1RU9L

Crystal structure (a) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected in-house.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 47
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ru9L01
2CDEA 5J9PB 2JIXB 3IDNA 4WEBH 4WW2F 1RIUH 4R3SA 5JTWA 2YD9A 4PV8A 1JPTH 4MJID 2R9HD 2VLKD 3Q6GL 4KTEL 1N59A 1LGVA 4JVUA 5I76A 3O4LD 3D39A 4Y5VC 4PY7B 4GAJL 4H20L 1Y0LA 4N0CD 2F54A 5EZJB 3QFJD 5C8JA 4LFHG 3QEGH 1NGZB 5E1HB 1U58B 3UJJH 4D0CA 2CIIB 2HKFL 1BD2A 1QLFA 1G9MC 2EC8A 3FT4B 3C60C 4L9LC 5FUOH 4GXUM 4U0RC 1IKFH 4YK4B 3I3BA 1X44A 5DHYA 4MB3A 4M48H 3NA4A 2HKHL 4HXAL 1OWWA 4XP9L 4OFKA 5GIRB 4GRWF 4I4WA 2X4UA 2DQHL 2NY7L 1FNLA 2DQGH 3RWFA 4XBPB 1CD1B 4YDJA 5HDBE 4M03A 1AXIB 2XZCH 5DK3A 2ZNWA 3MROB 5TE7L 4OF7A 3S96B 4K8RH 4U1IA 3K74B 4M4PA 4QYOB 1OTTD 1Q8MA 2AS5M 1N2RB 2ORBL 5IVNA 2JB5H 4M8QA 3BN9C 4P3CH 3S5LB 1KJ3H 4MAYC 4CW1A 4LKCB 1A1OB 4FQ1L 1JGUL 4MA3A 3PQYA 5F7WC 1VKXB 5B4MC 5T3XD 1F4AA 1RU9H 3SDDB 4OB5L 2WUBL 5HYSB 1U3HD 4X9FA 3AMKA 1I7UB 3QDAA 5EZLA 5CJ8A 1N4XL 3MRJA 3V6OC 3EFDH 5DWUL 3BPNC 5HI5D 5I1IL 3RWEA 1YNTA 2AEPH 5MP6L 3ZDYF 2D9QB 2EDWA 1N5AB 1OWRM 1GRWA 4PGBA 4Y16A 2VN7A 2RCSH 3WEXB 3VXOB 3JWOH 5D4QA 4FP8L 2OBGA 2XTLA 1T0MA 3U7WL 3WUWA 3MCKB 3SQOH 2YD3A 1VFAB 5CWSA 1ZLVK 3HRPA 1G6RB 4NSKB 3H7BB 5AEAA 5DVKA 1C5DA 5KSBF 2LAAA 4M6OL 3JV4B 1DFBH 3N0PB 2BRQA 2XWBB 3O0RH 3MZTA 3QDHA 4H1LA 3LMJH 3VXPA 1ZXQA 3B2UC 2NLJB 2JJTA 5C2BL 3BPCA 3CK0L 1YY9C 4FNLH 5D1QB 1AQDB 4HWEH 3OMZA 1L4IA 1G1YA 4LHQB 3LAFA 1XGUA 3QEUB 5F8RC 1S9WB 1LNUA 3S36X 4YHPB 5FV1L 1MCHA 2OM5A 3B2UD 5FYKU 4LVNC 4HKXB 4X83A 1VEMA 2HVKA 1DDHB 4F57L 4PJHE 3HNVL 4KVNL 5EDXA 2EDKA 4ODUB 5JORA 1MCWW 3SDXA 4Q74A 2NY4C 4LCYB 3O11B 2F8OA 4MB5A 3WD5H 5J4MA 1CD0A 4N0UA 1OVZA 4MDIB 5A40E 5DK0B 1UB5A 3EOYG 3UPRA 4PTTA 3A6BL 3EAKA 5ANMB 3TJHC 3V6FB 4EN3C 2HJFA 4PGEB 2HAZA 1BQSA 4P57A 4Y1AE 4DUXA 4GUPB 3VWKB 3BW9A 1PSKL 1FZKA 4HFUH 5F7YC 1JNNH 3UBXA 4FFYL 4N0UE 5E8PB 1GSMA 3O8XD 5E00B 1FPTH 2IAMB 5C0BB 5SWQA 4PTUB 1Q9OB 4DOHB 4NKIL 4WI4A 5K33A 1PQZB 2GJ6B 3MLYH 3OJ2C 1RZKC 4MJ2A 4MVBC 1YEEL 5J6HA 3HZMA 1GGBL 2DLFL 3DSFH 4XVUD 4YHOH 1QSZA 2BJML 2ZSWB 4PBXA 4OFYD 2BHYA 1OT2A 1FV1B 2HMID 2NY1D 4AEHH 4XP9H 1NDMB 3QHZH 5TE6H 3TBTB 2F54D 3X12A 4KK6D 4TNWF 4D9LL 1JZ3A 5I30H 5D7SL 4PJ9A 1JPGB 5IJVA 1BZ7A 4CN1A 4PRAB 3ULVC 1UH3A 3TT1H 3MRRB 1BQHA 2OX5A 3KPNB 1ED3B 1MHHA 2E9JA 4P4KC 3GSUA 4XBGA 1KYOJ 4W68A 3WD5L 2YD1A 1RJLB 2P5WB 1QLEH 4JM2F 3ZTJG 4YDKH 4OZIB 1J1PL 4JFHE 1OAYH 3G6JB 2X10A 5EBLB 3VGEA 2ITDA 5JZ7C 4ZPTB 1RZKL 1NFDE 3UYOD 3RAJL 3BJLA 2AEIT 3I9GH 3NFPB 4HWBH 4X6FA 5IF0B 2MQ3A 5FHAH 1NMBL 1GAFH 4NUJA 1YJDL 2J3SA 2EIEA 2DM4A 1JGDA 5EUKA 5D6DC 1CIUA 3PL6D 2CK2A 5FKAB 5GSRA 4OLUL 3TO4D 3VFOB 3STZB 2MJWA 1P69B 2Y1VA 25C8L 5H35A 1V8HA 2OL3B 3U7YH 4D0BA 4WCYH 4TULH 2BNRB 2GITA 3NFNB 1WTLA 4FQIH 4JRYA 4XTRD 3THML 2WBJA 3R8QA 4WW2C 1OD7A 4NC2B 2OI9C 4OBRA 3IKCB 3DXAA 5EU6A 2XTJE 1JGEB 4LIQH 1G7QB 2VKXA 2X4RA 4PGJA 1J1OL 4AIXA 3WFDL 3O8XC 1IM3A 4FQXB 5FUCE 3DVGB 4QRUB 2R0ZL 1SJVA 4GO6B 5DZNA 1CXLA 3HAEA 3EYFB 32C2B 5CUSH 1NBZB 4TVSa 1F6LL 2V9RA 1JL8A 3BXNB 3GO1L 1CICA 4L4TB 3VXUE 2D4DA 2NXZB 3NACL 1GH7A 1CD8A 3QXDB 4JKLA 4RA0C 4IMLA 2O26U 1HQRA 1IARB 5C0AA 4Y5YC 3MCLH 3WN5B 5E8OA 4JQXC 1WLHA 4JHWH 3MUGB 1A1MB 4HC1H 1P5UA 1X5IA 4GLRH 1MUJA 1LO5B 2XZQH 3MRBA 1ZT4B 5ISZA 3VI3F 1F3DH 5JO5B 1KXQE 4XGZA 2K9UA 3L3GA 1GGUA 4MD0B 3UJIH 1ZGLP 3QIWB 5DTFB 4G9FD 4H0GA 2BY0A 3T3PE 2G5BB 3QDJB 1A3RH 2D7NA 2ZG3A 4LSUL 1X5LA 2R2HA 4BKLA 3KXFD 4XWOC 1RJYA 4LEOA 4JEGB 1OT1A 4XX1E 1PG7X 4P2RB 3FB5B 3SOBH 1X6LA 4M1DH 4U1LA 1FG2A 4MXQC 4XB7A 1ZMYA 1AGCB 3O8XA 3RNKB 2DLIA 3VWJC 2IF7A 4E5XB 1AKJD 2C4XA 1MHHB 4FQ1H 1OW0C 4OZ4A 2H1PL 4ESKA 4PLOB 1TVBA 1DL7H 2MFNA 5HHOD 5JLZB 4IRJA 4BSJA 4GQ9H 5IB2A 5TPWH 5FA3A 2ZP0T 5EC1A 1TCRA 4U1KA 2D0FA 4A6YA 5IVXA 5DQ9B 2XQBH 4J3WA 1WWCA 15C8L 1YEIL 1F02I 5I8CB 1ND0A 4KUZH 1OSZA 3IDYC 1BQLL 1T66C 2ITCA 2FZ3A 1NDMA 4P4KB 1JUFB 1TVHB 4M7ZB 5B3JF 2F74B 2PXYB 3CAFA 4NQXB 2W59A 2HA1A 3CZJA 4L8BB 5C0CD 4PRNA 4J3UA 4WI3A 4GAFB 4G80B 4ZO8A 3B9KA 3DIFA 4NYLB 1Z3GL 5DGRA 4L8DB 1RK0B 2P5EE 1ZVSA 5TDPB 1U95A 4PJ7E 3SQBA 3MPCA 1EEYA 5F6HJ 4X99A 4JG0H 1XT5A 4M1CD 3OJDB 3LHPL 1LO3H 3LKNB 1IGIL 1M7XA 1FZKB 4MQTB 2R0WH 1ZWIA 3L9RA 4OUUA 2A9NH 2O5ZL 4PG2C 1F42A 3AROA 1W0YT 1T21B 2FIKB 3KPOB 5LWYH 4WI7A 1DN2A 1CFTB 5JNYB 3QPQD 5FUZL 3LDBC 4F8QA 2QADD 5DJZA 1UZ8B 3P11H 2WWKT 1H3PH 2EDOA 1SJXA 4G8GD 2VLJA 2HFTA 3P9LA 4GG6F 1JUFA 3V5HB 3WLBB 1S5IH 4R97B 1IC7H 1OP9A 5I8CA 2ZUWA 4F33B 3RX5A 3LRGA 3W9EB 3LKRB 4HLJA 2F8VA 3QHFH 3TV3L 1JNHB 2P5EB 5J12B 2UV3A 4HUUA 3WS6C 1FFRA 3K8LA 4MAYA 2HVKB 2HYMA 5HBBA 5JQ6H 2WANA 4PJEE 4PP1D 1UT9A 5LGKA 4UILH 1HSBB 1RZIA 2VIRA 4PJCA 3WL9A 3EDDA 3T0VA 1S7VB 2Y7QB 3MLUL 4N1CA 3FKUS 4WRLA 1DQQA 3EYVA 1ZS8B 3OAZH 1UA6H 3GO1H 1J18A 4L1DA 3CVIL 4LSVH 4IOSD 1CBVL 5EZOL 4P2RA 1R3IL 4NSKA 5ILTL 1XR8B 2WQ8A 1TZGH 1A6AA 2XXMB 2XACC 3MFFA 4OAWA 4P2OD 5MERB 5I75C 3HMWH 3FQRA 1EAJA 3BSZL 5GGVH 1X5FA 1ONQA 1GGYA 3VXOA 3O2WL 1GXEA 4Q7DA 3DUHA 1FYTE 3O4OB 3V52H 2C3HA 1N5AA 3O3EA 1ZT7B 1D5IH 3T2PA 3RTQB 4PBWD 4U1NB 3RL2B 43C9B 4ZUSB 4U0RB 3WE6A 1JZ6A 4M7KH 2PR4L 4ZXBD 4DN4L 4CVXB 3V5KA 1R3HB 3O2VH 3HR5B 2C7UB 2YKLL 3WN5A 1WJ3A 2BFVH 5EBGA 4U6TA 3V8CA 1UGNA 5HHNB 3QCUL 1BVKA 5JOFA 3QUZA 3DX8A 2NY6B 5MHSE 3BSZH 3NVQA 5BZDB 1ORSB 5JHDE 3MNWA 4N90E 1DFBL 4APQB 1DEDA 3DWTA 32C2A 2Y4SA 4POUB 4JVWA 4C54A 1I75A 3ZDYE 1G6VK 1OHQA 2X4PB 2BCKB 5D70H 4F3FB 3ARRA 2CKNA 4PR5A 4WWKA 1IM3B 4YZFF 5EU3A 1FIGL 3RU8L 1NGPL 3IAQA 4LNRA 1MFCL 3FOMB 1EK3A 3X14B 1GZPB 1UB6B 4ODTH 1HZHH 3SDXF 3DARA 3V8OA 4K94H 4QY8B 5HY9A 4MD4A 2LU7A 1QBML 1A2YA 1NL0H 3ARFD 3WFHA 4JPVH 1I1RA 4QRPA 4LSRL 4LVOB 5FO8B 5CGYC 1ACZA 5JQ6L 5F3BB 4N5EC 1CDCA 3STZA 1SJEA 3ULVH 3GBLA 3MNVA 3JWOC 3PXHA 4KQ4L 4LHJB 4GG6E 3IJHB 4JHZA 5F44A 3LQAC 4OQTA 4N9OB 4PRPB 3TESA 4OI7A 1T7YA 2X09A 2NTSP 5SX4H 4ALAH 4WU5B 5BOPA 2FGWH 4PG9A 4LSQH 4HAFA 5D2NC 1YN6A 2FCBA 2Z91A 3WMSA 4KRMB 1OGAB 4PY8I 1DQML 4MNQD 2IJ0C 4JQIH 4ELME 2YZ1A 2XPGB 3CDYA 1U8NB 5FGCE 1RJLA 2VAAA 3P0YH 1G7MB 4KI5C 2VAJA 1CE6B 3RGVD 2EYRB 1MCPH 4YWGH 5HD8D 4MZ2A 3KPRD 5AZEL 4YIQB 2KL6A 4HIIA 3I02A 3JTSA 4ZS7L 4PRAA 5L6YH 5EUOA 4I77H 1T3FB 2LE9A 4J3OC 1J05A 1Z9OA 1JI1A 5GGTA 1EUUA 4WEBL 5E8DH 5HGBB 3DO3A 5DK2B 4NQTA 5B38G 3RVVC 4F2MB 3CFBA 3ZYZA 3X12B 3AU1B 3HC4L 4N8CH 4PJCF 4Y19E 3BZEA 2FO4A 1MQKH 4HH9A 4WI8A 4RGOH 5EA0L 3F7PC 3PE9A 5GS2H 1UA6L 4JG1H 1QO3B 1FV1A 4GW1B 3RJDA 1VPOL 2EIDA 1V3LA 2VJXA 2R0KL 1KCVH 2E7MA 1HQ4B 2HG5A 3WIIL 3FO1B 2ZUVA 1F5WA 3DBXB 3JSSA 2ESVE 4X7SL 4KRPD 1PQZA 2GJ6A 4P2OC 1ZV5A 4BFBD 1PW3A 4DVRL 5IMLB 3DRQA 4V2CB 3FONB 2MTPA 3O6FA 2CLVA 1KLUB 1TJGH 4U33A 3KPLB 1JYVA 4JFZH 4GW4A 1IFHL 2P47B 3GIVB 3VWKA 3RVTD 2DWDA 5EOCH 4UQ2B 3BISA 3MV7D 4Y4HB 4DZBA 3BAEH 3CCHB 3QZWB 1U3HA 5GRYA 4CADB 4K7PH 1Q0YL 1OAXL 4P5MA 4P9MH 1Y18A 2NY2C 5DFWH 2IPUG 1U92A 3KPSD 3Q1SH 2XQYG 1TITA 1AO7A 1J9CT 4J1UA 2NZIA 4XI5D 3V0VA 4U3CA 5LQBL 2X42A 2BVOA 4HK3J 4WI2A 1NBYB 4J3TA 2XRAH 3CVHH 1J1XL 4F7EB 1MRCL 1EHNA 1BF2A 4X0KB 4XCCL 4N5UA 2OMBA 4K3HA 1AP2B 3SDYH 1MRFL 1KIQA 1NCBH 3BVNB 4U3HA 1FBIL 4KDWA 4F7MA 4DVBA 2OCFD 1NC2B 3QDME 3RWGB 4F15B 3UJIL 1S9WA 1BVLB 1B0RA 4I2XB 5IBUG 3T65A 4Z6AT 1N7ML 4IS6B 2DQFA 3HUJE 4NRXA 2Y36H 1QUNA 1D7FA 5EG6C 5I1CH 3HI1A 2F53A 4CN4A 2Z35B 2FHFA 3ULVE 2QJDA 1IJ9A 2OR8A 1HKLL 1GIGH 4EN3D 3CPLB 2XWTB 3CX5K 4FXKB 4Z7QF 1FVDA 3UO1L 2X40A 3S37H 1CGTA 2JJVA 4I0PA 3QUZC 3G5ZB 4ORGA 5JW3L 4F15C 3A6OA 2EECA 1T0MB 3BH8B 4NDMB 4XPBH 1OGAE 3C9NB 2YSSB 4U2ZA 4XAKE 2ZOKB 3MOAL 3GJFH 2YEZB 3KYKH 4S2SB 2D31A 3NIFE 5B8CB 1MH5B 3D39E 1E4WL 4I2XE 2SEBB 4P4KD 3RWEB 4R6UA 5MEQA 4LHUB 4LU5L 1WAAE 1IRAY 4K3GA 4TNVK 4X7EC 3IVKB 2AP2A 3D5OF 1XF5B 5GPRA 2G60H 3I6LD 4JFYA 3SGKA 2F53E 4X6DE 3MC0A 1WWAX 2VLKB 3G5VB 1DBAH 3KPSB 4PP2A 3TZVB 3W5MA 3QEQB 3RTQC 4JRYE 1I1FA 4LKCA 3MV8E 5DDHA 4QXTA 1RURL 3MRDB 3H9HB 4Y16C 3DVNB 4GAGH 4OCXH 2H2SC 3MV7A 4H88L 2PO6D 3HLAA 3LZFH 1Z3GH 4MLIA 4TSAH 4Z7QE 5T3XL 4NOFA 3MROA 1K4CA 1M6OB 5IVOA 4RCAA 5DUPH 3F58L 5FCUL 2DQIH 1NGQH 4OV6F 3L1OL 4ERSL 5I2IB 4JFHD 4X6CF 2B39A 3EDFA 5F88A 4CJ1A 4YHML 3I9GL 5DFTA 5KJRH 1XGPB 2GSIB 2XTJC 3O4LA 4EBQL 3U0WH 5F8QC 4YGVB 3RWDB 1RIHL 2FLBT 2XQBL 4JO3L 5E5MA 5AUMB 5FUZH 4FQHB 4ZFZB 1KN4H 2F5AL 3QDGD 4NNPL 1NANI 4YE4H 5IQ7L 4WI5A 3CUPB 3GSNL 4MGXA 2H45A 1A3LH 3OTTA 3T1FB 2PTTA 3GI8H 3LHPH 3MV11 2ZPKH 4X7SH 5HJ3A 4GRMA 1KOAA 1R5WA 3WYRA 3DI3B 1R3LB 5CSGA 2B0SH 4I3SH 3AAZB 4Y4KA 5IV2B 2NY2D 3S3JA 3O81A 1RZJL 5DA0B 4PFEA 2OK0L 2YHGA 3NCMA 5GS1B 3VH8A 3KHOA 5FYKH 1J5OH 1IAOA 3HI1B 3FHQA 2AJZB 2BMKA 4P2QA 3LS5L 3FZUD 4X6BA 2VLMD 1FE8H 1DBAL 3OAUH 5DI8B 2JE8A 4DGIH 3QDGA 4LASL 3FB7A 1WZ1H 3F5WB 1KJ2B 4KDVA 4P2RE 4R90H 2JTDA 1IT9H 1JFQL 3WKNA 3V7AG 3MRIA 1EXUB 1KIQB 4MXQD 4ZFOA 1FJ1A 3CFEA 1M7IA 1LK3L 2V5YA 5F7DB 4EUPH 1Q9KB 2DYPB 3V52L 3JV5A 4LF3A 4HX1B 3IFOA 2A74B 4NM4L 4DFIA 4HC1A 5DJ0A 4WFED 3MJ9H 1KTLA 3A0OA 1DBJL 5DSCB 2D0HA 4QRPD 1ITCA 3E2HB 3RI5K 3T0AA 2FHBA 4I0PC 5TGBB 3UO1H 3AMLA 4IRJC 3FMGH 4PREA 4WHCA 4OLUH 3TYFB 4PJ8C 3W2DH 3JVGC 1CT8A 1CDYA 1KLUA 1F4YH 1BJ1J 2IALA 2Y9RT 4WO4C 4GMSH 3RDTA 6FABH 4JAMA 2HTKC 2FJHA 5C08B 1MCFA 2GTZA 4AL8H 5ESAB 3NCFB 1H9VA 1RUPL 3U82B 1AR1C 3DHJA 2VL5A 1HI6A 4N8PA 1CDUA 1WBXA 3WHXB 1AIFA 1MHPH 4NC1C 1QRNA 5CGTA 4XP1H 1DSFH 3SO5A 4CU7A 2WP3O 1IAIM 3LIZL 5I1DA 3IFOB 3MGOA 1D9KD 3T0EE 4HH9B 4Y19D 4B53A 1JHTA 1JMZA 3N1QC 2H26B 1BBDH 4RMWA 1X5ZA 3CFEB 4EN3A 5FYLL 3FB8B 3S4SB 5HYSG 5I1IH 1CG9B 3OXSA 1V3MA 4O2FB 1A7OL 1JHTB 1FO0L 1JFQH 5IW3A 2P7TA 5IFHH 3F5WA 5DO2C 3I02B 3JTSB 4UIKH 4W6WB 4YHKL 1CGYA 2HFEB 2KH2B 2VABB 3TH3T 2XZQL 2EYRA 4DWHA 3TO2A 4DKEH 2J8UE 4K3JL 2NYYD 3DO7B 1HI6B 2CUMA 4XCNA 5DJ6B 3I6GB 3CFDB 5GHWL 3U30B 1QSEE 5FV2A 4MZ3A 1T04A 3RX7A 2NR6C 5FF6B 3EHBC 4MNGA 1F3RB 3PGFL 3UAJC 5HPOA 2YMXH 1VFOA 1R3KA 4PG9B 5KSAD 1ZK9A 1H3VA 2NR6D 4FHBD 3OKKB 4JLRB 1MJ8H 1KTRL 2UVFA 4U1GC 4HSQA 4QLRA 3RWIA 5CJBA 3MRMA 5KW9L 5E9DE 1I8KB 1ZHKB 1J1PH 2J5LB 3QO1A 1MCQA 5MI0B 5GISH 4X5XA 2GT9B 3HNTH 5ENWA 2I5YL 3QH3A 1QBLL 3KPMB 1YNLL 3U79A 1J87A 3O9WB 3SDCB 2C9AA 1V3KA 4MSWB 3FFCA 1A6TB 2A74A 3O6MH 5GRUL 1MFDL 3KG5A 3NFSL 5ALCL 3MLVL 1G9ML 1N64H 1XGPA 4OIBA 5DYOA 3RVVD 3LRHA 4R7DA 4EI6B 4D9LH 3U4EB 5CSZA 3BJ91 3BP6B 2Z8VC 2CMRH 1FG9C 3FB7B 5I73B 3DX9B 3BYTA 4U1JB 4AEIL 3UZVB 3OAUL 1S5HA 2APXA 4OZGF 9CGTA 3MV7B 4XI5C 3SGJC 4NJ9H 1EHLH 4LAJH 4PJAF 4DZ8A 5GS1A 4DTGL 4PGDA 5D8JH 3RWJB 4WV1A 3TBYA 1I1FB 2EE3A 5GJSL 4MA1B 2Q6WB 1OQOA 2B1AH 3OKMA 4LVOC 1C5BH 1Q9LA 1TQCC 5EIQA 1AQKL 1W72B 4PD4J 3LRSB 4FZ8L 5KVFH 4MXVF 5T3ZD 4KY1L 3MUZ1 4QRTB 5I1GH 3PWVA 4J4PC 1UM6L 4LHUA 5MEQB 3WFCH 3HC3L 2Q8AL 1ZT7A 4MWFA 1SY6A 5JIHA 5J6GB 3BD5A 2C1PA 4IRSC 2D7TL 4G8EB 3DX7A 3CUPA 1OGTB 4U7KA 1I9RL 1AHWB 5I30L 2W38A 2X9XA 3G5ZA 4ORGB 4PJXE 1I85A 3EOTL 1NCWL 4PYHA 1OAXH 4P9ML 4PRHD 5HYJD 1KEGL 4UQ3B 2DJ4A 1MPAH 3ARFC 3DTXB 5DMKA 4U1SB 4WGWB 2Z31A 1VESA 2E6QA 2GSIA 3WS3B 4JFZL 4XP1L 2O61A 4NQVA 4O02H 4EIGB 4ZUUB 1DQQB 4ONOA 1MFCH 1YY8B 4OT1H 4ODWA 2MKWA 3MJ6A 3MUJA 2ADFL 4LCWB 4NNXA 4PJEA 1KIRA 1T7XA 5F9OH 3KNBB 3MLWL 5DQJA 1KJ2L 5IVZA 5BO1L 4HZAA 3IDXH 4Z7UA 1MFNA 3C6LA 3HLAB 3G6AB 1HILB 2EDHA 4UV7L 4MCYB 3DSNA 4C83B 2CK0L 5T1MB 1CGXA 2AJYH 4QRSA 5C0NC 3MRCB 4BH8B 1XMWA 3ZO0A 3WLBA 2QADC 4OLYL 1FC1A 5GRWA 4PJFA 4JFYB 3V5HA 3UTSE 5D8JL 1K5NA 2NXYD 3P77A 4O02L 4X7DC 5KAQG 2EH7L 1FDLH 4W4OC 3MYZA 4XCEB 1I1AA 5EBMB 3PQYD 5CEZH 5GZND 3T0BA 5I8KL 1D5MA 3QEGL 4RMTA 2WUBH 4NT6A 1HWGB 3OZ9H 1U3JA 3GZKA 3LS4H 1MI5D 3C9NA 4L3ED 2VXVL 4NWTL 4HBCH 1MJ7L 1KLFA 3MSPA 3GMMA 3Q6GH 5H94B 3JWDL 1S9XB 3QJFA 2WWMC 3PWLA 3SGEI 2HP4A 3QQ4A 5J1AB 1CVSC 5MP6H 5IMLA 1L7TL 1MIEH 5IB1A 3MJ7A 2I5YH 1A6VH 3FT3A 3M07A 4JFOA 5DLML 3TBVA 1BX2A 4ENED 3GMPA 5C0CE 3HB3D 2Z8RA 2DQUH 3ZYIA 5F72S 1J8KA 1UVQA 1X6NA 5E8NA 4X9IA 2QL1A 1KC5H 2R1XA 1BVLA 3UCRA 1LEKB 4PRIE 4Q9QH 3LPFA 2V17L 2AEQH 1TXKA 2JB5L 4Y1AA 4P5KB 2EDTA 3D9AH 2CMRL 2WZPD 3BEVA 3OF6D 3DUUA 4U7SA 4BJLA 3X17A 5EBWA 2DF3A 3X13A 4G42A 2NY4B 1QSED 5FAAA 4ELKA 5FA3B 2UWEF 2J6EH 4C56A 4MA8H 3IU4H 4Z77B 1AC6A 5T1LB 4ONGL 1AD9B 4G6FB 5CJXA 4JY4A 1CE6A 4N5ED 5JHLL 3AS2A 3LN9A 3P0YL 2VAAB 3X11B 4DAGH 3ZKMC 1HDMA 3RGVB 1MCOL 1P7KA 4N8VA 4G7YL 4P4RA 2BK8A 1WAAF 4KKBC 3RFZC 1RJYB 4LEOB 4BKLB 3IFPA 2FSEA 2PYEE 3STLB 1KIPB 4Y4FA 5J0BA 3CFJB 1D3CA 1NFDF 2FHCA 1G7LB 2D03L 2R0LL 3N9GH 4MDJB 4D0DA 2R8SH 2FLRT 4QGTA 1PDKA 2QSTA 4LSPL 4CMMB 4X6EB 4I0KA 2PYFA 3S97C 4GW1A 2YPLD 3EO1B 5L8KB 1HXYA 5DD1L 3PABA 4Z7VB 4P2OB 4Y5VA 1T1ZA 4QRPB 5H37G 4MB4A 2X5PA 1NLBL 1PX3A 5EC2A 2GFBA 1MPAL 3KYNB 3LQMA 5CP7B 3ZE0F 4CMHB 5IGXH 2VWEE 1YUHB 4PP1C 1C1EH 5DK2A 1CFQB 3OV6A 5IB1B 4GJTB 4NQCE 2QADB 5C71A 3QNYA 3NTCH 2X4PA 2NNAA 1RFDL 5SX5K 1MHEA 4HK3N 3B2VH 3VMNA 4WFEE 4XAKD 2VDNH 5D6CB 3HG1B 1YECL 3AB0B 3G08B 4MLSA 4Y4HD 5HHME 5BXFA 2RCSL 3HI6H 4NKDA 3DHMA 4R4ND 5D96C 3CSGA 5F7LB 5TDNB 2AI0H 3OSKA 3CMOL 3ARDD 1CDBA 4OGAD 4MYWB 5ECJE 2DTML 2Z91B 5D5ME 5BW7C 1R3HA 3TO4C 1DBMH 4XCEA 4KK9D 4HS8H 3ULVD 3Q5YA 2J7LA 43C9A 1QLRB 1KCUL 4UBDC 5DD5L 3QFDA 5FOJA 5TFSH 3TN0C 5J56B 1I9JH 1VGEL 1JGDB 5EUKB 1MREL 5HYQB 1CL7H 2I25N 5C2BH 3NABL 4L3CB 1RUPH 1F00I 4TTDC 3PWPB 1MRFH 1DLFH 1GHFL 3C6LB 1TJHL 1WT5A 3K2UH 1DEEA 3JWDH 1A1NA 5BCAA 3K81A 3F7QA 3K8KA 4ODWB 1YMMA 4YZFE 4HBQA 1IKNA 1H3XA 1EEUA 3P73B 2OQJA 4OGXH 4LLYA 4OCWL 1S7UA 3SKJH 5CEXB 4G9DB 1U8PB 2Z31B 3KPSE 1ED3A 2N56A 2JB6A 1IEHA 2BCKA 4HJ0D 4YXKH 5ICYA 3SKUD 5B38B 1K8IA 4FQIL 3THMH 3P4NA 4X4YB 4APQA 2F19L 4HZLA 3QDMB 5I1GL 5HGGS 5C0AD 2LU4A 4LIQL 3QXAB 3FL7A 4X4ZA 2I07A 1F3DJ 3QPXL 3TBTA 2A6KA 5DJCA 1NSNH 2EO9A 1NLBH 2EDNA 1OP3K 5KVGL 1FC2D 3LH2H 2VLJB 3AREB 3HG1D 2W92A 5HVGB 3EOTH 4U1NA 1JF1B 1TCMA 5SWSE 2PF6A 3LRSA 3TZVD 2P24B 1MRCH 5I18L 5BVPH 4E41B 1WZLA 5INCB 2Q6WA 4RISL 1ZWIB 3MV8D 4XXDA 2BDNL 4PJBF 5IKCA 3TVMA 4JRYD 5EIIA 4X9HA 3DV6B 4L5FL 3PWUA 3ECBA 4PRIA 2O5XH 1MIML 4FQPA 4HJGB 2QQLL 3HE6D 2QQNH 4KJPC 5GGQL 3G9VA 1O7VA 5I6XB 5I1JL 1TPXB 5C1MB 4WTZA 3X3FL 3RWHA 4FOMA 1CF8L 4X9GA 5KZCD 3SDXE 1ZLUH 1XF4B 3MRNB 4EVNA 3PJSA 3EUUA 2F74A 4LCIL 5CBAA 3QRFM 4RISH 1CI5A 4FFVC 3FO9B 4TRPL 4O4YH 3GHEL 2HT3C 4AT6A 1CICC 1GYAA 2VKWA 1CWVA 4P5TB 4Z18A 1JZ7A 3L3JA 4JN2A 1NGXA 5DQ9A 2EYTA 2AGJL 2HJKB 4ZUTA 4N0FB 4JO1H 1MIMH 3RVUC 1P9MA 3LSOB 3PHQA 3GK8H 3D3VA 2FB4H 1PG7H 3F7VB 5A2FA 4PRHB 5TPWL 3ZHKA 3T77B 4ZXBC 1G6RH 2PYED 4PS4H 5CGMA 5KVDL 3SE8L 1R3KB 4OZ4B 1SYVB 3FT2A 3B9AA 1M7DA 4AEIH 4LPCA 3WHE1 3VXMD 1AGCA 3O8XB 4FQXC 3RNKA 5L9DH 1FG2B 4FZEL 2WAHA 3QUXB 1P6FA 4POYA 1G7PA 5DRXA 1EFXA 3E6FB 5E1AA 4L4VB 3IB4A 2BNRE 4OCLC 5L7XL 1WCQA 3K4AA 2R2HB 4MS8C 4F7CA 3P9MB 2VDML 5FYJU 1NCCH 1I3RB 3JTTB 1ZVSB 1RK0A 5I17A 4M1DL 4LHUG 3LIZH 1SM3H 3DIFB 4PGBB 1BFSA 4MMZC 4Z7WF 2YRZA 1ZT1A 3L3GB 5GZNC 1KTKE 2RQ8A 1LO5A 3LS5H 3PQYE 2DOCA 4WI6A 5FO7A 3ARPA 4PUBL 2BRRL 1TVHA 3EYOA 1I7ZB 1LP9B 1ZHNA 4EXPX 3B5GA 5LXGH 5FECA 1AIFB 4Z9KB 3CVHA 2OXGA 1F97A 5I71C 3EBAA 4J23A 1CGUA 1U8LA 3HZVA 4QRQA 4PJEF 1N2RA 3T0EB 3W2DL 3GHEH 2IAND 4NKQB 4XVTL 5EC1B 4CRPA 5BRZB 1F58L 4N9GA 3FMGL 5JLZA 1TVBB 3VRLE 4FXGB 3QUYC 5MENE 1FYTD 1UJ3C 5E2TH 4G9DA 5I1LA 4RRPA 3FCTA 4LGPB 3C5ZC 1D5ZB 2OZ4A 2XZAH 3BPLC 3D85A 3VMPA 2P8PB 5T3ZH 1AGDA 4NFDA 3WO4B 2P4AB 3PL6B 3B9VA 4G6JH 4GBXD 4KAQL 4NO0B 1G9EA 2WMPA 4D0CB 2BXYA 4G6AC 2Q3AA 1EZVX 1Q9KA 1TNNA 1IQWH 4J3SA 4K8RD 2ATKA 4NIKB 4JFFD 4XNXH 2VLRE 5IF0A 3QIUC 4HT1H 5F1IA 1B2WH 1YEHL 4MJIE 5I76B 5DVMA 4YO0A 1WFTA 4M43L 1A9BB 4U6VL 1A1MA 2YXMA 3HKFA 5DC4B 1LVEA 3BWAA 1RVFH 1P4LA 4PJ8B 4YPGB 4V1DE 1KBGL 2HRPL 2NW3B 2XRAL 1JGVH 4XP5L 3HCVA 5JW4Q 3WFEL 1A7RL 3G08A 4HCRA 2HMIC 4G8GE 3IF1A 1U3ZA 4LLVB 4Z5RA 4LHUD 1RZKH 1MELA 1NFKA 4XZUB 4UV4H 4Y4FC 2JCCF 2OR9H 3QSKB 1ZHLA 1HHIA 1HINH 5IJVB 2AEWA 5HHPB 3VD7A 2BP3A 1XH3A 2J88H 3C5JB 2X4RB 1I9IL 4M61A 3STBA 2ATPB 4UUJB 4X7CC 4UT9H 1VFUA 1GPOH 2AXJA 4TUJA 3GJEB 4DGYL 1J8HB 3PABB 2OL3A 4D0BB 2XA8L 2WINB 4Z0BH 5F1OB 1AY1H 1JPFA 2IANE 4G7YH 4PJGB 3VFGH 3OJMB 4UAOC 4HGWB 1IT9L 4IM8A 4JFDE 1K8DB 3DRTB 1Q0XH 5HGAB 3ILPB 1I1YB 1H3GA 4P46B 2FGZA 4NQDE 4QF1A 1MY7A 1IM9D 2IPTL 5EN2B 4KI5D 4ZTOL 3HI5H 1F6AA 5LGHL 2YD5A 3IETB 2FSEB 3L7EB 1M05A 2ITDB 2HH0L 2UZXB 3CMOH 1MCCA 5F7FA 1CS6A 2V2WB 4PJAA 1YZZA 1Z6JT 3VXRD 2P5WA 4HS3A 4L8SC 4XCYA 1AY1L 3FQNA 1WVZA 3ARBB 4XWGL 1U2HA 1A5FH 4GSDL 1FYHB 4JO4H 3QEQA 4Z8FL 1KB5L 3ZE2F 1OPGH 5I16B 4BQ8A 1NLDH 5F93C 1EHXA 5SWSB 2E7LA 4JQVA 2XXCB 1F4HA 1BZ7B 4LCYA 3FN0H 1A4KA 5C09E 3DYMA 3HZYA 4LCWE 1X5AA 3S8WA 4MMXC 5F3HA 2XZZA 1Q94A 4NO2A 5FK9B 1FLTX 1U41A 3NCBB 4HKXA 5D1ZB 4ALAL 4TUOA 1OP5H 3WJLC 4OZIE 4EBQH 3ARBC 1XR9A 3IAPA 4JRXA 3HC0A 1LNUB 4IBLT 1XGUB 4OCWH 3AY4A 1L6XA 1NGPH 4KVNH 5M94B 3B9EA 3RDTC 3ULVL 1KJ3L 4OIAA 3QFJB 2X7LB 1OARL 5FA4A 3ZL4L 5E08H 1S7WB 3GBNH 2F19H 5KSUA 2DDQL 4P99A 4JPVL 5ANME 1U8IB 3RP1A 4HUWA 5JPNB 3OR7A 1S9XA 2I26N 4H8WH 3ULVF 5DD3H 5TQ2L 4NRXB 3NACH 1IQWL 2Q1EA 1QRND 3BIKB 4NT6B 4WHDA 5IBLD 4OLXH 2IH1B 4NQEB 2JCCE 3L7FA 1R3JB 1D5MB 2DMCA 1V7NH 2B1HH 4CU6A 4U05A 3ZTNL 5ANMA 2EO1A 4I13B 3BE1L 1BOGB 1UEYA 3ROLA 4F7EA 1A4KB 1LEIB 3R1GH 1I7UA 1O0VA 3V4UL 4UU9A 1BPVA 1F90H 2APBA 1NUDA 3QA3B 4JDVB 2BSRA 1RVFL 4MS8D 2Q8AH 5JHDA 4J7RA 1Q0YH 4KKAC 3C60D 3ARBA 5CBEB 2G5RA 2OTWA 4IRSA 5EFIA 4U1HA 1N6UA 1BD2E 1K9TA 2DWDB 2BSTB 2EEDA 2NMSA 3OR6A 5J11C 3KNBA 4AENA 1S5IL 3O6FB 1FH5L 4LCWA 3AB0C 4XBPA 3JV6A 3BPCB 3EYQD 1INEH 3IAGC 1F6AB 2O61B 3TFKC 5KSBE 4FFZH 3MLSL 4GS7B 5C6TL 1T80A 1FZMA 5FYJD 5DXWA 3VRIB 3B9DA 3KPQB 3N1PC 1I1YA 4KQ3H 5C07A 3DRTA 1N5YH 4GQPH 4QXWA 2DQCL 2AV1A 3VG0L 5GZOC 3JVGA 1CXKA 3GJEA 4ISVB 4P59H 2ENSA 4TUOB 1H0DB 3CSPA 1TJIL 1MCPL 2BNRD 4WJ5B 5F3HB 4QRTA 4UTAL 5IEKA 4F8TA 4IOIA 1EBPA 2NY6D 1HHIB 2FH6A 1IGTB 1U3YA 2VNCA 1W72A 3D18A 3MRPA 1IC5H 1MWAH 3MLTB 4WW1A 2RHEA 4G6FD 1OSPH 4RMQA 4Z5RB 3TBYB 4WV1B 2HN7A 4WUUD 3IU4L 1SMOA 4L4VD 3U0PB 4NGHH 1JNJA 3VA2C 3UPAA 1HH9B 1JZ2A 2IFFH 4O2CA 2ZKHH 3U4AA 3HCVB 4W4NA 2D0GA 1A7PH 2JK5B 2MCPL 4Z7WE 5A43C 2VR5A 3ARYA 2O5ZH 4Q0XH 3SDCD 1M05B 1OGAA 1DANU 3SGKC 3E1F1 4K55A 1A9BA 2I9LB 4HS6B 1H5BB 4UTAH 4YQXH 4R7DB 4PRPA 1U8QA 5GIRA 4TRPH 5GXBB 1P2CB 4HG4K 1X4YA 4TSBH 3WDIA 2ATKB 4E41E 2DIAA 4Q58C 3NCEB 5TF1H 5KG9A 2R1YA 4OIIH 1RUMH 5AZ2L 1ULVA 1K8DA 4KPHL 2BY3A 3LN4A 1IGJB 3QDGE 3O4OC 4HGWA 3VXUD 4RIRA 1FGVL 1FAKT 3DJ9A 2DLEA 3BGFC 3QWQB 5K9JH 1B0GB 5DEFA 2A2QT 2PO6A 1JHKL 4PLKC 2R1YB 4I5BB 1KULA 1FFQA 4R96A 2XTJD 3X14A 5FO9A 3P4MB 1OTTC 1PFCA 2X4NA 3ARGB 2YPLE 1FYTB 1ZHLB 5DQDH 2VXSH 3TH2T 1HHKA 4ZDHB 4L4JA 2CDEB 3S5LG 5J9PA 2ZUUA 4ZPVB 2W0PA 4TQEL 3HC3H 5D71H 3WXWH 1V3JA 3I6GA 1A3RL 2VZTA 2E7LC 3SKMA 1QBMH 2P46B 1XGRA 4ZNEA 1IMHC 3U30C 4TSCL 4BZ1L 5BS0D 5FECB 4JGMA 5KOMC 2VXVH 2UY7A 5T1KA 3VJ6B 3HFML 2KZWA 4L3EB 2Q8BH 3D18B 1I7ZA 2FD6L 5FHAL 4OUOA 2GJZA 4PLJD 4IHOA 3QUYA 4U6VH 4PGZA 1P4BL 5D72H 4KAQH 4NJ9L 3FB8A 3S4SA 3RTQA 4CVZB 2AK4A 2VH5L 1A0QL 4MJ4A 5I1EL 1JTOA 3MGOB 2GKIA 1JRHH 4BQ6A 3WBDA 1P84K 2Y07L 1N0XL 2CDFA 3VE0B 3WNNA 1BFOB 5T33H 5F7UA 1UCBL 4OAWB 3MBEB 3I85A 2EDRA 5DJAA 4TTGA 2P8LA 2V9QA 3P0VL 5F1NA 5FUOL 3D85B 4HUNB 5C08A 3MLSH 3VW3L 3MJ9L 5IW1A 3RZCD 3RDTB 2ADFH 1S7VA 2Y7QA 3Q0HA 5E99H 4O51B 2HTKD 3T77A 1XF1A 2JELH 4Y2DB 4PJIA 3TYFA 2BSTA 2BY1A 3KS0H 3QDMD 1CU4L 2VIRB 4OJFL 2FEDC 4LMQE 1L7TH 3LSOA 2YUZA 2XFXB 4IRSB 5EFIB 1A6WL 2VE6B 4BA8A 1RJCA 5DQDL 1DQLL 3ZZ1A 5ACMA 3L3OB 2BVPA 1HXMA 4OT1L 1A22B 4JDTH 1S7XB 4UTBH 3BIAX 5JXED 4EJ1C 3FQTB 4UOW1 1IZJA 3H9ZA 3GRWL 2RIKA 3N50A 4UT7L 3ROLB 1AFVH 3Q5TA 5IBTL 2AJ3B 1EXUA 5ITFB 5FKPB 2GUOA 5GS3A 1F11A 3TC9A 2IH1A 4NQEA 4AM0B 1KV3A 2IADA 1MCKA 4XNYH 1A64A 3U6RA 5D1XA 3F65A 2NY1B 5HI3D 4ODXB 4FMKA 3TT3H 4JFEE 4HFWA 2JCCA 1NGWA 5TQ2H 3VFNB 3VXRB 4P2QB 4NNYA 4ONGH 1T6WA 1KCSH 5LCVL 4P9HC 4L4VA 4XXDB 1G0XA 3QIUA 4WFFE 1A6UL 4G8IA 4LCCC 4L8DA 4UTBL 1NMAH 2ED7A 4PJBE 2FD6H 1KSRA 3U2SA 3GMOA 5FA4B 5KZCB 2VDPL 2X7LA 3HPJA 3WIHA 1C7SA 1SYVA 4KJYB 1URLA 3GKWL 5GGRA 1YEEH 4R4BA 3SJVD 1XCTB 3PUCA 2BSED 4OLVL 5LBSH 3QAZB 1OSZB 1S7SA 1WSST 2BRRH 4CN6A 1FVCA 4M8VA 1D5XA 2W0FB 4RAUB 2DD8H 3IU3B 3BKCH 4XCFH 2AGJH 2EYTB 3ZKNC 5D7LA 1JTTA 4Y2DD 2WBKA 1QQDB 4ZSOA 5ICZA 4M1GL 5C0ND 1FZJA 3B83A 4AT6B 1DQJA 5GRXG 5E5MB 4WWKC 1NMAL 3VFTA 3RWDA 5SWSA 5IJKA 1K8IB 1Z0NA 2QSVA 5E2VL 1OPGL 1IVLA 5EU7E 4YDVA 1DUZB 4H5SB 4TVPH 3P73A 3FQNB 2DM7A 1T5XA 5CZXC 5IR1A 2RR3A 3CXDH 3QIUD 3LCYA 2AABH 3C09B 4PBVC 2YMXL 5I2IA 1KT2B 3QEQE 2V2WA 1YPZB 4M6NL 2LTQB 4AIZA 5IT2L 1ZGLM 3BE1H 3UEZA 5KAQF 3WHE0 5EIIB 3L3DA 4W4OA 3BP4B 2NZ9D 3GJFB 5E6IC 3H9HA 5KW9H 4WW2A 3MRDA 1GJIA 1OF2B 3RAJH 1LD9B 1UXWB 3BEWA 4X98A 1NCAH 5T3XE 2PO6C 5KVMC 2UVEA 5KS9E 1CFNB 1FFPA 5EUOE 2IMMA 3BX7C 4DAGL 3EZ8A 1QSVA 1M4KA 2G60L 1F8TL 1JPFB 5LGJA 2LTQC 4Z7NE 4NC1E 4X4XB 3MLVH 1P7QA 5ADOH 5C0AB 1GC1C 4XNQA 2EDJA 4PB9L 4ZYKB 2NY5L 1Y6NR 4OZFG 3MRQA 3H9SB 4L3EE 4JCLA 2XOTA 2YSSA 3QXAA 1KTDB 1LQSR 2ZCKL 4NDMA 3C5JA 3DVIA 3G6DH 2OZ4L 5HDQL 4KROC 3VW3H 3BXNA 3HNVH 1R5IB 4U6XA 1FNEB 1F4XH 4MHHG 2MHAB 4XCFL 1CFVH 4KHTL 5B38A 3P9WB 1CIDA 1F58H 2GY7B 2X4TB 2R0ZH 3WO4C 5KS9A 2QEJA 2FYYA 4LLVA 3L3KA 4PGCA 4LLYB 1DJSA 1FSKB 5L8LB 4R8WH 2F53B 1JGEA 1YYML 2IMNA 2YC1A 3EOBA 1XCQA 4JY5H 1T0NA 5D93C 2IPUK 4WO4A 3UX9B 3TPKA 3BD4A 5TF1L 2VMFA 4KQ3L 2BFVL 3BGAA 2C3GA 4K3DH 1T1ZB 2X9YA 3BKMH 5C0FB 3RWGA 3VRJB 1MFBL 1NC2A 1LMKA 5H35B 4NKMA 3KLAA 2A77H 1JN6B 5IESL 2J5LC 1A14H 4HKBA 3IXTB 1ZA3B 1WK0A 5CAYB 2FX7H 2VLRD 3FO0L 3MLWH 1NSNL 3ESUF 3CFJA 1NMBH 1INDL 5IM7A 4IIQC 2FL5B 4NCC2 3STLA 3OG6B 5I75B 3FQWA 3VXNA 4PD4K 3IJYA 3FAXA 3O2DL 1ZOXA 1EMTL 1KG0A 1MLCB 2P5WD 3GIVA 4HH8A 1ZGLB 3C5ZB 2CPCA 5I1LB 4F57H 5T1LA 3D0LB 2DD8L 2VDLL 1JK8A 4Y8DC 4G43A 3MRLB 1YEGH 1SEQL 4N9GB 1TJHH 4NUGH 5E24E 6CGTA 2XG5A 1I1AC 1S7TA 4U3XA 5ICXB 4IOFD 4LPWA 5IB4A 2ZSVB 2HLAB 1YUHA 4O00A 4FFWD 4Q6IB 3V9FA 2EE6A 4HLZG 1BIIB 1FNGB 1F13A 2VDQH 3TYGH 4UIMA 2FJGA 4Y5VB 4FFWC 1OB1B 4AK1A 4MQXD 3CFBB 1BX2B 5J13B 4LNVA 2AJXL 2K1MA 1J0HA 3ARGD 2HTLC 1J05B 4DGYH 3WFBH 3RL1A 5B39G 2AABL 1MHCB 1JK8B 5H94A 4JFED 4R0LA 1HEZA 1MEXL 4KK8D 2Q86B 4C4KT 1G9NH 3TWCH 2P5ED 4ETYA 3GB7A 3PGCA 1SJHB 1G7PB 3P30H 4GUPA 1I1CA 1MLCA 3CZFA 2P8MB 3DMMD 2HWZL 4HIHB 1KNOB 4X8JA 1KB5H 2X41A 1PJ9A 2AK1H 3UPRB 1NC4D 1NCDL 4B7IA 1G6RL 4IRJD 1L7IL 5BW7A 4ZO7A 1T66D 1J0JA 3QUML 4E42A 4RSVA 5HYEA 4MCZB 1T20B 3FQXA 4NQCB 5J7CC 3MNVB 5T1MA 3DUUB 4MQSB 4OF6A 4YHIB 4QTIH 5HDBF 5TJWK 4HKBB 5FM4A 3H3PL 3MACL 4AJ0A 5FO8A 3FO9A 4GRWE 4M02A 5L2KE 1LEKA 4YHPA 2DLGA 4LCIH 3DURA 5IVZB 1AE6H 1JF6A 3QCVL 4EVNB 3MRNA 5FGSA 1PKOA 4NNXB 1QBAA 2R4RL 3D85D 5KTEH 4FQCH 4K7PX 3OKYA 1FH5H 3EOBB 5SWZA 2WBWB 2E27H 5F96L 4FABH 3FT3B 4JFOB 1NEZG 4ETQB 3NCJH 2A6DB 1Z5LA 5JW3H 5EU3B 3E8UH 5LAXB 4EQ3A 3B5HA 1EGJA 1HH6B 3AS3A 5DMKB 5HHOB 2EDYA 4DK6A 1BBJA 4RMRA 1KN2L 2XKUA 4YAQA 1FNAA 4WHYG 4PJDE 5EOQH 3TVMB 1ORSA 2Q87A 4ZTPL 4OLXL 4F9LA 1A7RH 3MRQB 4R2GC 2W0LA 5I74C 3DV4A 1AE6L 1NJ9A 3CLEH 1BMGA 3MA9H 3OG4B 5IMOB 2VZUA 3C6LC 4BUHA 3WJLA 3VGGA 4ZUWA 1BJMA 1XF2A 3ZKSD 3EYSL 5JPMB 5DVOA 2A83A 5E2UL 3SDYL 2DAVA 2X44D 1HHJB 3O3AA 2EIBA 5KOVC 3O3EB 3LEXB 5FYJL 3KJ4C 1HNFA 4LGRB 1ZSDA 5GZOD 1T5WA 3HI6L 3ARTA 4EEEA 1NC4B 2YKLH 1NDGA 3PDGA 2FGWL 1L7IH 4BH7B 4PGDB 4PRBB 2Q20A 2J2ZA 3SKOA 3OQ3B 2NY2B 2D7OA 5MERA 1FCCA 3DOSA 1BVZA 1D5IL 3S96A 1A6AB 4HPYH 4FS0A 3KYKL 1KT2A 3QQ9C 5TE4H 1U8PA 2J1KA 3MOBL 1E6OH 3GMNB 5CSZB 1NMCC 3KYMB 2ZUQC 4OLZH 4Z7OE 2PTVA 3L5HA 4JDZA 2GHWB 1FIGH 3RU8H 3NH7L 2EDDA 3MLUH 4QT5B 1DUZA 3INUL 4GOSA 5DHYB 4ONFH 3T2NH 3TH4T 3ME0A 4CVUA 3RUGF 4A2LA 4Z7WA 5DJ8A 1A6TA 1QPPA 4PRPE 2XICA 3VFRB 4UDUB 2J8HA 4AMKL 1OAUL 4L3CA 3GMQA 1FGVH 5D7JB 3T4AA 1U8OB 3KPTA 5C8JB 3K1KC 2WBJC 2YPKA 5HVWA 2C1PB 4JREB 5IHUL 1S7SB 4Z8FH 3CNKA 1QLRA 3X3GH 3DX6B 3WNKA 1XIWA 4KZDH 2RBLA 5J1TC 3BT2H 1YDPB 5I6XC 3UXFA 1WITA 1ZLWH 1T83C 3SDAC 2JIXA 4PJXA 1PZUB 4BZ2L 4NM4H 4ZS6D 4XPTH 4YC2C 3U0TB 4OUUB 2BERA 4PJGF 5DRZB 1G7HB 4R4NC 1AR2A 5CIPA 4IEFB 3OPZL 2VABA 4AH2A 4X7TA 1GOHA 1BGXH 3OKNA 2WIIA 1A3LL 4RMVA 4HXBH 1FORH 4IRZL 3U6RB 3BQUD 4ZAKA 4NYLA 4RWYH 5BV7H 1KGCE 1TZIA 1RZFL 4F58H 1NGYB 2P44B 1A4JB 1IKNC 1DQMH 4MHHI 5T1DH 3MBXL 4HHAA 5GGSA 1CFSB 4P3WA 1IC4H 5E03A 3WLWD 4OIIL 2VLLB 4PV9B 4S1DC 2W65A 2WUCH 3FFCB 4Z7VA 1ND0B 5IG7B 4KTDL 5D1XD 3GSXB 4NKOA 3QO1B 3HB3C 2Q7YA 4P9HH 4PRDB 4Y4HC 2WWKO 5D7LE 4ZOAA 3GSOB 4S0SD 1TLKA 5IVXB 3L5WA 2YA2A 3UTTB 2JF1A 3IDYB 4H26B 1UWEL 4I3RL 4ZTOH 1T1XB 5C0GB 4RX4D 4DGVH 4GRLA 2O93L 2MWCA 5IHUH 3OKEB 3X3FH 1U8MA 3D3VE 3I6LE 1UJ3A 2R2BA 4JJ5B 5J1SC 1E28A 5IHZB 1PGRB 1VADB 5BMFL 3MLXL 1I8MA 4AMKH 2XY2A 3MBEA 5ESQA 4KKLC 4XP4L 2PUQT 3QNXA 2NW2A 5DHXB 1HHHB 1FL6B 1CGVA 5DJYB 3SGEH 5LWYL 4DEPC 2DBLL 2DN7A 2ZJSH 5IBLC 1MY5A 2KPNA 1CXIA 5FGRA 2ESVB 1I8LC 4F37K 2VH5H 4KC3B 4CVZA 1CG9A 1ZLWK 3BEVB 5MEOA 2DLHA 3ZT5A 4R4FH 5HGHA 3QUYB 3R0MA 3Q3GB 1UC6A 4HF5L 2ZUQB 3CC5A 2OZ4H 5HDQH 3IXAA 3GM8A 5DD0H 5FCSH 4K9EL 5A3IC 2ED8A 4XMKL 2ORBH 2V7HB 5IESH 1Z0MA 4Y2DC 4P23B 2YBRA 1PG7L 5CINL 5KVGH 2IFGA 3SCMD 3HAEB 4EI5D 5EO1A 3QJFB 1JWUB 1NCBL 1AXSB 1ZHBA 4PJHB 3BDBA 4U6XB 4FQXA 1FP5A 2X4NB 3ARGA 3D25A 3IKKA 3TBWA 1UM4H 5B39A 5KSVA 3DXAB 3IDUA 3IKCA 4OCYL 5EU6B 4KXZH 3U46A 4L8CA 1XF3A 1A8JH 3RNQA 1WGOA 4NN6B 4NZUL 1C16A 5D1ZC 3SKNB 4M3JA 2FECL 2X9WA 4OQTH 2YRPA 3NFNA 1YQVH 1ZE3C 1KCRL 3OB8A 2IQ9L 3NIGE 1T03L 4JRWA 3WFCL 2DL9A 5C09D 3DLQR 4HGKC 4P3DB 4S1QH 3BAEL 4N90D 2BC4A 1Y6KR 4JB9H 2E8YA 4PJFB 1FVEB 5TH2B 2D7MA 2PW1A 4R2GB 3VXQB 5L9DL 3F62A 3V4VL 3G04A 5I8OL 3V2AR 4QOKD 3T09A 35C8L 4YHYC 4UT6L 4DGVL 4W6YB 1EJOL 5BZWB 3HRZB 3WUZA 4QWWC 3ARFB 2A9ML 3MRIB 2ESVD 3BRDA 4RAVA 3TA3A 1KJ2A 1ITBB 4FXLA 3QPQC 1IBGL 4J3VA 3TN0D 1HYSC 3MGTA 1DQDL 4DKFH 4X6BB 4UDTB 3FN3A 5HDOA 4QXGH 1VPOH 4ZUUA 1H5BC 3WKMH 3JXAA 1EERB 5TE6L 3IGAA 3VXMA 4H5SA 1FL3B 4HMEA 3I84A 2FB4L 3BP5B 4U1SA 1Q38A 4YDLC 1YEFL 2VLKA 5B3NA 2HWZH 3DTXA 4JFDD 4UQ3A 2H3NB 2R15A 5AG9A 4HIEB 4EUPG 3WCYA 2ZCLH 4IOIB 4J6RH 4NZJA 1AHWA 4PPTA 2GJJA 5D5MA 4CL7A 5HHXH 2CR6A 2SEBA 5BOZG 4AY0A 2ERJC 3IU3A 2C3XA 5FYKD 1MJJB 4P49A 4S2SA 3NIGF 5ADOL 3WIHH 5FYKE 3IRZA 5ESVA 1UM4L 4M6ML 5D5MB 5AAMA 3WFEH 3MLPA 3LEYH 3UTOA 3HZMB 1F4WL 2NY1C 3TF7C 1C5BL 3C2AH 5C09B 5ACZA 5KANG 4BUGA 5GRJH 4AEEA 2CGRH 4M43H 4NGHL 1XGYH 3T8XB 1MAMH 2Z4QB 4HWEL 3QWOA 4GKZA 1MCEA 1LE9A 1RJZA 1QYGH 2FX8L 4AENB 4TPRH 3TT3L 3IDGA 1M6OA 4YFLF 5F70A 4EI5C 3OL2A 2GQHA 4YR6B 4U6YA 1CDJA 1JBJA 4X4ME 4EI6A 3NZHL 4JFFE 1B2WL 1YEHH 5MEPA 5T5FH 1G0YR 5F21B 1AC0A 3VXTA 1AR1D 3V4VH 2WWMD 1NBYA 4ORZC 3RDTD 5J8OA 1JWMB 3NN8B 1D6VH 1I3UA 3FN9A 3IVKA 1KENH 5ENWB 1BOGA 3Q1SL 3B3IB 1J0IA 2FEEI 4HIEA 4JO3H 4P5MB 4Y2OA 1ZHKA 1A6WH 1HKFA 3BKCL 2ADGB 5B8CA 1C16B 2WSKA 4Q9QL 3HE7A 5F9WC 1NCWH 1XF3B 3H3BC 1KEGH 4PJDF 4U4BA 3OKKA 5JHDD 2VDRL 2LFGA 3LY6A 1S9KC 2V5RA 3U7WH 1IGFL 15C8H 1UYWL 5SV4A 2NY5C 1UXSB 4WY7L 3REVB 4H1LB 1AI1L 4MNGB 4HC1L 3RIFK 3CPLA 2FR4A 3P0VH 4NKIH 3H0TA 5CZXD 5BO1H 4IJ3C 2QQQA 1PZ5B 2X1WL 2YUWA 1GGBH 2OLDA 3CLEL 3VG9B 3RKDC 3H9SE 3VXSD 4JM2A 4JPIB 1TTGA 2P7TB 4JB9L 3RVWD 3RX8A 4YHZH 3E3QC 5FFLA 4FQLH 1GGCH 2DKMA 4HBCL 3MZGB 1Z2KA 2AJUH 2R2EA 1J1XH 2HKFH 1JVKA 2ESVA 3SJVA 3BO8B 4D94A 2IH3A 2C3WA 3FQUA 4YDKL 1T3FA 1KIUA 2BVOB 5LKNA 3T0ED 5HYSA 5I1DB 4JKKA 5GRVL 4G9FE 1UENA 4PJ5D 1FN4A 2FBJH 5T1KB 3VJ6A 2PKDA 5F97E 4QOKA 4JRXD 4OSUH 3CGTA 2HKHH 4H0HB 4HWBL 2NXYC 2VL5B 1RUKL 3IFNH 5GGUA 5IHZA 1QNZH 4PIRF 4FFVD 3VFVA 1IEAA 5MI0C 4XPTL 3W0WD 2X05A 1UKTA 1U8MB 1BAFH 3B9KC 4GKSA 4LARH 5I1HH 4YLQT 2CLVB 2F9BT 3L7EA 2BHUA 3QRGL 3D9AL 3IETA 2R0LH 3P4LA 1I7RB 1WTGT 3L5XH 1EO8H 4GG8A 4Z78B 3RPIB 1JIBA 1G9NC 2DDQH 2YPVH 4MX7B 1KACB 2AW2A 1S8DA 2B0SL 3L5WB 4I3SL 5FDWB 5GGVY 4P9HL 1HQ4A 2BJMH 3MRHB 4FMFA 4EI5A 1AD0A 1RIUL 2V5MA 5F3BA 5IT2H 3RY4A 4MAUH 4WVRA 1CXHA 3EO0A 1UWXK 1U58A 4ZNEE 5JOEA 5KG9B 5EZJA 3S36L 2Z8WC 5DJYA 3R06A 3BZEB 1B9ZA 3AU1A 4XMPL 4Y88A 2ADIB 5A16A 1RFDH 4MA8L 1DE4A 3FOMA 1RZFH 4F58L 5E5RB 2EXYD 4PR5B 3MX0A 4JO2L 3B8YA 3JUZA 3OKNB 1CGSL 3SDCC 4GKNA 1TENA 2BHZA 1T1XA 3DX8B 1A7NL 3H9YA 3ALPA 2DWEA 4H1LH 1DBML 1U8NA 3EJJX 4ERSH 4XC1H 2XPGA 3MLTA 2X89D 4WW1B 4NFBA 4PJXB 4YPGA 4QNPE 3QXTA 4M6NH 1IGTA 2B1AL 4NKOB 4P2CG 4LSQL 3AC0A 4GAGL 5IEKB 2D03H 3QXUA 4OLEA 2IGFH 1INQB 5KSBA 1S9VA 2ARJQ 2YA0A 3TJHD 4ODVH 1DANT 3VFUB 3M8OH 3TNMB 4RX4A 1UACL 4K94L 4HHAB 5GGSB 3K1DA 2D4FA 1NC2D 5D7JA 2AQ3A 5DEZA 4LPVA 5DUMH 4NHCL 5A2IH 5IGXL 2VSCA 5C92A 5DHVH 5C07B 4WTZG 2C4FU 3CFIC 2M8XA 1REIA 2BOCB 3SGDH 5A1AA 2ZOLB 3NCJL 2VLRB 1PG7W 1ROWA 4CJ0A 4M4RA 3OKOA 1VACA 2VZ3A 3SDDC 5C0JA 5CZVL 1HHGB 4M9OA 5CP3A 3JV6B 2F58H 5CKAA 2MQ0A 4NPYB 2JJUA 1Q72L 3EDKA 3FFCE 1MIEL 1II4E 5DJDA 5GS0H 4PJCB 4F7PA 3W11D 5F89B 4OF3A 2DMBA 3IDXL 4GW5B 2GY5A 3EDJA 3G6JF 1A7QL 3QUZB 5JOFB 3DX6A 4PJ7B 4R90L 3CVHB 2BXZA 2FBJL 4JDVA 3LKRA 4Q9BA 3QP3A 5D6DA 2OTUB 4ZO9A 5ERWA 2QLVB 4RGMB 2C7UA 3EYOB 3O3AB 4WENB 1EH9A 2N7AA 2FX9L 3T4AB 1WIUA 4QHLB 5MENB 3ULSB 4S1QL 4BSWA 4ZD3H 1FDLL 1RAMA 2FIKA 4QTHB 5F9JA 4XNUL 2ICWA 2YRLA 2YEZA 1KELH 1TQBC 4QT5A 4LSVL 3VCLA 3BIKA 1HZHL 4HG4J 2GCYA 4HKZA 4GMTL 2GK2A 3H42L 5I8EB 3TN0B 1PVHA 2V5TA 3QUXD 4WV1C 2KQMA 1H8OA 5D2NA 1GZQA 3K4DA 4KV5E 1UACH 4G8FA 4I0PB 3LD8B 3QCVH 1XR8A 4LAQL 1YNKH 2EH8L 3S9DB 4NP4L 2C3VA 3NPZB 5HHXL 4GH7B 4LSTL 5D7SH 1JYWA 1KB9J 3T3ME 2I60H 1U36A 4JFDB 5D7JC 4LRIC 4OZHE 1NDGB 2EXWC 3BQUA 2EEAA 1MFEH 4L8SB 3ULUL 5EPMB 2DQFB 1W72L 4GAYB 4C58B 3EJZD 4RGOL 1MCWM 5EA0H 5HSFA 3F7VA 1MLBA 1ZTXH 3ARDC 3D3VB 3LQAH 4MQ7A 2ICEB 5D7JD 2H32B 3TGXA 2H6PA 2YZ8A 3BVNA 4WHYH 4R7NA 3LKPB 2P5EA 4JN2B 3TV3H 3VFGL 3L3JB 1CTNA 4L4TD 1T4KB 4M5YL 2K3TA 4A6YB 1CR9L 1QVOA 2VDKL 4OM1H 2NXZC 1KJVB 5GGTH 1OAKL 2E9BA 1FRGL 3QUZD 2IC2A 4Q9RH 4U1MA 4WUUE 1LDSA 4GAJH 4H20H 3WN5C 4X8XA 1CF8H 3RWHB 4KH2A 5CD3B 1U3HB 2XIDA 2EH7H 3CCHA 3QZWA 4UIKL 1T21A 3KPOA 1VFMA 5KSAC 5LAXA 3O3DB 4LCWD 2NY3C 4KPHH 2C26A 5F7EH 3I75B 5KS9F 3BDXA 5I15H 5JOPD 5D7IE 3QG7H 4CKVX 4XWGH 5EUOF 1RZ7L 2VITA 2DLTA 1MHCA 5EO9A 1QFWI 4WNQA 4F37F 1IAKA 3VDCA 1FRGH 1PKQB 2GSGA 4MD0A 1WF5A 3GK8L 3PL6C 1RULH 4DJMA 3B9KB 2AJXH 3ILPA 5HGAA 2XZCL 3C5SB 3SBWC 3SCMC 3ZKND 1AGBA 2R69H 4PRNB 4LLWA 1MUJB 3N9GL 5C7XH 5FYJE 5C0IB 4PRID 1JV5A 2VDRH 4E42B 1IC7L 1CU4H 3MUGA 2ITCB 5E8OB 1A6UH 1LE5B 2VXTL 3C87A 4BZYA 1HIMH 2DQDL 1MQ8A 1BP3B 2EDLA 1FNGA 4KVCH 4OSUL 43CAB 3Q6FB 1N3NB 4H8WC 5T1DL 2G9HA 4N0YL 1KNOA 4YJZL 2CLRA 3OGOE 2X89A 4HZLB 5T5NF 3NOIA 2ADJA 2DI8A 5D70L 3MRLA 4X5LA 4G43B 3GM0A 4IRJB 4HT1L 3NZ8B 5CIPH 1P7HL 5FYLD 4YE4L 5IQ7H 2AK4E 2W60A 3ILQD 3CH1B 2XY1A 1U93B 4OCSL 4K2UL 1MNUL 4NO5A 2VLKE 3RBSA 3FB5A 3HE6C 1N5YL 3UMTA 3PWPD 2NW3A 4RFEA 4YFDB 2HRPH 3BUYA 5DT1H 4JFXA 5D2LB 4PJ8A 2K7QA 3BWAB 4NCDA 5CLTA 1LO0L 4PJDA 4HPOL 2CKBL 4PJ5A 4Y5YA 4O2EA 1BZ9A 3F7YA 3N06B 3MNZA 1J8HD 3B4NA 3QIWA 5DTFA 4LRIA 5BVJB 1YEJL 1T1WB 4NUJB 5I0DA 3OHXA 1SJEB 4LLDA 4D9QE 2AQ1A 4OCXL 4HJJL 2AJUL 4CAGA 4GG6A 3MA7A 3ARXA 4ZPTA 1AGDB 2J12B 5C6PB 1GPOL 4MVBD 5FOBB 5T3ZL 3D0LA 3VDAA 4ZAKC 4NM8H 4POZD 4IMLB 1FHGA 3TCLA 2IEPA 1XCQB 2YC1B 2W60B 1ZGLA 3UYPA 3FCTB 2BNUA 1VSCA 4PGCB 2XNAA 3MUY1 5KS9B 1NBZA 1WIOA 1NEUA 1CGWA 3GSRA 4JFPB 4RFOL 4PRHE 5ISZE 1X5XA 3IRPX 2P43B 1GHFH 5IEHA 3GMRA 1EEQA 2ZCLL 2OP4H 2ZUSA 2G9HB 3MV8B 1V7ML 4X4MA 1WC7A 1RUML 4GXVL 1RHHB 1HIML 2VXUL 5A2KH 2BNRA 4X5WA 3VXUA 1P9MC 4X4XA 4TOYL 3EO1A 4O2EB 4HIXL 3VXRE 4MJ5B 2DTMH 2LAGB 4YHOL 35C8H 1ZT1B 3VWJA 4NZRL 5F6IB 3MBED 4QHKI 1BOYA 3GFUA 3I50L 5DMGC 2P45B 5CZVH 4JY6B 1QEWB 1UADC 2CGRL 2EDBA 3P9MA 2DMKA 2Q76B 3QULA 3NZ8A 3KAAA 5JDJA 1CQKA 1QFUH 2X4TA 5AWNL 5F6HI 3GJFK 3FJTA 4Q6IC 1R5IA 5E70A 4P57B 1IGML 2JIXD 3EYVB 3GSUB 4Y4KD 1KJMA 1N3NA 4LPUA 1AD9A 4K7PL 3ARQA 2QV2A 4HQQL 1FIEA 4U1MB 1LE5A 3IJSA 4EXKA 5JUEL 3SY0A 2WM0A 5I1AA 1A5FL 1T22A 3PHQB 3QG6A 4G42B 5C2UB 4QXGL 3WKML 3VXME 2PXYD 4TYUA 4WGVB 1WBYA 4XC3L 5GGQH 3C5SA 1Z9LA 1FAIL 4P5TA 5HHMB 3IT8D 3UC0L 1CFNA 1GIGL 4ZFGL 1BIHA 1BQLH 2WUCL 5CBAB 2JELL 2WLZA 4G7VL 4GAYA 5JOPE 3VFSA 4L8SA 2HJLB 5J89A 3WIIH 2BNQE 4V1DD 1RPQA 3GMPB 3HAEG 2DLFH 3DSFL 3MJ8A 5JNYA 4AIZB 5I8OH 3TIEA 3VH8G 1N6QL 3RWCB 4KMTL 2QQKL 2EH8H 3O6FC 4KI1A 4OCRL 4K2UH 1WCBA 5CMAA 8FABA 4DN4H 5JXEA 1KEML 3OJDA 3UTSB 3GMMB 5E00A 3C08H 3DETC 3OPZH 3DV6A 3WUWB 1EEYB 4YBQC 4NN5B 3PWJA 2GCYB 3I50H 1IE5A 4RZCB 2GAZA 3OKLB 1QSFE 3DVFA 2VZ1A 3GSNH 4XPFL 3K2UL 4QTHA 5F9JB 4LQFL 5I19H 1CICD 4JZJB 1JF1A 2I9TB 7CGTA 2H6PB 1A9EB 4N0UB 1FZOA 3QIBB 5JQHC 4YH6A 2X4SB 1YMME 1RIVL 5E95B 4D3CL 1NAMA 1VKXA 1UKQA 4KQ4H 1VDGA 5EPMA 1HXMB 2R29H 2BVPB 4KJYA 2I07B 2HVJA 4MCYA 1G1CA 5E7BA 5SWSD 4JFDA 4YXLL 5C70A 4JKPL 5E4EB 1JZ4A 4GW5A 3GMOB 5T3XH 4Z7UB 3KLSA 1FL5A 5D7IF 3VI4E 4J4PA 5DMIL 1KCSL 4G8FB 1U91A 3ULUH 5I1CL 3VFNA 2JCCB 5CEXA 1BM3H 2DI9A 3FFDA 4E5XA 4YUEL 4ZUVA 2XWBA 2ZOLA 3CH8A 3VG0H 1A1NB 3JV4A 2COQA 4PJ7F 2OR9L 4RDQF 2H2SD 2ICWB 3GMLA 2P8LB 3VFMA 4EDXA 5DC0A 2XKNA 1RD6A 2P1YA 3C6LD 3EZJB 3MCKA 4G5ZH 3FT4A 3SKJL 3QDJA 2YOCA 4QHLA 5SX5H 3EDEA 3UJJL 2I24N 3FQTA 2J8UB 2DKSA 4LKXB 4Q9RL 3DX7B 1H3WM 2J4WH 2QHRL 2WNGA 4OCYH 5ERWB 2OTUA 5I74B 4JDTL 4WDIB 2R4SH 1CLZH 3BZFA 3CX2A 5DMIH 1H8NA 2VXQL 3MLRH 2HLFC 2QTEA 1YYLH 4KU1A 1KCUH 3MRBB 5ISZB 2A73B 1KN2H 5FYKL 1J5OL 4R4FL 4HWBA 2PYEB 5HI4C 4NQED 2F15A 1FO0B 5KVFL 5E5UB 4KMTH 4G6MH 1DVFB 3BI9X 4LASH 4OLWL 4O51A 4OZHF 1TDQA 2ARJB 3DROA 4YDIH 5JR1H 3S5LA 4CW1B 3MXVL 5BS0E 2EE2A 3OKOB 5C0JB 1X9QA 2AK1L 3BKJL 4RWHA 5ID0A 3FTGA 5IOPA 5D71L 1OSPL 4K94C 3EYFA 3DX9A 2Y6SD 4Z7VE 3VD3A 2D2OA 1KJ2H 3NIFF 3QNYB 4IJ3B 1ERNA 3DVGA 4QHKJ 3FRPA 3O3BA 1E6JH 4M5ZL 3TPUB 1RUQH 2W07A 3BESR 3R06B 4LPYA 3TNMA 1NL0L 1JZ8A 3LKSB 4JRYB 1Z9MA 4Z7NF 4LPXA 2AEPL 4JHBA 2W9LA 1JHKH 4K71C 3ZKMD 1S9VB 2DL2A 4JHAL 5SWZE 3EO0B 4X5XB 3AUVA 2NCMA 1EZVY 1KCVL 3ZT7A 4WTWA 2GJZB 3VFOA 3E0GA 3UJTL 5FKAA 2FJFB 3MRMB 3QDJD 1G84A 1A7PL 4GBXA 1MWAB 3C6SB 4MX7A 3D39B 3RPIA 3V6OE 3LN5A 5DRWA 2A1WH 2XKSA 1N59B 3SKMB 5ETUA 4R3SB 4ZPVA 3C5ZD 5F7EL 4KROB 3AM8A 1CDGA 1B6UA 2JK5A 3MODH 2XN9E 5A2LH 4K23L 1WBZB 1WUNT 2J8OA 3DYOA 1PAMA 4NN6C 4XCNB 4KZEH 1RUKH 3IFNL 4I3GA 3P4MA 1QD0A 5CILL 4JG0L 3AXLB 3LV3B 5CCKH 5DEGA 3A6CH 4XRCB 3R8BB 3QZWG 1CLZL 3DGCR 2ICES 4XB8A 2J6EL 1OM3H 3MV9A 4BZ2H 1JPGA 3GBML 1F2QA 3MV01 4OLZL 4HLZH 2HH0H 5EBWB 4YEFA 1BLNA 5CEZL 3TO4B 1J0KA 1ZA6B 3LKSA 2DQJL 1HOCB 1IQDB 4WHTA 2R1XB 4KUCD 4GG8B 3ZSSA 4OI8A 4YUEH 3C8KA 4ZNCD 1U2CA 3GSNA 2XQYK 4PLNC 3T3MF 1J10A 4BFIB 5KVEL 1WBXB 4IDJH 4Y4FD 2NY6C 2X1XR 3C60A 1J88A 1X5YA 4O4YL 1FZMB 1NAKL 2FR4B 5JW4R 2LVEA 3CU1A 3UTZB 3U0PA 5L2JB 3REVA 4LSDA 3CDGB 3DMMB 1T6VN 3ZHLA 1HSAB 3QHFL 1YYMH 3K3QA 4M93B 4D9RE 3VU2A 3L3IB 3ARGC 3HE7B 4C56D 3UBXG 1A7QH 2VZSA 4U1HB 4NN7B 4Z7UE 1NFDA 5I8KH 4P0DA 1OCWH 2R9HC 4OZGA 1X4XA 2FATH 1I1AB 3GSVA 2VUYA 2C5DC 5JHDB 3QAZC 1RZ8B 3N1FC 3BKYL 4LBEA 1HK6A 1H0DA 1X5GA 3BZFB 2FX9H 5BQ7A 2AJSH 4UU9B 3CD4A 2VDKH 4OM1L 3RZWA 1J0ZA 3KYOB 3WXVL 2W1NA 5B4MD 3SDXB 5A2JH 5GS2D 2EKSB 5E4IA 1K2DA 2AV1B 3ARZA 5E2TL 5F9AC 4C83A 3ULUD 4EDXB 1FCGA 3VFMB 1KFAL 3GI9L 3GNML 4M9PA 5KN5A 4J8RB 1MCSA 4ZUVB 5EWIL 3IDGB 2DYPD 4DKAA 1TTFA 4I48B 1QRNE 5CZKA 1U6AH 1GAFL 1QHPA 1U8HA 3RA7H 5A3ID 4PJGE 4KXZI 4Y19A 3BHBA 4IMKC 4QHNA 2AJZA 2BMKB 2AXGB 3HE6B 3VXPB 3OR6B 1X5HA 4HUWB 5JPNA 4RNRA 2OK0H 5CJOH 4JM2D 5TFSL 2DM3A 1LK2B 2I27N 3T0XA 5ADPH 5DR5L 1LO2H 1Q1JH 2WIMA 4H1LG 1QTYT 4XC3H 3MRGB 1R3LA 3W82A 5IMKA 2BSSA 5C9JA 2Y06L 5TDOA 3CXDL 4QNPF 2Y5EA 3QA3A 1NAMB 1CD9B 3W5NA 1YEKL 4LP4A 4NQSB 4JRXB 4ZO6A 3B2VL 2X1OA 2V2TB 1A7NH 1H8SA 1FZOB 2KQNA 1MJJA 3QIBA 5DURB 5J6GA 4MWFB 3V0WH 4EUPA 4N8CL 4NO2B 5FK9A 1NCNA 3VFPA 5EU7C 1SVZA 1NFDB 3NABH 4N0YH 1MCOH 3HZYB 3FB6B 1IAII 3VWKC 1IAMA 1ZLVH 3PWJB 5CJQL 2ICCA 5F96H 5F7KC 4JGJA 3CIQA 1LK3H 3O4LB 4MA3B 3O3UN 3ZT6A 4ZFFA 2Y23A 1ACYH 3IGAB 3T8XA 3UTZA 4M7KL 4UDTA 4DQOH 4CGTA 1A6PA 3SE9L 2RFXA 4PJHF 2QQKH 4LRNL 4NBYB 4RFNB 4N68A 2CQVA 3KPPA 4ELMF 4JPKH 4L29B 3PWPE 4U6HA 1QR1A 2HJLA 3VFSB 3RWFB 3WJJA 3C8KB 3U9PH 5FEBA 5L2KB 1EAPA 2XTJB 4UMGA 4LEXL 2H8PB 4KKBD 3TZVA 3P2TA 1HOCA 4FQXD 3CSYA 4NQDD 5H8DA 5E2WH 3MRFA 3EOAB 4YHLL 4MNGE 1DUYA 4JN1H 1Q94B 3NPSC 3JZ7A 4MAUL 3ZHDA 1KN4L 2F5AH 2OJEB 2YK1L 1BZQK 2H2PD 1BJ1H 3FHAA 3T04D 2A0LD 2QQLH 4UV4L 2F54B 5IB3B 2BNQA 3MGAA 5I16A 3RWIB 2VQ1A 5JHLH 5AZEH 5AG8A 1F3JB 2ZOKA 1FL3A 3AXLA 2W9DL 5T33L 4M61B 1MI5E 5B39B 1NKRA 1JI2A 4FQQA 3SEPA 1XH3B 4J6RL 5FM5O 4HS3B 1VB9A 1ZLUK 1CLOH 1EMTH 2CRYA 3MGTB 3OJVC 3QXVA 4PB0H 4XZUA 2O5XL 5DR5H 5EORL 1T04B 2NY0C 2OL3L 4OFIA 2XWTA 4AL8L 4RBPK 4Q97A 3GUTA 5GHWH 2OYPA 1HYRC 4OV5B 5MHSD 4WI9A 4AEHL 1QEWA 1R24B 3QT2A 5D1ZD 5EN2A 3DO7A 1G7JB 2G75B 2R2CA 4G9FB 3S3SA 3S35L 2ZUTA 1UQSB 4WFGE 1YYLL 3REWB 4DKDC 3G04B 1DSFL 4IS6A 2B4CL 1F4WH 3QUKA 3O9WC 5DS8B 4TSCH 1NCAL 4RDQG 1FVEA 5TH2A 1K6QL 1QP1A 1UM5L 1DQLH 2OSLA 4XX1G 4UV7H 4Y16D 2WINA 3OXSB 5I73C 4YO0B 4NP4H 5JMOC 3RTQD 3O41B 4KJWD 4A6YL 1TZGL 4TUJB 1YEGL 1R5VB 3WDJA 1OOAA 1PX4A 1RHHA 1CCZA 4MXWL 1WC7B 3OXRB 4J4PD 5IUSA 2R1WA 1P5VA 4P2YA 4JZOA 2FX7L 1U92B 4LDOB 4PY8J 4L4TE 4YK4C 1SHMA 5BMFH 2NTFB 4KK5D 3OBAA 2XT1B 1IAIL 3G5YB 2QKIA 2R2BB 4JJ5A 4MA1C 5L0QB 3QUMB 4K3DL 3WSQH 5C08D 1D5ZA 3WJJC 4HJJH 4JAMB 2UY6A 4CNIA 3DROB 5LVEA 5D7KE 5BJTB 2EDXA 4YFEA 3MR9B 3IXAB 4R8WL 5MEND 5AYUH 4UB0H 2GTWB 3OKDA 4QKXB 1YNKL 1U8JA 4KTEH 2FO1A 3T0EA 1MCRA 2A73A 4O9HL 3ULUE 1CL7L 1T1WA 2B8OT 1KENL 3H42H 4OZFH 4LLUA 5C86A 4J3XA 3O6FD 3NMEA 1YMHA 3QUYD 4LKXA 4DFHA 5E94B 4DTGH 3KLHD 3KYAA 4AYFA 4YGAB 3RHWK 4Y5YB 5FGCB 5DJ2A 5FYLH 5ESQB 4V2BA 3PV7A 4LLQA 3CU7A 1TZIB 5HGBA 4BQCA 3NTCL 1OAQL 2W9EH 1I4FB 4C56E 2WIIB 1KPUA 4OZIF 3QJHB 4AH2B 4XBEH 3U1SL 4GKOA 3I3EA 3LKOB 3DUSA 3C08L 3OX8A 4FXGA 1IAOB 4HS8L 2NXYB 5E6YA 1AXTL 1G7HA 2VZOA 1EFXB 3E6FA 2OJZL 1FL5B 4H26A 5DD6A 3CDCA 3U7YL 1RHFA 3AAZA 5TE7H 2FH8A 1WZKA 2YK1H 4I18B 1JWSA 1ETZA 5J11B 1SQ2N 3HMXH 2MPAH 2R0KH 2GI7A 2IFFL 2VDPH 4HEME 5J06A 3BPOB 1EHLL 4M7LT 2W9DH 4NRZB 4WUUB 2V7NA 3IJHA 3TYGL 3SE3C 1A9EA 2VLLA 1NCDH 4LLWB 1INEL 1YN7B 4EKXA 3EW3B 3VD4A 1NGXB 4HUMB 4NNPH 4XH2A 4OKDA 4UDUA 5ITBH 3QCTL 4V1DA 3GNMH 5E9DB 3LEVL 2A6JA 1IAKB 3MJGX 3JTTA 3I2CH 3GI8L 1A2YB 1MFDH 3LPGA 2VXTH 2EZ0D 1Y6MR 2FBOJ 1AGEB 5HHQB 1IKFL 1F6FB 1EEZA 2E5EA 4OLVH 1I9IH 2P49B 3HAEH 4M1CC 3HHRB 4OCRH 2BVQA 3EKCA 1K6QH 2P48B 5TE4L 5L6YL 3DYPA 3KS0J 4YBLC 3TIEB 4FRWA 4U0QB 4PYGA 3QI9C 3ZE1E 4XVUC 3HE7D 1G7IB 1CE1L 4YHZL 3B6SA 1XIWB 3D69B 4NZUH 2DS4A 5TQ0H 2D3VA 1EJOH 1VEPA 5INCA 1A3QA 1IC5L 4NHUB 2FECI 1ZSDB 4LARL 5I1HL 3O0RL 1CLCA 2EE9A 4JO1L 1OTSC 1BWWA 1JGUH 3HR5A 3RVTC 4H25B 4G8GB 2A83B 1A14L 4R7NB 3V5KB 5JIIA 5JPMA 5T5NG 2VRAA 4KKCC 4UOW0 5H37H 2W91A 4OZFB 3CXHK 2DKUA 5SWZD 4GT7A 1D6EA 1QNZL 1EJ6A 3V6OA 1NJ9B 3GSWB 3WXVH 1DL7L 2YN3A 3D1MC 2P42B 3HUJA 5KSAB 5IK3B 4N0RA 4XBEL 3U1SH 2YN5A 2IWGA 1EUTA 5JA9A 2KZ1B 2Y5TA 3QDMA 3SDAB 4Y5XC 3MOBH 3QO0B 3JWOL 2FATL 1RSFA 3MFFB 3ZDXE 2HFFA 4KMQA 4HJGA 4QRPE 2XV6B 4BSVA 1FQ9C 3PWUB 1NANH 4L5FH 3CDFA 3E8UL 1ZANH 2APWA 3O6KH 4LCUB 4UT7H 1HCVA 4JY6A 4PRBA 3U9PL 2X2YA 4QHMA 1YMMB 3LS4L 2BVUA 1P84J 4Z95L 1LEGA 2NY3D 2RAMA 1Q9WB 5HI5C 1T5WB 3LMJL 4CUCA 3LEXA 1B0RB 4I2XA 3T65B 4MNQB 3DETD 3WL9B 2R23B 2X70A 3BDYH 2JLLA 4YX2L 3QISA 2PR4H 1S7QA 1T2QH 1JPTL 4P2RD 1UKSA 3QIBC 3PDOA 4L9LA 1MFBH 3AREA 4MAYB 4X5WB 3FFCD 2A38A 1JNHA 3RA7L 1F4YL 2NX5B 2UUDH 2VLME 1IGFH 4MCZA 4GXVH 3GGWA 6FABL 5I9QC 3QUXC 2HFGL 4G6AD 1KFAH 4KI5F 2CKBH 3RY5A 5DJZB 2C1OB 1Y18B 1NFIA 5GQBA 4CADA 4HIHA 4XHJD 3INUH 4AG4H 2JB6B 3P4OB 3FO2B 1L9NA 5K59F 2A6IA 1HHGA 1IGIH 5HHMD 5J13C 3KPLA 1D5BB 2VWEC 2AVGA 1YC8A 5DD3L 5D1XC 5L7XH 2AAVA 5FOBA 1U95B 3MLXH 4HCRH 4IIQB 3UDWA 1IC4L 2A6JB 5E9DA 4GG6B 2ID5A 1E6JL 4M5ZH 3S37X 4NQDB 3DBXA 1ZAGA 2CR3A 1GC1H 4G3YH 4LSPH 3OHXB 2N1KA 4R9HA 1DP0A 1FORL 4WO4D 4UI2A 5CEZD 3QFDB 4LSSH 1BZ9B 1YMMD 3F7YB 1HXYB 2Z31C 1CYGA 4UIMB 2ENYA 1NUNB 1XIWC 3GEWB 4CMMA 1KUMA 5E8EA 1SY6H 2APTA 2OL3H 1EVUA 2EYSB 4I18A 3BP7A 1JPSL 1U8KB 3PV6B 5I66B 5IQ9B 4EOWL 1QHOA 4NO5B 1SJHA 4NJAH 3PGCB 2DJSA 4MAYD 5DUBB 4HQQH 5IIEB 4YIQA 1JRHI 1NCTA 1KIPA 3DUSB 1G9MH 1HEZB 2Q86A 3D2UB 4P23C 4D2NA 3C5ZA 1U3HC 5IIEA 2M2DA 2F53D 4NBZB 5C3LD 4N8VB 1P7KB 4HW6A 2E9IA 1UM5H 3NIDE 5EO0B 4Y1AD 1RIHH 5I66A 1YNLH 3ZKQD 3LQZA 5K9KB 4IOFC 2EYSA 5A16B 1NQBA 2EIZB 4QHUB 5IW6A 3Q6FA 43CAA 3KPRE 1A6ZA 2GFBB 3KYNA 5CILH 2BNQD 4WU5A 5E2WL 5EC2B 1OM3L 1FLRL 3K4ZA 1EGJL 4PJAE 4UBDD 3S34L 1MI5B 3ETBF 1UZ6E 5ALBH 3AFLA 3V4PL 1AKJA 2NY0D 3K46A 4M5YH 2L4OA 5I0ZA 4U2YA 1MCBA 2PYFB