6M A;  2REE A;  4A39 A;  2Z3L A;  4CAV A;  2EK9 A;  5D29 A;  4MHP A;  3I9S A;  4OAE A;  4M6I A;  2O4H A;  1TF8 A;  2D4P A;  3PZJ A;  3R9F A;  3D3S A;  1XOV A;  1RTQ A;  4NGP A;  3IC1 A;  4LUA A;  1J4J A;  4E0A A;  3D7D A;  3DSB A;  3KR5 A;  2NYQ A;  2FSR A;  2FCK A;  2Z3K A;  2VL1 A;  4P4D A;  2PE3 A;  1K4J A;  4NGM A;  5IB0 A;  4C2X A;  2ARH A;  3B3S A;  3LOD A;  2AFX A;  2GIV A;  2ZEF A;  3B2Y A;  3HLP A;  3S9N A;  2AE6 A;  3GUX A;  2V8H A;  1I21 A;  4TNU A;  1CP7 A;  2V8V A;  3BI0 A;  3IJ3 A;  3V8I A;  4CRZ B;  2DPT A;  1P0H A;  1MJA A;  3WAB A;  4KVO E;  2VQY A;  2ZEP A;  4UIB A;  3SJF A;  4UIA A;  5I0C A;  5KTC A;  5K8N A;  1Q2Y A;  3PP9 A;  2I79 A;  4G1P A;  5IB9 A;  5J8F A;  1S7K A;  2OH1 A;  1BOB A;  2B3V A;  2J8R A;  3KI9 A;  3FMC A;  1R57 A;  1VKC A;  2PRQ A;  4NEX A;  4Y49 B;  2ABZ A;  2ATR A;  1KWM A;  2IQ6 A;  4MCQ A;  4X3R A;  2ZW6 A;  5F47 A;  2PQ8 A;  3T90 A;  2FT0 A;  4ZGY B;  1PCA A;  2FVG A;  5JPH A;  1P4N A;  2PJ4 A;  1ELL P;  4GS4 A;  4R6T A;  2R8V A;  1ZG9 A;  3NFZ A;  3H8F A;  5K8O A;  4B12 A;  4L8A A;  4ONU A;  3D4U A;  2I00 A;  3W6S A;  3TFY A;  2IJZ A;  4A30 A;  3PB8 X;  4A94 A;  3H5Z A;  1ON0 A;  4HKF A;  3S9L A;  1B6B A;  4HNX B;  2EVN A;  1V0C A;  4UCM A;  4ZY1 A;  1Z8T A;  4NGR A;  3B3T A;  5C88 A;  2FE7 A;  3D67 A;  3IFE A;  2FIW A;  4II9 A;  1AMP A;  1ELM P;  3KGQ A;  1PU9 A;  3IO1 A;  1CJW A;  1PUA A;  1HDQ A;  3FJU A;  3S6G A;  3WR7 A;  4EME A;  4EWT A;  3IWE A;  2F7V A;  4PXB A;  1IYL A;  4KVX A;  1X12 A;  1YSJ A;  2GAN A;  3PEI A;  4AB7 A;  4FD7 A;  3LMS A;  1YVO A;  5HXD A;  4YFJ A;  2AFU A;  4PK2 A;  2RB7 A;  2B5G B;  3CZX A;  4MCS A;  3L2N A;  4FD5 A;  4UCN A;  2YND A;  1BPM A;  1IID A;  2ZOG A;  4NJQ A;  4J3G A;  1MJB A;  3F0A A;  4IK2 A;  2QIR A;  1ZO0 A;  2ANP A;  2PJ2 A;  2Z10 A;  4R3K A;  4CRY B;  5JM6 A;  1HDU A;  4A95 A;  3MN8 A;  3G3S A;  3IU1 A;  3MRU A;  5F49 A;  2ZEM A;  2O28 A;  1LFW A;  4PSX A;  3V38 A;  2Q0Y A;  3DGV A;  4FD6 A;  4Q38 A;  2QYV A;  4OID A;  1FNO A;  1Y9K A;  5LYI A;  3WC6 A;  2JDC A;  3DNS A;  4BD9 A;  1M44 A;  4X8I A;  4JLY A;  4JXQ A;  1Q2C A;  3BXM A;  4UEF A;  4CGN A;  3SXN A;  2YNC A;  3SHP A;  5HVG A;  3SI0 A;  4A33 A;  3R9G A;  1QSN A;  4BMH A;  4JZ0 A;  2A4N A;  3FEE A;  4B5O A;  3UY5 A;  3NA6 A;  4CGM A;  2CIJ A;  4A31 A;  4WWV A;  3ISX A;  2C1C A;  2B58 A;  5LYF A;  4PSW A;  3D2M A;  2PJB A;  3B8G A;  1NSA A;  3NH8 A;  4NSQ A;  4P45 A;  4U9Y A;  5IX3 A;  1Z8W A;  5KTA A;  4H89 A;  2PJC A;  1QSM A;  1ZLH A;  2BL1 A;  2JEV A;  4OP4 A;  3IWW A;  2FIA A;  4RI1 A;  1M4I A;  4OC2 A;  2HC9 A;  3IGR A;  5HH1 A;  1EE3 P;  3T9Y A;  2AFM A;  1GYT A;  1VHS A;  2C6P A;  5F48 A;  5GCN A;  4FWU A;  4F9U A;  2R7H A;  4R3L A;  1IYK A;  2ZEG A;  1R3N A;  3P2F A;  2OOT A;  1IB1 E;  3SI2 A;  2CNT A;  2EO8 A;  2AJ6 A;  2J9A A;  2HQY A;  2PRB A;  2ZEE A;  4KOR A;  5AG7 A;  3ZZI A;  4NCZ A;  4NGN A;  3R95 A;  4CAE A;  7CPA A;  5A27 A;  2H5M A;  2Q4Y A;  1YX0 A;  3QAH A;  4M3S A;  1FY7 A;  1YW4 A;  4CYP A;  1VHO A;  1ZLI A;  3S6K A;  5K8M A;  2EWB A;  1L0C A;  3BJ7 A;  4E8O A;  1QMU A;  2GE3 A;  2Z3O A;  3PFE A;  4P4B A;  5CPA A;  2ZOF A;  4E2A A;  4H6Z A;  3JTK A;  5AG6 A;  4LQG A;  1N71 A;  2QVP A;  3CPA A;  4AVC A;  1S7L A;  2GU2 A;  3FRM A;  4JWP A;  4NGQ A;  3SJE A;  2PCU A;  4P4I A;  3NE8 A;  4PQA A;  1DE4 C;  4M85 A;  3QB8 A;  3GKR A;  4KUB A;  2Q51 A;  2Z3M A;  2G3A A;  4R8F A;  3R96 A;  4CYO A;  2FL4 A;  4KLW A;  4FAI A;  3N7Z A;  2HV2 A;  5DWM A;  1Y7E A;  4MY3 A;  2CTB A;  5G22 A;  5HVF A;  3TO6 A;  1IOF A;  1Z4E A;  2PSW A;  2WSA A;  1Z9U A;  5THW A;  3CPX A;  4KZT A;  4PV6 A;  1Y0Y A;  3KQX A;  1XIX A;  1Y7R A; 
#chains in the Genus database with same CATH homology
 3LWU A;  4ZX9 A;  4Z65 A;  2Q4Z A;  3I1U A;  2QJ8 A;  1XFO A;  5LRG A;  4UF4 A;  4NJR A;  3VAT A;  2WYR A;  1AYE A;  4MMO A;  2ZEL A;  4MHY A;  3VAR A;  1H8L A;  2C6C A;  5J1Q A;  4UEZ A;  3TC8 A;  2ZEO A;  3NH5 A;  4OC3 A;  1ARL A;  2PIZ A;  4TWE A;  2XEG A;  3FF3 A;  1IY7 A;  1Z2L A;  1YLO A;  1CBX A;  1TKF A;  4ZI6 A;  5JH9 A;  4F8Z A;  2RFH A;  4OC5 A;  4O23 A;  2BO9 A;  1ARM A;  2WZN A;  2PJ6 A;  3B7I A;  4MCP A;  3QNV A;  1F2O A;  3KHZ A;  4P6Y A;  4H2K A;  2F8H A;  2JBK A;  4ZY2 A;  3VH9 A;  2PJ0 A;  3BI1 A;  2AFO A;  4AXV A;  4IAV A;  3SJX A;  2PVV A;  4OC4 A;  3S9M A;  1PYT B;  3N5F A;  4K3N A;  1Z5R A;  5D8N A;  1YW6 A;  3D68 A;  2XEI A;  4OC0 A;  1VIX A;  4EFD A;  1ZG7 A;  1TKH A;  1XJO A;  4P4E A;  4B6Z A;  2GRE A;  2ZEH A;  3ISZ A;  3PB4 X;  2O53 A;  4WJB A;  3T8W A;  3RZA A;  4Q7A A;  4A38 A;  2PJ8 A;  3B3C A;  5F09 A;  1R43 A;  2ZEN A;  3D7F A;  4PXC A;  1F2P A;  2POK A;  4OC1 A;  5ELY A;  1HEE A;  4MHN A;  2DEA A;  2BOA A;  4ONW A;  2PJ9 A;  2XEJ A;  3B3W A;  4KSI A;  4YU9 A;  4NGT A;  4P44 A;  2ZED A;  3B3V A;  3KAS A;  1QQ9 A;  3WC7 A;  3FEC A;  2V77 A;  2V8D A;  4JYW A;  4F9V A;  2G9D A;  5LYD A;  2AFS A;  2PVW A;  2PJ7 A;  3FVL A;  4MRI A;  3RBU A;  8CPA A;  1XBU A;  2PJ5 A;  2Q43 A;  4FUU A;  3D66 A;  3NH4 A;  3PB7 X;  4MCR A;  1M4L A;  1F57 A;  1UWY A;  1CP6 A;  1VHE A;  4DUK A;  2JEW A;  3PB6 X;  4OIW A;  2OR4 A;  1BAV A;  3JRU A;  5LRJ A;  3PB9 X;  4A37 A;  1LAP A;  3CT9 A;  4CPA A;  1Z8L A;  3RAM A;  1XMB A;  4IHM A;  2C6G A;  4OKO A;  2BCO A;  2PJA A;  3FED A;  3CDX A;  3IIB A;  3PBE A;  1LAM A;  6CPA A;  5I4M A;  2EK8 A;  3WT4 A;  2I3C A;  5CBM A;  4MXU A;  4X2T A;  1BLL E;  4P4F A;  4GM5 A;  2NSM A;  4UEE A;  3H8G A;  4NGS A;  4DJL A;  3PBB A;  4MHZ A;  3PFO A;  3IEH A;  1TKJ A;  2AFZ A;  4R7M A;  1IGB A;  2CF4 A;  1CPX A;  4ZX8 A;  3TX8 A;  1BPN A;  1VGY A;  4PXE A;  4ZYQ A;  1CG2 A;  3D7H A;  1TF9 A;  2CTC A;  4DYO A;  4FBE A;  4NFR A;  3K2K A;  3KHX A;  1FT7 A;  5LYL A;  1YME A;  4PXD A;  2IMO A;  3DLJ A;  3SJG A;  1LAN A;  3V7Z A;  4YWY A;  3KZW A;  1Q7L A;  4OME A;  3SI1 A;  3HUV A;  4PPZ A;  2AFW A;  3K9T A;  1ZG8 A;  3D7G A;  4R76 A;  2XEF A;  1Y0R A;  2GLF A;  2PJ3 A;  1LCP A;  1OBR A;  5LRK A;  3PRT A;  5K8P A;  3BHX A;  1CX8 A;  1DTD A;  3H8E A;  3WC5 A;  3FH4 A;  3KQZ A;  3B35 A;  3KR4 A;  5JGF A;  3GB0 A;  2JBJ A;  1JQG A;  1CPS A;  1LOK A;  3GLJ A;  2GLJ A;  4W9Y A;  5DS0 A;  4P10 A;  3KL9 A;  2V8G A;  4P4J A;  1XRY A;  2PJ1 A;  2HB6 A;  5HVH A;  1TXR A;  4RUH A;  4ZY0 A;  3FX6 A;  2PIY A;  4A39 A;  2EK9 A;  5D29 A;  4MHP A;  2O4H A;  1TF8 A;  4NGP A;  1RTQ A;  3IC1 A;  3D7D A;  3KR5 A;  2NYQ A;  2VL1 A;  4P4D A;  2PE3 A;  4NGM A;  3B3S A;  2AFX A;  2ZEF A;  3B2Y A;  3HLP A;  3S9N A;  3GUX A;  2V8H A;  4TNU A;  1CP7 A;  2V8V A;  3BI0 A;  3IJ3 A;  3WAB A;  2ZEP A;  4UIB A;  3SJF A;  4UIA A;  5K8N A;  5IB9 A;  4G1P A;  3KI9 A;  3FMC A;  2PRQ A;  2ABZ A;  1KWM A;  2IQ6 A;  4MCQ A;  4X3R A;  1PCA A;  2FVG A;  2PJ4 A;  1ELL P;  4R6T A;  3NFZ A;  1ZG9 A;  3H8F A;  5K8O A;  3D4U A;  2IJZ A;  3PB8 X;  4A94 A;  3S9L A;  4ZY1 A;  4NGR A;  3B3T A;  3D67 A;  3IFE A;  1AMP A;  1ELM P;  3KGQ A;  3IO1 A;  4EME A;  4EWT A;  1HDQ A;  3FJU A;  2F7V A;  4PXB A;  3PEI A;  1YSJ A;  3LMS A;  5HXD A;  2AFU A;  2RB7 A;  4MCS A;  3L2N A;  1BPM A;  2ZOG A;  4NJQ A;  4IK2 A;  2ANP A;  2PJ2 A;  5JM6 A;  1HDU A;  3MN8 A;  3MRU A;  2ZEM A;  1LFW A;  3V38 A;  3DGV A;  2QYV A;  4OID A;  1FNO A;  5LYI A;  3WC6 A;  4BD9 A;  4X8I A;  3BXM A;  4UEF A;  5HVG A;  3SI0 A;  4JZ0 A;  3FEE A;  3NA6 A;  2CIJ A;  4WWV A;  3ISX A;  2C1C A;  5LYF A;  2PJB A;  1NSA A;  3NH8 A;  4P45 A;  2PJC A;  1ZLH A;  4OP4 A;  3IWW A;  4OC2 A;  2HC9 A;  1EE3 P;  2AFM A;  1GYT A;  2C6P A;  4F9U A;  4FWU A;  2ZEG A;  1R3N A;  2OOT A;  3SI2 A;  5K8M A;  2J9A A;  2ZEE A;  4NGN A;  7CPA A;  1YW4 A;  1VHO A;  1ZLI A;  2EWB A;  1QMU A;  3PFE A;  4P4B A;  5CPA A;  2ZOF A;  4LQG A;  2QVP A;  3CPA A;  2GU2 A;  4NGQ A;  3SJE A;  4P4I A;  4PQA A;  1DE4 C;  2Q51 A;  4R8F A;  4FAI A;  1Y7E A;  2CTB A;  5HVF A;  5THW A;  3CPX A;  1Y0Y A;  3KQX A;  2PCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...