1RU9L

Crystal structure (a) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected in-house.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9L01
3GBMH 2FWOB 2FD6L 1RHFA 4MX7B 5FGRA 5FYJD 4X0KA 4FQXA 4OI7A 2F53D 3C6SB 1GZPB 1NFDB 5DXWA 4LCYB 4JFEE 3ZE0E 4OZGF 2EDBA 2J7LA 2VXQH 4WO4D 4OUUA 3QRGH 3IU3B 1A4JB 5LQBL 3BKCH 4MXVE 4ODWB 4XPBL 4Z0BL 3D39E 5EU3B 4KJWC 4JLRA 1G0DA 2EC8A 2LFGA 2WBWB 1DL7L 2JIXB 5IROA 2HKHL 3PWVB 4IRSD 2G75B 1FYTB 3MSPA 5DJXA 4BH7B 1K5NB 4AT6B 3S9DB 2C1PB 1G6RA 3OKKB 2ESVA 4Y2DC 5AUMB 2D7PA 1QP1A 2AEPH 3QH3A 3BN9C 3ZTJH 4UQ2A 2YMXL 4Q0XH 2FECI 1YDPB 5HYJD 5IEHA 1MHEA 1H3TA 2YEZB 3BH8B 4L8SB 4PJEF 2PTTA 1FSKC 3MLSH 5IHUH 3TCXA 2AQ3A 2Z8SA 1ED3A 2WIMA 3O2VH 1N5YL 1U91B 4CVZB 1VKXA 4Y1AA 2YPLA 5I17B 4APQC 2V17H 3HG1E 3DROA 3KWWA 1IQDA 1F4WH 43C9B 5E1AB 3QJFB 1DLFL 4WW1A 2EYTB 1KCSH 5DJ8A 1QR1A 1SJHB 2XTJE 5BO1H 3MFFB 3EOTL 4XHJC 1BQSA 1QA9B 3NCMA 1SJEB 3RWHA 4ZD3L 2R56L 1F97A 1FCCA 4ZFGL 4P4KB 3WJJA 5T3XL 4OUOA 1RUKL 2F8VA 1F90L 1ZANH 1TIUA 1CFTA 2AJ3B 4XMKH 3BPNB 4ONFL 2APBA 2LU7A 4ODTH 3TPUB 4ZOEA 4Y4HB 4R0LA 3U0WH 1T83C 1D5BA 1R3LB 4NT6A 5DLML 5GZND 2GJJA 3X13B 4ENEC 4ZSOA 4IOIB 1ADQL 1G7MB 3L3IA 4J4PD 1V05A 4G5ZL 4OCRH 2X7LA 1JPST 4U1IA 4LFHD 3SE9H 3P0YH 2CLRB 3TF7C 5GGQL 4R8WL 4N8CH 1VERA 3K8LA 1ZEAH 1KELL 4ISVA 1JCKA 4OLZH 1HQRA 1Q94A 2I26N 3HI1A 2Y07H 1ERNA 2XA8H 1G6VK 4KZEH 2RFXB 2X9YA 2MWCA 1V3MA 2C9AA 5D96C 1V3KA 4X6DE 3MUZ1 1AGEB 2AGJL 3DETC 1FNEA 4UINL 4X7SH 2KKQA 5JDJA 5EU4A 3RDTB 4O9HH 4YFLI 2P5ED 4K9EC 1YC8A 1ZT1B 2A6IA 5E56A 4RGNC 3F7VB 2A0LC 5HYFA 4JFXB 4WUUD 3DX6B 3HG1B 5FF6B 3CLFH 1TMCB 3D3VB 4OKDA 1EEYA 4QRQA 3I6KA 3L7EB 3H9SB 4QHNA 1YEHL 2EE3A 4OLXH 1KSRA 1G9ML 3OB8A 3RWEB 3STZB 4X4YA 1P69B 2XTJB 1XR8A 1INEL 2ARJA 2LAAA 2DMCA 1M6OB 3QCTH 1HSBA 1UCBH 2Y7QB 4PB9L 4OFKA 1TPXC 1T4KB 2VLJE 1TTFA 1HHHA 3ZZ1A 4HWEH 5B38A 4UAOB 5J12B 4LEOB 5E2UL 4GRLD 2P8MA 5DWUH 1QFWL 5IG7B 1CZ8L 3JWNC 4OF6A 2DTSA 4PFEA 4GFTB 3V5DB 4K7PL 4DK6A 3VFPA 1M1SA 2ZUYA 4U1LA 5IBLC 2IADB 2NY2C 3T3PE 1IFHH 1ZHNB 4WI4A 4KRMB 1BQHG 5JA8B 1VEPA 3WNKA 3SE8H 2R0KL 3PXHA 2ADIB 4NQVB 2OCFD 5BV7H 4TULL 2W1NA 4IS6A 3OL2A 3MGTA 2MPAH 1ZMYA 5HGBB 4HLZG 1CG9A 5DJ6A 1HILB 5HPMA 4TOYH 1C12B 3C2SA 5DC9B 1GGCL 4S11A 3FRUA 3VG9C 1DQDH 2YA0A 5J6HA 1AI1L 2M26A 3TT1L 4G80B 5DRWA 4F8QA 4ZYKA 4OGYL 4PGEB 1PZ5A 3MLPA 3FO2B 1RZKH 5HYJA 1OOAA 1FLRH 5DJYB 3QUZA 1O7SA 2EDTA 4KQ3L 5FCUL 1L4IA 3SY0A 3BZ4A 4F58L 1WBYA 1Y6MR 1FYTD 1EVUA 4HX1B 4LSPH 5HI3C 2ADGB 1H3PH 4FFWC 5I15L 3PDDA 4LLQA 4ETQA 4LLDA 4DW2H 3CFJA 1NCDH 1U93A 1MHPL 3TN0A 1A2YA 3ZKQD 5DD5L 4WFHE 1QD0A 1I7ZA 3L9RB 1F3JA 2GFBB 5TGBA 2VLJB 5I1KH 4YXHL 3ZKXC 5I1DB 3HAEG 1AGDA 5D7JA 4XPAL 4JN2B 1P7QA 5CEXB 2A83A 5E8PA 4MA7L 3GSNA 5EC2A 4QRPD 3C60B 2XZCH 7FABL 2XRAH 3CU1A 4UV4L 1MCPL 1CDHA 1NC4B 2CMRL 4XPGL 3IJYB 4YPGB 1MRDL 4QHMB 5GS1A 4YIQB 2I07A 1FGVL 4G9DA 5CILH 3T2OA 5C6TL 3QG6B 2X4RB 2ZWLT 3P4NB 1ETZA 2YN3A 2N7BA 1F3DJ 1HI6B 4L9LA 2EECA 1NANI 1J05B 2XN9E 3T8XA 1UC6A 2QHRL 4P4KD 1WBZA 4GH7B 3DV4A 1P6AB 4BA8A 3OF6D 5DMIL 5J9PB 4YWGH 5L6YL 4Q9QH 3FHQA 4NOBA 4C57C 2DIBA 3CC5A 4Y4HD 1JHKH 1CN4A 2VAAA 3QUYC 4OF3A 2OSLA 4KDTA 2W0FB 2P5EA 4ZXBC 2G9HA 3LSOA 5CFHA 3OG6B 4KMTL 1TCRB 4GW4B 4KJPC 1RUPH 5DHVH 1KACB 2IGFL 4WFEE 2AAVA 2FYYA 2B7DT 3HHRB 4WEMB 2NY7L 4XHQA 3RPIA 1NEUA 4FQ2L 3IETA 1CF8H 4OD2A 1G1YA 1ND0B 1ZA6B 3B9KB 1FFNA 2YD6A 3BWUC 1KULA 2JB5H 1KJVB 3V7MA 4MSWA 3RWCA 2GT9B 1MQKH 3RDTD 4OFDA 2FATL 4OT1H 1X5JA 4HGMA 4X83A 1QBBA 4XPHH 4RMWA 3SGEI 4FFVC 4TRPL 1QUNA 5I66A 1IAMA 1EO8L 4RNRB 4K07A 2P48B 2HLFD 3J7HA 3HG1D 4LQ1A 1GOHA 3D3VD 3QXAB 5KJRH 5TFSH 1U92A 2X4TA 4XGZB 3NA4A 2SEBB 3H9SD 3SCMC 1AJ7L 2BVPA 2XTJD 2FHBA 4NQDE 4PJAA 4ZNEE 5CCKH 5DMJB 3O2WH 3DWTA 5FO8A 4DGYH 2VDMH 4N0YL 1ZE3C 2XN9B 4LVHB 1U8LB 3L5WA 3R1GH 4HAGA 3HNSH 5C0GA 4OB5H 4LCYA 3VE0A 2J1KA 2Q76B 3OKLB 3ULVC 3MLWL 1YEEL 3A6CL 1XCTA 1AQDA 1JNLH 4XNXL 2HFGL 1FO0A 5DUPL 5B3NA 2JK5B 4CNIB 2ED9A 1U9KA 2QSQA 3MLYL 3VDCA 5DFWH 4JANA 1W2KT 3LQAC 3PWVA 3PWJB 1OT1A 4IM8A 4XP6L 5DRZA 5MERA 1PKQA 1HE7A 4WRLA 5HVWA 3FN3A 4P48A 2FLRT 3C09C 1BIIA 2XT1B 1WVZA 1K5NA 1C5BH 3FO0L 4JB9L 3KS0J 1X5IA 3W9DB 4QLRA 4BSJA 5DJCA 4QXUL 4M7LT 4EI6A 4YGVA 3BIAX 1YN7B 4ZOBA 1KPRA 1U6AL 3HMXA 1BJ1H 4QRUB 4XCFL 4NRYB 5D1XC 4RWYH 12E8L 1DCLA 5ICZA 2LAGB 5LCVL 5IESH 4JRXA 1AO7E 2ED8A 1VGEH 1T5WA 1U8KA 5ETUA 4Z7WF 4FG6C 4U4BA 2VXSH 5L9DL 1KB9K 4WHYG 1BWWA 3GUTB 5TDOB 3MJ7A 3DO7A 2W59A 4PJCF 4QRPA 5EUOA 2VC2H 1JBJA 1CL7H 3H7BA 5KN5A 5DHVB 2E7CA 4UIMA 3TNMA 2VDPH 2FX7L 1XF3A 4KDVA 3JV5A 3WS6C 5GQBA 2DLEA 2X6MA 1ODAA 5IJKA 5JIHA 1DBAH 5J8OA 2BNUB 1NCAL 2R4RH 1YPZE 3UTPD 1FLTX 3ARSA 5GS0C 4NQDB 3A6BL 1YEFL 1AIFA 4N0RA 4GKZA 5GGVL 1NMBL 4FQLL 2ADJA 3HZKB 4ONGH 3TYGH 1GC1H 4BSWA 2YHGA 5I1CL 1TZGL 3OR6A 4JN1H 4I13B 4U6VH 2HN7B 3C60D 2J2ZA 3WHXA 1BOGA 2WWMC 3MNWB 4U7SA 5FDYA 1NC4D 3VXRE 4Y4HA 3LAFA 2JCCA 1MQ8A 3CH8A 4OD3H 1UYWH 4JG1H 4OZHE 4P5MB 4X5WB 5CWSA 4MLIA 4L3AA 3W39A 1D5MB 3MLTB 1BBJB 1D9KA 1EJOH 1OTUC 2UZIL 3LZFL 3RI5K 1XAUA 3MACL 3GSOB 4XP1H 1MVFA 1NCTA 2BVOB 2NY3D 3DIFA 5H2BA 2JB6B 1XF4B 3P9LB 4PGCA 2XQBL 3R4DA 2O5YL 3S8WA 1OTSC 3T77A 2OI9C 2VH5H 3E6FA 3L7FA 4P2OB 2W9EH 4Z7UE 4KK5C 4D0DB 1GRWA 2V2XB 1CD1B 4EDWL 4XTRC 4OIIH 4EUPH 4P9HC 4F3FA 4QF1B 5L8LB 3NCEB 1DEDA 1YN6B 3TJEH 4KQ4H 3UTTA 1DQMH 5HHXL 5IVOA 3UYRH 3RIAK 4HIIB 5GJTH 4I5BB 3SKJL 1P4LB 5TDNA 1TQCB 2BK8A 3WIHL 3JV4A 4RGOH 3B9KD 3H9SA 5FGBC 4F2MA 1T1YB 4M1GL 2RJMA 3TNNA 1CFVH 4JY6B 2E7MA 3QNZB 1IEBB 2NY5H 2Y7QA 4M1CC 5MENA 4Y19A 2HAZA 4NQSA 4Z77B 3ZYJA 1KIQB 1T2XA 3G5XA 3VFSB 4X4ZA 4UDUA 1MCJA 3D9AH 3CFEB 3WFDL 3TZVC 5E7BA 5F9JB 1M05A 3U9PL 3SPVA 1X5HA 4AENA 3GJFH 4P9MH 3KPNA 5B3JF 1RHHB 5ICYA 1MCLA 4Y89A 3ZSSA 1K8DB 1S5IL 3VXRB 5C0IA 1F6AA 2Y72A 3MV11 1YYMH 2R0ZL 1MFCH 5J06A 4MVBD 4J3XA 4Z95H 4XNZB 4LSRL 2FNBA 1Y0LA 2EC9U 2ZCKL 1FRGL 3L95B 4FQ1H 4JY4A 2Q3AA 1W0WB 1XF2B 1KT2B 2GITA 1H5BC 4HUNB 1AGCB 2DJUA 5IIEA 3LS5H 1XGRB 1P5VA 4PJXF 1C5CL 4M7JH 3VRLE 4RAVA 5BW7C 4ZUVA 2HFFA 3C5SB 1JJUA 1FFPB 3CDCA 5ESAB 3FO2A 3K1DA 1KXVC 4PRAB 3BGFB 1QBLH 4JZOA 5SX4H 1N0XL 1TJIH 4NQEE 3TJHD 1D5IH 3TO4C 5E8EB 4YDJB 3HI6H 5GRXG 4PD4K 2EKSA 4JY5L 4TVPE 2OBGA 4WFED 5AWNL 4E9LA 5E7FA 2YPKB 1JPFA 1BBDL 1CU4L 4XCEB 3HB3D 3ZYZA 3AUVA 4K71B 5I1AB 4HEPG 5ESVA 5CEZH 4P23C 3H7LA 4X6CF 3RVXC 4EXKA 2L7JA 2WUCH 2PYFB 3C2AL 3QI9B 1OLZA 5KAQG 3EO9H 4HQQL 5CLWA 4LRNL 4BQ8A 1ZWIB 5HHQB 3DGGA 3CMOH 3HE6C 4EUPB 3GKZA 5D72H 1UZ6F 4QCIB 1E28B 3QO1A 4PRBA 3IDYC 3VXMB 2YA2A 3DO3A 2ZUQC 1SYSA 4JKMA 3QUML 3IJYA 4YPGA 5JW5B 3UPAA 4LNRB 5DMGD 5L7XH 2BY0A 4G43B 3DVNB 1MELA 2NTFB 3VXQA 4NQDD 1MLCB 1MEXH 3MBEC 3GNML 4NHUA 2O5XH 1T2QH 5CD5D 1ZLSH 4PGDA 3TVMA 4UDTA 1NLDL 4AM0A 5EFIB 4JPWL 4Y4KC 3T4AB 4XPTL 5J9PA 2E7BA 2GJ6A 3QIWC 2ATKA 5AYQA 5GIRB 4Y5YC 2B2XL 1YY9C 4BSVB 5EB9A 4WENB 3TA3C 2MQ0A 4GXUM 3CIQA 1JPTL 1YA5A 4ODBD 4NQEB 2J5LC 1KN2L 3TO2A 3G5ZA 3G6DL 4DTGL 3EOYG 2AW2A 3QPXL 1I3RA 1TCRA 4G8GA 1EGJH 4A6YH 4O00A 4HH8A 1S7UA 1CQKA 5HVHB 1GPOL 2X1XR 3ARFB 3QIUD 4WDIA 1TQBB 3DTXA 2ESVE 4U49A 1SEBA 1ZA6A 2I60H 5HGHB 4EBQL 4P2OD 5IBUG 4KKAC 4BZYA 4H5SA 1KJVA 4FXLA 3O6KL 4IIQB 4JFZH 4K3HA 2CUHA 2DLHA 4NN7C 5A2LH 5DK3A 2FGZA 4TTDD 5IWLA 5I1JL 1TVBB 1F45A 2DIJA 5C09B 3DGCR 2AJXL 3Q2CA 3IRPX 2YR3A 4Y1AE 4AEIL 3L3KB 3QWRA 3B6SB 4TPRL 2VXVL 1M7DB 4ODUB 1KIPB 2SEBA 1EHNA 1JV5A 2NY4B 4GQ9H 5JORB 3KPLB 4NWTL 2LTQB 3HRPA 1OP3K 2WP3T 3VGBA 3ARPA 4OV6F 1VHPA 5JW4M 3OAUL 1U8LA 4P5TC 3HRZA 2I9TA 1A7RH 2IPUG 4KVNL 3JV6B 2Q76A 4KKCD 3HE7B 2CLVB 4CL7A 1Q9WB 3VI3F 3BAEH 1SVZA 5DD1H 4XPFL 2BJML 2DDQL 4JAMA 4N9GB 3GHBL 4JM2C 3MRMA 5EBGA 3ULSA 2CSPA 3TBWB 3BEVA 1OT2A 3O4OC 3VU2A 4O2CA 1XT5A 4JDVB 1VCAA 3FONB 1XGQA 3RAJH 1A1MB 5DT1H 3MREB 1T04A 5FECA 3L3OA 4WI9A 4FS0A 5I71B 4Z8FH 3QZWA 1YN7A 4DN4H 3LKQA 5EBWA 2F58H 2CKNA 3MJ8A 4JFDB 1MCWW 1JRHH 1TJGL 3ALPA 4D0CB 5IQ7L 3V2AR 1XGUA 1CFNB 1ES0B 5KANG 4PJEE 2EEAA 4WEBH 5JR1H 3WIIH 3T0EC 1V3JA 3QQ4B 4HGWB 3MJGX 1CXEA 3PP3H 2V7HB 5D1QD 4EJ1C 1XGYL 2Q20A 3BDXA 2AJSL 2ERJB 3FN0L 4G6KL 4FQHA 1JN6B 5DHVA 5C0RL 1UXSB 2AJVH 2PKDA 1KN4H 3D2UA 2WP3O 1W8OA 3EO0A 3U7AA 1EZVY 3V4VH 1IAOA 2YRZA 3QI9D 4FQIL 5C6PB 1H15B 4PY8J 3GIZL 1LK3H 3C6LA 1G7JA 1JZ6A 1WZMA 5C1MB 1K6QH 3PUCA 5FHAL 3WDJA 4DKFH 3T0XA 5E6IC 3REWA 4OZGB 1I8IB 1D5XB 2ZOKA 5TH2A 1A3LL 1T3FB 3VXMD 2FD6H 4KDWA 3F7YA 5T5FH 4R4BB 1RZFH 2NY6B 4XC1H 2VKXA 4WU7A 4X98B 4Y7MA 3MLTA 3UMTA 1B90A 2MHAB 1JGUH 2X4OB 3TBVA 1A0QH 1EXUB 5GGTH 1CT8B 4LOUD 1KJMA 4OFVA 3RVTC 3IFOB 4JQXA 1XF4A 2PW2A 1E4XL 1NQBA 4O58L 3KPQA 4XH2A 3I3BA 4G6JL 3QIUA 3U6RB 1RMFL 2R2HA 2BC4B 2DKUA 4ORGB 2BSRA 3PWLB 5DVKA 4ZFOB 3O41B 1DL7H 1MCIA 3SDDC 1KC5L 2R23A 2V2XA 4RRPA 5D4QA 2V2WA 4NQED 3IVKA 3HC3L 1JYNA 4PJEB 5LVEA 3ZL4H 2NNAA 3GO1H 2YPVH 3RL1B 4WI3A 4WNQA 1JVKA 3DXAB 3EYVB 4QHLA 2YWYA 4WW2C 3ARFD 4QY8A 4YUEH 4MNHA 1IM9A 5DS8B 3WO3B 3OHXB 4EQ3A 5BQ7B 3HPLB 1OP5H 3H9HA 4OCYL 3WLWC 4NO2B 4NBYB 3QXTA 2HVKB 4OD1H 4ZUWB 1U95B 3BD3A 2V9QA 5C92A 3VFNB 4RMQA 4FP8L 3MRQB 4UT6H 3CFEA 4I0PB 2ZOLB 1VENA 1DBKH 4HKZB 5C09D 1S9VA 3MMEB 5GRVL 2VZUA 4Y16B 1LO4L 3GMQA 2IALB 5E00A 1PG7W 3IDNA 1N6QH 1CXLA 4E42B 4HJGA 1LEKA 4J1UB 1TFHA 4N8PA 4XXDA 1T1ZA 2C5DC 2NY4D 4ZFGH 1LK2A 4O2FA 4L3EB 1RUKH 3RY5A 2WWKO 4LNVA 2HLAB 5CEZD 2ZKHL 2EE6A 2R15A 5IHZA 1JK8A 3V5HB 1F11B 1S7XB 3NZHL 1AGCA 3BP7A 3X12A 4U1SB 4AIOA 3WFBH 2OL3L 3V4PL 3GGWA 3FAWA 3I6GA 2NQCA 1T03H 3HE7D 3FT4B 4ZUSB 5K9KB 1ADQH 4HDIA 3NAAH 3IFPB 3O3AA 2OXHA 3RWGB 1RPQA 1SVCP 1LHZA 5I73C 2HTKC 4HF5H 2XICA 3GBNH 5EA0H 1A1NB 2OYPA 1NCCL 3T1FB 4M1DH 3JWOL 2IPKA 5D1QA 5T3XE 4RMSA 4CMMB 2GUOA 1KLUB 4R90L 2YK1L 2A73B 3SBWA 1WFTA 4F7MB 4HWZA 1J1OL 5B8CA 1K2DA 4PJ9C 1W72L 4G8IA 1CLCA 1QQDB 4JFDD 1H3GA 5IMKB 1I1AA 4NCDA 1HHGB 3BDBA 5BOPA 4JZJC 4J12A 4KUCD 2ICWJ 1H3XA 2N4IA 5CEYB 3MRKA 4NUJA 3ZE1F 3BQUC 4U1GB 1A6UL 4LMQE 4PGBA 4QTIL 2C4XA 5D7SH 2Y6SD 1JZ3A 3MOAL 1G9MH 1AXSB 3GHEL 4NZJA 1INEH 1DFBL 3BPOB 5ADPL 4I9WE 3AC0A 5SWQB 4KKLC 5F70A 3WO4B 3DUUB 4J3VA 5E2UH 4X9HA 4NKDA 4YHLL 2R0LL 2X4UA 1WICA 4L29B 1LO5B 5LGKA 8FABA 4L8CA 4D9LL 1ZA3A 1NBYA 2VLRE 5CIPH 4PLJC 1A6AA 2B0SH 2EIEA 4LCCA 1J8KA 2NXZB 2R0KH 3SDAB 4FMFA 3KJ4C 3CFIC 2A6JA 3GJFA 4YDVB 2NY6D 2NR6C 1ZK9A 4R2GC 3QDHA 3IJSA 2H6PB 5DK2A 1GGCH 3GSRA 1AI1H 5F3HA 4G8EB 3WIFA 4MQXC 3A6OA 4YR6B 5E4EB 5F9WB 3QHTC 2VUYA 1PKQE 4RMVA 4AY0A 6FABL 4LSVL 1EJ6A 1A7NH 4HSQA 2EKJA 2YUVA 4K8RL 2PNDA 1JI1A 4KQ3H 5FCUH 1A3QA 2VLLB 5LAXB 3RHWF 4NPYA 3MZTA 4QRSB 3W82A 4QWWC 3VXTA 4LLMA 4JO4H 5CP3H 4JRXE 5E6YA 5I15H 1URLA 1WC7A 4M7LH 3PWNB 2R2EB 3LH2L 1RFDH 3DXAD 3P3YA 5EUOE 1CDGA 1X5ZA 3U4EA 4WGVB 4WTWA 4YBLB 4YXHH 1EHAA 3MUGA 3ZDXF 3RZWA 1S9WA 1KENL 4LLUB 2VERN 3OXRA 4U3CA 4AIZB 1I8MB 7FABH 1R0AL 3JV0A 1MCPH 2VLRB 4HXBL 4XP5H 3N9GH 1CD8A 4NM4H 5EZLA 5JNYB 4I0PD 2FJFB 5IVNA 4QKXB 5DRXA 1DVFB 3O6FC 2IPUK 3VXOA 5DVNA 3I9GL 2AEQL 1EBPA 4YHYC 3N85L 3IDGB 2F5AL 4XZUA 3QDGA 1S9YA 2CIIA 1ULVA 2JCCE 5D5MF 1KPVA 1YMHA 4JGMA 4L3ED 2X1PA 1D5ZB 1D3CA 5SWSB 2AV7A 5DZLA 3S88L 4NCC2 3W9EA 1I7TA 3U9UB 1RJYB 1HXYA 3GJEA 5DMIH 1NFIB 5L6YH 1N8ZB 4MA8L 5DMKB 3WV0A 3MV8D 3X17A 3L3JA 2HFTA 4F7EA 2VDOL 5C0AE 5L2KA 1J0ZA 2WLYA 1ZLVK 4KTDL 3F12B 2V6HA 1MPAL 4N1CA 4N5EC 4TYUA 4L8BB 4JDTL 5IEKA 4QT5B 4Q6YA 5I19L 1GGTA 3QJHA 3UYPA 1V7ML 4UTBL 2CRIA 2NY7H 4Z7WE 3HC4L 2ITCA 4PP2A 3ES6B 2AERT 4R3SB 4OCWL 4Z0XB 1U8OB 1OSZA 3TC9A 5GJSH 3UTTE 1XIWC 1J18A 1YEKL 4PJCE 1CL7I 1S7VB 5FKAB 1EGJA 5JPMA 1NBZA 4A6YA 1X4ZA 2HH0L 5A16A 5DI8A 3HTLX 1FZJB 1U8IA 5D6DC 3NFNA 3MR9A 4PJ8C 5FB8A 3VG0L 4J7RA 4GLRH 2VDKL 4H0IA 4HJJL 1BQUA 3T0AA 1EO8H 3K74B 5MENE 4Y19E 5I1GL 1INQA 4NKQB 5F1SA 1FV1B 3GI9L 4R97C 3B2UD 2C3VA 1QNZL 3L5IA 4IRJA 3VDAA 4OZGA 2D4DA 1OAYH 3OKDB 2YBRB 4ZODA 4OF5A 5ENWB 3TH3T 5DJAB 3DX7B 5D7IA 4GKNB 4W6YB 3PWPA 1ZGLP 2RB8A 3MYJA 2WAHA 1YMME 3Q1SH 3MLWH 1YEEH 3A6CH 1CT8A 5E2WH 2J4WH 1T22B 4WVRA 4F7PA 4XNXH 3O3BA 1NFKA 5DUPH 5ISZA 1AXTL 3TBSA 4LPYA 3QEUA 5C0AB 1Z9SA 4JRYA 2BC4A 3UPRA 3MRPB 3RWFA 2NXZD 3SDAD 3QO0A 3C87A 2ZUXA 4MXQD 3B5GA 1BGXH 4PJGF 4WI6A 2V9RA 1MCFA 4MD0A 3FO0H 5FUOL 4Z7WB 4FXKA 4Z7NF 1FL5B 3VXUE 5FDWB 2P8LB 4S2SB 3AY4A 3ROLA 5FUZL 2W9DL 5T3XD 1CFQB 3MLRH 4XCFH 2QSCL 3P9MB 2YWZA 3LRHA 4PJCB 4X8JA 3I3DA 1I9IH 12E8H 4YNYB 5SWZD 5CJ5A 4N0UE 1JGVL 1M7XA 5DRNB 4HKJB 1NCWH 1X5GA 1S8DA 4LCUB 2XPGA 2VIRA 2WUBH 3QQ9C 4LKCA 2AABH 4LKXA 3TIEA 3RTQA 1VFOA 2GTWB 3DRQA 4KH2A 3BHBB 1JWMA 1REIA 1CE1L 1AKJD 2FX7H 1SM3L 4NP4H 1C7SA 3TLRA 3NFPB 5TPWL 5B3JE 2R39A 1E4WL 1YEFH 5TQ2L 1U2CA 5D2NB 3GMPB 5GGVH 1NMBH 2UWEF 4HK0A 4I9WD 5CMAA 4FQLH 2K9UA 3LPGA 5KZCD 4IDLA 5B39A 2B5IB 1YMMB 2D31B 4IMLA 4X6FB 2BXYA 1I1RA 3MV7E 3ULVH 1TNMA 3MV8A 2VLRD 3VFUB 3VWKB 2OM5A 4NQXA 3E6HA 2OR7A 4PJXE 1I8LA 3U0TB 1DVFD 4FMKA 1UB5A 4YHPB 3ECBA 3RWGA 2GJ6E 4PJ7F 4U31A 5HGGS 3LZFH 3TH2T 5SX4I 3MACH 1A6WH 3LQAH 1SMOA 5IW6B 3HZYA 1YY8A 2DL2A 2GW5A 1B4JH 2WNGA 5EO1A 1NGZA 2EDXA 4HUWB 4XMLH 5DJZB 5SWSD 3SDCB 3VXUB 2GQHA 5KG9B 2CK2A 4X80L 4MWFA 2KH2B 4ZFZB 5GGTA 4P57A 2VDQL 3K4AA 2XACC 1LMKA 3ARXA 3GMNB 4N0UB 5EIVA 3ROOA 5E2TL 4IHOA 4NJAH 1M71B 1BIHA 2NLJB 4PD4J 1Q8MA 4G3YL 4HS6A 1YNKL 3EO1A 4WV1B 4X6CE 3TIDA 3NFSL 4JJHA 5HHXH 1IZJA 4FXGA 2A6KB 3KDMB 1R3HA 4KKBC 4JFOA 3C5ZC 1CGXA 3UTSB 3WIHH 4M5ZH 2FIRT 4YHNB 4OGXL 4E41E 3QA3A 2BCKB 1UZ6E 2DIAA 3HN3A 4NNYA 2FL5A 1I3VA 5HI5D 5F7HA 4LHQB 2QEJA 3PL6B 5C0BE 2NZ9D 3DETD 3LPWA 3CZFB 4L29A 2A6DB 5JO5B 1FVEB 4E5XB 5FYKL 1FZMA 2WBJC 2X4QB 3V6BR 1H8SA 3MV7B 2VR5A 3WN5C 3BZDA 3VFOA 2HT4C 3P73B 5IFHH 4DVBB 4UT9H 3TCLB 3DARA 1BEYL 4PJXB 3QSKB 1OHQA 5J13C 1RSFA 2C26A 1FIGL 3SDAA 5I1IH 2I25N 1FRGH 5KVGL 1DBML 3SKMA 1C5CH 1TVHB 3D6GA 4Z76B 1A5FL 1MCOL 1IQWL 3M45A 1T0NB 2H8PB 5I2IB 2YXMA 4K23L 3KPOB 4LGSB 5SWZA 5SV4A 1ZS8B 5C0AD 1GOFA 1N0XH 5E99L 1TCMA 1ZTXH 2HVJB 4GOSA 3EOBA 2EXYC 5F3BB 2BVEA 2P7TB 2GK0B 3G08A 3JWDH 4P9HH 4M7ZB 2ZCLL 4JFQB 3U4BH 4X6CB 3ESVF 5MP6H 4NNXB 1QPPA 3NCJH 4JY5H 5CS7A 1BVLA 2R1XB 2ZSVA 4GRWE 5HYQB 3O3DB 1BFSA 3W11D 5AWNH 2EH8L 3LEVL 1RU9L 4NYLB 1BBDH 1CU4H 1AKJA 3SOBL 1H3VA 1OM3L 3CSBA 3KPPA 3VW3L 4E41B 1OAUL 3WXVL 4NN6C 4XNMB 2NYYD 3BRGC 4HQQH 1OVZA 1UFUA 1R5IA 3OJ2C 3R06A 2YRLA 4XAKE 4LRNH 1DQJA 1WAAF 3BX7C 5DEGB 3LVEA 5C0BB 2IAMC 3VXPB 4H8WC 3G9AB 3FFCB 1L7IL 5DJDB 3DMMB 3IDXL 4OLVL 4IRZL 2Z93B 3SDYL 1ACZA 4WTZG 3GMLA 3MRCB 1IVLA 3U83A 3WLBA 1SMAA 2GAZA 3P0VH 4APQA 1LWRA 2QKIB 2K1MA 3KHOA 3QB7C 5JUEL 1FC2D 2RCSH 5FOBA 1IC4L 3F7PC 5DHXB 4HWUA 2DQGL 4F57H 4U1JA 4PJFA 3GNMH 3VI3E 1WWWX 2FHCA 5IB1A 4YAQB 1HHIB 2DTML 2Y23A 2CRMA 1YMMD 4BUHA 5FHBL 5E8OA 1NFIA 3W0WA 2OQJB 1FFOB 1G9EA 2VR4A 3RUGA 2G2RA 4RFOH 5CIPA 5E8NB 3G6DH 4DTGH 1JRHI 1DEEB 5KSAB 3U7YL 1T83A 4ONHA 3NIDF 1FDLL 4CVXB 1VDGA 5HI4D 3GMRA 4M3JA 3SDCD 4R3SA 3P77B 4Z0XA 3VXUD 4AL8L 3ARDB 4M62H 3I75B 2XWTB 1BM3H 4PRHE 1LO2L 5J3HC 4ETYA 5AD0B 3OJDA 4ZPTA 3O4LA 3O6KH 1J10A 4JHBA 1WT5C 4CN1A 5TE6L 4R7DA 3VFTB 3O11A 2YSSA 1JFQH 5TF0A 4XBPB 1IZKA 1QLRB 2AJXH 5HHVL 4TUOB 5F96L 1C08B 4AEIH 1MHCA 3MUY1 4TSCL 3UTSD 2D7NA 4MCYA 3UTQB 1MWAL 1P7KA 4I0CC 5JHLL 1T21A 1KEMH 1EUUA 2OJZL 4NWTH 4WO4C 5HHPA 2YUWA 1OPGL 3PL6D 4NO5B 2CIKA 4MA1B 4J8RB 5LWYL 5D93B 2ZJSH 3MV7D 4IRSC 2J8UA 4FFZH 3C08H 4U33A 1NSNL 3BIKA 3FT3B 4XPFH 1CFSA 3QUMB 4S0SD 4LAQH 5F1KC 3D85D 1BFOB 4UU9B 4OM0L 1LP9F 1F3DH 5I8KL 3SCMD 5GXBB 4PIRF 5ID1B 1WSST 1XCQA 5DJ2A 3PWUB 3ULUL 2P8LA 3RNQB 1T1XB 1BX2A 5KVDL 1TZIB 1IGTB 4PRHB 2W92A 3OQ3B 2QL1A 3Q0HA 2PR4H 2FH6A 1ZHBB 4ZG1A 4U0RB 5A43C 1OD9A 3MJ9L 1MAJA 3QIBB 4S0TD 4DZBB 4MAYB 4TNWF 4KRPB 4HIXH 1RUQL 4R26H 3KPTA 3IDUA 2H32A 2NCMA 4NUGL 4DN3H 3FN0H 3MNVA 1OW0C 3M17A 4NKIL 2DICA 3V4UL 1X44A 2AXGA 1R3KA 2YRPA 1ROWA 4E41D 5TF1H 5IK3B 4MQSB 1U8NA 4LBEA 5MEOA 4FQIH 1RULH 1X5YA 3D48R 1T5XB 4LCWB 4YHKH 4RGMB 5D2NA 1GHFL 3VH8A 4YJZL 4S1SL 1N64L 2FCBA 5J89A 5C0BD 3VI4E 3STLA 5GZNC 3FFCD 1OF2A 3WFHB 4DGIL 5FHAH 2ENYA 3HR6A 5CSGA 4J4PC 4CVWA 1MSPA 1IAIL 3DMMD 1TITA 5FUCE 1G7QA 4JPVH 3Q48A 3LD8C 1DDHB 4PG2C 4RFNB 4YE4L 3EYFA 1NCNA 3NA9L 4LPCA 1ORQB 3FOMB 3S96A 3HZMB 4R7NB 1U0QA 2IQAB 3AM8C 1A6VL 2D7QA 4YHML 3ILPA 4ODVL 4ODSH 3QDJE 4HWBH 1HHKA 2D7OA 4DEPC 4QRRD 1E4XH 4G9FB 4O58H 5KS9F 4G6JH 1RMFH 5ACZA 4QRTA 2DLIA 1QKZL 5KG9A 4V2BA 4PRPB 2ITDA 3KPSE 3BT2L 1KC5H 1WZ1L 1Q9LA 4KWUA 3RU8L 4R96B 1IL1A 4JFFB 2NLJA 2F5BH 2QJDA 4Y5VB 3G5VA 4GG8A 4YO0B 4K3JH 3PG2A 5KSAD 3V9FA 1UACL 3F65A 3QUYA 3WUWB 1P4IH 4JFPA 1S9XA 3MXVH 4S1QL 4ZXBA 3BD4A 3KPMB 3KS0H 3V0VB 1IC7L 3QDMB 3O8XB 1NPUA 3ARDD 1MY5A 4AEHH 1MJJB 4NZDA 4GRLC 1OCWL 3E3QE 2VMFA 3JXAA 3O0RL 4P3DB 3LIZH 4OCYH 1OTSD 5GSRA 4NZRH 4KK9D 2J6EA 4K3EL 4XAKD 5J6GA 4LSUH 2XNAA 2IH3B 2C4FT 3V7AE 1NAML 2MTPA 4HV8B 2GY5A 2A6DA 5ITFB 2A74A 3HLAB 1OLLA 4V2CB 4X6EB 1FNFA 4KPHH 5J1SC 2DS4A 5JXAL 3V95A 1J8HD 3D85A 3TWCH 3CK0H 2JJSC 2ZKHH 3SCMA 3QDJB 4UIKH 3OBAA 3NZHH 3QDGE 1L6XA 3LN5A 4QHKI 4FNLL 4M7KL 1GIGL 4R6UA 3QYCA 4XX1E 4HMEA 1GH7A 3MZGB 2ED7A 4DWHA 3KPSB 5T3ZH 3TZVD 2KZWA 1YECH 3NCYP 5ID0A 4ZTOL 4HUVA 1Q72L 1H8OA 5BJTA 2HVJA 4KKNA 5F3BA 1FZOB 1S7SB 4LLWB 3MLZH 5L88H 5ITBH 5I8EA 2O93L 5ADOH 1KCVL 1L9NA 4M6ML 1A9EA 2Z8WC 1HZHL 4CADB 2W0KA 4R90H 1VFBA 1FL6A 1PSKH 3QEGH 2D7MA 3WHE0 3MODL 1P84K 4L8SC 2FB4H 1W0VB 1Q0XL 3B5TA 1UM4H 2X40A 3B2VH 2N7AA 1G7PB 1DBJL 1Q9KA 1EAPB 4MJ4A 4PRHD 3R0MA 4LSSL 1OAXL 3WJLC 1MFAH 3F5WA 4L5FL 5D1XA 2NPLX 4OCXL 5D6CB 3NN8A 5EN2B 3QIBD 4KGLA 4MAYD 4WWKB 1X3DA 3ZDXE 1F6LL 3VXPA 4QTIH 5I18L 5HSFA 3UO1H 3MOAH 3GHEH 3H9YA 1SBSH 4NBXB 4WHTB 4J6RL 1MFDH 5K9QI 4P4KC 5D2LF 1WBXA 4LVEA 1AP2B 3HNTL 1XEDA 2R0LH 3BPNC 3WS6A 4LCWD 3GEWB 1I9JL 5BZWB 1YEDA 1N7MH 2AV1B 5D5ME 4QRRA 5D7IE 4D0BA 2Q86B 1VPOH 1SHMA 3UC0L 3RVWD 1J0HA 2ZUWA 2EDKA 4PRNA 1T66D 2CKBH 4OCSH 4PJDF 4P2QE 4TVSa 4CN4A 1JYWA 2E9IA 3MCLL 1JPGA 1XF1A 3UEZA 2H26A 2PXYB 5KSAA 2BX5A 4M00A 3C8KB 4P0DA 3SKOA 1KJ2L 3NACL 5KVFL 5C07E 4DK3A 2QR0A 4LSVH 3DVGB 4G9FD 1RZ8B 1RZJC 3DUSA 5L0QB 3RDTC 1XZ0A 2OL3B 1K4DA 4PRPD 2W38A 3RRQA 5FEBA 2G60L 2WMPA 1ZVYA 4ELMA 2HLFC 2KUTA 4JFFD 1JGLL 2DF3A 3FOLB 1YY9D 5EU5B 4GLRI 4HK3N 5HGAA 3QNXB 4OZIF 3UROR 4XBPA 2C7UA 2XTJC 4JO1H 3MFGB 3DSFH 3O8XD 3QDMD 1A02N 4UAOC 3U7WL 5J12C 3I02A 2MCPL 2FO4A 1J8HA 3BW9A 3RVUD 1W72B 2JLLA 1EFQA 4P2YA 2C1OB 5FGBA 4M6OL 1JUFB 1CGUA 4JVPA 4HXBH 5D5MB 5GRUL 1CDUA 1WIPA 1NGQH 5EBMB 3MLVL 2Y36L 3WDIA 3I9GH 1CK0H 2AEQH 5FM5M 3WUWG 1OSPL 1UKTA 2V7NA 2HWZL 3PHQA 3TZVA 4P2QB 4LPWA 1P1ZB 4ODXA 3FT3A 5GGVY 1A8JH 1VACB 4KJYA 4D94A 1WUNT 5CINL 4MJIE 2VZSA 4TUJB 4ELKA 4M6NH 4PJGE 3Q5TA 2HG5B 2XQYG 3FQTA 3QDJD 5ID1A 1VEOA 4MA8H 5C07B 1F3RB 1LO3H 3EBAA 2FEEL 3V6FA 3AREB 4Z7NE 1H5BA 2EE2A 4P5TD 4KTDH 1CE6A 3IFNH 1PJ9A 3KPSD 5F1IB 1IGFH 4GAYB 5BW7A 4LHUB 1JNHB 5INCA 3PP4H 1V7MH 4UTBH 3HC4H 4Z7QF 3VRJB 1HOCA 5KSVA 4PTUB 1JNNL 3OR7A 5HGDB 3Q3GB 1CCZA 1I7UB 3D69B 1J86A 1IC5L 4PV8A 3TO4A 2WLZA 3QNYB 4EN3B 4Z7VF 2DM7A 3NH7H 5F7YC 5F7WC 1S7TB 3AFLA 4YHOL 5T1DL 4B50A 2YUZA 1CTNA 3P30L 2DQIL 3VG0H 4HC1L 5IK3A 2P42B 1T7WA 4ZAKB 2DM2A 5DJ0B 3C60C 4HJJH 3CSYB 4P23A 4JQIH 3EOAA 2ZPKH 2UWEE 3E2HB 4WWKD 3GI9H 2XA3A 1TETL 3DNKA 4NRZB 5K93A 1MCSA 1EUTA 3HE6A 4PYHA 1H0DA 3U30B 1JF1A 3TFKD 1AQKH 2IQAA 3ZT7A 4H20L 3AMKA 2Y5EA 4MJIB 4YEEA 1UXWA 3CSGA 3A67L 1EEUA 3MBXL 2CUMA 4PJ7E 4DUWA 1Q9OA 1RVFH 4JGUA 4PJGB 4XBGB 4L4TB 5IMMB 3KXFA 3QUKA 4EDXA 1AXTH 4PJBA 5IW1A 3MBEA 3OGCA 3KJ6L 1RJZA 1TJHL 1T20B 3GSVB 4UQ3A 2KQNA 2XZQL 3V7AG 1CDYA 4OLUL 4C55A 5EC1A 4MNQA 4Y4KA 3GB7B 3BJ91 5CZXD 4JJ5B 2EIZA 2XY2A 3QIWA 1T1WB 4Y5YA 1I1FB 2PXYD 5FUOH 1NEZA 2QADB 3PXJA 3TA3A 4MXVF 1VGKB 3B9KC 3MO1B 5ALBL 5T1KB 2VE6A 2FSEB 4EOWL 1MREH 1NGYA 3MV9E 2PUQT 1RZKC 3QDMA 3U0PA 3PIQB 1FZKA 2H9GB 4RFEA 3OKMA 5FO7B 4XX1G 1Q0YL 1ZGLA 5T3ZD 3OZ9L 2GKIA 1I4FB 5KSUA 4O51B 3H42L 2EYSA 3NCBB 2R1WB 5I16A 4BK4A 2UWEB 1CE1H 4ZFFB 4LDOB 1A7QL 3PDOA 4U1HB 1NBQA 4Q9RL 1S3KL 4OKVB 4MVBC 2I5YL 3DV6A 4YFDB 3AMLA 3OKEA 2J88H 5F1NA 1E4WH 3RWJA 2FX9L 5H35B 3CDGB 4LVHC 4LP4A 1SYVB 1UJ3B 3LV3A 4RZCB 3GSWA 2XKNB 4AH2A 2OZ4L 5FM5O 3BH9B 1RUAL 4PJ7B 4XVTH 4ZPVB 2Z92A 1VA9A 1I1YA 4UOW0 4LSTL 4OBSA 3T2NH 3LB6D 3OKNA 4JPKH 1JGDB 5GRZA 1S7WB 3TJHC 3REVB 2V2TA 4GKSA 4P5TA 4RAUA 4V1DE 2Z35A 3U1SH 4C4KT 3W0WE 1YC7A 3V6OC 4P2QD 1JZ2A 5DO2D 5ILTL 5LJYH 4ZUTA 4D9RD 1CIDA 5DZOA 2WQRA 3RUGE 3KYNA 5CP7A 3LKNB 1FC1A 4NZUH 2QQKL 1L7TL 4NQTA 4LP5A 3HB3C 4YHYB 5GISL 3WNLA 3MOBH 1V7NH 1I7RB 3FT2B 1KCKA 2QQNL 4JM2A 5C07D 3UPCA 1X7QB 3BSZL 4XB8A 4LLVA 3MV9B 4HWBA 5K9JL 3MRHB 3KPRA 4PJ5E 3WNPA 3KR3L 3ARED 5E2TH 3VCLA 5IT2L 1LD9B 1HQ4A 2CDEB 1KCUL 5F72S 2VABB 5FYLH 5LBSH 4LHUD 3KAAA 2HT3D 3BGMB 1JE6A 2FR4B 4H1LA 5E5MB 5L2JB 4D8PB 4JM4L 4X6DF 3BZFA 3BI9X 4OGXH 4WUKH 5C8JB 3WE6B 4EN3D 3T0EA 2A9MH 2EYRA 1OGAA 3SDXA 4EVNA 5F7EL 1IEAA 4G7YL 1CLZH 1GVIA 1NJ9B 4DKAA 5CD5C 5TE4L 2NX5A 4ZAKD 3MRFA 2IANE 4K55A 2PO6B 4YQXH 5FYKH 1BF2A 4KK8D 1JI2A 5AG8A 5F89A 1JF6A 3QHFH 4LHUG 3CH1B 1DE4A 1GGYA 3P11H 1AGBA 2DQEL 4Q2ZB 3G04B 3FB5B 4OTXL 5ELIA 4C4KO 2XFXB 4PUBL 4JHWH 4P5KA 1K8IA 5D9SB 4FFYL 3KYMA 1FIGH 4J2XA 3SKNA 4V1DB 3GMMA 3VFMB 5E6IA 4NN5B 2AK1H 5I74B 4YXLL 3WSQH 5IUSA 4MJID 2FJHB 2VXUL 4JO3L 4MGXA 5C0CE 1MCOH 1MJ7L 1IQWH 4JE4B 4B5EA 4P2OC 4L4TD 3NIDE 1ZT7A 3NCCB 4UOJA 4YGAB 2VB5A 4GMTL 2IFFL 3S5LA 1U8MA 4FRWA 5BZDA 4TTDC 1LEIB 1FL3B 1OGTB 5DUBA 1KB5L 5F8RC 2B4CL 3VXSA 4U3XA 3LKPA 2M1KA 4DJMA 1HDMA 3KLHD 4H25A 1TQCC 1RZIB 4MQ7B 3SDDA 4GG6F 2QADD 1KUMA 3OGOE 3SOBH 1OM3H 4QOKA 5T1KD 1BMGA 1OAUH 2ZSWB 1UA6H 1BJ8A 3LN4A 3SJVB 4KY1H 4MQXD 3WXVH 2DN7A 5C0JB 2LU3A 1A6ZB 2FX8L 2XKSA 4N1EA 3GIVB 4PG9B 4FQCL 4PRIA 2X4PA 1F4YH 5HYSB 3D0LA 4WW2A 5F8QC 5HY9B 4KKCC 2AK4D 4XVJH 3LKSB 4PR5A 2C1OA 2IANB 3GSQA 5EORL 1IGYA 4DVRL 1L7IH 3IDXH 4WEUD 3SDYH 4OGZA 1KJ3L 3X3GH 2H3NB 3BPLB 5IVXF 1NAKH 1KGCE 3O2DH 1A14L 1QO3B 5JUEH 4XNZC 2B1HH 1YYLH 4QHUA 1P1ZA 2D3VA 3THML 1HEZA 4QXGH 3MLXL 4LEXL 3E1F1 4GAGL 1GXEA 5C70A 1NCBL 2PCPB 4HT1L 4CJ0A 1J5OH 4X4ME 1ZVSB 3LCYA 1UVQB 3T0BA 2ATPA 3BGFC 5GRYA 2XQYK 1KNOA 2JELH 3FRPA 1PQZB 4NKMB 1J1PL 1JZ7A 5HHNB 5IVZA 1L0YA 5BMFL 5F1IA 3U7YH 2WQ8A 2CKBA 1OAQH 5IV2B 1NC2A 4KK6D 1D7FA 1QSFB 1FDLH 4QXTB 3FB6A 4FQJL 3S35X 1UZ8B 2Z31B 4AL8H 1BWMA 1XH3A 4K71C 4MZ3A 4MDJA 1G9NL 2UZXB 1QSEA 2BNQB 2GJZA 1LO2H 3QI9C 3MV9D 4KROB 3B9AA 2DQTL 3H8NA 5DK0A 1S7TA 3S37X 4CN6A 5IM7B 2OTUA 1OB1B 3INUL 4DUVA 4L3CA 5TE6H 1OARL 1YNTB 4HBCH 4ZAKA 4JKLA 3GJFK 3MLUL 3RL2B 2GSGA 4PJ9A 4U1MB 4H8WH 1MH5B 5HHVH 5F96H 4JFYB 2DLGA 5F7LB 3JUZA 3F6LA 2XXCB 3BPCB 1R3JA 3CFBB 4G8FB 5JHLH 4JZJA 1AGFB 5EPMB 3ZDYE 4NKOB 4F15B 2X5PA 3BQUA 4LOUC 1HINL 2X42A 2K3TA 3HI5H 4ZOCA 2HJKB 5EZIH 3SGEH 1FVDA 4KUZL 1BECA 4P59L 5A40E 1OAZL 2PO6D 4PBWD 2Z4QB 1LP9B 5JDSA 2VL5A 4LVNB 1E4XI 1O7VA 3P40A 2PF6A 5IHBA 3PQYA 3OJVC 1NSNH 1FVCA 4XNYL 2ICWB 5KS9E 1DUYB 2D0FA 2Y06H 3CVHL 2H2PD 4F7TA 3OX8A 1KIRB 3QQ3A 4OM0H 5I8KH 3IDIA 3VGHA 2WIIA 2HJLB 5HVHC 2VAJA 1BJMA 4GXUN 2VJXA 1NH6A 4JHAL 3WD5L 3SN6N 3ARFC 4DGVL 1EFXB 1TQBC 3S36L 2DWDB 1VFMA 3CDFA 4HZLA 5KVDH 3C9NB 5FKPB 2KL6A 4JFHE 2ICEB 4EI5B 4MLSA 1JTPA 4X99B 4IIQC 4RX4D 4L8DA 3MRNA 3GRWL 1MHHB 3K2MC 3D1MC 1T6VN 3NGBB 5FA4B 3O3UN 1FP5A 1DQQA 5T1MA 3IF1B 1RUQH 2AK4A 5GGRB 3QG7H 5AAMA 3V0AC 2C3HA 2D9QB 2F74A 4LF3A 4W81A 3FQRA 1F5WA 3X11B 4NKIH 4HFUH 4HS3B 1B0GA 3V4UH 1QRKA 5D71L 1R5VB 5CBEB 3HFMH 15C8H 1NKRA 2NY4C 3TV3H 3ULUE 1K9TA 3SJVD 2LTQC 3QWOA 5JHDE 3CDGA 4OZFB 1NCUA 3RHWK 1VADA 5E95B 1MCCA 4HIEB 1QSZA 4X9GA 1YNLL 3ZE2F 3VGAB 3HE7C 3BH9A 1QRNE 4DGIH 2IAND 5AZEL 1KTLA 4ZQKB 4NQCE 5CBAB 1NDMB 3MRRB 3NA9H 4YE4H 1J9CT 1YPZF 3LQZA 4Q9BA 1UJTA 4YBQD 1HH6A 5KS9B 1A6VH 2BMKB 1MWAB 5DYOA 2GSIA 3AXLB 5IF0B 4YHMH 4WU5A 5DDHB 1ONQB 4NO0A 1EAJA 3SQBA 3WEXA 3WHE1 3O6FA 5EOTB 4TVPL 3VFGL 1BZ9B 4P46B 4P4RB 5JZ7D 5I71C 2BOBA 6CGTA 2DWEA 3TBYA 4DUXA 2OJEA 3L3GB 1QKZH 5I76B 5I75B 3HZVA 4OZHF 4BJLA 3AB0B 3CFKB 5HYSG 1ZSDB 1IM3B 3BT2H 4I48A 4GW1B 5FYKD 5CHNB 4G42A 2C4FU 3FQXB 5HDQL 4XRCB 3CX2A 1GGBH 3RQ3A 1UGNA 1VSCA 5INDA 1YJDL 1UACH 4G6FD 5CKAA 4UTAL 3BXNA 1JWUB 1QSFD 2VUOA 3UAJC 1P84J 2Y6SC 3MA7B 2ERJC 4MD5B 1JIBA 4ZDHB 3ARRA 3EYOB 1XGPA 4B53A 4OLWL 4Z7UF 1IC7H 2P24A 2BZDA 4L4VA 2P8PA 2BNQD 3WE6A 5HDOA 1CR9H 1OCWH 1RIVH 5LXGH 4M5YH 3QEQB 4U6XB 3JTTA 5BRZE 1XIWA 2GCYA 2M8XA 1NJ9A 5JHDB 4KAQL 1IRAY 5DD6A 3RBGA 3W5MA 4KTEL 1UB6B 1KF9B 1S5HA 4OZ4B 1FNGA 1WGOA 1NAMH 4Y2OA 5BVJA 5GS2H 4OBRA 5D6DA 3V6ZB 4PJ8A 5E08H 3EGSB 4POUB 3VRIA 5DEFA 4NWUL 4NQCB 1GJIA 1NL0L 2NY6C 2XI9A 5GGUB 1KPUA 1RZGB 1I9RH 4HS8L 5CGMA 5JXAH 3DECA 4K2UL 1QHPA 1FG2B 1A7PH 1XR9A 3PJSB 4I2XA 4DCQB 3KYKH 1T0MA 4YFLF 2X70B 3HUJA 4KVCL 4M7KH 5FYJU 4RISH 1G6RL 2CRZA 1HXMA 3KNBB 3MNZB 3RKDD 5SX5K 1PVHA 4ZTOH 1Q72H 2C3WA 2ZZUT 4HPYH 4N8VB 2W0PA 1AHWB 3QFDB 3PHSA 3S97C 2A9NH 1AD0B 4L4JA 3WFEL 5IB3A 1KCVH 3VRLF 4M6MH 2NW3B 1HZHH 1S7QB 4HLZH 5FGCE 5ALCL 4X6BA 3B8SA 2ICES 3MODH 4LLYA 3I50H 4MB4A 1EFXD 1Q0XH 4N5UA 3QDAA 1CBVH 1DBJH 4EI5D 3MRLB 1BQLH 1K4CB 5HHOE 4DZ8B 2B20A 5BRZB 3FFDB 4LSSH 3S35L 4AEEA 4L5FH 4MXWL 4HFWB 4OCXH 3IJHA 4I0PC 3WKML 5D2LB 4AMKH 4XT1C 5DD0L 2OMBA 4Y16C 4CGTA 1D6EB 4FZEL 4YHIA 3ARGB 3G6JF 1HKLH 4R4NC 1MNUL 3R0NA 4W4OC 1BFVH 3CMGA 2R69L 3A0OA 4M93B 5CJOH 3EFFB 5D7LB 5F97E 5I1LA 4UUJA 4PJDB 4UNVA 4JZNB 4PTTB 4D9QE 4JDZA 5F7NC 1A9BA 3HAEH 4MDIA 5IB2A 3UC0H 1Y6KR 1RK0B 1QOKA 5B4MD 1NAMB 1C16A 3NABL 4UV7H 5HDLA 3CFCL 3EFDL 4CW1A 4E0RB 2EH7H 3EJZC 2YKLL 1CLYL 3TBTA 5IFJB 4LAJH 1SBBA 5MEPA 4C59B 1WEJL 1ACYH 4CU6A 4MNQE 4C83A 3KG5A 3VFVA 3H3BC 4P46D 1DN0A 1MCQA 3FQNB 3BP6A 1NGXB 4Z7QE 1LNUA 4MJ6A 1UQSB 1IILE 4UBDD 1F02I 4OZFG 1WZLA 4OZIB 4JFHD 3EYQD 4YLQT 1E27B 1FJ1B 4BFGA 4Z7VE 1EMTL 5HHOB 1XF5A 4PJHA 2XWJB 2P5WA 2DYPB 1HCVA 4M61B 2IJ0C 3ZTNH 5ERWB 3B2UC 4U1GC 3FTGB 5IMLA 3LRSB 2MFNA 3UBXB 4TQEL 3QXVA 3V5KB 5C7XL 2O61A 3UCRA 1WZKA 3BPOC 3F8UB 1CLOH 4IOSD 4IDJL 4JPIA 3DHMA 2MCPH 2R9HD 3WO4C 4HHAB 2A77L 1RJLB 3B3IB 3C5ZA 4NO3B 3QEQD 4ONOA 1INDL 1HK6A 3DOSA 4LK4A 4I0KA 5D1ZB 5ICXB 2IG2L 3NIFF 2R2CA 1DBBL 1WIOA 5C3LD 3T1WA 5FO9B 3GMOA 5GRUH 3FMGL 3RZCB 2PYEA 3VXNA 2NXZC 3WBDA 1BZ7B 4LSQL 4MXQC 1JHTB 2Y36H 3VJ6B 5D7KE 2XYCA 5GHWL 4FA8A 1P2CB 1A7BA 4NQCD 3WNNA 1WJ3A 2HWZH 1CICB 4U6TA 4XAWL 3TYFA 2WBJA 3O3EB 5CJXC 3G6AB 4FTVB 4X5XB 1BD2A 2OTWA 4J3TA 4PREA 5DEZA 2DD8L 1OP3H 3WN5A 3D0VA 4YX2H 4FQQA 3TT3H 4LARL 4U1KB 3FCTA 3O2DA 5E4EC 3VD5A 5F9WC 4MD4A 4U7MA 2RR3A 1GAFL 1R24A 1S7RA 5EUKB 3SGDI 1RZJH 4MCZB 3HAEB 1MAML 1XGTA 2CDFA 3IXAA 3KHQA 4S1RL 1NDGB 4EI5A 4X99A 1IAKA 4GUPB 5EBLB 4Z7VB 2BNRB 5DURB 3QFJE 3KPRE 4AJ0A 1ORSA 3PHOB 4HH9A 1WFOA 1T89C 2R4SH 2HJFB 1MI5B 1KTDA 4D2NA 1O5DT 2GTZB 3KLAA 4XBEL 1JNNH 3BP5A 1JGEB 1KJ2B 4HIJB 1MFEL 4LL9A 1G7HA 1U3JA 4YHOH 2AJYL 4YBLC 5T1DH 1NBVL 2WV3A 1MVUB 5DHYA 3L3HA 1IKNC 2G5BB 1OGAE 3Q6FB 3OG4B 1ZHKA 3DX8B 2VRAA 5IB5B 4KRLB 2AP2A 5H94A 1JHLL 1SY6H 3U48A 2NX5E 4PY8I 4WHYH 1DVFC 4U2YA 4N8VG 3U4AA 1EPFA 2F54E 3CPLA 1TETH 2X4NA 3CU7A 1Z5LA 2IAMA 3ARGD 2Q8BH 4U1NA 5HVFB 2VDRH 1G9MC 3MRRA 2DQHH 2Y25A 1DSFL 3BMVA 5E9DD 3QULA 3B83A 2FZ3B 4NHCL 5HJ3B 4YXKL 5D7LD 1L0XA 3A67H 5KTEH 3VD3A 2BXZA 5GGSB 3I85A 4YHZL 4JFEB 1LE9B 1BAFL 4P4RA 5KVEH 2VISA 1J1XH 4ZUUA 3V8CA 1EIBA 1X5KA 5EZJA 4OLEA 4OGAD 3V52H 1TJHH 4LGRB 1I3GH 2ZCHH 4XNUL 3D39B 5GS2D 4TSBL 4HUUB 5EO9B 4OLUH 1CD0A 3LEYH 4OCLC 3VMNA 3QFJB 4DAGH 1EZVX 5EO0B 3GDBA 4C56A 1EHXA 4IBLT 5ALBH 2W60A 1A6TA 2KPNA 2FJGA 1PG7L 1N4XL 2BVQA 2Q6WA 3MRIA 3EYOA 4LPVA 5HI5C 3H3KA 4I3SL 1G7IB 5C9JB 3K2UL 2JE8A 3N1FC 2NZ9C 2YD1A 3BWAA 1PDKA 3RWIA 1PY4A 3QEQA 5IKCA 5HHOD 1A4KB 4DKEL 5CZVL 3OZ9H 4URTB 2DYPD 2Q7YB 1MCDA 3K3QA 3U36B 1MIEH 3MGOB 2CJUL 5TDPA 2DBLL 1IGJB 4ERSH 1DLHA 1WT5A 4Q9RH 3S4SB 1S3KH 1AFVH 2AKRA 5EWIH 5TE7L 4GMSH 3FB8A 1FN4A 2D7TL 2FX9H 2VITB 1FO0L 3FQUB 3O6LL 5DUML 1MJUL 4HXAL 3OXSB 1IT9H 2NW2A 1N5AB 2AJZA 3IU4L 2OZ4H 1FG2A 4MA3A 3LKOA 2PTUA 3I2CL 5D1ZD 4PJIA 4D9QD 5J1AB 3HKFA 2F53A 3T65B 3HCVB 4KC3B 4AG4H 3BEWA 3DYMA 2R1YA 4WO4A 5HDBF 4K3DL 4PV9A 4NSKB 4NJ9H 4HIHB 4Q97A 4XNQB 4WJ5A 1H9VA 1N2RA 3HMXL 1CICD 3UBXG 4KZDL 5I8OH 1PEWA 1MJ8H 5E0QA 3FL7A 2W65B 4FTVD 5DGQA 1RZ7L 3W11C 4IRSA 3X3FL 1YEIH 4RBPK 3T4YA 1L7TH 4JR9H 5MEQB 4OV5A 5GISH 5C0DB 1E6OH 1D6VL 1QLEL 2QQNH 4I4WB 4PB0L 4M48H 3BSZH 2NYYC 5DTFB 5K9JH 1NMCB 1TZHA 1AE6H 4GG6E 3KR3H 5JOPE 4RDQF 5IT2H 3DBXB 4HKBB 4X6DB 4HCRA 4BKLB 3MRLA 1QSEE 4A2LA 4P2RE 4OAWA 1UEMA 3TESA 5E94A 1SEQH 2BNRD 4XCYB 5DURD 3MROB 4PYGA 5C08E 3K7UA 2Q8AL 3RWDB 2JIXD 2HKFH 1MI5D 3F58L 1JWSB 4I77H 5C2UB 5KSBA 4UI2A 4BZ2L 1F58H 3ARBB 3RVVD 3KYOA 3CFDA 5FGSA 2GI7A 2ICWI 3IDMA 2VWEE 4F33B 2CDGB 4LU5L 5IGXL 1B0RA 2BY2A 5D2NC 3CUPB 4HMCA 4G7YH 5DSCA 5F7EH 2Z8RA 4D3CH 5C0EB 5IVXE 1QFWM 1OW0A 5E9DA 1FAIL 1GZQB 1R5WB 2B5IC 4JG0L 1NEZG 1U8JB 4U7KA 4PJDA 3BZEA 5DFTA 1NGPL 2E8YA 1HSAA 2Y4SA 3VWKC 3GBML 2QQQA 1UCTA 4TNWK 4PUBH 3QCVL 2E9JA 4O2EB 2ADFH 1NAMA 2GEEA 5D7KD 1RD6A 4QTHB 3G5YA 4E0RA 4J4PA 3R8QA 8CGTA 5HI4C 3PQYE 5J7CC 3K4DA 4PJAF 2DQUL 4GRMB 4YXLH 4PG2A 3SDCC 2D03L 3S3SA 2VXUH 4WI8A 1YUHB 3AM8A 4JFED 4FQPA 3P4MA 5IQ9A 4GMTH 1NGXA 5BCAA 4G6AD 2J8OA 4POZD 4DQOH 4GG6B 3LS4H 4WV1C 1KB5H 3D39D 5I0ZA 3BVNB 2B4CH 4P2RB 2MKWA 2HT2D 2YC1A 2OR8A 5FV1L 5C08B 3QFJD 3D18A 4RQQA 5CD3B 1N3NB 4Q0XL 4X7TA 1MRCL 5J0BA 3RJQB 1Q1JH 1BQHA 3LRSA 4WUUA 5B22A 3F7RA 3WNMA 3MLSL 5IHUL 1RK1A 3HR5B 3O2VL 1PZUB 3LEXA 4YDKL 5IVXB 3PL6C 2V17L 2GK2A 5JW3H 4NO3A 2UZYB 1F4WL 3X14A 3AS0A 5EORH 5HVGB 4GRLA 1KCSL 3GSXB 1QLFA 4Z5RB 1KJ3H 1MUJA 5EUOF 4X9IA 1FYHB 4WCYH 1A14H 3ARYA 4KI5F 2E8ZA 3EKCA 3BYTA 1P2CA 3KLDA 4NDMA 2ENSA 3QBTB 3UTZB 1Y18B 2BSSA 4X8XA 1HNFA 3AAZA 3U2SB 3RIFF 1QYGH 2FWOA 3MLXH 4MX7A 2BFVL 4GAGH 4ODTL 5F21B 3WMSA 4ALAL 1NCBH 1GGIH 4H1LG 4OQTH 3U0WL 3VFRB 4JQVC 3C6SA 1GZPA 1NFDA 2DMKA 1F13A 3H0TB 3MRBB 3KLSA 5EUKA 4OCRL 2JJSA 4Z78B 1ZHLB 3IU3A 1A4JA 3HPJB 3OJMB 3SE9L 5K9OB 5FV2A 4MCZA 1MFBL 4ODWA 3P0YL 3SGJC 3BKYL 5EU3A 5BMFH 1HIMH 1ZEAL 2JCCF 4M7ZC 5EBLA 3S4SG 3H3PL 2JIXA 2Y07L 2XA8L 4KZEL 4DFIA 2G75A 3BN3B 1FYTA 3EYSH 5F6IB 4BH7A 4L1DA 3VA6A 32C2B 2DBJA 3MRGB 2R29H 4AT6A 1G9NH 2V5TA 2C1PA 2NTSP 3OKKA 1BLNB 5AUMA 5LGJB 2DQTH 2WSKA 4HZAA 1YDPA 3INUH 4L4VE 3QAZB 3BH8A 1OARH 2F19H 2YEZA 3CLFL 4L8SA 1YQVL 4LASH 4X7CC 3Q6FA 5DR5L 3BO8B 1KB5B 2CK0L 3DMMC 1S9KC 1EHLH 1U91A 4CVZA 5I17A 2VDLL 3ARBD 3QCTL 1UCBL 1LEGB 3WJLA 3ZE2E 4HWEL 5EU6E 1DUZB 2DMBA 1GSMA 3NPSB 43CAB 5IMOB 3UZQA 43C9A 5TQ0H 2R8SH 3O9WB 5E1AA 3QJFA 1QFOA 2DQFB 1QVOB 5DWUL 5I8CB 1AH1A 4N0FB 2EYTA 3TGXA 1T80A 2V5MA 1KXTB 1SJHA 5JOFB 3MFFA 1QA9A 1PX4A 4KUZH 1SJEA 3LY6A 2VLJD 4P59H 3WL9B 2ZNWA 4P4KA 5IBUB 3SE8L 4WHDA 5GZOD 2AJ3A 4I2XE 1J7VR 3CCHB 1MRFL 5BV7L 3FB7B 3OF6A 4HKXB 1NLBH 4XNYH 3DX9B 1EO5A 4MHHG 3TPUA 2YZ8A 4TOYL 3W2DH 5KSAC 2EICA 3D39A 1R3LA 3X13A 1UG9A 4IOIA 4K94L 1G7MA 3SQOH 2FRGP 4WFFE 3MCKB 4OM1H 2CR6A 5DZNA 4JHAH 3WD5H 1RJCA 4B0MM 2MOVA 3S36H 1ZOXA 2CLRA 3ARDC 3DJ9A 1F4XL 2UYLB 3I6LE 1AXIB 4KK9C 1CIUA 1A22B 4LSPL 2RFXA 3ELAT 1AGEA 2EDJA 3BDYH 1WWBX 3LKRB 1AO7B 3JUYA 1LDPH 3EW3B 4MJ5B 4P2RD 1NCDL 3RDTA 4M6AA 3JWDC 5C08D 5IJVB 1ZT1A 3QEHB 4AQOA 1KLFA 3F7VA 1IC1A 4JFXA 2AXFB 1CGVA 3DX6A 3HG1A 3FRPG 5EU6B 5FF6A 3D3VA 3BUYB 3R8BB 3FKUS 1U3HB 3IGAB 3L7EA 4Y5XB 5A2KH 4H26B 4LIQE 4WFHD 3RWEA 3STZA 2XZCL 2VLKE 2XRAL 1MLBB 1YPZB 1M6OA 2CGRH 2CLZB 4MA1C 1T4KA 5D93C 5AZEH 2FBOJ 4WI2A 4LEOA 4I1NB 3OKOB 5FM4A 5I30H 4M9OA 3HCVA 5C6WH 1F4HA 5IG7A 3O45B 4U6HB 5C0FB 3V5DA 1UWEH 1FFQA 4YZFF 5ANME 1SY6A 3FO1B 3WYRA 4NRXB 3T0WA 5ESQB 2IADA 2XWBB 5BVPH 4OZHB 1ZHNA 1L0QA 1LO0L 4QYOB 3DI2B 2MCG1 5JLZB 4YWGL 2ADIA 4NQVA 5JIKA 5JPNB 4TVPH 4Q9QL 3VFGH 2P1YA 5HGBA 3BYYA 4OF7A 1JHKL 1HILA 2XN9D 1C12A 1J0JA 1IGIL 2VOTA 4RIRB 1Q38A 4G80A 4HUXB 5T5NG 4FN0A 5BS0E 4U0RC 4PGEA 2Z91B 2MNUA 4Z7UB 3QIBC 1G7LB 4MAYC 4KRPC 1YJDH 5DJYA 4UTAH 1A7OH 5C2BL 1CF8L 3CVHB 5T1LB 3ARVA 1HKFA 1H3UA 2P5WE 4HX1A 5IB4B 3P4OB 2ADGA 2FIKB 1MQKL 3DVIA 4OLWH 2B1AL 5IOPB 4GXVH 1I8KB 5ACLA 1QFUH 5IR1B 4G7VL 3MXWH 3G6JE 4RGMC 4JHZA 2VLME 2VLKB 4KAQH 3L9RA 4KTEH 1R5WA 2GFBA 2DKSA 4ZTPL 5KJRL 2VLJA 5I1DA 1QBAA 3RVWC 1T66C 1U3ZA 1CGYA 4JN2A 2P46B 4I3RH 5CEXA 2QV2A 3IXTB 4NWUH 5LG1A 1QEWB 1RI8A 4RFNC 1VFAB 3C60A 5CCKL 2Q7NA 4HS8H 2VDML 3EDKA 2D4FA 2PYEE 4O2EA 5ANMB 4BH8B 1NC4A 2AEIT 3R1GL 4CU8A 3HNSL 1FFRA 1NMAH 2GY7B 4K2UH 4OB5L 2X4SB 4BFEA 4GBXB 4QHMA 4YIQA 4OJFH 3QG6A 2X4RA 3P4NA 4MNGE 2UUDK 5F7KC 4F9LA 1JNLL 1HI6A 1BVKB 3D25B 1J05A 3MX0A 3PV6B 5EDXA 1N6VA 3CAFA 2IH1B 2I9LB 1HWHB 5BS0B 4HULB 1FNLA 1KCLA 4Y5VC 2VQUA 1B4RA 3BVNA 2WINB 1FQ9C 3WFEH 2W0FA 1S78C 2OR9H 3JTSB 3ARZA 1JMXA 5DQDL 4UILL 5ABDE 1A3RL 2NMSA 4RWYL 4GW4A 3O8XC 2DRUA 1LE5B 4GQPH 5CSZB 3QXDB 4JKPH 5JXED 2FBJH 3RVUC 2A1WL 1MY7A 4XCNB 1ND0A 3B9KA 1UWXH 2BHZA 1DQLL 3G6JB 3PGCB 1FNSH 2B39A 4MXWH 3VWJB 2VC2L 2XXMB 5M94B 2GT9A 1CL7L 4GRWF 4NZTL 3E0GA 1AO7D 3WKMH 4Z9KB 4NGHH 5DD0H 3UJIL 4LVOB 5FUCC 1ZT4B 1DBAL 3NIFE 4FZEH 3VFWB 2R4RL 4XXCC 4RNRA 3NZ8B 2YPLE 4HUMB 3QXAA 2R69H 4ONGL 2CRYA 1GC1L 1U8PB 4XGZA 5M7QA 4JN1L 3RNKB 2VQ1B 2K7PA 1C1EH 4U6VL 1GCFA 2L4OA 5BXFB 1HH9B 5JQ6H 1G0YR 2XN9A 1UYWL 4X0KB 4FQXB 1EEZB 5F88B 2CO7B 1EJOL 3CLEH 3NABH 1TTGA 3OKLA 3CFCH 2FEDD 2E7LC 2FEEI 2QQLH 1M7IB 4OUUB 1CLYH 2JK5A 3VXRD 4CNIA 2QBWA 4ZSOE 1FGNH 2VH5L 4JLRB 3PWJA 2W9EL 3T3ME 3V6OA 1RUML 1UKQA 32C2A 5DJXB 1VB9A 4JREB 3W9DA 5KBNC 3E3QC 5DA0B 1G6RB 4LCIL 2ESVB 4KQ4L 1DQML 1UH3A 4QRUA 4HJ0D 3QH3B 4NRYA 5GJTL 1CI5A 4UQ2B 3UP1A 2KQMA 4WWKC 3C5JB 5J11B 5IEHB 1B2WH 1MHEB 5T1LD 2PTTB 5C7XH 3GUTA 5TDOA 3MPCA 1ED3B 3OAYK 3AVEA 3TFKC 2NY5L 4LRIC 1VKXB 4Y1AB 2YPLB 1DUZA 1OY3B 1Z2KA 2HRPH 2VDNH 3DROB 3NCYS 3KWWB 1IQDB 3M8OH 5FA3B 4M8QB 3QT2A 3L5HA 4JKKA 2IG2H 2BNUA 4WW1B 2VLKD 4P9ML 5DJ8B 1QR1B 4NQDA 4ZNEA 5GSVB 3HZKA 5FYJE 3RWHB 1YYML 1MFCL 2F53E 5GHWH 2HN7A 4HBQA 1TXKA 4WWID 1IMHC 5CZXC 3D87B 4FQ1L 5EG6C 4AEFA 3MNWA 3IRZA 2PXYC 2BERA 4GBXD 4X5WA 4LARH 4P5MA 3AROA 4R0LB 1D5MA 1D5BB 2N56A 4NT6B 3BKJL 1BBJA 1GAFH 4ZSOB 3L3IB 3GSOA 3ILQD 4CKVX 1J0KA 2ZUSA 2BVOA 2V5RA 5L0QC 1QBLL 2X7LB 4U1IB 1TJIL 2WWKT 5LQBH 2JB6A 3P9LA 4XPBH 1RIUL 1D5IL 4OQTA 4S1RH 4Z0BH 3HI6L 4ISVB 3QP3A 3F7QA 3GM0A 3IS1X 4P2OA 1CQYA 1Q94B 3E8UL 2HKHH 3HI1B 3Q5OA 4YFEA 4D0DA 5HYJE 1CD1A 4MJ5A 5DMYA 1FNEB 3JWOC 5EU4B 4QF1A 1Y6NR 1F42A 5CEZL 1YN6A 2A6IB 4HIIA 4I5BA 4TVPD 5KSBE 2AXFA 2YMXH 1P4LA 2CD0A 4JKWA 1OTTD 4KU1A 1EEYB 4QRQB 1T1YA 3I6KB 4MS8D 2VLMD 5D72L 4QHNB 4IOFD 4JY6A 1RY7B 4CVUA 3QNZA 1IEBA 1N5YH 3LB6C 1JHLH 4X4YB 1XR8B 2ARJB 5H37G 4Z77A 1HSBB 1KIQA 5F1OB 3BISA 1HHHB 3VFSA 5L7XL 3AS3A 1N6UA 3VD7A 4J3SA 5F9JA 4N90E 5AYUL 1DLFH 5C0FA 2P8MB 5DO2C 1RHHA 2O5XL 1DSFH 3FO1A 5HDBE 4NRXA 3EOTH 3VFPB 4U1LB 1T2QL 1K8DA 1ZLSL 3VXRA 4ZD3H 2R56H 3VI4F 5T3XH 2H2SD 1F90H 1CVRA 1BAFH 2WW8A 4AZ8A 3L95A 4XP4L 1W0WA 4ONFH 1XF2A 1KT2A 3AREC 3MGTB 3SE3A 2JKXA 4FQXD 1CG9B 1XGRA 5DJ6B 5HPMB 2EXWD 5DLMH 5J6HB 3C5SA 5DRWB 2CPCA 4ZYKB 1WWAX 1FFPA 2HT3C 3BIBX 5ESAA 1PBYA 4A6YL 4G5ZH 4PRAA 4Z7UA 4TTGA 1X5XA 3DYPA 5GGQH 4R8WH 5DVOA 3QUZB 5E8EA 4ZS6D 2I60L 4YDJA 4EN3C 2P5EE 5C3TA 1KELH 3BZ4B 3SY0B 1PG7H 1N4XH 5IB4A 1WBYB 1F00I 2YD7A 2FIKA 1NUDA 2YPKA 4WUUE 2AGJH 4XCEA 4LLQB 4KTYA 4ZAKC 4LLDB 3MQIA 4M4RA 4UINH 4ETQB 3CFJB 2ESVD 5I1AA 1U93B 3H2WA 4KK8C 3TN0B 1A2YB 5CZVH 1I7ZB 2PYFA 3QI9A 3E2HC 2CJUH 2DBLH 2ZG1A 1F3JB 2FHFA 5TGBB 1ZWIA 5HHQA 1GL4B 1AGDB 5D7JB 4GQ9L 4YC2B 1P7QB 2A83B 3SE4C 3U30C 4EUPA 5E8PB 1YEHH 4CAGA 5EC2B 2HTLD 3UAJD 2D7TH 4QCIA 4Y1AD 1E28A 1FO0H 2YPLD 3O6LH 1MJUH 3VXMA 4BH8A 1A7RL 4PB9H 5JW5A 4LNRA 1NGWB 4G43A 3DVNA 2AS5M 2XG4A 5GS1B 2NTFA 2I07B 5B21A 4G9DB 3WFCL 1QFWH 1MLCA 1ETZB 1CZ8H 4PJAE 4X7DC 3LRGA 4K7PH 4PP1D 4L9LB 1MCKA 1BZQK 3T8XB 3MUHL 1KBGL 2AJUL 1WBZB 5EFIA 3DV4B 3T4AA 4OFIA 5GIRA 3KLHC 3RAJL 5DT1L 4TULH 4BSVA 2QADC 5IFAL 1WTLA 3CC5B 4NQEA 2VAAB 2OSLB 3O81A 4Z8FL 1D6VH 2UVFA 4DN4L 1JPSL 2F58L 2P5EB 3TT1H 5H8DA 2G9HB 3LSOB 4OGYH 1FYTE 5CSZA 2H1PL 2FYYB 4WEBL 3RPIB 3N50A 4AK1A 3ARFA 5JR1L 3WIIL 2COQA 3IETB 3S98A 3JBG7 5HGHA 4OD2B 4F58H 3SHSA 2WM0A 3MYZA 4IIQA 2AJVL 3RWCB 3C8DA 5I9QB 1KN4L 4Z7OE 1TVBA 4QGTA 4WI5A 5C09A 1MHPH 4BZ1L 1MIML 4LU5H 5DD5H 5I66B 4QRPE 1UJ3C 3L3KA 3B6SA 3ARUA 2JJWA 1QR4A 7CGTA 1FAIH 1I85C 1M7DA 4KI5E 4ODUA 4JG0H 1KIPA 1U92B 3RNKA 2X4TB 2X1WL 4KJQD 4XPAH 1NGPH 5JORA 3K8KA 3KPLA 4MA7H 5BXFA 2BVPB 3WDHA 5T5FL 3MA9L 4PJAB 1RZFL 4XC1L 5FO8B 4UV4H 3QCVH 1NUGA 1EEZA 3L5WB 5F88A 2CMRH 5C0GB 1HHJB 4XPGH 2HYMA 3JV6A 1MRDH 4I18B 3HE7A 2DQCL 3VE0B 3FZUD 1JGUL 1FGVH 2CLVA 4KK6C 4Y16D 5C6TH 1M7IA 1A0QL 5GGTL 1XCTB 1AQDB 1T7YA 2DQUH 4HWNA 1Q9WA 2D03H 4R4ND 1FO0B 1ZKAA 1ITBB 2QHRH 5D7IF 4K3GA 4N9GA 2LQRA 3TBWA 4JANB 4JDVA 3FONA 5DRZB 5MERB 1PKQB 1A1MA 3N1MC 3MREA 1BIIB 2XV6B 4WY7L 4NM8L 3ZL4L 5DJCB 4BM7A 3ZHDA 3GO1L 2YPVL 4YGVB 4EI6B 5B38G 4JFDA 1KPRB 4NC1C 2BY3A 4D0CA 4KMTH 1MRCH 3C5JA 1CFNA 5ICZB 3EJZD 2IGFH 1ES0A 4X4XB 4JRXB 4YUEL 1H8NA 1T5WB 4P3WA 3QUZD 1U8KB 5ETUB 3NPZB 5JTWA 3QQ4A 4HGWA 4FQ2H 5KANI 2V7HA 1LGVA 3MJ7B 3DO7B 3SEPA 4OD1L 4QRPB 1JN6A 5EUOB 4YDKH 1UXSA 2P4AB 4CDGC 3D3VE 3H7BB 5KN5B 3UJJL 4UT6L 4UIMB 1KB9J 3TNMB 2PO6C 5FA3A 1XF3B 1DBKL 2FATH 3TN0D 3H9SE 4M8QA 3T08A 5GSVA 1H15A 3B43A 4TRPH 3RBSA 4S10A 1N6QL 3LHPL 3Q5YA 1AIFB 4GKZB 3UDWC 2H2PC 5D7JD 2ADJB 4FZ8L 4BSWB 1P7QD 3OR6B 4N90D 1J87A 4NN5C 1WLHA 1I8IA 4OIBA 1AJ7H 1BHGA 1D5XA 1J88A 1T3FA 3WHXB 5I74C 4R4BA 2BFVH 1BOGB 2EDRA 1E4KC 3WFBL 4ALAH 2JJTC 4N0YH 4X98A 2JCCB 4OIAA 5CWSB 5DVMA 5E5RB 3W39B 3NAAL 4O02L 1D9KB 2MHAA 2X4OA 4BQ6A 4LDLB 1EXUA 3L6FB 3IFOA 4HF5L 3DIFB 1MFBH 1E4JA 2HFGH 3GBNL 5EA0L 2YOCA 3BKYH 5H2BB 4PGCB 3U6RA 4M1DL 4ORGA 3MLYH 3PWLA 4ZFOA 1VFUA 3O41A 2P47B 2EE9A 3H3PH 3T77B 4PLOB 1MFNA 3E6FB 3L7FB 4LPTA 4XP6H 5CUSL 1OAKL 2AQ2A 4PJEA 2IMMA 4JB9H 5IHLB 5J1TC 4F3FB 4QXUH 3SO3B 3RL1A 2DL9A 3UTTB 1U6AH 1K85A 3DXAA 3EYVA 3EAKA 3N1GC 4U6YB 5TDNB 5LCVH 2X89D 1YQVH 4LFHG 4W6WB 4RA0C 3JV4B 5DS8A 5L9DH 5DR5H 2OP4L 3OHXA 2CK0H 4F2MB 5BQ7A 5D7SL 3HPLA 3TNNB 4J3OC 4NO2A 3UTPE 1A64A 3GBLA 2HVKA 3OB0K 3BPLC 2VDLH 4ZUWA 1U95A 4J3WA 2J3SA 3VFNA 4YBQC 5HD8D 4Y19B 5MENB 4NQSB 3MRQA 4RDQG 5C0ND 3G5XB 4I0PA 2ZOLA 4HKZA 4UDUB 3BMWA 3MMEA 1M05B 4Y16A 1E0OB 3OAZK 1HNGA 3JVGA 2IALA 3SPVB 1NCAH 4AENB 4YZFE 3KPNB 5JZ7C 4E42A 3A6BH 3VGEA 4J1UA 5ICYB 4W4OA 2EDNA 5C0IB 1CDBA 2B0SL 1F6AB 2AVGA 5I1CH 1TZGH 4L3EA 1U58B 2APVA 2HLAA 3LDBB 1MRFH 4YK4B 1Y0LB 3V5HA 1F11A 1S7XA 3VGDA 4JY4B 4U1SA 2GITB 1B9ZA 5IIEB 4GS7B 2J8HA 3FT4A 3ESUF 4ZUSA 5K9KA 4K94H 4RAVB 1OD7A 4ZUVB 3IFPA 2HFFB 4XP9L 5E03A 2UZIH 3ETBF 3S34L 2Z31C 1A7NL 1HWGB 4JZOB 5FM8A 1LDSA 1A1NA 3FJTA 4H0GA 3T1FA 1BPVA 1F4XH 3CVIL 2XQBH 4N68A 4KROC 2O5YH 4IMKC 4CMMA 4K9EL 4G8GE 3S6CA 2EKSB 5D8JL 1KLUA 2A73A 4JO4L 4F7MA 4X5LA 5E2JA 5M95B 4OSUL 4J23A 4M7LL 1JPFB 4XVUC 2OK0L 4EDWH 1QQDA 4YDLB 1SJXA 1RFDL 5IMKA 5ESVB 1WISA 3RP1A 4PBVC 4B7LA 1HHGA 3EZJB 4JVWA 3SKJH 1YQ2A 4JRXD 3RX7A 2X9WA 5CEYA 4F15C 3DGGB 1EVTC 1P7HL 4M1GH 2V5SA 1AXSA 5F6HJ 2HMIC 3P9WB 2AXHA 3QO1B 4PRBB 4XP5L 5AG9A 3N9GL 4NM4L 4KI5D 1SYSB 4P2CG 5SWQA 1NGWA 2D9CA 3DUUA 3RKDC 4LVNC 1EA9C 3WFDH 1LO5A 4NCC1 3U9PH 3VXQB 1IGML 3WCYA 3QUXB 2NY3B 4BQ9A 4NHUB 5CSBA 4AIXA 1S5IH 4PGDB 3TVMB 4UDTB 2PW1B 3NIGE 1LO0H 2R0ZH 4AM0B 1C7TA 1E6JL 2GJ6B 4LSRH 1JF5A 4GRWH 2ATKB 5LGHL 1AR1D 2ZCKH 4YDVA 4PJFF 5CJXA 2H6PA 3TO2B 1IGIH 4MB3A 4EI5C 3G5ZB 1D9KD 4G8EA 5JA9A 4YR6A 1I3RB 3V6OE 2X10A 2APFA 4G8GB 3NGBC 2DQJL 5BV7B 1S7UB 2X89A 1AY1L 3RUGF 3U46B 2VLLA 4WDIB 5LAXA 5C2BH 3DTXB 5CGYD 5GJSL 1SEBB 4WTXA 4QRSA 2RGSA 1ADQA 2ZUUA 4H5SB 4F9PC 3VD4A 3UJTL 1FPTL 1T89A 3PWNA 2B1AH 1MOEA 2R2EA 3CXDL 2Z9TA 4G7VH 3UTTD 3QXUA 3RGVB 1I9EA 5JW4R 4HLJA 3M07A 1QZ1A 3C2AH 2IBZY 2DB8A 3VGAC 4ZTPH 5IBTL 1A1OB 5B4MC 3V79C 4LLUA 1JV5B 4S1DD 1OAYL 1IKNA 4PLKD 4OFPA 1QG3A 3ZT6A 4AIZA 1I8MA 1PD6A 3QRFM 5MEND 4Y19D 2VLRA 5JNYA 1HHJA 3HRZB 2I9TB 2FJFA 3QUMH 3UZVB 3P4LA 4I18A 1DVFA 4G6ML 2C3XA 3B9DA 1UM6L 2RQ8A 3Q1SL 5E2WL 2J4WL 4P46C 3IDGA 4M02A 1J0IA 3EHBD 4HGKC 1U42A 5CJBA 4UBDC 2XY1A 5K59F 5I75C 3AB0C 3EYQC 1D5ZA 2XIDA 5SWSA 4JAMB 1NLDH 3ULSB 1PY9A 3MRMB 3U9UA 1RJYA 2KBGA 1BGXL 2V5YA 3BEVB 4JPWH 4A2MA 4O2CB 4XPTH 1N8ZA 5DMKA 5IW3A 2C3GA 1XGQB 2J8UF 4RMUA 2B2XH 3VWKD 5EZOL 1I1CA 4ZS7L 5A2JH 3ZTJG 1T04B 5FECB 3L3OB 1JPTH 2FH8A 1KN2H 3F12A 3QZWB 4L8BA 4P49A 3MLRL 3QPXH 5DQDH 4UILH 3LKQB 4QT5A 5EBWB 2J6EL 3MJ8B 1A3RH 1I9IL 2E27L 3EDJA 4X4XA 4GRWB 4BQCA 1XGUB 1GPOH 2R9HC 3ULUC 3ES6A 1NCWL 5JQHC 2A1WH 3QQNA 1U8OA 1J11A 2WUBL 4EBQH 1DQLH 2AABL 1S7VA 5FKAA