1RU9L

Crystal structure (a) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected in-house.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
total genus 47
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9L01
4GKSB 1TCRB 4GH7B 4JQVC 5TF0A 2KKQA 4LLMA 4U1GC 2EDRA 3P9MB 3NCBB 5HD8D 2SEBB 1CWVA 4XNZB 1N2RB 4LHUB 3T65B 5DD5L 2FYYB 3QT2A 3DUHA 4YAQA 3GJFK 4QRPA 1R5WA 3QCVL 1CE1L 3BUYB 3B3IB 2XKSA 3DXAB 1OAXH 3B8SA 3BQUB 4IOIA 1TZIA 4GQ9H 1G6RA 1G9EA 4QCIA 4J3WA 3D39E 3WCYA 1XGYH 2PW2A 5J6GA 4JAMB 1OTUC 2CLRB 4LHUD 5INDA 4K3GA 1BM3H 1FIEA 1FBIL 4K2UH 4HKXB 3F12A 2DB8A 3ARDA 1U2CA 1KOAA 2YS4A 4XPAH 3MBEB 4K55A 1HCVA 4Q2ZA 1NL0H 3DXAD 2XXMB 3BQUD 3G6JA 7FABL 5EPMA 4LVOB 5CGTA 2L7UA 3H3PL 5F72S 3D87B 2KQNA 4JCLA 5JHLH 3V6FB 2Q3AA 1BD2E 3ARFA 4GRLC 1GZQB 2XKNB 1CXFA 1TQBC 3MRBB 2DBJA 1CLCA 5IW1B 5EU7E 1AI1H 1Q0YL 2A9NL 1ZANL 3MBED 2NTFB 2OMNA 5I1CL 4WGWB 5ELIA 1MCHA 2DQUH 3MV7E 5GSVA 3VFRA 4YQXH 4S1RH 1T21A 1UA6L 1G9NC 4NQCB 2JCCA 2AXGB 5CKGA 4JZJA 3S36H 1ZVSB 5DMIL 3OKDA 3TN0C 2HT3C 4G6JH 5I1HL 3NCFB 3VXMB 4L29B 3VGEA 3MLSL 1NAML 5D71H 5EO9B 1C12A 1HEZA 4LNRB 5IMKA 3W2DL 2ADJA 3W0WB 1FFNB 2DL2A 5HJ3A 5IW6A 4BQ8A 4OZHE 4LSTH 3S3JA 3VFUA 3K8LA 4WU7B 5C6TL 3TBYB 1UB6A 1HNFA 2NYYC 4QXGL 1U8HB 4LARL 5DHYB 1XH3A 4ODWB 4CJ1A 3SBWA 3BN3B 1QEWA 5F3HB 4H5SB 3DSFH 2FB4L 3SDCA 1AD9A 4S10A 3VXMD 4PGDB 2CK0L 2DQCL 2H2PD 5TH2B 1L7IL 4YDKL 3W0WD 3OGOE 3B5TA 5K9QI 1H8OA 1A1OA 2R0WL 1FNFA 5D5MF 4RAVB 5GRJH 2Y7QA 3LIZL 4ZUSA 5A3IC 3CSYB 2C9AA 3DRQA 1IKFL 2W0FA 3FQUB 3RBGA 4KJYB 3TV3H 1K6QL 3MJ9L 4P4KC 3DYMA 2PUQT 4JZOA 5FO8A 4S1QH 3PWLA 2HVKA 1XF4B 1I3RA 4O51A 2WW8A 2IG2H 1EK3A 1JTOA 4APQA 4GUPA 4X6DB 1UJ3C 4ZXBB 1BVKB 4N0FB 3R0MA 5K9KB 5T1DH 5GGVL 5ISZE 3K46A 1MWAB 3ULVD 1BQLH 4JFEA 2X70A 4PJ8C 4XZUA 2HT4C 2FLRT 1NDMA 1Q38A 1A02N 5DQ9A 2ITDB 35C8L 1EXUA 4NKOB 4UQ3A 3EOAA 1I1AB 1BLNA 1JHKL 1W2KT 4BFIA 3TIDB 4PLKD 4ZXBD 2XWBB 3HR6A 2R1WB 4Z7NF 5E6IC 5IVOA 4LRIA 3EO9H 3KXFA 3MYZA 2ZNXA 2WWKO 1NFKA 4U31A 3ESUF 2O61A 4EVNA 1CICD 4PBVC 4S2SB 2VXTL 3H8NA 3ZDYE 3RVXC 4J3TA 1Q9LA 5D2NE 2VZSA 3NA9H 3R1GL 1ZAGA 1QA9A 2F74A 2X40A 5F1NB 1I1AD 5IBTL 4NJ9L 4LSSL 2YD7A 3UMTA 2ICCA 5E08L 1WITA 5JW4R 5CEYB 3WXWL 4GSDH 4X6EB 3H3KA 4IS6B 2AKRA 3OKEA 5KZCB 1MHHA 1XMWA 2UUDH 1AGEB 2YN5A 1B3JA 1PX3A 3TIEB 3PF2A 2VQ1A 1IAKA 4ALAL 4C56B 1NLDH 5B3JE 3ZLQC 5T1KB 2BNRB 3M1BA 1I8IB 3GSUA 3UJTH 4Z7VA 3C2AH 3RWDA 2C1PA 2IWGA 2E7LA 1IKNC 3GRWA 4F3FA 1IM3A 2J12B 3TT1H 2LFGA 5A2LH 3DTXB 1MF2H 3GUTA 5KZCD 5L6YH 3OPZL 2BC4B 4MA8L 2VC2L 3CFDB 4OM1H 1ZK9A 4C56D 4LPCA 2DLGA 5T1KD 5KS9B 2BNRD 4MXQD 5IMMB 4JB9H 1XCQA 3T77A 4KZEL 5F6IB 1X44A 3WNNA 4WW2F 2ICWI 1BQSA 4QWWC 4QRQA 1JHTA 2DJSA 3L3JB 5EU3A 1BOGB 2G75A 2HVJA 3H42H 5HDQH 1QFPA 4ZAKB 4KJPC 5F9AC 2DIAA 1NANH 4ZPVB 4DGYH 1V3JA 4OCWL 1LE5A 4YHIB 5MEOB 2C4XA 3MRRB 4MLSA 1FCCA 3HCVA 5I19L 4A2LA 5I15H 4DK3A 4JY4B 4CVXB 4R4NC 4JO1H 1OPGL 2HJKB 4BKLB 3P0VH 3UYRL 1MIEH 3HNTL 4ZAKD 5JUEH 3LRGA 4LKCA 1RZ7H 1FPTL 3D39A 1VFMA 2CD0A 2V17H 3QIWC 3ZYOA 3C6LC 5DRNA 1ACYH 5J9PB 3BKYH 3FB8B 1RUAH 1WZ1H 3WMSA 2BP3A 1S78D 1T2JA 2X4RA 4MNQE 2VE6A 1KFAH 3BXNB 3F7RA 2JB6B 5IF0A 1INQA 3WN5C 5JXAH 3OAYH 4Y19B 5CEZE 1GGBL 2DMCA 1MLCA 3KPOB 4G42A 4NO5A 4BQBA 2EKJA 3RX5A 5KG9B 3U6RA 2EDDA 2Z9TA 1UM6L 1NEUA 3KYMB 4PRNB 5DD5H 3BGAA 4PGBB 2D9QB 1RUKL 3QWRA 5LAXB 2J8HA 4HW6A 3QCVH 1CE1H 4N8VG 3SGJC 1DQQB 4CU6A 3QDGB 5F6HI 2Y36L 4F15B 3MV9A 4OLYL 3S4SB 2I9TB 5CCKL 3LN4B 4RX4A 4Y19D 3DUUB 2EC8A 2QADB 5GRXG 3MV7A 2XWJA 4P3CL 4WUUB 3RPIB 2FRGP 3FQRA 4X0KA 3MNZB 3GI8L 3V8OA 1G7MB 3WE6A 4KK5C 3FRUA 4P2OA 2ZUQB 3BKCL 2VLME 1IL1A 1FBIH 3G6AB 1GGCL 3CFCL 5HVFB 1RUPL 3PP3K 1F90L 1YMHB 3D25B 3QDGD 1A0QH 5JDSA 3U4EB 4O2FA 4PJXE 4YHOL 3GMPB 1W0VA 5FECA 1CFQB 4OZHA 4JY5L 5DQJA 3TA3C 4EQ3A 3E8UL 3EYVA 4FZEL 2DICA 4V1DE 1R3LB 3T0XA 5ADPL 4NBXB 4G9FB 4L9LA 1G7PB 2GY7B 3UZVB 2XNAB 1DE4B 2V2TB 1D9KC 2YXFA 1Q0YH 2A9NH 1CXLA 4NZJA 3MLYH 5I1CH 5BO1L 3VH8A 4Z76B 3IDXL 1R5IB 1UA6H 4KTYA 1NPUA 3IKCB 1MVUB 2X41A 3GBMH 3VWJC 2EIBA 3FKUS 1HI6A 5J11C 3UPRB 4L3CB 4ZOBA 5DMIH 4YZFE 3AB0B 4U1IA 4G9FD 5I1HH 5EOCJ 1KB9K 3MLSH 1NAMH 4LK4A 1MIMH 1SMAA 4DTGH 4LCWE 4NNYB 1QKZL 1W0WB 1P53A 2AEWA 1L6ZA 4JRYE 4R4FL 1GIGL 1OWRM 4QXGH 3C5ZB 3Q6GL 1J1PL 3C87A 4JZNB 2BX5A 4LARH 4D9QE 1KN4L 1UCBL 4ZFOA 3O2WL 1TVBB 1NGQL 3OL2A 2NMSA 3KNBB 5ISZA 2FB4H 3KPSB 3PHOA 4I5BB 3FZUD 1YECL 3QISA 4PP2B 2DQCH 2VSDA 1CD1A 1L7IH 4YDKH 4OLWH 5CJBA 1MJ7L 2Q7NA 3S97C 2R0WH 4BFEA 1D6EA 1K3ZA 4EI5A 2V7NB 3C5ZD 4ZUTB 3LIZH 4MD0A 4PRDA 1I3VA 2ENYA 4LU5L 1IKFH 2NZ9D 5E2WL 4DZ8B 2J8UA 5BVJB 1K6QH 2EDKA 1YA5A 3MJ9H 3KPSD 2OZ4L 1A21A 2QQQA 3CK0L 3RWGA 4RBPH 3D5OF 2HRPL 1EH9A 3F6IA 5E2VH 1FL6A 5IB3B 2VQTA 5CMAB 3ROLA 5D2NA 3TZVC 1FC2D 1V7ML 5DJXB 3QEUB 5FUOL 5GGVH 2YEZB 2FWOB 1OGTA 2JK5A 5KTEL 1KBGL 1EFXA 1PKQE 5J6HB 1FFQA 1OQXA 5SWZD 1G84A 3MV8B 5D6CA 1DBJH 1OT2A 1CCZA 4FQXB 1P9MC 3CXHK 3PWNB 4NZDA 5HYSA 1D5BB 4NZUH 2DWDA 5HD8C 4YUEH 4PREA 1JHKH 4UDTA 5MEQB 5FYJU 1U3HB 1MOEA 5CEXB 4KV5F 5DFVD 2EYRB 4P5KB 4AENA 4NCC2 2CIIB 2OQJB 3NA4A 1ZLVH 5EB9A 4KJWD 3KPTA 2X4TA 1U2HA 4XXDA 3MV8D 1T7ZA 1ADQL 1FG9C 3BWAB 4FQXD 3R06A 1EHLL 3PWPB 3HE6C 5SWSB 3R1GH 2KZWA 3P30L 5D1ZA 5IBTH 3UZQA 4NJ9H 1ITCA 4LSSH 1U3HD 3GSRB 5F9JB 4D9LL 5E08H 4KPHL 2GCYA 4M1DL 3WXWH 3HZKA 4HKBB 2P5ED 4WV1B 2GTZA 1WSST 32C2B 4YGAB 5FO7B 5T3ZH 3I6LE 3BQUC 2IAMB 4PLJC 4UV7L 4N90D 4ALAH 2AJSL 4XXCA 2V5RA 4OD2B 3PWPD 1YZZA 5SWSD 2VISB 4X5WA 4N9GB 1JZ7A 1ZS8A 5HYIA 1JPFB 1KPRB 3MBEC 4OFYA 5EFIA 5FUCE 2R23A 4LEXL 2IAMD 3DRTA 4MA8H 4LFHD 1JNLL 1SVZA 4QXTB 3QO1B 1VPOL 4ZUWA 4KDWA 4MNQA 2PKDA 3FFCE 1A7PH 4WTXA 1XF2A 2R9HD 1NCNA 3DO7A 2DN7A 1TJGL 1B0RB 4KHXL 5D2LE 1HZHL 1V3KA 3T0EE 5ID1B 3ARTA 4NDMA 3LOWA 4OCWH 4GRWB 3EIFA 1WT5C 3CFKB 5JW4M 4UNVA 3V5DA 4AM0B 2FO1A 1S3KL 1FNLA 2YHGA 3JUYA 5I19H 2AV7B 4DVBA 5C0JB 4MQSB 3ELAT 5C0AB 2YWZA 1DLFH 3REWB 1YEEL 2LTQC 4OI8A 4MAYA 4L3AA 4MX7B 2ZSWA 3C5SA 1PY4A 1S9WB 5BZDB 2GJZA 5C08D 2NY4B 3UYRH 1VDGA 3MA7A 4K3EL 3VA2C 4U49A 1FPTH 3VXPA 1AHWB 1M1SA 5GS0D 3WNMA 2AQ2A 4LIQE 3AU1A 3MLXL 3S96B 1PG7L 2BNQD 4GLRI 4P5TC 1RVFL 3HS0A 4WTWA 1KLFA 3RY6A 2VLJB 5I30H 5C0AD 4JM4H 4KRPB 4PJ9A 4JJ5A 3BUTA 4PJXA 4KQ3H 1JVKA 2KZ1B 2NY4D 1UM6H 3CC5B 4LHUG 1WVZA 3BWUC 5JDJA 1RUKH 4HV8A 3SEPA 4V1DA 3EYQC 2DAVA 3RNKB 2Y36H 2DQFB 4XP1L 3WL9A 3EOTL 4OLYH 1JGEA 4Y4KD 3MSPA 5CCKH 4TVPL 1BZQK 3ULVC 1G7JA 4KRPD 1JUFB 4P3CH 4MCYA 2AABL 2A6DB 3HE7B 2ZZUT 4U2YA 1UJTA 3BKCH 1REIA 1GGCH 3CFCH 2GITA 4PV8B 1RUPH 1F90H 5CHNB 5MHSE 1KJ2A 2HLFC 3CFBA 3IJYA 4G6ML 5A43C 4R0LA 4YHOH 3D69B 5MI0B 1FVCB 3UJIL 4M4PA 4LCWA 1CICC 4I18B 3E8UH 4FZEH 5DJYA 2OL3L 3HE7D 3PV6A 3P0GB 5ADPH 4X4YB 4NM8L 3RPKA 2WK2A 2QKIA 1PY9A 4CDHA 4TUJA 1MAMH 1KIRB 4YEFA 5GGSB 3BP5A 1A9BA 1QR1B 4MJIE 3OX8A 1LE9A 3IDXH 1TFHA 1H3UA 4PFEA 4ZYKA 1QFWL 2LV4A 5E4IA 5E9DB 1R6VA 4ZFFA 3ETBF 5B8CC 2B7DT 5ANMB 3LEYH 1JN6A 1C5DB 2LQRA 4WRLA 5F8QC 2IGFL 2BNUB 4YFLF 3BISA 4LBEB 3VRLE 4UTBH 4PBXA 3FT3B 1U91B 1WZMA 3IS1X 1PBYA 1S7VA 4DAGL 1QKZH 3IDGA 4R3SB 3BSZL 4Y5VC 1Z3GL 3EW3B 4GS7B 3BMWA 2DD8L 4R4FH 1GIGH 3Q6GH 2OJEB 5E9DD 4AG4L 4AIXA 1VB9A 3ULSB 2Y6SD 1KN4H 3O2WH 1J0YA 5I1DB 4MXQC 3WO4B 1NGQH 1UM4H 3D85A 4RMUA 5T5NG 5E56A 5FFLA 3S6CA 2VRAA 5ILTL 4QTHB 4AT6A 5KVEL 3GGWA 5GRUL 1QSVA 1YECH 2XTJB 4WWKC 5D8JL 3VGHA 4AIZA 4AZ8A 3HPLA 1ZT1B 3OWEA 3BO8B 3H9SB 4Q74A 4ETQB 3QWOA 4XVUC 2W9EH 1MJ7H 4R7DB 5CJ5A 1AR2A 3HR5A 3LEXB 4ORGA 3EKCA 1U58B 3AXLA 4WTZG 1F42A 1CFSA 1Z9OA 4LU5H 5E2WH 3VFVA 4YHML 1TZHA 3VFSA 2J5LB 2BSRA 2RBLA 3SJVE 2OZ4H 3CK0H 2XTJD 1K8DB 4UT6H 2EXYC 2HRPH 3H9SD 1KB5L 2MQ3A 4ZAKC 2VZVA 5FYLD 4ZUVA 1PYWA 4YHLL 4GRMB 1V7MH 1JWMB 5D96B 4J7RA 1AE6L 5FUOH 4P2RE 5JXED 3RL1B 1ONQA 4I77L 2A83B 4KUZL 2EDOA 2AERT 2GKIA 3GSVA 4HJJL 3T4AA 5DWUL 2PO6A 2RIKA 4NRXB 4UQ2B 3OHXB 3O45A 4U2ZA 3WHXA 2LU4A 3PP3H 4JM2A 3MRGB 3P4MA 1HOCA 2X5PA 4KXZH 1VEMA 5IB2B 4GOSA 4YE4L 5FA4B 1U8MB 1P4IL 3QHFL 4IBLT 1RPQA 5JA9A 1BVZA 4O2EB 2XZCL 5TQ2L 4NZTH 3WJJA 2AQ3A 5CSZA 5C9KA 2ZKHL 1OAYL 1ROWA 3FT2B 4XPTH 4HWZA 1ADQH 4JFPA 4XMPH 4TOYH 2P7TB 1T22A 5FGCE 4M3KB 2AJZB 4PRAA 1XIWB 4D9LH 3ZE0F 1M6OA 3QRGL 4M1DH 4HH9B 4JGJA 5ABDE 3L3DA 4QF1B 3H2WA 3QUYC 4GT7A 3T0EA 1HXYA 2PW1A 3LRSA 4K7PX 3SDAB 2AJSH 1KCUL 5E8NB 2HP4A 3UDWC 2XQBL 1DCLA 3K1KC 5DJCB 4CW1A 1MFCL 2G60H 1XIWD 4U6TA 2H32A 3P77A 1NAMB 3QNZA 3K1DA 3O4LA 5EBWB 5IUSA 4LEXH 5IGXL 2XY2A 3NFSL 1N3NA 1JNLH 4KDVA 3SDAD 4M8QA 1VPOH 3KYNA 3IDIB 2ERJC 2YC1A 3IDMA 1LO4L 4PRPB 3T2QA 1JPTL 3JTSA 3HFML 3NPZB 1LD9A 4JFHE 1P2CA 4KHXH 1HZHH 3NIDE 4LSRL 4GW4B 4Y2OA 4KKBD 5IHLB 1U8JB 1QRNB 3CVIL 3PGCA 4K9EL 2NNAB 1S3KH 3QZWB 4NUJB 5C0EA 4OB5L 2DL9A 4ENED 2EDBA 3HUJA 2HFGL 1A7QL 1KLGB 4RSVA 3MRNB 4MB3A 4RFNC 2VABB 3GMRB 1KIPA 3MYJA 4K71B 5KAQG 1CFNA 5I17B 5L8LB 4LPXA 3GJFB 1NFDE 1IGJB 2G2RB 5EA0L 1QRND 1I1FA 3ARYA 1LO0L 2X4SB 1UB5B 4IMKA 1G0DA 2VDRH 3C5ZC 4Y4FB 1EAJA 1HHIA 1OB1A 1PG7H 4XBPA 4X6CB 4NKDB 4ZG1A 4G6AD 1EGJA 2CQVA 5D6DA 4XHQA 4OF3A 5DDHB 4GW1A 1T0NB 5IQ7L 4WFGE 2EIZA 3PHQB 1NBQA 4IHOA 5CJQH 4BQCA 3C60A 2DM7A 3OKMB 1BVLB 4U1MB 1WFTA 3FQTA 3MQIA 4Y4FD 2XG5A 3S4SG 4XP1H 3FQWA 4PUBL 4RRPG 1Q9OA 3RIAK 3FO2B 4TVPH 4IIQB 5JQHC 4MJIA 5FYJL 4KI5F 3MRIB 4L4JA 1RULH 5CIPH 2AABH 4B53A 3P4OA 5I1IL 2GSGA 4PRBA 3C09B 2IH1B 5TF1L 4YHYB 3K4DA 2BVUA 2Z35B 3GHEH 1MCLA 3PL6C 3OJ2C 4GMSH 2W0KA 4G6MH 1HE7A 2HTLC 1YEJL 4MA3B 3T1WA 2OX5A 5ICYA 2AXFA 3O6FB 1KNOB 3UJIH 1DBAL 4WHCA 4XPHH 4JPIB 4J6RL 4NQEA 2X4NA 3WFCH 2OL3H 4Y5YA 3U30C 4RQQB 5A2JH 5AZ2H 3EGSA 2IQ9L 4NM8H 5FOBB 2XT1B 2NW2B 3SHSA 1U3HC 3NIFE 5JR1L 1MELA 3PUCA 3VFWA 4I48B 4FTVA 4PRHE 4HZLA 3MREB 1CN4A 3O6FD 1QFWH 3JWDC 3BGMA 4NRYA 4FQ1L 3QQNA 5IHUL 1CGWA 3EFFB 3MRPA 5SX4H 2IPKA 3DUSA 5IQ9B 5CILL 3L3GB 4CJ0A 4F9LC 3ILQD 1NGXB 4FFVD 2IGFH 2ESVE 1MQKL 5EBLA 3TBTA 1EPFA 4ZUUB 1WZKA 5F44A 2UWEE 3OBAA 4TUOA 2HLAB 3SJVA 5E2JA 4DAGH 3BSZH 1JK8B 3O41B 4YFLI 1Z3GH 2DD8H 4KTEL 3BIKA 1LEKA 2FH6A 4AG4H 1KTDA 3WXVL 4TVSa 3EOYG 1T7YA 1RJLB 3QDMB 5DEGB 3G5ZB 4LPWA 2GSIB 4P2RA 1TJHL 3GMMB 1I1RA 5GRUH 3ZKSD 5D8JH 4HCRA 2O5ZL 1ZT4A 4JRXB 5ICXA 3BN9C 1OTSC 1UG9A 2G5BA 1ZLUK 1KG0B 3GMLA 3TP4A 4HIJA 3SE3C 3PWJA 3G08B 4OJFL 2K3TA 2AGJL 1DBBL 3KJ6L 4EDXB 4DN3L 5I66A 2FDBP 4YHMH 1QYGL 3QDMD 4GAGL 4U6XB 1NFIB 1CL7L 2VR4A 3TFKC 4FFYL 4QRRB 4YHNB 4NO2B 2A2QT 1C16B 1KB5H 4JRXD 5T1MB 5H35A 3ZTNL 3X14B 4PJ7E 3ALPA 3S5LB 3CXHJ 4Z7QF 5E00B 4YHLH 4IRZL 1BIIA 3L1OL 3GIZL 4PJ5E 3KLSA 1VFBA 2GYSA 4HS8L 1HHKB 3NCEB 1U8NA 4WFED 5I1LB 4I77H 2BRQA 4D0DA 4KUZH 4XNQB 4QRRD 5DWUH 3L5XL 1Z5LA 4P5MB 1QLFA 1TDQA 1X5JA 3L5HA 4B7IA 1SYVA 3M17A 5IVZB 1LO5A 2WAHA 4WJ5A 2ITCB 4YE4H 2EEDA 5IT2L 3F5WA 4LLDB 4XCNB 1P4IH 1KTLA 3QHFH 2QSTA 1E28A 3AREA 5TDOA 1D5XB 1QHOA 5TQ2H 1XGPA 3EUUA 4Y4KC 2YK1L 2V6HA 4LSVL 1UZ8A 1OAYH 5T3XH 1F5WA 3MCKA 5J7CC 1AKJB 4HIIA 5F1IA 4OGXL 4A2MA 4M6ML 1BJ8A 2P5WE 3X17A 1P4LB 2EXWD 1BZ7A 2GJ6E 3UCRA 4E5XB 1V05A 1WBYA 3KPPB 3RHWK 3I9GL 1F3RB 3ESVF 4JKLA 3QRGH 3H0TB 5E1AB 5KSVA 2IPUG 5ALBL 5B21A 2EYTA 1XGQA 4LFHG 4YAQB 4B0MM 1ZA6A 2YPLB 1R5WB 3LKRB 4YC2B 3LKPB 3F6LA 2Y25A 1KCUH 3QYCA 5C2UB 1AKJD 4P46A 3ZE2F 4G8GE 2XQBH 4IOIB 5JHDE 3ZKQD 1UKSA 5GPRA 4BH8A 4S1DC 1G6RB 4B41A 3ALWA 1S8DA 1MFCH 5FAAA 4FQQB 5J12B 2HJFB 4QCIB 3W11D 5C2BL 4J1UA 1GOGA 4BQ6A 1ZGLP 5J89A 3MV01 1ND0B 5J6GB 4ODTL 5M7QA 2BY1A 1NGYA 4KKLD 4G43B 4XC1L 1DBML 1V3LA 4MSWB 3S37L 9CGTA 3LKNB 5IGXH 3NFSH 1O0VA 2CRYA 2YPLD 5MI0C 2WBJC 3BGFC 3P9LB 1FZKA 3BP4B 5FHAL 4IMLA 1IGYA 3KPLA 3CPLB 2OJZL 4B5EA 1JPTH 3HFMH 2OTWB 4RISL 5F3BB 5IG7A 4UINL 5HI3D 2P24A 1DLHB 1EEYA 5CWSA 5GGRA 4GG8B 3Q5YA 4TTGA 4GG6E 5CP7B 3ARFB 4LSRH 4XMKL 1AXTH 1LDPL 3CVIH 4K9EH 3OXRB 4XNXL 1MFBL 5HYQA 1U8OB 1GGYA 2FEEI 4UNTA 5DJ8A 4OB5H 2FECL 5I1JL 4P57A 1KGCE 3B2UC 3M8OL 4E42A 2Y6SC 4N5ED 2HFGH 4X4ME 3SOBL 1QFWM 1TPXC 2HMID 1MRDL 2JCCB 3TBSA 4XMLL 4ZSOE 3HAEA 1ZGLM 5EZJB 2XWTB 3NCJH 1QBBA 2MMXA 3ARFD 4N5UA 3OKDB 4UAOC 2JLLA 4LCCC 1WBXA 5EA0H 5ESQB 2B1HL 4M1CD 2CPCA 3VRIB 4XNUL 1LO0H 4GS7C 3T2OA 4MJ5A 4KI5D 1UH4A 1MFAH 1MH5A 3ORJA 2WUBL 5IMKB 3EHBD 5IW6B 3T8XA 1JE6A 3LN9A 2QL1A 2BSSB 4L1HA 5GGUA 2D7NA 4N8VA 1UB6B 1PSKL 4HUVA 3QBTB 5I73C 3T3PF 3DETD 4UT9L 4OCSL 4GKNB 1S9YA 3O6LH 5H94A 2ATKA 3CZFB 2NY5L 4OCRL 3IGAA 1IGCL 4LQFL 4JLRA 4XAKE 2NXZC 2DLTA 4DKAA 5EZIH 3LH2L 3RIFK 4DKDC 4I0PA 4LP4A 1E27B 1JPGA 3DX8A 1DDHA 5ESAB 2P43B 1OLLA 4PUBH 4OI9A 1A1OB 3N06B 1S9VB 1CTOA 3NFPA 4PRHA 2CK2A 5FYJH 4M6OL 3KPMA 5I18L 2B39A 4QT5A 4JEGB 4ZUSB 5HVGB 5I1IH 2BHYA 2VZOA 5C0NC 2WV3A 3LDBC 5BS0E 2ZNWA 1S7SA 5F88B 5TF1H 3U83A 3PXHA 5FGRA 4K8RD 4FFWC 1AXSB 5I0ZA 4LRNL 2QSQA 3DXAE 3PWLB 2A73B 1HQRB 3IETB 2FIKB 1KIQA 4O51B 1A2YA 1DBAH 4MVBD 4J6RH 5DD6A 4H25A 2AK1H 4DJMA 4HWEH 1HQ4B 2Z92A 5BZWA 2BVQB 1H8SA 4JE4B 4PS4L 2IQ9H 5HY9A 4F7TB 3WS3B 5IROA 4XZUB 1ZHBA 3CLEL 5JR1H 3DV4A 5IK3B 3IYLW 4KMTL 3RP1A 5DQ9B 5LCVL 4UQ3B 3EOAB 1CFVL 4F57L 1QLRA 1Q94B 2BY3A 4NN6B 4APQD 4FQ1H 5IHUH 4JN2A 4PJCF 1JNJA 1IFHL 4KXZI 3BVNB 5JW4N 5CILH 4IRSB 2Z8SA 4UT7L 1BAFL 4RWYL 1X5HA 2QJDA 1C1EL 5DZLA 1Q9LB 3STBA 3M45A 2F74B 3NBNA 1OP9A 4KTEH 1OARH 4NQCE 1ZA3A 1EVTC 2ZPKL 4PJ7A 3SDAC 3GSXA 1XCTB 2AKRB 3OKEB 3B2VL 3KXFD 3P73A 2VQUA 2YWYA 4PJ5A 2J8OA 2DLEA 2VQ1B 1TJHH 1WWCA 2ZUYA 1WZLA 4FA8A 4PGCB 3VXME 3OJDB 1A14L 3GSUB 4MA1B 4JPWL 4Z7VB 5L2KA 2BERA 3RWDB 1KACB 5DRXB 4BK4A 3SO3B 5GGRY 3QG6B 1AP2B 5DJZB 4OJFH 2AGJH 3DHMA 1DBBH 3KJ6H 4DN3H 5CD5C 4ENEC 3GUTB 4XRCA 1NBZA 1QYGH 2BVPA 1FDLL 4NRZB 5D7SH 1NAKH 4FFYH 4ELKB 1CQYA 1WFOA 3NOIA 5DT1L 4Z9KB 3FAXA 3Q0HA 3ZTNH 3MLTA 4HLJA 2E6JA 4AEHL 4ZNEE 1C08A 5JLZB 1PX4A 1IMHC 1R3JB 2P5WA 2PCPB 4IRZH 3L1OH 3GIZH 3VI3F 2GJ6A 2L4OA 3ISWA 4XPFL 1F97A 5FYKE 3E2HC 2FL5B 3QIBA 2GK0A 4HS8H 1NBVL 3QDJB 4G6AC 2ZJSL 4R4BA 4K71C 3L5XH 5CIPB 1OAZL 2ZUXA 4K7PY 4U3CA 3NN8B 3U9PL 3LEVL 5EUOE 4G8GA 1UEYA 4RCAA 5IT2H 5JHDA 2G9HA 5KSAB 3QSKB 4X7FC 5HGDA 1GCFA 3WUWA 5E70A 5DRNB 2YK1H 3U1SH 4DGVH 3QIUC 4CN4A 1J10A 3KLHD 3GBLA 3DI3B 4JFOA 4F7CA 4OGXH 2Q76A 4M6MH 1VA9A 2OL3B 1QR4A 5IF0B 3TPKA 3V6OC 1INQB 4LPYA 3VD9A 3WKNA 1LILA 2WIMA 3ZMRA 1MLCB 3I9GH 4NO5B 5F7DA 5AYUL 1E6OL 2XFXA 3C8KA 5KSAD 2OTUA 3U6RB 4P48A 2NY2C 3IAPA 3CX5J 5ALBH 3DX9A 4L4TA 1F3JA 4NO3B 4OCNC 5GS2D 1AIFA 2YPKB 4GG6A 4IIQC 1BD2B 3U82B 2PTUA 2GHWB 3RDTB 2Z8RA 2AJUL 1DANU 3MRFB 1ZGLB 4I2XA 4QHMA 3TLRA 1MJJB 2VMFA 1F13A 3C09C 5C2BH 3MV7B 2XWJB 5EN2B 2N4IA 3L9RA 2HN7A 4YHYC 4X4MA 4ODTH 5DSCA 4QHNA 1DBMH 2FCBA 3S37H 3W39B 4RAUA 1IL1B 1JV5A 4PRIB 3O6FC 1BD2D 4ONOA 3RKDC 3NVQA 1FAKT 3RDTD 4C56E 5HYJE 3IKKA 5FHAH 4OT1L 3BD4A 2FLBT 3QHTC 1W0VB 5FECB 1MCDA 3QPQD 2EKSA 3MV7D 4UINH 4FFVC 1A6TA 4OZIE 3EYVB 1ZLUH 1NUDA 3MGTA 4L8DB 4MHHG 4XMKH 3WIHA 2PTTA 1LDPH 3H7BA 3CVHA 4L9LB 3QZWG 4XNXH 4PRID 5I1JH 2R2HA 5L7XL 3M8OH 1MHEA 3OR7A 5F7LB 3DGGA 4PJDF 3K74B 2DKMA 5E8OA 2JJUA 3SOBH 5GJSH 5HDLA 5DJ2A 4Y1AB 1MRDH 1F02I 2EDHA 2OLDA 1HHJB 1CDJA 4ZODA 3U7WH 3FB7A 2ICEA 4XMLH 2OR8A 1MHCA 4GKSA 1TCRA 2Q8BL 4JFFE 4DW2H 3P9MA 4OQ1A 1C8PA 2SEBA 3NPSB 4XNUH 1N2RA 2Z91A 2D0FA 3BD3A 4MDIB 1AGCA 2FYYA 4TUKH 5BS0A 2WUBH 3VDCA 1T7VA 3TCXA 1OP3K 3BUYA 1E4XI 5L0QB 2FX8L 3B3IA 3DXAA 4Y1AD 1PSKH 4OM0L 4NOBA 4UT9H 3RZWA 4OCSH 4DVRL 3IFLL 1CDIA 4U05A 4RGMB 5HHPA 2NY5H 1U8LB 1IGCH 1UWEL 5EO0B 1JYVA 1ED3B 4LQFH 4L3EB 5ISZB 1HYRC 4JAMA 3LH2H 2IBZX 4MNHB 4OAWA 2E6PA 2P48B 2V5MA 4HJ0C 1CD1B 4XB7A 4HKXA 5F96L 2NY1D 1RAMA 5FYKU 1EEZB 1EHAA 1D6EB 4KZDL 4Y19E 1RI8A 1CVSC 4M6OH 4WI4A 4EI5B 3LKSB 5I18H 4XX1E 3ZO0A 5D70L 3N50A 3K8MA 2VLKB 4U1JA 4DFHA 5ISZD 1A7RH 3BD5A 3O3UN 1I85C 1BFTA 1GZQA 2XKNA 4LMQI 5I16B 4LRNH 5IW1A 3LD8B 4CADB 4HSQA 2NTFA 3EAKA 5BRZE 4EI5D 3I50L 1UKQA 3IF1B 4WUUE 5HDBF 3BE1H 1BJ1H 1CGXA 3TC9A 4M1GL 2JJSA 4NQCA 2JK5B 4JDVB 2AXGA 5EC2B 2ARWA 2C3XA 3L5JA 4JR9L 4QHUB 4NSKB 4XNYH 3CLEH 1FAIL 1Q9KA 2EDXA 3RWEB 4KMTH 4OLXL 1VEPA 1PEWA 2APXA 3OJMB 2DWDB 5LCVH 5JTWA 4PREB 4L29A 4LCIL 3VXMA 1X3DA 5EO9A 4C59B 4X80H 5CD3A 4LNRA 3U9UB 5ACZA 3W0WA 1FFNA 1MJUL 25C8H 2OR9L 4WU7A 4X6BB 4HLZH 2ATPA 1IFHH 5DD0L 4XCFL 2Q87A 2MCPL 4I3SH 2OTPA 4ZS7H 5AAWA 4S0TD 1PZUB 2AJVH 4K3DL 5DHYA 4UT7H 2X4TB 4XXDB 4WHDA 4ODWA 5D5ME 2CDEA 2PETA 1C1EH 4X98B 1CT8B 1BZ9A 3W11C 3NGBC 3R06B 4Y7MA 5I0DA 4H5SA 4KKLC 1NMBL 5D1ZB 1W72L 5TE4L 4NHCL 4PGDA 1OP5K 4U3XA 5TH2A 1GJIA 1CYGA 4G3YH 3HZKB 4JCMA 4YC2C 2RCSL 1WAAF 4HFWB 4ZS6D 4ZNEA 4RAVA 4OUOA 1DQLL 3OKYA 4CUCA 4WTZA 3S36X 3CSYA 2DM2A 4OSUL 2CUHA 3SDDB 1IARB 3FQUA 1A14H 4KJYA 4U1LB 5E4EC 5EC1B 5I75B 1ODAA 4JPWH 4Y5XB 4MJ4A 5I6XC 5D1ZD 4X5WB 4JN1L 4EDWL 1XF4A 2F54B 3ARDC 4QYOB 2HAZA 5EFIB 5EUOA 4HKJB 4X6DA 4ZXBA 2R23B 1UWGH 4N0FA 2YD5A 5JNYB 1FDLH 5K9KA 5A2FA 3D3VE 1JMXA 1MWAA 3SDDD 5DT1H 3TO2A 1I1CA 3A0OA 3ZDXF 5IFHH 4KC3B 4MNQB 3S5LG 1YEDA 5I9QB 1QQDA 4AEHH 2YUZA 5C6PB 3NIGF 3DO7B 1TETL 5K9OA 3FO0L 2ITDA 3HN3A 2F54D 3WDJA 4XPFH 3QUXB 3V5KA 3VCLA 3ZHLA 4OFYD 3KYAA 1A64A 1RZKL 1NBVH 2AEQH 2ZJSH 2R1WA 4PJEF 4TN9A 3GSNL 4P3WA 4ODSL 1V7NL 4JZJC 1S9KC 1OAZH 4TYUA 4MNQD 2QSCL 4S2SA 1I8MB 3ARXA 4QNPF 1A3LL 3LEVH 3IDJB 4HH8A 2XXCB 4NN5B 1AJ7H 4RGNE 1R0AL 1YYML 4MAYB 2ZSWB 2C7UA 3K8KA 5F1NA 4P99A 4IOFC 3QUXD 5IVNA 3HRPA 4M6AA 4PJAF 3WS6A 2X42A 1HSBB 5CEYA 1CGSL 4PD4K 3VXTB 4X6EA 5BJTB 5KANI 2VITB 5JIPA 5HGBA 4IS6A 5FYJD 5HPMB 2YUWA 3AU1B 1AGEA 5A16B 3TIEA 4BSWB 2CUMA 3HS0B 4DEPC 4C56A 4QHKJ 5T1KA 4ODUB 3SBWC 2UY6A 1I8IA 4ZFGL 3ZT7A 4MAYD 4NN7C 1E6OH 3SDCC 4K8RC 4FABL 3G9AB 5BOPA 2BOCB 4OZIA 3AVEA 1SMOA 3DTXA 4HV8B 5EUKA 1CQKA 2CLVA 2D7TL 4N90E 2P47B 5JORA 1NCAL 5LXGL 1OSPL 3ARBB 2VLMD 1J0KA 1JCKA 3PWPE 4WFFD 3VFOB 1DR9A 3CFDA 3BFOA 4QOKE 4JDZB 4C58B 5IMMA 3PQYE 5E7BA 5IV2A 2BMKB 3IXAA 1LHZA 4JY6B 2IEPA 3S8WA 3QUZC 5F7EL 3L3JA 1BOGA 1IGML 1U3ZA 5JZ7C 4V1DD 4TSAL 4JANB 4ZPVA 4APQC 4GXVL 1L4IA 1F11A 5EZOL 1DFBL 4OT1H 4YHIA 4ZFZB 3MRRA 3S34L 5D93B 4R0LB 1YYLL 4F7PB 3EJZD 3HC0B 4LCWB 2R0KH 4JY4A 2H2SC 1JJUA 5DJYB 4CVXA 4JRYB 4U6YB 3I6KA 2HJKA 3PV6B 4MNGB 1MQ8A 3L3HA 4Z5RB 1JWUB 2QKIB 1I1YB 2NY3B 1E6JH 3Q1SL 4R97B 5L7XH 4JQIL 5J9PA 3K81A 3FB8A 4Q6IB 4DOHE 1U0QA 1FRGL 2EE9A 4LRIC 4ZYKB 2D7OA 3BXNA 3VFTB 2H3NA 2JB6A 4LCWD 4ZFFB 1ZVHA 4Y19A 4JRYD 3KPOA 1JN6B 2AJ3B 4OQTL 2Q8BH 4D9QD 4YWGL 3EJYD 3G9VA 2ORBL 4HS3B 4JFZH 1HXMA 3KYMA 2MFNA 2NY3D 5GGQL 4PGBA 3OTTA 2VN4A 3QFDA 5LAXA 4GO6B 1S7VB 5ALCL 2A74B 1DQQA 3QDGA 1F8TH 2FX8H 5C71A 4HUMB 3S4SA 2I9TA 4DVRH 3IFLH 3LN4A 4QGYA 1AQDB 4BYHA 5BRZA 4WUUA 1TLKA 3RPIA 3N9GL 2R8SH 2DLFH 1UWEH 1A4KB 3D85B 3MNZA 2E7LC 4OCMC 1Q72L 1PKQB 3SO3C 3X3FL 1KJMA 3HPLB 3QWOB 1XZ0B 3G6AA 5F96H 3I3EA 1U42A 4LOUD 3O8XC 2C3VB 4X6FA 3QXAA 2ARJB 2VLJE 4UILL 4KZDH 5HBBA 4R90H 2W9LA 1BBJB 3RZCB 2ZUVA 5F9OH 1AR1D 1QNZL 1FZMB 3VFVB 5D70H 1CFQA 4P59L 3OB0H 1RUQL 1Q9WA 5ICZB 5F7FA 1KELL 1TZHB 3D85D 3V8CA 1R3LA 4W6XB 5H37H 5DVOA 4NFDA 3RIFF 4K3JH 5D5MA 3UP1A 4ZUVB 4OF6A 2Z31B 3PDDA 3ARRA 3QQ4B 4M5YL 4Z76A 3MCLL 1EVUA 1B90A 3KLHC 1EDQA 1R5IA 3RZCD 3N1GC 4G7VL 3D1MC 3VXUE 1P1ZB 4JR9H 5M95B 3MMEB 3UPRA 2J7LA 3NH7L 4L3CA 1NSNL 1FLRH 4FQIL 2R69L 1FAIH 3PXJA 3KHQA 1ZV5A 4YDJB 4OLXH 4XP6L 3QJHA 3P4MB 1FP5A 3HG1B 4LCIH 2Z31D 2C3WA 1AGBB 1SHMA 1FSKB 5BV7L 2UVEA 4NNYA 1CG9B 1JL8A 5DD0H 4G7YH 1H0DB 3RVUC 4JZNA 1WFUA 1KCRL 3GI9H 4K3DH 4YH6A 1VFOA 5H2BA 2DMKA 3GMQB 3FTGA 4HWZB 1TVBA 1JZ4A 4LGPB 3I6LD 3PDOB 3VXNB 3KNBA 4NWTL 5I8OL 3D3VA 3QR2A 4I5BA 1NMBH 1W72H 1N7MH 5TE4H 4NHCH 4PRAB 1QD0A 4PJEB 1CD8A 4L8SB 1M6OB 3FFCB 3GRWH 2RCSH 3ZKXB 3G5XB 4PBWD 5D2LB 5FM5O 2V7NA 1F6LL 2WBKA 3JV6A 2FEDD 5EU7C 4E0RB 1HXYB 2XV6B 1B0GA 4Q97A 4OSUH 3QPQC 1L9MA 1WIUA 1AY1L 4DZ8A 1T0MB 3RWJB 5BVJA 3L95A 3MOQA 3DROB 1RU9H 4P2OC 1KJ3L 1EFQA 1I9IL 4JN1H 4EDWH 4NQUA 2OI9C 3FFCD 2H32B 3P77B 3ZTJH 3P4NB 3DX7B 5IB3A 1RMFL 4UTAL 5CMAA 4AH2A 1HSAB 1FO0L 1I8LA 1TQCC 3T0ED 1P4BH 2YEZA 1MCIA 3MGAA 2FWOA 3B9KB 1RFDL 1EERB 2CR6A 2XTJE 5J6HA 4KV5E 3H9SE 3LS5L 4O02H 3MV8A 3IDMB 2XN9B 4YBHA 1OWWA 4FQXA 1IC5H 3PWNA 1BGXL 4IDLA 4L9LC 3IJHB 1P2CB 3FO0H 4WI5A 2LAAA 5MEQA 1RZKH 1AC0A 4HS6A 5CEXA 3QNXB 2EYRA 3MTRA 3PGCB 1HYSC 4P5KA 3WSQH 3SKUD 3B9KD 4ODSH 3X12B 2IC2A 1V7NH 2OQJA 4ZD3H 2WLYA 5CKAA 2QSCH 2XN9D 5FYKL 2ZG3A 3BWAA 3MYJB 1DQML 2FECI 3PWPA 5SWSA 5AUMB 4QOKA 1JYXA 3BDYL 2W1NA 3ZYJA 3GSRA 2Q1EA 5F9JA 3AY4C 5BMFL 1CGSH 2NY1C 3PQYA 4R2GD 4C57C 3U46B 1S7RA 2R56L 2GK2A 32C2A 4LVNC 4O9HL 5L0QC 1F58L 4UOJA 3V4PL 4PGEB 5IMOB 4F8TA 3VG9B 1XF3A 4D9RE 3ROOB 2X1XR 3SQOL 1YJDC 1NFDF 4ZFGH 3BZDA 4PP1C 2OCFD 4MGXA 2VISA 4FABH 4JKPL 4JQVA 2VDNL 4HDIB 4IHOB 1WC7B 3C60B 5D9SA 4FXKB 2D7TH 1KPRA 4NQVA 2CDFA 1NCAH 5BVPL 1GZPB 3T2NL 4EI5C 1OSPH 4KVCL 1VGEL 1J1XL 3VMOA 1Q9OB 3SKOB 3UTSB 4YPGB 4QXTA 3QO1A 3HNSL 5MHSD 1RJZB 1I7RB 1QSEB 2VZ1A 1OP5H 1P7KB 1DN0B 2B4CC 4W68A 3NACL 2XA8L 2OP4H 5F7EH 1B0RA 1IGMH 3F58L 3C60D 4S0SD 4TSAH 3QFJE 3U4BL 5D2NC 4GXVH 5EZOH 5EU5B 3U2SB 3CFKA 1DFBH 2P1YA 5J13B 5MEPA 2ZOKA 1H5BC 1A7NL 3S34H 1YYLH 3I75B 5C0JA 1QSED 2BVOA 3FQXB 5E6ZA 4ACPA 4F2MA 1ZLWK 4UV4L 3VJ6B 5IBUB 4MX7A 4XGZB 3RL2A 4JFXB 1S9WA 1ACZA 1J0HA 3UTTB 5DR5L 3JV4A 4ERSL 5DJ6B 1AHWA 1D6VL 4JQIH 3B4NA 4OBSA 2YR3A 5LQBL 4TULH 3LVEA 1FRGH 1J0JA 4PRPE 4XVSL 2IBZY 1CGYA 3BGMB 3S96A 1JRHL 2VLJA 2LE9A 4CBPA 1CLYL 2IPKB 3DUSB 3SN6N 2DQDL 1WTGT 3QULA 5ERWA 4OQTH 4YWGH 4ONFL 3UAJC 3CC5A 3RVTD 3SO5A 3UTTD 5GHWL 2VOTA 3TBTB 3OXSA 5B38A 3BYTA 2NCMA 5ALCH 4U0RC 2YD1A 3RNKA 3CH8A 4JPKL 3BIKB 1LEKB 5CLWA 4FQLH 2NY0B 2YPVL 4XXCC 1AC6A 4POZD 4H8WC 1JUFA 1DQJA 5IVXF 3N9GH 4OTXL 1CR9H 3GSQB 4P2RB 2DTML 1Q72H 1Z2KA 3HE7A 3VXUA 3MLZL 3WUZA 4MA7L 3T0DA 2B0SL 1ZT4B 4PG2A 2B4CH 2DQIL 2F8VA 2DOCA 5H8DA 2MCG1 3T2PA 1DVFB 4UILH 5TE6H 2PNDA 1DBKL 2NY0D 1QNZH 2HKHL 3D69A 5I66B 3OKKA 4P59H 1RUQH 5DMGD 2WUCL 1KELH 1A6PA 2Z93A 3MCG1 4P2RD 3BIBX 3RTQB 1T4KA 1MCSA 2AJXL 2YSSB 1SBBA 1DVFD 1KIRA 5JIIA 5GGSA 5FGCB 5C0RL 1BIIB 4M5YH 2AW2A 2EDLA 1M7XA 4GBXB 3TJEL 1WQVT 4G7VH 4G8EB 2R4SL 3GSWB 3O3AB 2B5IB 1U8NB 4OFVA 3BZEB 1UJ3A 5C1MB 4JHWL 2MJWA 3NH7H 3SE8L 4FQIH 2R69H 3RTQD 1Z5LB 2J88L 2ZG1A 1SYVB 5F1SA 4XP6H 4Z18A 2BNUA 5IKCA 2E7CA 4LBEA 5T3ZE 4WJ5B 3FT3A 1U91A 3EYOA 1NMAL 5F70A 5BV7H 3JWNC 5SX5K 4GBXD 1KTLB 1E28B 1JF1A 4OKVB 3UBXB 3DMMA 5IR1B 4UU9B 4JFQA 4ZMAT 1ZEAL 1XGPB 3ULSA 1UEMA 1AH1A 4HUNB 4OLZL 1TTFA 3BI9X 1OAKL 2D7MA 4PJ9C 4XWGL 5I1DA 2JE8A 4HIIB 5F1IB 1MCEA 2XOTA 3L7FB 4NWTH 5I8OH 4QTHA 2DI9A 2OYPA 1WBYB 1AGFA 1ZT1A 3H9SA 4IRJB 3HLAA 3BPLB 4MS8D 5F7NC 3ARED 1LMKA 2CKBL 4WEBL 1U58A 2EYTB 5D7IF 1S5HB 4EUPH 3F65A 1VFAB 1ZA6B 4QXWA 5IB1A 5JXEA 5F9DC 3AMLA 1AY1H 3VGGA 4P46B 1WF5A 2J6EL 3KPNB 5FM4A 4BH8B 3ARVA 1WWWX 1S8DB 3T1FB 1I9IH 2FGWL 3C08L 2R1YA 3I3BA 4IRJD 2VL5A 5M94B 1T20A 4JFHD 1EMTH 1NKOA 1T1ZB 4GRMA 2X2YA 1JWMA 3DBXA 1G7QB 5JMRA 2HG5B 4OIIL 1NFDB 1IZJA 1R3KA 1PKOA 1RFDH 3RL1A 1FZKB 3LQAL 4P46D 5EORH 3LS5H 4JRXE 5GISH 1N4XL 4U1KA 4Q9RH 2R2BA 2VNCA 3BKMH 4NRXA 3QXDA 4NC1E 3OHXA 1BGXH 3EJYC 3ZKMC 4BQ9A 4CU7A 4U6VL 5EOQL 2EDJA 3PIQB 4ZQKB 1AO7E 3B9EA 3MRGA 3VD4A 5IB2A 1JFQL 2CDGB 2GY5A 3MNWA 4WDIB 4WFEE 4GMTL 3RA7L 4O2EA 2E6QA 4QRRE 2F53E 3IDYB 5KOVC 4KAQH 3ZE0E 5IFJB 4P57B 4PD4J 5IMLA 2BVYA 3FT2A 2UV3A 1T89A 5DC9B 3PGFL 4XP9L 2P7TA 5DURB 1DQMH 3L7EB 1IM9B 3FB6A 4TQEL 2VZ3A 4ORZC 4ZOAA 2AJZA 3BDYH 3A6BL 3HAEB 3HB3C 4LASL 1K9TA 1MI5E 1XIWA 3LHPL 3VXRE 4HH9A 3DV6B 4QF1A 3VDAA 1F58H 4MJ5B 4CMMA 3GM0A 4WFGD 3V4PH 4CVZB 3ULUL 2FH8A 5DVKA 3SQOH 4BJLA 3IB4A 5DURD 1OAXL 1IM9D 5F9WC 2WWMC 5DJCA 5H94B 4HIHA 4E41B 3F7YB 3IGAB 1NAMA 2J8UF 5EBWA 5BVPH 2AK4B 3T2NH 4KVCH 2OK0L 1DDHB 1VGEH 5FO9A 5HGHB 4C4KO 1J1XH 1KJ2H 5GGSY 4DCQB 1JGVL 3NFPB 3HNSH 1RY7B 4LLWB 5C6WH 3KPMB 4JO2L 4PRPA 4QT5B 3HZVA 3NACH 4YXLL 1FZJA 4NNPL 1P84J 4FN0A 4E41D 3F58H 1S7SB 5T33L 2H45A 3U4BH 4G6FB 4HIEB 2BK8A 2AK4D 1U8JA 4HGWB 4R26L 2ESVB 1T83A 1A7NH 1KIQB 2CXGA 3QZWA 4NUJA 2VUYA 4ZOCA 2UWEB 1A2YB 2DQUL 1GC1L 5CSBA 2EIDA 3MRCB 4YQXL 1KLGA 1K4DB 2PO6C 1YEFH 2VABA 3GMRA 4UV4H 1S9XB 2Z92B 4LLQB 2NW3B 3MJ9A 4NM4L 1FORL 1X5FA 4Y88A 4JM2C 5I17A 3FN0H 3TA3A 2KH2B 3GJFA 1WWAX 2COQA 3EBAA 3MXVH 4MCZB 4YGVA 4AQOA 5LQBH 2ESVD 2X4SA 3KPQA 4XVSH 3VFGH 3DVNA 1UB5A 3PWVB 5KVFL 3WJJC 4Y4FA 5D71L 1JRHH 4LVEA 4YFEA 2AEPH 1PLGL 4LSTL 2HT2C 4WNQB 3RX8A 2P8PB 1CLYH 4KK6C 2DQDH 2EO9A 5J3HC 4WEMB 3OKNA 3DWTA 1MNUH 5DDHA 3VD3A 2BFVH 1LO2L 4ONFH 5J1AA 1T0NA 2QQLH 3ZKND 1KF9B 5CGMA 5C8JB 4N68A 3PHQA 1GSMA 3OKMA 4N1CA 4K23L 2WMPA 4JPKH 4U1MA 2NXYB 2F19L 3T0EC 3GSNB 1ZA3B 3CGTA 1QVOB 3R4DA 3FO2A 2YPVH 4JFDE 1G7LA 1YY9D 1FL5B 1JGUH 4N0UE 1IRAY 5E5MB 3I6GA 3MRIA 1CI5A 3S3SA 2DTMH 2X4UB 3KJ4C 4FS0A 4MA7H 2B0SH 3W81A 2DQIH 3G5YA 2XI9A 4CRPA 3L3OB 3LMJH 2PXYC 4RGOL 2NXYD 3L5WB 4S1QL 4R96A 2HRLA 1G9MC 1VKXB 4MA3A 1SM3L 2HKHH 1NEZB 4YDVA 4JPIA 1NBZB 3ZT6A 5IESL 2WUCH 2BVPB 4WCYL 3WYRA 5EO1B 4HK0A 4KJQD 4RQQA 3UTZA 4X7EC 3DPBA 2FO4B 4Y2DB 1G9NL 1B2WH 2W60A 2NW2A 2WZPD 1C08B 4M7LT 5D7IB 3OAYK 5C0RH 4R2GC 3KYKL 2GJ6B 3TJEH 3QIBB 2GK0B 2R4SH 2BOBB 1INEH 4BZYA 5CP3H 3RNQB 3EFFA 4JHWH 3SE8H 5IQ9A 2J88H 4HFUL 1KEGL 4Y2DD 5EU4B 5E7FA 2E5EA 4Z7WF 5TPWL 5C0DA 1SBSL 1U8QA 4W6YB 5JHDB 3NA9L 3O3BA 2G9HB 3OR6B 2GJ6D 3QXTA 4ONGL 3O41A 4IMKC 3QIBD 1UM5H 4DZBB 3WUWB 1NC4A 3MOAL 5AAMA 5CZKA 1ZLWH 2VDPL 1A6AB 4OZFH 4OLZH 5D6DC 1OAKH 4XWGH 1JGLL 4JFOB 1FVEB 1QBLH 1RJLA 2ED8A 1J0IA 2GSIA 3BEWB 1PDKA 2HTKD 5CBEB 4EEEA 3LQZA 4HWBL 4XTRC 4AL8L 3FB5A 4JRXA 4KK8D 4Z0BL 5TFSL 5HXMA 5MERA 1NGPH 3C60C 3UJTL 5JHDD 4JFYA 1T7XA 3JBG7 3SE4A 2CKBH 1KG0A 4P23B 3DX9B 4B50A 1UZ6F 5K9JL 2BCKB 4JRWA 2F58L 1MF2L 3G08A 4GG6B 5GZOC 4EDXA 4Z7QE 1G9MH 5DA4A 3IFOA 3SDXF 2J6EH 4U6XA 1NFIA 3ZSTA 4MDJA 3T4YB 2FJGB 4HIXL 4QRRA 3SKMB 2F53A 4YHNA 1EAPB 4NO2A 2FGWH 1C16A 3C08H 3B8YA 3V6BR 1H3GA 1WIPA 2HN7B 4WO4B 4HAFA 4Y89A 3S5LA 4ODVL 5E00A 1NJ9B 4ZSOB 4RAUB 4OIIH 1JV5B 5HDQL 1MI5A 4DGYL 1HHKA 3MJ7A 3WD5L 1M4KA 4L4VE 4Y5YC 1KSRA 2BZDA 1FE8L 3QQ3B 4P5MA 5GGVY 1KGCD 1VCAA 1KCLA 2EKSB 4U6VH 5EOQH 3RVTC 4WO4D 4JO1L 2ITCA 3EYFA 1JFQH 3A6OA 3H7BB 3F62A 4XCNA 4CU8A 1MCPL 4GMTH 1MJ8L 4X83A 5KVGL 3O4OC 4RIRB 3IDUA 4KROC 4RNRA 1RUAL 5E8OB 5DK0A 4P9HL 5HVHB 2JTDA 1AKJA 4XP9H 5DJ2B 3GKWL 1FNAA 2DMBA 3FB7B 3UYPA 2GT9B 1HKLL 1P4LA 4E5XA 3A6BH 1MHCB 2WQ8A 3KPPA 4LASH 2EDFA 3LHPH 3ZE2E 1WLHA 3FCTA 3QDJE 3H0TA 5E1AA 4TVPE 3FRPG 2EYSA 2Z91B 4TTDC 2D7QA 1AGCB 5BS0B 1CDUA 4OIAA 4XAKD 4RBPK 3STLB 3ULUH 1H3PH 2YPLA 3I02B 3LKRA 3LKPA 5IBLC 5DMGC 5DXWA 3QJFA 3QB7C 4OZGF 3K2MC 2YD4A 1TTUA 4P5TA 5HHPB 4FQQA 2HJFA 5SX5H 5D72L 2FR4A 1ERNA 1ND0A 3PNWA 1L7TH 3OZ9L 4NBYB 4HLZG 4G43A 4OAWB 4MSWA 2OK0H 5BS0D 1TMCB 3LKNA 4HC1L 4WW1B 2F15A 1CS6A 3P9LA 5IEHA 4XCEB 1JGVH 2CMRH 1A0QL 3BP4A 3KWWB 3CPLA 4JO2H 3QHZL 5FM5M 5IWLA 3IU3B 4YXLH 2OTWA 5F3BA 4NNPH 2VSCA 1BOYA 1DLHA 4U1JB 3G6DH 4GG8A 4Y4HB 5T33H 1ZLVK 1I8KA 4OV5B 4PPTA 5CP7A 1I9EA 5BW7C 2HFEB 3F7VB 4LSUH 5FM8A 3OXRA 4R26H 4KKAD 1U8OA 3ILPB 1UT9A 2B5IC 3MLYL 4EUPB 5B39A 4QY8B 1PJ9A 1GC1H 1EZVX 2R0LL 3VFPB 5IBUG 1LEGB 2HFTA 4EN3C 4NM4H 1FORH 2RR3A 3GBML 2OZ4A 1OTTC 3OF6D 1GOFA 4Y4HD 4PRIE 4TNVK 5EZJA 2XWTA 4N0UA 1Q9KB 4GLRH 1FYTB 4MJ6B 3T3PE 5ESQA 3BYYA 4MS8C 3AREC 1OSZB 2DIBA 3VRIA 1FO0B 5KVFH 5CD3B 4U6HA 1MIML 5ACZB 4DTGL 1FJ1A 1PLGH 1FYHB 1LDSA 1K5NA 2BSSA 3MRMB 2ATPB 4WI2A 4FHBD 3BPOC 2Q20A 3V5HA 4NQCD 3BH9A 3VXSB 1LO2H 1GPOL 2WIIB 2X9YA 1A1MA 3CJJA 4GKNA 5HHNA 3BESR 2CDEB 3MX0A 3CZFA 1BZ9B 1FYTD 4XNMA 3MUJA 1MCQA 3VXOA 4K23H 1E27A 2WP3T 3O6KL 1II4E 2F19H 5ESAA 1F4WL 4Y1AE 4OLWL 3OKOB 1RK0A 1S9VA 4K94C 2WBWB 4I3RH 3QQ9C 2QEJA 5HHVL 4P46C 1ADQA 3VXSD 1T5WB 5GSRA 4NOFA 3EZ8A 3UZEA 5F88A 1JP5A 2VH5L 1U6AH 3CUPB 4RGOH 1AXSA 3MJ8A 4Y16B 4NFCA 2A73A 5E2VL 3IETA 1HQRA 2FIKA 1SM3H 5B4MD 5EUOB 5DC0A 5IESH 4WCYH 5FYKD 3FT4A 4L3EE 2DYPA 1HQ4A 2YZ8A 3REVA 2BVQA 3VDBA 3U0PB 4F7TA 3WS3A 3TO2B 4PJCE 1G9NH 1QFHA 1DBJL 1N26A 2IFFL 1YEDB 1QQDB 1XGRA 1BQHA 4IJ3B 5IK3A 2FBOJ 3LZFL 4X9IA 5K9OB 4NZUL 4Y16D 1NCDL 3KYKH 2QBWA 3HZYB 5T3XE 4YUEL 3SDXB 3V5KB 4NKMA 1Q94A 3VCLB 3LCYA 4GAFB 2VLKE 2ICWB 4G6KL 4I13B 1ORSA 2XPGB 4WI7A 3BVNA 4GQPH 4IRSA 4KMLB 3V2AR 4HFUH 2HH0L 1KEGH 1PGRB 5TGBB 1MCRA 4MQXD 5TPWH 5E2UL 1D3CA 1SBSH 1OL0A 1BJMA 3FOMB 2C7UB 1CK0L 3UBXG 5IFAL 5DUPL 2NY6C 4ONGH 4Z0XB 5TDPA 2BHZA 1WCBB 4P9HC 3MOAH 5D1XB 3P11H 2QLVB 2VDPH 4XCYB 5HGBB 1XCTA 4WU5A 5T3ZL 1GGIH 1JGLH 1H3VA 4LLAA 4JQXA 1UQSA 3ULUF 4RFEA 3TBVA 5HYJB 4PGCA 4HWBH 3OJDA 1X5XA 1U3YA 4AL8H 4FG6C 5TFSH 4Z0BH 3GIVB 4L4VA 4NIKB 4I0PC 5DRXA 1KTKE 4HGMA 1UACL 5K9JH 4OZIB 5D1XD 3QG6A 4N0CD 4WHYH 4IDJH 3VW3L 1AP2A 2KPNA 5EUKB 2B8OT 2F58H 2CLVB 1JMZA 1DEEB 1UKTA 5DJZA 5JORB 1H3XA 4KKCD 3SCMC 1K2DA 5C0CB 3VI3E 4NRZA 4YHZL 3GDBA 4ELKA 3QCTH 4HIXH 3QAZB 3IVKA 4AEEA 2CR3A 5HYJD 1N5YH 2NPLX 4LL9A 1F2QA 5GRYA 1A7PL 3PG2A 3TJHD 5IV2B 4ODVH 3IXAB 5JLZA 3NABH 1R3JA 2A77H 2C4FT 2PCPA 1MY5A 1KCVL 1HILB 4M00A 2FL5A 5FKAB 4OZGB 4XHJD 1QHPA 1F11B 3WD5H 1KENL 3VWKC 4EI6B 3QDJA 4JFFB 5C0CD 1RK1B 4G80A 3ZHDA 4LQ1A 3THMH 1N0LA 1FE8H 5EU6B 5CIPA 5IROC 1I4FB 4XP5L 2F54E 3NN8A 4HEPG 5GZNC 5HI4C 1DLFL 3I6KB 1FZOA 1N59B 5KSAA 3L3HB 1MCPH 4RDQF 1MJ8H 4EOWH 4J3XA 5KVGH 1IAOA 3O2DL 4JFFD 5I74B 1AGDB 2FNBA 3TCLA 4P9HH 4KRLB 5CINL 5EU6D 3GKWH 5DEFA 2H3NB 4MJ2A 2OL3A 3HC3H 4YHKH 5H37G 1M71B 3VMPA 5FDYA 1HKLH 3HAEG 4LVHC 3CFEA 4K7FA 5I30L 4A6YL 4JM4L 2W92A 4KQ3L 1JRHI 3LN5A 4UMGA 1HXMB 1CDBA 3WLWD 5FYJE 2YMXL 4NO3A 3V6ZA 4NHUB 2YPKA 1EUTA 3QFDB 5FIEA 2CGRH 3D6GA 1BD2A 3EO1B 5FCUL 3F7PC 3IAGC 3RVVC 3RDTA 3MRFA 1W8NA 1ZGLA 1FN4B 4TSCL 4Z77B 3E3QE 5DRZB 4WFHD 3P0YL 2X6MA 4J2XA 1MJJA 3TWCH 5BRZB 5EN2A 5D72H 1SEBB 3CU7A 4O00A 3C5JB 1EO7A 3OZ9H 4I0CC 4XI5C 1KJMB 2ZUUA 3W39A 4PRIA 4HC1H 3MGOA 4P3DB 4WFFE 4X6FB 3ARPA 3QXAB 3BRGC 2QR0B 4B7LA 2CSPA 3TVMB 1CZ8L 3QHZH 2X1OA 4OZ4A 1T66D 1CVRA 1FFRA 2WNGA 3L6FB 5BRZD 2QADD 4WUUD 4PJDE 1ITBB 1Q9WB 4BM7A 4X7TB 4YDLB 1QTYT 1T7WA 2FEEL 3SPVB 4L8DA 3ZSSA 4P49A 1L0XA 4N8PA 4XAWL 4HGKC 3BEVA 3KYOA 5D5MB 1QSFB 2CKBB 3WV0A 4F33B 3NZHL 1MAML 2JF1A 3RGVB 3TVMD 2R0LH 3CX2A 4MB4A 4Y1AA 1NC2A 1HHJA 4XB8A 5LVEA 2HTKC 5JO5B 3BP6A 1KB5A 4UBDC 1IILE 3LEYL 1BFVL 3D2UB 4RAHA 2D4FA 4XPGL 5C3TA 2FSEA 2UVFA 3LSOA 1HN1A 3S37X 3B5HA 1QSFD 4JPVL 3QJHB 5F1OB 2VB5A 4UTBL 2FATL 4MDIA 4BA8A 5I1KL 4OLVH 3QH3A 3RGVD 2VDML 5HI5D 1ZSDB 4HG4K 5FB8A 3ES6A 3LKOB 4MNGE 1GPOH 4YK4B 5H2BB 3FTGB 6CGTA 1FCGA 3D2UD 1GL4B 1U8LA 1UM4L 5EO0A 1ED3A 4I4WB 4L3EA 3D3VB 3MLRH 3ULVL 4MNHA 5JW4Q 3O6KH 3PV7A 4PJCA 1F4WH 3MBXL 2Z0BA 2W9EL 1EEZA 1ZOXA 5HHVH 4CNIB 4PYHA 3LKSA 3JV6B 3BW9B 4R8WH 1ES0B 1N0XL 2R1XB 1B0GB 1YUHB 1KYOK 2BVTA 4I1NB 4Y8AA 1K85A 1CFTB 2VLKA 5HDBE 4YHPA 3L95B 2UZIH 2DLHA 3AROA 5CGYC 3VGAC 3MO1A 2VH5H 3D3VD 4YX2L 5I16A 4UT6L 1IGFL 2FIRT 2X4PA 3WNPA 1NEZG 5IB4B 4CADA 3FQNB 2O5YL 4RGNB 4MWFA 3OGCA 5DHVH 4AH2B 3VI4F 4LSPL 3IF1A 3FOLB 4J23A 3H9ZA 3EDJA 1F4YL 4JDVA 2A0LD 3JSSA 4H1LH 5EC2A 1FG2A 1IEBA 1ORQB 4QHUA 3O9WC 3KG5A 2Z4QB 4NSKA 3KS0H 2IFFH 4O2CB 3RWEA 3LZFH 1NCDH 4QO1A 3V79C 4JG0L 3QA3B 1LVEA 4RGND 3BJLA 3U9UA 3ULUD 1U41A 4Z95H 4HS6B 3F7QA 2FX9L 4G6KH 4HD9A 4X6BA 1IEHA 2NR6D 3JWOC 2F9BT 4NZTL 4M93B 2HH0H 1WAAE 4U4BA 4XPTL 4WW2B 4QHKI 4XMPL 3QEHA 4HMEA 4P2QB 5E2UH 4X98A 1CT8A 4TOYL 1N5AB 1U9KA 1CK0H 5IFAH 4QOKB 2JB5H 4XNZC 5DUPH 3WUWG 2BJMH 1YEKH 2Y5EA 5IJKA 3PQYB 1R3HB 4W70A 3QO0A 3I3DA 1S7RB 4HBCH 4HFWA 3C9NB 1ZT7B 4PR5A 2R29H 1XF3B 2QHRL 3K2UL 1U92A 2AVGA 3BJ91 4YBLB 2C3HA 3HG1E 3SDDA 1D5ZB 4U1LA 2C3GA 4F8QA 5EC1A 3B5GA 1UGNA 4Y5XA 1RZJL 4QOKD 3D0VB 2G60L 1UACH 5GGTH 1BX2B 3VW3H 3ZDXE 2F54A 1FFOB 3PQYD 5D9SB 4QYOA 4NQVB 4U1GB 5E95B 2EIEA 2CDFB 3NIGE 4HKJA 2EO1A 4TPRL 5DZOA 3ECBB 5JNYA 3SGKA 4YHZH 3P9WB 3MRDB 4LVOC 5I8CA 1NCUA 1EEQA 2YBRB 5IW3A 4PJBE 4PJEE 1VESA 4DOHB 2AS5M 5FK9B 5C0IB 2FHCA 1KCVH 3WDIA 3QUXA 4QNPE 1EO5A 3WIHH 1KENH 3AMKA 3KGRA 5MEPB 3GMNB 3UXFA 3OSKA 2ZOKB 4PJAE 2JJSC 2XQYK 1FQ9C 4JKMA 4KDTA 2BVOB 4NCC1 4XP5H 1I8MA 1K4CA 1YPZF 3O2VL 4F2MB 3IDJA 4YO0B 4XBGA 3RL2B 3UTQB 5DJAB 2PN5A 2H2PC 4OCLC 4OI7A 3JV4B 4GRLB 3O2DH 1HSBA 1N8ZB 1OTUD 3MLPA 1TQBB 3VXTA 3ARSA 5BJTA 5ENWB 2VITA 3GKZA 2H26A 4P2YA 5HPMA 4NT6B 4PJFF 5CINH 2VDRL 2XN9E 5A16A 1JNNL 4BSWA 3HA0A 1G0XA 4EZMA 5CBAB 2VL4A 3AFLA 4HUUB 4A6YH 4ODUA 1NCTA 1SY6L 3QXWA 3QULB 2X1WL 5ERWB 3W82A 3FO1A 5C0BE 3FMGL 5DZNA 5EIQA 4NUGH 2K9UA 4D0BA 2YMXH 2BOCA 4GRLD 3OXSB 5CJQL 5B38B 3OKLB 1FNEB 1HH9B 4IOSD 5FCUH 3WHE1 2XZQH 3ARBA 1BWWA 3VFOA 4TSCH 2VLJD 3P0YH 3FHQA 1RHFA 4JDZA 1DQJB 5HPOA 1QFUL 4NGHL 1RULL 1EZVY 2BMKA 2CRMA 3VXUB 4JY6A 4N8CL 4URTB 3D18A 3KLAB 4ISVA 5F21B 2VERN 4JANA 4LDLB 1OQOA 2EC9T 4PLKC 4FXGB 1SJHB 3GHEL 4ZXBC 4GMSL 4ZFZA 3T08A 1CZ8H 5K9QG 2B1AL 5KJRL 3NMEA 4F7PA 4XPHL 3OKKB 3HC0A 2NYYD 2ZCHL 2ENSA 3RQ3A 2O5XH 3WFCL 2Z93B 4W4OA 4JRYA 4U6YA 5AD0A 3VXUD 5AZ2L 4MNGA 1T4KB 4XAWH 4Z5RA 1JWUA 1I1AC 3B83A 4PJIF 1I1YA 4U3HA 3NZHH 3RKPA 4EUPG 3UTSE 5JPNA 1J8HE 5I76A 2M2DA 1FVDA 1MEXH 2FJFA 4Q6IA 1QSEE 2DJ4A 4HQQL 4G8FA 3VFTA 3RY4A 1B4RA 2DM3A 1UJ3B 3CSPA 4NYLB 4U1NA 5C3LD 3LB6D 1BFVH 1MVFA 5A3ID 2AJ3A 4XPGH 4HS3A 4JPVH 3STZB 2DKSA 4PJ8B 4WHTB 5IKCB 1E4XL 2FATH 3CLFL 3WS6C 2R2EB 5I1KH 3EYOB 2VDMH 5F89B 4BFBD 2A74A 1NLBL 1JF1B 3DMMB 4FNLH 4JFQB 5BXFB 2VXVL 1XR9A 1YN7B 3HMXL 1MAKA 5DVLA 3GM8A 3V4VL 1AQDA 1FIGL 3UTTE 1LK3L 4TNVF 1A4KA 2V2XB 3ULVH 1B0WA 4PJ8D 1PKQA 1I7TB 2HT4D 4LGSB 2DI8A 1AGFB 5ACLA 3V95A 3MBXH 1XZ0A 4OBRA 3MFGB 3O3DA 2C3VA 2ARJA 2QTEA 3HLAB 3VMNA 3DMMD 4D0CA 1BBJA 4UIMB 1VFUA 1N0XH 4R7NA 3RZCA 1Z9SA 5IB1B 4DUWA 1FZMA 3TPUB 1RZJC 4NCDA 5ICZA 3MLUH 1MWAH 3MXWL 5F6IC 3B9DA 3B43A 4YX2H 4LDOB 1WBZA 3BZ4B 2R1YB 3RVXD 1IGFH 1WAAA 2HYMA 5GJTL 1LGVA 4AYFA 2VL5B 1YEGL 2O5YH 2Z31A 1VGKB 1FH5L 1FHGA 1T20B 3QQ4A 4LSPH 5TE7L 1BMGA 3DBXB 5JMOC 4JKKA 1LP9E 1BFOB 1S78C 3K4AA 5AZEL 3ZT5A 2VDLL 1F4YH 2R4RL 1R3KB 3LY6A 4KGLA 1P1ZA 3FFDB 3MMEA 3JWDL 4U1KB 2R2BB 2NY7L 4BK5A 3QXDB 4M7JL 4YDJA 1CU4L 5C86A 2EDNA 4JG0H 4QGTA 3HG1A 4QRPE 1AGBA 3I2CL 4X7DC 1SJEB 2ZUTA 5INCB 3MNWB 2XZZA 2FX9H 1CG9A 4PY8J 4ODXA 1H0DA 4Z7UF 1UXWA 1XR8B 4MMXC 3GMQA 1DQTA 5IMLB 5T3XL 3SKJL 1C5BL 2IPTH 3PDOA 5C0GA 3VXNA 4FP8H 3FB6B 4D9RD 1SEQL 2A6JB 3IXTA 1YNTB 2A1WH 4PJEA 4L8SA 1CF8H 2E9JA 3FFCA 5FDWB 4OD1H 2E27H 3G5XA 4F15C 4KJPD 2IH3B 4CMMB 5D2LA 4DQOL 3QIWB 5FF6B 4E0RA 2N56A 1BHGA 3B6SB 3C6LB 2QHRH 3K2UH 3QFJB 1T66C 5F71A 4LF3A 2Q6WA 2QADC 3HI6L 1T0MA 4HK3N 3RWJA 1U95A 3DROA 4PJAA 1MCFA 1RZJH 4J3UA 2PYFA 1FNHA 4QRSA 2ZUQC 4HIHB 3JXAA 3P4NA 3DX7A 5DQDL 4LCYA 3QEQB 2X4QB 3ZE1E 1Q0XL 4TPRH 1HSAA 3QUML 3QIWD 1ZHLA 5FO9B 3C6LD 3QFJD 4U7KA 2W0PA 3B9KA 3ARUA 3S98A 3GBNH 4YDLC 1J88A 1NCCH 5TQ0L 5HHQB 3FN3A 2XN9A 4X9BA 3HZVB 3RUGF 1NGWB 1FZJB 4ODBD 3QWQB 3IJHA 5DD3L 2AP2A 4QKXB 3QEQD 5IHZA 5JW5B 1AXTL 3QNXA 4NQDB 3MODH 5CUSL 2FZ3A 3HI1A 3X12A 1Z0NA 1TVHA 4W6WB 2NZIA 5I8KL 2MQCA 4PRPD 3O2VH 4NQTA 5HYEA 3AB0C 1JBJA 3TYFA 1O7SA 1HWHB 5EH1A 3FZUC 3ABZA 5AUMA 3TA3B 2MTPA 3MROB 3NCJL 1CDYA 4KK5D 2AJYL 4LEOA 2HJLB 4YGVB 3U46A 1GH7A 2KUTA 5DHVB 1ZHNA 3KPQB 3DVNB 1C5CL 1MFAL 3FRPA 5IMOA 4PGEA 1JNNH 4GKOA 2WWKT 4YK4C 3SDYL 1FL3B 3ROOA 4H1LB 2NZ9C 4AEFA 4XX1G 1SY6H 4PJIB 3OKNB 3FMGH 3LQMA 3CFIC 4M8VA 5E0QA 3O3EA 3VE0B 3VWJB 5J1AB 3TA3D 3O6LL 5J11B 3QCUH 3GEWB 4HDIA 1WC7A 5DF0A 2HFFB 4BZ1L 4FXKA 4MXVF 3ULVF 5EZIL 1T6VN 4MQTB 1GZPA 1U8PB 2MOVA 2CXKA 1J1OL 5DI8A 3SKOA 3QI9A 3UTSA 4YPGA 2A0LC 4JFEE 5GRWA 1G7LB 1RJZA 1I7RA 1QSEA 1H3WM 1ZTXH 1QFUH 3I6GB 4NGHH 1P7KA 1DN0A 2ILLA 4X6DF 3IDNB 3VWJD 1YMMB 2X05A 4N8CH 5DRWB 4ZTPL 2YD2A 3QXVA 2DLIA 4HHAA 3G5YB 2ADGA 4RGNC 5EU5A 1OF2B 5J8OA 1I8LC 3U2SA 5DFVC 1UVQA 4R96B 2NR6C 2B1AH 5KJRH 5FV1L 3I75A 4YDVB 2F5AL 4KJWC 4F9PA 4FZ8L 2UYLA 5DYOB 4XVJL 3FQXA 1J05B 2AK1L 2A6IB 2ZCHH 4HK0B 4KVNH 5EOCL 4E41E 4HWEL 5C0FB 4MYWB 1JIBA 4FQXC 3OMZA 3VJ6A 1Q1JL 3UTZB 2AK4E 1BF8A 1UFUA 4XGZA 4JFXA 2X44D 2W60B 3UTTA 1T04B 4Z7OF 5DJ6A 1H8NA 4X99A 1KB9J 5T3ZD 4HQQH 3W5NA 3TZVB 2XRAL 1OCWL 4ODHL 2H1PL 4GW5B 1MCWW 4ELMF 1E4XH 4H20L 3CH1A 3CLFH 4OCYL 5HGAB 5C0DB 3DI2B 5IVXE 1U8QB 1T03L 4WV1C 3O3BB 1ZWIB 1NLBH 4KWUA 3MRJA 4YXKL 2IAMC 1OARL 1NC4B 1UC6A 5HVWA 2VXVH 5DVNA 2VR5A 3HMXH 3ARQA 2E8YA 3V4VH 1FIGH 1LK3H 1JHLL 4OFPA 2XKUA 1TCMA 3GSQA 4MD4A 2R9HC 2FD6L 3LQZB 3RFZC 1WIOA 3MUHL 3FB5B 2WANA 5MERB 5KS9F 3HE6B 4Z7UB 2C1OB 1DVFA 4JFYB 3AGVA 1RHHA 5FKPB 1NC4D 1AO7B 2IADA 1HWGB 2L7JA 4CMHB 1I3GH 1CLZL 3IFOB 4EXPX 4A6YB 4M7ZB 5D7SL 3MXWH 1NAKL 4MDJB 1NQBA 2F53B 3RTQA 2IMMA 3BOVA 1HDMB 1HHGB 2VN7A 5GJTH 1M05A 3TH4T 1A9EB 4G9DA 2YA2A 3HE6D 2YSSA 4GFTB 4MD5B 4PB0H 1YEGH 4RMQA 1FH5H 2CUIA 5GS0C 5GS3A 15C8L 5TE7H 1AO7D 3G04A 3PGDA 4GBXA 5AZEH 2VDLH 3SY0A 3ARWA 5KAQF 2R4RH 1MI5B 2PYEE 3GSWA 1MUJB 3O3AA 4G8EA 3VXRB 3MJ7B 1NMCB 3BZEA 5BCAA 3JWDH 4PLJD 2NY7H 3EOBB 4L8BA 2F53D 4O4YH 5L88L 4M7JH 4AJ0A 1CU4H 2NY4C 4CL7A 3E6FB 4QRTA 3TO4A 1RZ8B 4QTIH 5B3NA 1AHWC 3I2CH 3EYFB 3NZ8B 3MV9E 4GAYB 5JXAL 1T80A 5GRVK 1CE6A 1WTLA 4OKVA 3UBXA 5IR1A 4UU9A 1MI5D 3VXRD 5T5FL 3U1SL 4DGVL 4RNRB 3RUGB 3U36B 5DK0B 3SKJH 4KRPC 1C5BH 4XP4H 3MOBL 5FCSH 5D7IE 3L7FA 3UROR 2GQHA 1SEQH 2ZUSA 5CJXA 3DURB 4IRJA 3FCTB 2LTQB 5JOFB 5F93C 1NBYB 1P6FA 2EYSB 4DQOH 2R0ZL 5F97E 3OAZH 1S5HA 1VFAA 4NQSA 3W9DB 1B4JH 5AEAA 4RDQG 1DN2A 3HI6H 3NCMA 3QJFB 3KPNA 5ETUA 5CS7A 5F7UA 4P5TB 3HE7C 5F8RC 3T1FA 4PG2C 2MKWA 2FR4B 2VZTA 3DVGA 3VD5A 5DQDH 3Q2CA 4NKIH 1Q0XH 1S5IL 3PNWB 3D48R 3H6JA 1T1ZA 3QUMH 1QLEL 2Z8WC 4GAJL 3BRDA 4HX1B 1G7QA 2HG5A 1FNGB 4FQ2L 1NFDA 4GRWH 5GS0H 5IEHB 1JZ8A 5DUBB 2D03L 3MRLA 5BOZG 4I18C 2VLLA 5TQ0H 4P5TD 3LB6C 2Y07L 1RIHH 2VO5A 3VXQA 1BEYH 5DD3H 3PIQA 4S11A 4ZQKA 1AQKH 3VRJB 1I8KB 1YNLL 4M9OA 4HWUA 2CDGA 1IAII 2NLJB 4MXWL 3QUZA 4WDIA 3P4LA 5CUSH 1KPUB 5J1TC 4N1HB 3EYQD 5ITBL 5IFJA 5B39B 1BPVA 5DEZA 5I8KH 4C83B 5D4QA 3V7AE 2X89A 1UXSA 1KPVA 3D0LB 5GJSL 2IJ0C 1F6AA 3L7EA 4XH2B 1IM9A 3U7WL 4X8JB 1CICB 4JFDB 1FNSL 4OCXL 4N0UB 2AJYH 4YR6B 4M61B 4PB9L 3DV6A 4DW2L 4JREB 4FQJL 4V2CB 3WNKA 3DMMC 1C5CH 3TNNB 4U6HB 4TUKL 4CVZA 3L3KB 1FJ1B 3SDYH 4OGAD 2HLFD 2J8UE 3GZKA 1K5NB 3NFNA 2H41A 4UI2A 3WO4C 3V5HB 2YD9A 1MHPL 2I27N 3BH9B 1P7HL 1F45A 2XTJC 1A1MB 5HHNB 4JFDD 3HKFA 5IM7B 5GQBA 5B8CB 5B38G 5GRVL 4E41A 5J57B 3F7YA 4XNMB 5I1AB 4BZ1H 3LPWA 3VXOB 2AK4A 2QQKL 5DUML 3BAEL 1J1OH 5HGHA 1H15B 3TBWB 4OIBA 1RK0B 5LBSL 4DCQA 5JXEC 4LLWA 4Y5VB 4HUWA 4ELMB 1BBDL 1LNUB 5ITFB 1IGIL 2J5LC 3L5IA 4EKXA 3WFEH 4LSQH 5GSRB 1UENA 1CBVH 4ZTPH 1EUUA 2P45B 1W72A 1A7RL 3T0BA 3JVGC 4HIEA 2M26A 5D7LE 4C54A 4WWKB 3FO9B 1NDGB 3MJ8B 4HGWA 1P7QB 5D96C 5CZXD 2ESVA 1KT2A 1L0YA 5IVXA 3O8XA 2UWEA 1IC1A 2F5AH 1JF6A 4FZ8H 4XVJH 2YA1A 3MRCA 3BE1L 3O0RL 5EOCH 1K4DA 3FT4B 3X3GL 2DYPB 4QLRA 1S9XA 4LLQA 3REVB 1Q1JH 2NW3A 2FBJL 5D7JA 5C7XL 2E9BA 4WHYG 4XNYL 4EJ1C 4N0RA 3GFUA 1XGRB 1BQHB 3RJDA 4WWKD 1P7QD 1X5ZA 4MCZA 1WISA 4YPJA 3NTCL 1I9JH 4XVUD 3GB7B 4NKMB 3PWVA 4X80L 1D5MB 3VA6A 25C8L 4QHLA 3NAAL 1T89C 1OCWH 2WLZA 2XRAH 4ODHH 4WNQA 2H1PH 1ORSB 2P8PA 2DYPD 2VDQH 4I3SL 4ZS7L 1C7TA 2AJVL 3RX7A 2VAAB 4H20H 1XIWC 1BECA 4OCYH 2DQEL 3MA9H 4ZDHA 5C8JA 1T03H 2ZWLT 2EXYD 1XF5B 3CDGA 4OFKA 5TDPB 4YXKH 5FYLH 1BQUA 1UADC 3GSNA 4PV9B 1QVOA 5E6YA 4G3YL 1ETZB 4O58L 4U1HA 2P8MB 3WFBL 1FL5A 1MFNA 2AXHA 4WU5B 3UJJL 4IRSD 1IE5A 5E5UB 5E5MA 1JHLH 1N6UA 1FYTE 1UQSB 3QUKB 4RFEB 1CGUA 2PYEA 3TBVB 2FD6H 2X4UA 4NKQB 1JZ2A 3RWFB 2MSPA 1EHXA 4BSVA 4L4VB 4ZO6A 1KLUB 3B9VA 3L3OA 4KKBC 3L5WA 3HRZA 1VKXA 1X7QB 1T1WA 3VXSE 3TGXA 1NEZA 3LRHA 1CLZH 1K2DB 1UWGL 2EDYA 5EO1A 3QUYB 3RVWD 4GRWF 2DBLL 2Q3ZA 4UDUA 3IVKB 1OW0C 2FO4A 4Y2DA 3U4AA 5IFHL 4L4VD 4CN1A 5EBMB 2XA3A 4AIOA 3EDDA 5D1QA 3VFNA 1ULVA 5D7IA 15C8H 1JZ6A 1T83C 4Z7WE 1S7XA 1MRFL 2BOBA 2UZYB 2ZOLB 4HJGB 2AEQL 2GI7A 3RNQA 2GEEA 4G80B 3QUYD 1OT1A 7FABH 2JIXB 5IIEB 4PTUB 4UIKL 5L88H 3H3PH 5EU4A 2ERJB 4N0YL 1U8KA 1AJ7L 3E1F1 3QNYB 1FZOB 4Z78B 3MZTA 1A6WL 3OR6A 2CIKA 3A67L 4Y4FC 4DZBA 1ZANH 3CDYA 1IAOB 3V7MA 5T5FH 3QDJD 4JHZA 4TVPD 4DUXA 1A6AA 1SYSA 5E8PB 3TCLB 3TH2T 4HZAA 2JIXD 1EJOL 1UZ6E 1FVEA 3MOBH 3MNVA 5DEFB 5JPMA 2VXQL 3UEZA 5C92A 4YXHL 2CO7B 3BEWA 2P44B 3O81A 5CBEA 3CFEB 4K7FB 2IQAB 3N1FC 1JZ5A 3SDXE 2DWEB 2LVEA 3VFMB 1YY8A 4RFNB 2D7PA 1G6RL 3LN5B 3OB0K 3S3PA 2VWEE 1C7SA 4HPOL 5J06A 1TNNA 4P23A 3W2DH 2R0ZH 3V6ZB 2D9CA 2BCKA 3AY4A 1OVZA 5FEBA 5C6TH 4TSBL 3T3MF 1I7UB 3T4YA 2FJGA 4P2CG 3SKMA 4OQTA 1EAPA 1JI1A 43C9A 1QBAA 2P49B 1P5UA 1JPST 4WO4A 1KEML 2NX5E 5ACMA 1JNHB 4EQ2A 1F6FB 1S5IH 1NJ9A 2CK0H 4GAJH 1QLEH 5C9JA 2YD6A 4ZSOA 3BDXA 4FQ2H 4NQXB 2OBGA 3MGOB 2ARJQ 3Q3GB 2W91A 5SWQB 2D03H 1EIBA 5IJVA 2Y07H 4OZ4B 2Y06L 1MLBB 3QQ3A 4DN4L 3ILQC 4D94A 1ZKAA 5EZLB 5SWZB 3V0AC 4X7CC 2R0KL 5IEKB 1ZHKA 1YNLH 3P40A 3GJFH 4MXWH