1RUAH

Crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
221
Chain Sequence
b'RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaH01
5DHXB 1OAZL 4K94L 3NA4A 4RIRB 2X1XR 4IIQB 4HH9B 3NZHH 3S36X 4AQ1B 1WFOA 1HOCA 5I16B 5J0BA 1LO2L 1IGJA 1BM3H 3BZ4A 1IGYB 2AEQH 5HHPB 4Y4HC 4PRIE 3NGBC 5TQ0L 1J0YA 2E7LC 3ZMRA 1ZS8A 4NO3A 3UC0L 1ZGLM 1BPVA 5J12B 3B9AA 4CDHA 1JYVA 3LKSA 1MUJA 4ZUUB 4U6VL 4IIQC 1AR1D 5CIPB 1UH2A 1E4WH 3NAAH 5FYKE 1EDQA 4TQEH 2B5IB 3WFZA 1KLUA 4UT6L 3HZYB 1OTUC 2XTJB 1P5UA 3MUHL 4H8WL 3RKPA 5IJVB 5I1LA 1W72H 2DTMH 1EIBA 3EYUH 3DVFA 4GRWE 5DQDL 5TH2A 5CEZH 4FXLA 1G6RB 1MCPL 4NJ9L 3LKPB 5DMYA 1X5HA 4DN3L 3U4EB 2ZCKH 3F7YA 2H2SC 4OGXL 1EV2E 4IRJC 4ZQKA 5E8NA 5D7JA 2W0KA 4ZPVB 4NYLA 2AK1L 1DQML 1G9NC 3RHWF 5I76A 4LU5H 2HTLC 4OAWB 5F89A 1NL0L 2EDQA 3P9MA 4P46C 4ZXBB 3REWA 5JZ7D 4HIXL 4P5TB 3RWDA 5DMIH 3I50L 4ZUWB 5FOBB 1C5CH 3QDGB 2ZCHH 1E27B 1M7DB 4S1QL 1UH4A 5ISZA 1D5MA 5T5FH 1D9KC 4MXQC 4LQFL 1KFAL 5JLZB 4E5XA 2CMRH 2QV2A 4AEHL 3O4LE 3H9SE 5MERB 3L5HA 5FHBL 4NRZB 1TLKA 5GJSH 5IQ7H 2A9NH 1LP9F 5T3ZL 5C0BD 1E4JA 3W39B 1RZIB 3WNLA 4PGCA 4NFDA 3RNQB 1U42A 4MHHG 1FIGH 5TQ2H 4BM7A 4TNWK 3MV7E 4RZCA 2J6EL 4X7EC 3CFDA 2HH0L 2V9RA 3BESR 3QXTA 1QOKA 1E6JL 4JQVC 3VXTA 2H9GB 3ARED 2EICA 3DARA 2FYYA 4OGZA 1CTNA 3ZKSD 2A6KB 1BX2A 5IHBA 1YEHL 1KEMH 1OD7A 4HUXB 1S9XB 5I6XC 1ZKAA 3EYOB 1T1XA 4V2BA 2X44D 2C7UA 4OD1H 5IIEA 2ARWA 1FCGA 4NQCB 3RUGF 5B3NA 3QQ9D 3KJ6L 4NQSA 3LN5A 1SHMA 2X42A 3FO0H 3V4VL 4TRPH 4Z78A 4E41E 1A21A 1YYLH 1EJOL 1U9KA 2NX5E 3CFEA 1T04A 1R3LB 1U8IA 2I60H 1OTSC 1G9NL 4YBQC 2GJ6D 2VITB 4L29A 4Z6AT 2H8PB 3G5XB 1AHWC 4OI9A 3H42L 4CJ0A 4DKAA 1KCRL 3IT8D 3TA3C 5BVJB 5T3ZE 2OJEA 4X6DA 1IMHC 3QRGL 1NUGA 3NCYP 4JY5H 4PJIA 4MJ5B 3O3DB 4JFDD 2CIIB 1SYSB 3NCBB 3VD5A 1A7QL 3OWEA 5DVMA 5E2UH 1K8DB 4S1RL 5HHXL 1I8IB 2A6JB 2G9HB 4MNHB 4V1DD 4RFNB 5KANG 4WW2C 3QXDB 5E2TL 1EFQA 1MRCL 5EU3B 4OZIF 3PWUA 1DLHA 3QUYC 3QIBA 3QNZB 4O4YL 2A9ML 2B1AL 2FLRT 2EO1A 3EOAA 5DYOA 5IBTH 1DANU 1JPGA 1VESA 3GSXB 3DV6A 4FQLH 4WFFD 3GSUA 3RJQB 4DK6A 4DN4H 4F58H 1I3RB 4ZYKA 1NBVH 4PJCB 5E70A 1RUPL 4ODXB 5AUMB 4JO3L 2J6EA 4MS8D 1CDUA 1UM5L 1BAFH 4TULL 2IFFH 4RIRA 5JR1H 4HH9A 1WZKA 3OPZH 4HW6A 5I8KH 4JANB 4M61A 5I16A 2MQ3A 4PJ5D 1IGYA 4L3ED 5HHPA 3ZKXC 3VFOB 3MOAL 2D9QB 3OKDB 4NM4L 5GGRY 1MCNA 3VXNB 1WC7A 2EXYC 3ZDXF 1MAML 1Q1JH 1Q0XH 4YHIB 1A7NH 1CE1H 2A0LD 4Z9KB 2NXYD 3MA9L 4ZUUA 5KVGL 4HPYL 5F9JB 1ODAA 5CIPA 3ZT6A 4G8GE 5D1XD 3NABL 2Z31B 1J18A 4WUUD 1JGDB 3HZYA 2CK0L 2EIDA 1JHKL 4N68A 1BEYL 3MRJB 4R9HA 5IJVA 3HTLX 1NBQA 4KK8C 5F8RC 1J5OH 2XZAH 3PABA 1G6RA 4BJLA 4PJEE 1AGEB 2X40A 1LO0H 1S7WB 3D69B 1WVZA 3LKPA 4JG0H 3TWCH 2R69H 4JLRB 4NBZB 5IB4B 3TVMD 3U4EA 2FX7L 1QFUL 4P4KB 1CL7L 2NY5C 3RIAF 3DRTB 4UV4L 1DN2A 2I07B 1NC2D 1FORL 4AM0B 4ZPVA 3UPRB 2BNRB 1I7UB 2P5EB 3QUZA 1RI8A 2G75B 1YUHB 3CMOL 3KNBB 1MFEH 3MODH 2D0FA 5A2KH 4OLVL 5DVKA 4ZXBA 2EZ0C 1A6WL 3RWGB 2OR8A 4K2UH 4H1LG 4P5TA 4ZUWA 1YJDC 2QQQA 5FOBA 1YMMD 2CUIA 5DO2D 3QDGA 3MLWH 1E27A 1M7DA 2H3NB 4KC3B 5F7YC 4ODVH 2XFXB 1IGTB 4L3CB 2I5YL 4PD4K 4IRSC 5D5MF 2H2PC 1P5VA 4HGMA 3DUSA 1CGSH 5JLZA 4JKWA 5DS8B 3T0XA 5I2IB 4YZFE 1EO5A 4JRXD 5MERA 3OJ2C 4NRZA 1QO3B 2NY6D 3BP7B 5D2LF 1SJVA 3TYGH 2OXGA 5DT1L 1ZWIB 4DGVL 1CQYA 3W39A 1RZIA 4O58H 3RNQA 5L9DL 3FQNA 5HDLA 2HT3C 1H3VA 4NCC2 1TDQA 5AAWA 3MRHB 1JI1A 4IJ3B 2B20A 4YDIH 3PJSB 2XN9E 3IDYC 1IAKB 4X4XB 1DBJH 4HXAH 3IETB 1RZFH 2WWKO 2DLFH 2IAMB 4KZDH 4CN1A 2H9GA 4PJFF 5ESQB 3RAJH 2X41A 1ACZA 3GB7B 4PJ7B 1BBDH 2N56A 3CZFB 3QR2A 3S3PA 2A6KA 5LGJB 4JHAH 4HUXA 1S9XA 1F58L 1Y18B 4MCZB 3CLFL 2WP3O 5ACLA 4FQIH 2GEEA 1IGCH 5DEZA 1WSST 3TESA 4I3GA 2WLZA 2NY5L 4NQCA 5F1IB 4FTVE 2VAJA 5F44A 2IAMC 1TZGL 2O26U 4K9EH 2YC1B 4JRYB 3ARYA 3KYNB 2VITA 1RZJC 1YEDA 2H8PA 3G5XA 5IHUH 5B3JE 4KKNA 1RY7B 3CDYA 4QRSB 3P9WB 5BVJA 2N1KA 1YJDL 3VXMD 3O3DA 2CIIA 4EOWH 1SYSA 4FFYH 3LZFL 5MHSE 1K8DA 4F9LC 5D7SH 3ULUE 5J13C 1LE5B 2A6JA 4PY7B 2ZP0T 1CBVL 2G9HA 4MNHA 4QXUH 3FMGL 3QXDA 1L7TL 3BWAB 4W81A 5EU3A 1FBIH 3QNZA 2KQNA 2R15A 4K3GA 1RMFL 1TJIL 4TVPH 2JJTA 4MJ4A 1CLZL 2Q3AA 5E5MB 2J88H 3BEVB 3I9GH 3GSXA 2JCCF 3MRPA 5TE7L 1AIFB 4PJXB 5IBUB 2VDML 1I3RA 1QBBA 5SWZB 3BPOB 4K3JH 4LAJH 5E2VH 4PJCA 2AABL 4AZ8A 3VFMB 4ODXA 2IQ9H 4XGZB 5AUMA 3BRGC 5JDSA 1QTYT 1UC6A 5DJ0B 2FBJH 1V3KA 5I9QB 5IQ9B 4JANA 3SY0B 4ZDHB 4ZTOH 5DVOA 3V4UH 1F97A 3VFOA 5GZOD 3VFGL 3OKDA 1T7XA 4CUCA 4YGAB 1JMXA 3VXNA 3FB5B 1XGRB 4YHIA 1RD6A 3C2AL 5F9JA 3SKJH 1AR1C 4S1DC 2Z31A 1RZJL 3HNTH 4R6UA 1JGDA 1N0XL 1QPXA 2DM7A 3U9PL 3MRJA 1ZHLB 5GSRB 1AGBB 1QFWH 1NFKA 1AGEA 1V3LA 1MY7A 3D69A 1S7WA 1N6UA 4PG2C 1NEZB 2R4RL 2X09A 4JLRA 5IB4A 2VLRE 4P4KA 1WAAE 4ZNEE 3ZE2E 1WT5A 3DRTA 5H35A 3S6CA 2I07A 4OUOA 5F1KC 4AH2B 1A3LH 2IEPA 3AS0A 3LH2L 3LKNB 4GMSH 3UPRA 2BNRA 1I7UA 2P5EA 5K33A 1I8MB 4N8CH 3VI4F 2G75A 2YWYA 3KNBA 5DJCB 1Y6MR 1SBSL 1KCVL 2HRLA 1MH5A 5CJQL 4YBLC 3RWGA 4K23L 2F9BT 3V0WH 3WFHB 1A02N 5JZ7C 3P11L 4Y16D 2H3NA 3VMNA 1IGTA 1LILA 1V7NL 4L3CA 4Y4FA 2VC2L 4Z8FH 4MAUH 3ESUF 2MHAB 1I1AB 4WY7L 3ROOB 3O9WB 5DS8A 2EDBA 5I2IA 3P0VL 2PR4H 4X83A 4Z95L 1QO3A 3BP7A 4M00A 3PF2A 2P43B 5HGHA 3S9DB 2M2DA 2FH8A 1ZWIA 2A77H 1MHHB 3AS1A 3NMEA 3SQOL 3TLRA 1EMTH 3T65A 1M4KA 4W4OC 3I6LD 4Y5VC 4PY8I 4LVHC 4DKDC 3VXSE 5DQJB 1HXMB 4NGHH 1KTDB 3MRHA 2ZG2A 1PG7W 3PJSA 2BSTB 3OV6A 1IAKA 4X6DF 1VEPA 4X4XA 3IETA 1N7MH 3T0BA 1AXSB 3TT3L 4GW4B 5GGVH 4XNQB 4U6HB 5ESQA 3GB7A 4PJ7A 3CZFA 3AREC 3F5WB 5IMKA 4XBEL 1FL3B 3RY4A 5LGJA 1TVHB 2C4XA 4UOW0 5C0CA 1Y18A 4MCZA 2R9HD 4BZ1H 2A6DB 5F1IA 4BH7B 1Z0MA 2UWEA 3QQ9C 4MA7L 1J1PH 2YC1A 2XG5A 4JRYA 5K9JH 1Z3GH 4U0RC 5D2NC 2NXZD 1BWWA 3KYNA 1X5LA 3GNML 2OZ4A 2J8UE 4MNQD 3DMMB 1LMKA 1ZTXL 2HMIC 1EHXA 4QRSA 3NIGF 1ADQL 1CZ8H 3BWUC 3KGRA 3NFSL 1CCZA 4ONHA 3TFKD 4ZOEA 4X80H 2DICA 5FYJH 1LEGB 5D7JD 4UTBH 1RPQA 4ORZC 1NAMH 1IGFH 1LE5A 4LCCC 1QZ1A 3HA0A 4PY7A 4YHKH 3TO4D 1NLDL 1AC0A 4DOHE 3TH3T 3BWAA 1GPOH 3GGWB 4JM2B 4YHLH 2HKFL 1AJ7H 4G6ML 1KIQB 3D87B 4MMXC 1A6TA 2H41A 2XQYK 3NTCH 1HN1A 4P2YA 5E5MA 4KI5D 1GJIA 3BEVA 5ISZD 1AIFA 2XT1B 4PJXA 7FABH 1EVTC 3UTTD 5I1HL 1EZVX 4NKQB 1U0QA 3VFMA 4XGZA 5KS9B 1IAIL 1TITA 1AFVL 5DJ0A 1CICC 4MS8C 5IQ9A 3RVWD 5DEFB 5JPMB 3QQ3B 4K7FA 4ZDHA 2DWDB 4KDTC 5HHNB 2DLIA 4ONFL 1WBYB 2DQEH 1FNAA 2EDTA 4X7CC 2R0WL 3WS3B 5ILTH 1MQKH 4HFWA 4P2QD 4QRPD 5GHWL 2EDRA 3RU8H 1XGRA 5DR5H 4O2EB 3RL2B 3LCYA 4UILH 3T08A 1AH1A 1MJ7L 1X5ZA 1L0YA 5DFTA 2R29H 2NXYC 3M1BB 4XPHH 3IF1A 1H3PL 2CUMA 2W9DL 3MBXL 5KSUB 1V5JA 2HVKB 1ZHLA 5K9KB 3W81A 5GSRA 1AGBA 1REIA 4RDQF 4Z7UE 3REVB 5C0BE 3A67H 3HI5H 1MRDL 4OCYH 4WV1B 1JZ8A 1AR2A 1N4XH 1YNTA 2HFFB 1NEZA 5F88B 4X6CF 4RBPK 2R4SH 1QHPA 2ADIA 1N0LA 4XCEB 3TVMC 4LSVH 1ZANL 4AIOA 4AH2A 3ARSA 3LKNA 2OXHA 1MPAH 1I8MA 5C6TL 2AJUH 1KNOB 2AV1B 4UT9L 2MPAL 4PV8A 5DJCA 4CMMB 2UYLB 3Q5YA 1FFQA 1FH5H 3HC0B 3WFHA 5GRJL 2YOCA 4GOSA 3V95A 3KPSB 1OP3K 5DO2C 4NQTA 4KJQC 5EBMB 4KGLA 2MHAA 1I1AA 3D2UD 3ZHKA 3G6DH 2P24A 3O9WA 4XPTL 2GJ6E 4L8SC 3MLVH 1H8SA 1OM3L 4ZO6A 2QSCL 4E0RA 2HT2D 1W0WB 4M7JH 1HHGB 4C59B 5JW4N 1TJGL 3FQWA 4JFDE 25C8L 1E4KA 3MO1A 1HXMA 1FLRH 1DDHB 1KTDA 1PG7X 4PJDB 1H5BB 2M1KA 4YXKL 2BSTA 4PLKD 2NPLX 4V1DE 1EBPA 4ZO8A 1VHPA 1AXSA 4GW4A 4XNQA 3PNWB 3H0TB 3RJDA 5I1CH 4L9DA 4S0SD 5A3IC 3X13B 1S5IH 5DDHA 3F5WA 4OF3A 4LRNL 3MGOB 1FE8H 2ED7A 3GMPB 1TVHA 4IOIB 4WFFE 1MLCB 1R3IH 2QSTA 3K8LA 3SDXB 1ZLSL 4EDXB 2NLJB 3QDMD 4PP2B 2A6DA 2YN3A 4BH7A 3UYRH 5HVWA 5KAQF 4K7PH 4G7YL 4HMEA 5LCVH 4AG4H 1KJ3L 1NJ9B 1X5GA 5AYUH 3VXOB 4NSKB 3L3HB 1H0DB 5F72S 3VXQA 3BIBX 3DMMA 2E7CA 2NW2B 5FV1L 1L0XA 4PJ5E 3O6FD 2XZZA 4PJCF 3QYCA 4EI6A 4L3EE 2BX5A 4MD5B 1C12A 3FQXB 4XX1G 1NDGB 5I73C 2WBWB 2XZQL 2HJKB 1A14H 3QIWC 4JDZB 1QRND 1LEGA 3M17B 5EOCL 2APWA 2W38A 5EO1B 4Y1AD 3QUZD 3P3YA 1BQUA 4WHYG 4JM2A 4WUUE 1VFAB 1HHHB 1PSKL 3WS6C 2DQUH 5DGQA 3T09A 1KIQA 3U0TA 2IALB 4JFYB 4P5TD 4MDJB 2BVEA 4HH8A 5FA4A 2VZSA 1S9WA 3GBNL 4C58B 4RBPH 4PJ8D 1L7IL 3HC4H 5TF1L 1LP9E 2X4NB 3FZUC 4UB0H 2P46B 1P4IL 1JNLL 5EUKB 5KS9A 3MRLB 3GIZH 3KWWB 1KTRL 2YPLB 5DEFA 1JNNH 5F21B 5JPMA 3GMNB 3QQ3A 4X7TA 1GHFH 4FS0A 1F5WA 1IC4L 3OXRB 2DWDA 4LEOB 5E99L 5HHNA 1DUZB 1WBYA 1HYSD 2DMCA 1OP3H 1YMME 3WS3A 1OQXA 5GZOC 2ZJSH 1G9MC 2VXTL 3WO3B 3WKMH 4O2EA 3RL2A 4J3OC 4R0LB 5F6IB 3VGAB 1JZ7A 1CF8L 4PR5B 1ZV5A 2J1KA 4OLYL 1FPTL 3QQNA 4POZD 5B38B 3M1BA 3RUGE 3IDMB 5GPRA 1NCUA 2E9BA 3OKEB 5J9PB 5KSUA 3B3IB 1NKRA 3GSQB 1F4WH 1VKXB 3QDAA 3F58L 5K9KA 5J57B 2FX8H 3UYOD 3ULVL 4ENED 1X4ZA 2RAMA 2VYRE 2WANA 4WV1A 3D0VB 2CJUL 4R0LC 5F6IC 2HFFA 3FQUB 5EC2B 1IT9H 5D1ZB 5F88A 2KZ1B 2APBA 4XCEA 4L8CB 3JBG7 2VKWA 1I1RA 1BFVH 1NMBH 4G5ZL 1KNOA 2AV1A 1OP9A 1U3YA 2NYYD 4CMMA 2NY3D 2UYLA 2Y07L 5LBSH 3U7YL 3MRNB 3BIAX 4CVWA 3DVNB 2XQBL 1FO0B 5DA0B 3HG1D 3HC0A 3GHBL 1PY4A 3QH3A 4M62H 3DO3A 2A74B 3KPSA 2AK4B 1KIPB 4Y16C 5EBMA 1K3IA 1LNUB 5DC4B 3BKCH 3VH8G 4LSUH 3GHEL 4ZS7L 3E8UH 4UBDD 4HIEB 4R7DB 3NCCB 1WBZA 1PW3A 5IB5B 5EU7C 2K9UA 4R96B 5AD0B 1MFAH 4KUZL 1HHGA 2UWEF 3VXME 1JPTH 3WSQL 4NKIH 3V8CA 1BQHG 5L0QC 3RVVD 5DJ2B 1G9ML 4U3XA 4ODTL 4ISVB 5EOQH 3VD3A 3RX7A 1DDHA 1XGQB 4PJDA 1Y6NR 4J3WA 4XXDB 5FGSA 5FUOL 1I8LA 1H5BA 2YD1A 3T04D 4GFTB 3ZDXE 1A3RL 3KPMB 5FKPB 3ILQC 1C16A 3GRWH 5F1SA 1XF1A 3PNWA 3H0TA 3IFNH 1H3UA 5E9DD 5JHDB 1R5IB 2BJML 3RZCB 3N1PC 4HG4J 3X13A 1A0QL 4QNPE 3MGOA 5JA9A 5TDPB 1NQBA 3GMPA 4IOIA 3B5TA 4OFIA 5KW9L 3NBNA 3BGFC 1F4XH 1MLCA 1SEQL 1RSFA 2X4SB 3SDXA 2C3WA 2AJXL 4EDXA 1IGMH 3SN6N 2NLJA 1RULL 4PP2A 3OMZA 1T0MB 2R9HC 2ZSWA 3JWDH 1A3QA 2BVQB 4W70A 3MROA 3VW3L 5I19L 2VQUA 1NJ9A 3NFPB 2JELL 4PJXF 3VXOA 4TYUA 3HZKB 4NSKA 3GO1L 1H0DA 3L3HA 2NXZC 4KRMB 3UO1L 2NW2A 2IANB 2UZIL 4YK4C 4MD5A 3JWOH 3FQXA 4HD9A 1MNUH 2FDBP 1IZKA 1NDGA 2DYPB 3O45A 2HJKA 4N5ED 4P5MB 3TFKC 3SCMD 4JDZA 2VLJD 4P9HC 3WXWH 3M17A 5EO1A 4M7KH 3QPQD 4HFUL 3V4PL 2GY5A 5FGCB 5D5ME 1MFCL 1U8JB 3TT1H 3TO4C 1VFAA 1HHHA 2AV7B 4L3AA 1LGVA 1FO0L 4L4TD 2VDPH 5I1KH 2IALA 4M93B 1O0VA 4X6EB 4MDJA 5JMOC 4UU9B 5D2LE 2Q6WB 4Y4FD 4KI5C 2K7PA 1T89C 4LPVA 3C8KB 5D93B 2X4NA 4I18C 1ZLWK 1V7ML 4JREB 4B7LA 1KPRB 4OLXH 1SVCP 5EUKA 3QBTB 2DI7A 3GSRB 1A2YA 1MVFA 3MRLA 4LIQL 3CNKA 3KWWA 2BDNH 2YPLA 3GMNA 1R3JB 3OXRA 4LEOA 4Y2OA 1DUZA 2VXQL 3NZ8B 3BRDA 5C2BH 3C60D 2DQDH 3O2DA 2E9IA 43CAB 1ND0B 1F4AA 5JOEA 3MLRH 2D03H 5B38A 1R0AH 4NQEB 5EU7E 3IDMA 3VXRB 3QUMB 1SQ2N 3OKEA 3RY5A 5J9PA 2BVUA 3B3IA 5AG9A 3GSQA 4YIQB 1J8HB 5C0CD 1VKXA 2DQCL 2EDDA 4KZEH 3R06B 2BCKB 5EA0H 3TM6A 4JGJA 4H88H 3D0VA 3I6LE 3FQUA 5EC2A 5D1ZA 4Y5XB 3O6KL 4JRYD 4KPHH 5DXWA 4ALAH 4L8CA 3EDKA 5K9OB 3QNYB 2DBLL 3FO9A 3C08H 3LS5H 3N1MC 3FT3B 3U4AA 1UA6L 4JPWL 4HHAB 3DVNA 3FJTA 3JXAA 4Y5XC 1FO0A 3BE1H 5F7MC 1PFCA 2HVJB 3O4OB 4RWYH 5HDQH 1UT9A 2A74A 2CK2A 2JCCE 5DMKB 5DJAB 1PLGH 2AK4A 1KIPA 5FB8B 5JIPA 5INDB 2GSGB 4ZMAT 1LO4H 3GUTA 4LSRL 2DOCA 4PJGB 4MJIA 4AENB 4MNQE 4HIEA 1KT2B 4R7DA 1YEGL 5F9OL 5CJ5A 5IB5A 3GMOA 4R96A 5AD0A 4XC1L 1OSZB 2YD8A 5FYLL 1K8IB 3I85A 1TENA 1VGEH 1Z5LB 3FFDB 4KAQL 2B1HL 1MY5A 2DQJH 4YHYB 2HT2C 4JJ5B 5DJ2A 2FRGP 3O11B 3LPFA 1ZLUK 3SJVB 2JB5H 2FO4B 4ISVA 4QF1B 1XGQA 2F54B 1KULA 4XXDA 3SPVB 1XF5B 4G6KH 5IB3B 3KPMA 5FKPA 3UXFA 3P77B 1QSED 2RBLA 4PLKC 1HZHH 4R2GB 4XB7A 5JHDA 3RZCA 1F3JB 3RWJB 5FCUL 1ZSDB 3C6LB 5TDPA 4KI5E 3EO9L 4F7MB 3TN0B 1J10A 1BFSA 5ISZE 1ZLWH 2X4SA 4JM2F 3CVHB 4XWOC 3UTTE 4PRPD 4X99B 4YHZL 2VUYA 1YEJH 1A8JH 1MJUH 1JWMB 1A7BA 3F12B 4WU7B 3RWHB 1WIPA 3UDWA 2BVQA 4I8DA 3FT4B 4XPFL 3HZKA 4AEEA 1CD8A 2IANA 1FAKT 1MAKA 5DD5L 3ZTJH 3O6FC 5KS9F 1VFUA 5M94B 3KVQA 5T33L 4P2QE 4QRPE 3MBEB 4ZAKD 2DYPA 4FOMA 3SDDB 4NC1C 1VEMA 5DVLA 1IBGL 4AEIH 3RGVA 4U1KB 1U8JA 2AV7A 3VWKB 3WDHA 4P99A 2GJJA 2OL3H 2DQHL 2FGWH 3JTSA 5E6YA 4UU9A 4JR9L 1L9NA 3SDDC 2JKXA 1JUFB 4KQ3L 3C8KA 5IP4A 3MOBL 2O5YL 1F02I 4PJ8C 3T3MF 1DBAH 4H26B 3PWJB 1DBKH 1Z2KA 2ADFH 1KPRA 3GSRA 4MQTB 3LIZH 4OFYD 2WMPA 5IJKC 3K80A 3QWQB 1GIGL 1R3JA 4GLRH 5C9KA 4GAYB 4YHMH 1A6VL 1G7QB 2BFVH 4LP5A 3ZL4L 3BQUD 43CAA 3GMMA 3DUHA 2RCSL 1AQKH 4PLJD 2GK2A 5BW7C 3NOIA 2F53B 3C09C 3EO1B 2GYSA 5JXAL 2AJYL 3IXAA 4ERSH 2BVYA 4GRLB 2OYPA 3VXRA 3QUMA 1IAII 4X5WB 4NWTL 4YIQA 1J8HA 4ONOA 4HZAA 3R06A 3KJ4B 2UVEA 5ESAB 2BCKA 4HJJL 3W0WD 4LVOC 3NIGE 4KJPC 4F7EB 5L6YH 4OQTA 3FO1B 1RURH 2X4PB 4NHUB 4ELMB 4FNLL 1W72B 4UMGA 1F3DH 1N3NA 1XIWC 1TCMA 5K9OA 3QNYA 3HUJB 1P9MA 4K8RH 5CD5C 5GS1B 5JO5B 3FT3A 2HG5B 3B2VH 5IM7A 2C3HA 5D72L 1KYOJ 4DEPB 1OAUH 1R24B 3G5VB 4FN0A 4HHAA 4RFEB 2NYYC 1D6VL 4XCFL 2NY3C 3FCTB 2RB8A 5DHVH 3MGTB 2HVJA 4J3UA 3QDME 4OCRL 4U1NB 5DD1L 5DMKA 5DJAA 4R26L 1OLZA 5INDA 4OCXH 1JF1B 2FECI 5CZVL 5GS1C 2GSGA 1CG9B 2ICWB 5DUMH 3QFJD 2R0LL 4PJGA 4JO2L 4AENA 3SDXF 1KT2A 5L8KB 3HZVB 5D96B 1I9JH 5IB1B 1K8IA 2CDEB 1Z5LA 3FFDA 1LWRA 2WWKT 5D1QA 5GQBA 3RY6C 1H8OA 4JJ5A 3NIDF 1Q9WB 1JRHL 1NGQL 4RQQB 3O11A 1KTKE 3K74B 3SJVA 2WIMA 2FO4A 1FNLA 1QRNE 3RVVC 1TETH 4QF1A 2F54A 1QBMH 5E6ID 35C8H 3SPVA 4Y1AE 5IB3A 2WP3T 4FZEH 1WZ1L 2FZ3B 3ULSB 3P77A 5HVHB 2YD3A 1RJYB 2WUBH 2JJVA 1F3JA 2MCG1 3RWJA 3WIHL 3ARPA 3C6LA 4F7MA 3LPGA 3TN0A 2EDYA 2BSRA 1Q72H 4S1SL 2DQIH 4MWFB 2AEQL 3CVHA 4NN7C 4OCMC 1KCSH 4X99A 4XXCA 4Y5YC 5DTFB 5I17B 1JWMA 4XVJH 4YC2B 3M07A 1OLLA 3F12A 4P3CL 5C0ND 3RWHA 4X6CE 3ZDYF 1XT5A 5I1IL 1ZXQA 3V6OC 3FT4A 3DRQB 4UINL 1U8LB 3SGJA 1DQQB 2XTLA 1XF4A 4GW5B 1UEMA 3EJJX 3BMVA 3ARGB 3EYUL 4OBRA 4YC2C 3MBEA 1T83C 1WTGT 1Z9MA 2OSLB 5F6HI 2IBZX 4N5EC 3SCMC 1XEDA 3TV3L 4EKXA 4U1KA 5FGBA 4ODWB 4KTDL 3QPQC 4NUJA 5L2JB 5B21A 3VWKA 1BF2A 1CT8B 3BP4B 3MCKA 2ATKB 2XWJB 4O2CB 2QR0B 5JQ6H 4Q9RL 1IC5H 1U8KB 5ALCH 5ADOL 3IDNB 4MCYB 2J8OA 3MLUH 4LPXA 1U8HB 2DTSA 3BKJH 5MP6H 3SDAB 4H26A 1F8TH 3PWJA 2XKUA 3EBAA 4JQXC 5EUOF 4LSPL 1IQDB 1JK8B 3QNXB 4UNUA 4W6WB 4K3HA 1F13A 4OJFL 4LCYB 4FQQB 2CMRL 3CFIC 4F7TB 3P4NB 2P5WB 3G6JB 3HG1E 4I3RL 4GAYA 5I8OL 4YDKL 4MYWB 1G7QA 2A9NL 5FGRA 3NA9H 2MQCA 4FFZL 5FYKH 1YEFL 4RMVA 3C60C 4HDIB 3ZE1F 3AM8A 3RVXD 5TDOB 2F53A 3EO1A 5E7BA 3LQAC 1QQDB 3B5HA 4GJTB 4GRLA 4XH2B 1YEIL 1R3KA 4QOKD 4X5WA 1X5FA 1YY9D 4XPAL 4D9QD 3FRUB 4X4MA 5FK9B 2DMBA 3WUWG 1BGXH 3T0EB 5ESAA 4NN5C 4M8QB 1NANI 3UBXG 1KEML 4F7EA 5GS2D 3FO1A 1OAZH 2X4PA 4K94H 4NHUA 4ELMA 4L4JA 3DI2B 1W72A 4U1JB 2CKBB 4O9HL 4LLMB 1KB9J 1DLFH 3OKKB 3TBYB 2VZTA 3HUJA 5E9DE 4JKMA 5JO5A 1AY1H 3SGKC 2HG5A 1GZPB 1R24A 3G5VA 3UC0H 2R2BB 3CZJA 4RFEA 4CDGC 2PTVA 4DKEL 3S4SG 4U6VH 1J0ZA 2XXCB 3MGTA 1XGPB 4FRWA 1EO8H 2D4FA 5FOJA 3NPZB 4JY5L 4U1NA 5EZJB 4UT6H 2HJLB 3QULB 1JF1A 4JQIL 4H8WH 3VDAA 4JHZA 4LHUB 1CG9A 5CEXB 2ICWA 1UENA 3LOWA 4QYOB 2EDKA 5DQDH 4MVBC 2ED9A 4PRBB 5BQ7B 4PTTB 3HZVA 1MCPH 1OT2A 4PGEB 5IB1A 2CDEA 1TCRB 4N8PA 4DN3H 4QWWD 3DXAB 4OGXH 4EQ3A 1Q9WA 1CI5A 3N1QC 4RQQA 4EI5D 3AAZB 2VLJE 1GOHA 3EUUA 1EAJA 2AK1H 1DQMH 1IAOB 4J4PD 1DSFL 1NL0H 3GK8L 1NBVL 2D7PA 2FZ3A 3ULSA 1VENA 3CGTA 3BRFA 1EHLL 3BN9C 4HIXH 1HIMH 2W60B 4L4TE 4PJAB 5JW3L 5IG7B 3I50H 4PP1D 3ZE0F 5JR1L 4OB5L 4S1QH 3OF6A 2XPGB 4GBXB 5KVMC 1M7XA 4LQFH 1MCLA 2YSSB 1NBZB 4HT1L 4MWFA 4OSUL 4ZODA 1GC1C 4AK1A 1NSNL 3DLQR 1HQ4B 1CTOA 5DTFA 5I17A 5INCB 4OZFH 1Q1JL 1A7NL 5C0AB 4YUEL 4I77L 4HXBL 4QXWA 5T3ZH 5C09D 1UB5B 3DRQA 4NIKB 4P2RB 5KN5B 1DQQA 2NY0B 4Y7MA 2ATPB 2VAAB 1NGXA 5I1GL 3L9RB 1IL1B 3HE7B 4GW5A 2HH0H 3ARGA 3HI6L 3GM8A 1C5DB 2CKBL 1X6NA 4WIQA 4YXLL 1E6JH 2FJFB 4ZAKC 3N9GL 1LO0L 2E9WA 3TWCL 1HCFX 2HTKC 2IBGA 4ODWA 1YEHH 5L2JA 2DN7A 5IEHB 1K3ZA 2PO6D 1CT8A 5C0CE 5TGBB 1EO7A 5FDWB 3BP4A 2R2CA 2JE8A 3HE7C 5CFHA 3SE3C 2ATKA 2XWJA 2QR0A 5J6HB 3BP5A 5DHYB 1U8KA 3DBXA 4HK0A 3KJ6H 3V4VH 3IDNA 1J11A 5E5UB 3C5JB 3HAEG 1EJOH 2UWEE 3VFSB 3DURA 3KPRD 4BK5A 1G9NH 3SDAA 3C8DA 4JRYE 5TDNB 3S35L 4XNUH 5DSCB 1S9VA 3MLWL 4MJID 3H42H 3LSOB 1IQDA 1JK8A 3QNXA 1G6VK 1KCRH 4RA0C 5I30L 5ELIA 4D8PA 2CO6B 4LCYA 4XAKD 3QRGH 5B39B 3R8QA 2HN7A 4FQQA 4F7TA 4UNTA 4WI8A 2ICWJ 3N0PB 2P5WA 2QADC 3QEQD 3U1SL 3G6JA 4S1RH 5BOPA 1MHPH 5HHXH 3DGGB 3LQZB 1DBML 3WBDA 2VLKA 5E2TH 1MRCH 1RJCA 4HDIA 4U2YA 3BQUC 3KPQB 3AROA 4JKKA 4O4YH 5TDOA 2A9MH 2HLAB 4PLJC 2B1AH 3BYYA 1QQDA 3RP1A 4YDIL 3JSSA 1DBJL 4HXAL 1RZFL 4Z7WB 3FRUA 2DLFL 3KPLB 1NCDH 2HYMA 5FK9A 3UTZB 3S34H 2RJMA 4TUOB 3UTSB 1BBDL 2C4FU 1P84K 5LAXB 3T0EA 1ZVYA 1RUPH 4LMQI 4M8QA 5DJ6B 1SJEB 2YA0A 4PJGF 3WHE0 4JO3H 4TOYL 3T3PF 4Q6IA 1UM5H 2ITCB 2UZYB 4FQIL 1MI5E 2X4UB 2CKBA 4LLMA 1BJ8A 1QSEE 3OKKA 3QHZL 5EU6A 3TBYA 5JNYB 5DUBB 2IAND 4OLZH 3N1FC 4K9EL 3VWJB 3MOAH 3V5KB 4NM4H 5E8OB 1PKQB 1IARB 4PYHA 2P45B 2R2BA 3PDGA 3QT2A 3D3VD 4FP8L 5IHUL 5IMLB 4W68A 4YHOL 3BPNC 1S8DB 3MA9H 5KVGH 2ZCLH 4MA1C 4PRPE 2A6IB 5EO0B 5EZJA 3RGVD 4MHHI 1H3TA 4EOWL 3TZVD 2HJLA 4IDLA 2CK0H 4GG6B 5FYJU 1JHKH 1BEYH 1ZA3B 1X9QA 4LHUA 1NCBL 5CEXA 1QLRB 4I48A 1CXLA 4QYOA 2VTFA 4PRBA 3E6HB 4PTTA 5DRNA 2AEPL 2BHYA 4XTRD 3X3GL 3F6IA 1TCRA 1BIHA 3STZB 2FX7H 3EJYD 2DF3A 1UXWB 4GSDL 4EUPG 1OY3B 3VXUA 3Q6GH 4HZLB 3MUGB 3H9HA 1GGTA 3OGOE 3SDCB 1IAOA 1P1ZA 2MJWA 3QUXC 1WITA 3CMOH 5E6IC 5E2VL 4K3JL 5DC0A 5I15L 4OLVH 1O7SA 1T7YA 1A6WH 5A2FA 1LEIB 4PJAA 1VERA 5IG7A 3VH8B 4U6YA 2WNGA 4OCSL 1YECL 1HKFA 2I5YH 2XPGA 1JBJA 3MJ7B 4GBXA 2YSSA 2ZPKL 3U2SB 1NBZA 3LRHA 2JTDA 4U1GC 1V05A 4M6ML 4F8TA 1HQ4A 5DGRA 4OFKA 5DLMH 5INCA 1HYRC 1ZHNB 1FFRA 4U1MB 5C0AA 2UUDK 5C0NC 5DT1H 3LS4L 4D94A 1KCKA 1UB5A 5KANI 4LCUB 3UZQA 4Y19D 5KN5A 2ATPA 3ARBD 3L9RA 1IL1A 4CGTA 1BVZA 5F7UA 5IROA 1C5DA 4GQPH 1QFWL 5HYJB 3MV8B 2FJFA 5BZWB 3KR3L 2VQ1B 1TZIB 1GH7A 2ZNXA 1U92B 2J5LB 5C07D 5F70A 4ZUTB 1F58H 5IEHA 4PRAB 1JGLL 3L95B 2IJ0C 3CLFH 5FDWA 4WWKD 1NAMB 4Q0XL 2NY5H 5J6HA 4JDVA 3HCVB 3W0WE 2ITDB 1TZGH 4LL9A 5EPMB 3D25A 3VFSA 2DJ4A 2E8YA 5TDNA 5BXFB 1I3GH 5D6DC 3PE9A 5DSCA 2DDQH 1IE5A 2X9XA 3LSOA 2WWMD 1YJDH 4NP4L 4JZNB 2P49B 2D7NA 2IH3B 5B39A 2CH8A 1WV7T 4GKZB 3OJVC 2YUVA 3BD3A 5D1QD 4ELMF 3LZFH 4BKLA 4Y4KB 4BUHA 4AL8L 3MRKB 1UACL 3DGGA 2Y06H 3BT2L 3LQZA 1CBVH 1A1NB 1A1OB 3HUJF 2V17L 3WNPA 2P48B 3KPQA 4UAOB 5EBGA 5GRXG 2HLAA 2MNUA 3QFJE 1RMFH 1TJIH 1MJJB 1CLZH 3WNMA 4JZJC 3C6LD 5TE7H 3EFDH 4Z7WA 2VDMH 1DEDA 3KPLA 3GFUA 5FIEA 1YY9C 1M05B 3UTZA 1WIOA 2EH8L 1MCQA 4TUOA 3UTSA 1DP0A 2AABH 5LAXA 1Q9OB 1EX0A 5DJ6A 2CLVB 3ARZA 1SJEA 1YN6B 5IVZB 5ITFA 4PJ9B 5KS9E 2X1PA 2ITCA 5ICYB 2X4UA 3QSKB 5EN2B 5CJBA 5B8CB 3RI5K 4BZ1L 5JUEL 5FAAA 3S96B 4F9PA 5JNYA 5DUBA 1F6FB 3RNKB 4AT6B 3VWJA 3CCHA 3V5KA 1Z3GL 3VFGH 5E8OA 5K9JL 1PKQA 2A73B 4M48L 3NIFF 4LOUC 5IWLC 3C2AH 4PJ9C 1S8DA 2GTWB 3GM0A 1CZ8L 4DGIH 3MRFB 2A6IA 4QHNB 5EO0A 5BRZB 1RZJH 1SMAA 4GG6A 4KROB 2UUDH 3U9PH 1BQSA 1ZA3A 3FB7B 1RJZA 3T3ME 1N64H 3VWKD 1QLRA 1CE6B 1IGFL 1KLFA 3E6HA 4PRDB 1V3JA 4YHLL 3WN5B 4NZRL 1AJ7L 2BY0A 3STZA 2V5MA 2OQJA 4N0RA 3NTCL 1UXWA 4QWWC 3QI9C 3AS3A 3PWPB 4HZLA 2QQLH 3MUGA 5BS0B 3DX8B 3A6OA 4RGNB 3SDCA 1JWUB 4EI5C 7FABL 4BA8A 1OP5K 1PDKA 4J4PC 4JFPB 1KCVH 4JG1L 2FD6H 4OZFG 1B0GB 4BQCA 3MJ6A 1LEIA 1WICA 3VH8A 3PXJA 3CDGA 3P11H 2YD2A 1F2QA 1V7NH 3MJ7A 2VC2H 4M5ZL 4KRPB 4WY7H 5E4EB 2DQEL 4WENB 4PJBA 5IW6A 1JRHI 5ID1B 1TMCB 4NCDA 2OMBA 5ILTL 5KSAB 1ZHNA 1QR1B 2ZNWA 1KXVC 4U1MA 4U3CA 2YD4A 3U7WH 1HK6A 3TBSB 2W0PA 3VFWA 3SKNB 2EDNA 2R29L 1N5YL 2VR9A 4LCUA 4XPHL 4KFZC 1YQ2A 4RX4A 3JVGA 4B41A 4X9IA 1OL0A 1Z0NA 4KH2A 4FHBD 4PD4J 5LGHL 3A67L 5KSAC 2L7JA 3BDXA 5HYJA 3HI5L 3MV8A 4OCYL 5BZWA 3TT3H 5CEZD 1NC4B 2PTTB 5CBEB 2VQ1A 4EQ2A 2R0ZL 1RHHA 1TZIA 3B2UC 4XBEH 1TVDA 2PW2A 1U92A 4QOKE 4ZUTA 2X70B 4D9QE 2YD5A 3L95A 3O8XB 3OKLA 4N8VG 2PO6C 1MPAL 4KKCD 1NAMA 3ZO0A 4F2MB 3V6ZA 1B4JL 1U8MB 2B39A 2ITDA 2JIXD 5EPMA 2GITB 5DI8B 4QGTA 2NY2B 1ZT1B 4HEPG 3PV6B 2Q20A 4TSAH 3HPJB 4HC1L 5BXFA 3GNMH 4MAYD 4LLQB 1SYVB 4HGWB 2BNQB 1YYML 3W2DL 1ZTXH 3WIFB 3I75B 3GIVB 2VDNL 1ADQH 3MUZ1 1IQWH 4R4BB 2XYCA 3NFSH 3LN4B 4JZNA 2IH3A 3G6DL 4GKZA 2P7TB 1J0HA 2WQRA 5FCSH 3CSYB 4WI4A 4DK3A 4P2OA 4Y4KA 2XIDA 5F3HB 3MRKA 5HVFB 4TNWF 5EWIL 4N0FB 1A1OA 1NLDH 5C7XL 4K7PX 2YS4A 3UZVB 4R97C 3BGMB 3DOSA 3A0OA 2HKFH 4G6MH 3BAEH 4X8JB 2ZUVA 5HHVL 1S3KL 2ERJC 4CU7A 1QSZA 4EDWL 1MJJA 4LCWD 4HLJA 5CJ8A 3OF6D 3ZDYE 4KTEL 3TPUA 5I1HH 2Y25A 4BQBA 3ZYIA 1Q9OA 2CLVA 5EOTB 4X4ZA 1YN6A 5IVZA 1IAIH 1LD9B 1AFVH 1R3IL 4D9RD 2EECA 1OP5H 2I9TA 5ICYA 5EN2A 3UTPD 3ZDZF 1MF2H 4YWGL 5B8CA 2Y36L 3Q48A 3UYRL 5LG1A 2KPNA 5LCVL 3RNKA 4AT6A 2EDLA 2R0WH 2AJVL 2A73A 4PJHB 4F33A 4KK6D 1IJ9A 1AGCB 3WE6B 2GTWA 1FNEB 3MCG1 1UGNA 2EKJA 4QHNA 5BRZA 4PJAF 1H3PH 2W9DH 3MBXH 5HI3D 5AZ2H 3SDYH 4ESKA 1A14L 3TZVC 1GGCH 3NPSC 4J3VA 1CE6A 1OW0A 5C09E 5EUOE 4AIZB 1MRDH 4PRDA 2COQA 5C08B 1INQB 3WN5A 1I4FB 1P7KB 4EN3B 5JXED 2P47B 1C8PA 3EJYC 1ZANH 3PWPA 5BS0A 3DX8A 3HC4L 5EZOL 1JWUA 5C6TH 4NNXB 4Q6YA 3WJJC 2MPAH 4R8WL 1EGJL 5C8JA 3ZE1E 1B0GA 1K85A 3OX8B 3N06B 5GRJH 4NZTL 2C1OB 3DX6B 4S10A 4BYHA 3GI8H 5C2UB 2CDFB 3H3PL 1NEUA 4BQ8A 4RAVB 2VLKD 1VCAA 4X9HA 1HEZB 4U1IB 3KPRE 4XPTH 1MCEA 5ID1A 3V79C 4Q9CA 5I75B 1BJMA 4MJIE 2R56H 3WYRA 4PTUA 1OM3H 2OTPA 2QSCH 1QR1A 2FHCA 1FNHA 3VA6A 3TBSA 4XAKE 1I7RB 2YD7A 4OTXL 1DVFD 3HMWL 1YQVL 1G7MB 2QQKL 3ARDA 1D7FA 4XMLL 2X4QB 1U36A 4YHNB 3QEQE 3ARBC 1F4WL 4YXKH 1A22B 4MQ7B 3HC3H 2VWEC 2IH1A 4GO6B 2IF7A 3P0YL 2AJSL 3B8YA 3OTTA 1NC4A 2PTTA 5EU6D 2MKLC 5CBEA 1I85C 4LRNH 3B43A 2EDXA 4KKBD 5C86A 4JRWA 2X70A 5LJYH 2PTUA 3O8XA 4X5XB 1ZLSH 4P23D 1ZA6B 2EDHA 4ZFFB 4WWKC 4F2MA 4OV6F 5FV2A 3LV3B 4G7YH 2GITA 4C56B 1TPXC 5KOVC 3EHBD 4IOSD 1MHEB 3PV6A 2LV4A 4UQ2A 1KJ3H 2PXYB 3HPJA 3TBVB 4Z7WF 4FFVC 4G6FD 4LLQA 4HGWA 5L2KD 2BY1A 3EOTH 2GHWB 3I75A 4MQXD 3L3GA 5AZEH 1NUFA 3GIVA 4YBHA 4R4BA 2IANE 3LN4A 4LSUL 4CMHB 3FFCB 3VRLE 3E8UL 2P7TA 2XZQH 4YHPB 3D3VE 1EGJA 4RGMB 3CSYA 2YBRA 2BY2A 5DURB 5ALBL 3VXUD 3ZE0E 5F3HA 3QEGL 1WQVT 4FMFA 2IQAB 5FM5O 4N0FA 1X7QB 1LVEA 4N1EA 3BGMA 1PSKH 4YR6B 3QPXL 2YPKB 1JGVL 4KV5F 3DX9B 5DK2B 1MCWM 4CMHC 3ZKQD 1FZKB 2Y5EA 4RGMC 4Z7VB 2XA8L 4GBXD 3CPLA 3ET9F 5JOFB 1BVLB 4HWEL 4WWID 4GG6F 4NZDA 2CR3A 5T1KB 1P4IH 4OF5A 1NLBH 1JNLH 5EOTA 4XP4H 3N85H 1LD9A 4IMKA 2IPUG 4S0TD 3U6RB 4U7KA 2D7MA 4HF5L 5E99H 1IC4H 3VFRA 3SOBH 1TQCC 4BSWB 1NANH 1ZOXA 2P8LB 5LXGL 2VQTA 2FJGB 2VISB 3I84A 3WE6A 5GGTL 2VXTH 4OUUB 4PGBB 4AJ0A 5GRVL 3B9EA 1LO5B 3K4DA 4OLYH 1FPTH 1FFPB 3JWOL 2DS4A 3FONB 3WUWB 2ZWLT 3UBXB 1DQLH 2XY2A 5I0DA 3IS0X 4BZYA 3ULVH 3RTQB 1BMGA 5DJDB 3RDTB 5E2WL 4Y19E 1CGWA 1KB5B 2CJUH 4PJBF 5C08A 3TT1L 1DZBA 4FQHB 1INQA 1I4FA 5T1MB 1P7KA 4EN3A 2VDPL 3QIUD 2VWEE 4LPTA 5F7DB 4BQ9A 4WI7A 1E6OL 4G9DB 5HYQA 4TVPD 4Z7OF 4HGKC 4N0YL 1IEBB 4HULB 5DRZB 1A6ZB 3MC0A 3S4SB 4NNXA 2C5DC 4MB3A 4F3FA 2GAZB 3RTQC 3RDTC 2Y07H 3OBAA 5C07E 1RUAL 3O41B 2XQBH 3BX7C 3OX8A 4IM8A 3GHBH 2L4OA 4JCLA 2C1OA 3DX6A 1X4XA 4HUKB 4GUPB 2CDFA 3KYAA 4RAVA 3GRWA 2AXGB 3MUJA 1HEZA 4G8EB 4U0QB 4Y8AA 4ZS7H 2DQDL 2DQGL 4HS8L 5ENWB 4I0PD 4KUZH 1I7RA 4XCNB 1IKNA 1YC7A 3BHBB 5MEOB 1AO7B 1G7MA 1G9MH 4HUUB 1G0XA 1J0KA 4YHNA 1GOGA 4TSBL 4Z5RB 4MQ7A 4KZEL 4WHCA 4F37K 4LSTL 3RIFK 1T0NA 5GGTA 3P9LB 1WWBX 1EAPB 1ZT7B 3TJEL 1TTGA 4KHTL 5KW9H 4JB9L 2AJXH 1A5FL 4X5XA 5IW1A 1U58B 2QQNL 3LS5L 5F8QC 5HDBE 3UTQB 1ZA6A 1RULH 4HLZH 3NCJL 1DQJB 2DLTA 4XVSL 3OL2A 3LV3A 3SO3C 4C56A 4C83B 4N1HB 4JE4B 2H26B 3VW3H 5I19H 3RPKA 1MHEA 2ADJA 2OL3B 3VDBA 2PXYA 4L5FL 3TBVA 2APFA 1I3UA 3GO1H 3MV9B 4L9LB 2WBJB 3T1FB 1KB5L 4MAYC 1JFQL 2UZIH 4CNIB 3QCUL 4LFHG 1J9CT 3MLZL 3FFCA 4IMLB 5GZNC 3S37X 3AY4C 2FLBT 1A6AB 4JHBA 3TBTB 2IQAA 4HFUH 3V4PH 2DQJL 4OLWL 4OF0A 2FIKB 1II4E 1MFCH 1X7QA 4URTB 4YR6A 2YPKA 3NH7L 2ZUXA 5CAYB 3DX9A 2ZG3A 5DK2A 3K0WA 3ILPA 1FZKA 5TJWK 2ZOLB 4G6KL 4Z7VA 1AC6A 3TBWB 3RFZC 3BW9A 4KMTH 1WJ3A 3KS0H 5JOFA 5L7XL 3IJHB 4R7NA 1V7MH 5T1KA 1HE7A 3F62A 3PIQB 3C5SB 4LIQH 4WO4D 4M6OH 1FN4B 1U8PB 3U6RA 3OAZK 1U3ZA 3PL6D 1G1YA 3MLTB 2PN5A 4RX4D 1HI6B 1RZ8A 2GT9B 1VFOA 2P8LA 2FJGA 1FCCA 2VISA 1CLCA 2VZ3A 4OUUA 4KY1L 4PGBA 4KK6C 3MV8D 1LO5A 1QA9B 5EB9A 3VGGA 4NRXB 1FFPA 1CFSB 3FONA 3P30H 3D0LB 3FN0L 4QRTB 1IM9D 1UQSB 3V0VB 4JFEB 5HI3C 2DQCH 5D7IB 3RWCB 4ZFGH 5FYJD 5DHVB 3C6SB 4AEIL 3W9EB 5DJDA 3U30C 3OKOB 3LMJH 1E4XI 1KB5A 5E8DL 5EFIB 4FQHA 2DJSA 4P9HH 5T1MA 4RMQA 1MCCA 5CCKH 3ARFD 3O6KH 3ZT5A 5CZXD 1T21B 5J56B 1GGIL 1QG3A 5F7DA 4ELME 2OLDA 2M8XA 1U3HD 4ACPA 5JXEC 2ED8A 4G9DA 2NY4B 1ETZB 1IEBA 4OZHF 4XP9H 2DBLH 5CEZE 1A6ZA 1KPVB 4TPRL 3WHXB 1C1EL 3MJ9L 1UA6H 2FL5B 5I8EB 4JPWH 4KKLC 4Q9BA 1DBKL 4LDLB 4OLEA 3MJGX 3P4OB 1JNHB 3Q5OA 3O41A 5KVFH 1OWWA 2QEJA 4NO5A 4P2OD 1XZ0B 4Y4KD 4RCAA 3LIZL 3NN8B 3TH2T 1I9RH 5AAMA 5T1LD 3IJSB 4GUPA 2NY4C 1VEOA 1LQSR 4RRPG 2AXGA 4GAGL 4G8EA 1FSKB 4LSRH 2Z91B 4Q74A 4XBPA 2YD9A 4YHML 2GQHA 1YEGH 4MX7B 4NQVB 5F9OH 3W11C 3KYOB 3LHPL 4TNVK 4XC1H 5ENWA 5FYLH 4QRRD 4I2XE 3J8F7 4KAQH 4XCNA 2B1HH 3BHBA 5MEOA 1AO7A 1DVFC 4HUUA 1NGWB 2X4OB 5GS0D 1KUMA 5C70A 2L0DA 12E8H 4Z5RA 2F74A 3CX2A 4NQDB 2QJDA 4QHLB 3HE6D 2VMFA 5J1TC 5L6YL 1EAPA 2LTQB 3K4ZA 2A83A 4OI8A 2WW8A 4LCWE 3EO9H 3R1GL 4LNVA 4G6JL 3ARVA 4KKBC 4B53A 4PBXA 2PYED 3PUCA 1U58A 3FRPA 4YXHL 3UTQA 1JNJA 4P23C 2DBJA 3MUY1 5SWSE 3ABZA 5CKGA 2GCYB 3D85B 4ZOAA 4C83A 1ITCA 2H26A 1CD9B 3IKCB 1DN0A 5LGKA 2OL3A 5LWYL 4D9RE 3EHBC 4XPFH 4ZPTA 3H8NA 1GGBH 3MV9A 4L9LA 2WBJA 3UTPE 4XI5D 4PB9L 3VG9B 4ZSOB 5DD5H 3QHTC 4OCXL 4MQXC 1V8HA 1AGFB 4KDWA 5DUML 1JYWA 5T33H 1CN4A 4IMLA 1IAMA 3RA7L 3FHQA 3HRPA 1FJ1B 5FKAB 4G8FA 5D8JH 1I9JL 1NKOA 1A6AA 2YKLL 3PWPD 1IBGH 3TBTA 5BS0D 4HKZB 4E42B 3F7RA 1U6AL 3KHQA 4NM8L 2QHRL 1N6QL 2FIKA 1ZAGA 3EGSA 4J8RB 7CGTA 1G7HA 3NACH 5I0ZA 4HJ0C 2H1PL 2DQHH 1NPUA 4C54A 2ZOLA 1T20B 3JV6B 4FZEL 3TBWA 1S7QB 4KQ3H 3MOBH 2V5YA 4N9GB 3IJHA 2EEBA 4LSDA 4GRWB 4POYA 4N0UB 4EXPX 3PIQA 3C5SA 3WLWC 5GGSY 4MJ6B 2FCBA 4HX1B 1U8PA 1KCSL 2EEDA 3MLTA 1GIGH 1BLNB 3MXWH 2YXFA 3ARDD 2EH7H 4OZGB 1HI6A 2GT9A 4H1LH 2F15A 3B6SA 2VH5H 3BKMH 1M6OB 5AG8A 3EOYG 2VLKE 4LLWB 2RCSH 4JFZL 4JM4L 1MCFA 1QA9A 3PP3H 3T2QA 5JXAH 2AJYH 4NRXA 1CFSA 1FFOB 3D0LA 1HHKB 5HPOA 1Z9SA 4QRTA 1S7XB 1XF3B 3V0VA 4NWTH 4JFEA 2D0GA 1QSFB 1VPOL 4OD2B 5D7IA 3RWCA 5DHVA 1CLOL 3LDBB 3R4DA 1P7HL 3W9EA 3OKOA 2HKHL 4MB5A 3B9KA 1CFNA 5EFIA 3BI9X 1F4YL 5CZKA 3RX8A 5LQBL 3O4LB 1RUQL 1T5WB 3H7BB 3AMKA 4DZBB 2D7TH 3H9SB 1T21A 1AI1L 4FNLH 3HR6A 1UB6B 3QIUC 5EC1B 3H9ZA 1XGYH 2VDRH 1IC5L 3L3IB 2HAZA 4UT7H 1KPVA 5EU6E 2P4AB 3WHXA 1P53A 5D72H 1RK0B 3MV7B 2FL5A 2WQ8A 5I8EA 1NGYB 1AXIB 1D6VH 3P4OA 4XCFH 1JNHA 3ZYZA 1UJ3C 1OAYH 1L0QA 5EZIH 4OIIH 3MLSL 4HBQA 1XZ0A 3NN8A 5KSBF 3IJSA 5DD1H 3IVKB 2ZUSA 4YDLB 3OJMB 1SM3L 2DQFB 4IHOB 4LLAA 1GXEA 5CZVH 2R0LH 3AC0A 2Z91A 5KOMC 3JTTB 2BK8A 4MX7A 5L2KE 4NQVA 1ITBB 4K3EL 3KYOA 5FYKL 1MHCA 4LLVB 1DQDH 1KBGH 5M95B 2F8OA 2W91A 3P40A 4I0PC 1CK0L 2YUZA 3K81A 4GMTL 4E41B 2NX5B 1UZ6F 4YDLC 4NCC1 1JRHH 1NGQH 5CMAB 1NGWA 2X4OA 4OZFB 2JJSC 3UCRA 3VXUE 4R3SB 5B4MD 1FZMB 4Y4HB 1N59B 2Z8RA 3NGBB 2CLZB 1WZ1H 2X89D 4I4WB 4NQDA 3SGDI 1ZGLP 5DF0A 3EO0A 3FQTB 3QXUA 4QHLA 4YE4L 1FZOB 1UZ8A 3WIHH 1P4LB 3FAWA 1JTOA 2JF1A 5FF6B 2GUOB 1DLFL 1SY6L 2Z9TA 4S1SH 4XRCB 1JE6A 1XGTB 1AY1L 4D0DB 1T2XA 5C0RH 2GCYA 3ARQA 3D85A 4P3CH 1VA9A 4F15C 1KF9B 4Z7VF 3IKCA 4DWHA 5I1IH 4XWGH 3DPBA 1S7SB 2CSPA 2H32H 2X10A 1F3DJ 2GTZA 1EO8L 4UINH 4ZNCD 3GJEB 1CIUA 4IRJB 2IGFL 4ZSOA 2VN4A 2O93L 3U46B 5BCAA 3IAGC 1AGFA 5CJXA 4GRMB 5TPWH 1V3MA 4HPOL 1FJ1A 4OIBA 5FKAA 1CU4L 5F7KC 3CLEL 2OTWA 4HIHB 4QTIL 5HYSB 4P46B 4S11A 5ANMA 2IMNA 4HKZA 3TV3H 4PB0H 4KTDH 4AYFA 4J8RA 1D9KB 1WTLA 3Q5TA 5HHOD 3B83A 3P2TA 4UIKL 3U36B 3V52L 4Q9RH 4GKNB 5ADOH 1T20A 3JV6A 1ORQB 4G8GB 1MCRA 1HIML 3BEWB 4QCIB 4N9GA 5KBNC 4LSPH 4TVPE 2HRPH 5E94B 4N0UA 5D7LD 4OJFH 2ICCA 4PJEB 4MJ6A 4HX1A 3SHSA 4WO4C 1YPZF 3MV11 4NFCA 5FUCE 4LFHD 4PY8J 1KCUL 3RVTD 3PL6C 3B9DA 4OZGA 5E08L 4I3RH 4LEXH 5I8OH 4YDKH 1M6OA 3LQMA 4FFZH 1ED3B 1YEFH 2X2YA 3LRGA 4LLWA 3G9VA 1SY6A 5FM8A 4HBCH 5I6XB 4QHKI 2VZ1A 1HHKA 1YEIH 1S7XA 5J3HC 1XF3A 4XPAH 3VRIB 1X5JA 3U82B 1QSFA 2DB8A 2VUOA 3D39D 4OD2A 4KMLB 4FXKB 3UEZA 1S78D 4HWZB 1IEAB 1AHWB 2F8XC 3DETD 3O4LA 1T5WA 1RJLB 3H7BA 3TA3B 3FQRB 4UUJA 4DZBA 3H9SA 4J3XA 5HGGS 3DYPA 3AVEA 1UB6A 3ARFC 1J12A 5CZXC 5EC1A 2EEAA 4GKSB 3VI3F 4O9HH 3QFDA 1S9KC 3I3DA 3L3IA 1MOEA 1U3HC 1CFVH 1LEKB 3G5YB 1BREA 1FVCB 1RK0A 3MV7A 4LDEB 1AE6L 3CJJA 1PKQE 4XNUL 1NGYA 4KV5E 4WW2B 2XN9B 1UM6L 1FVEB 4N9OB 4DKEH 2F5BL 5D6CB 3QUYB 3IVKA 4WEMB 2DQFA 5T5NF 4IHOA 1T66D 1KGCD 4JQIH 1HKLH 5E0QA 3TP4A 3U0WH 1MHPL 5A16B 2CRMA 3JTTA 1WEJL 3RBGA 4LLVA 2OP4L 5DWUL 3MPCA 1UG9A 2A1WL 2NX5A 5T1KD 2W1NA 1D5XB 1F4HA 4BSVA 4OZFA 4CVZB 4NDMB 1CXKA 4R3SA 3RWEB 3ARTA 5GS0C 1NCDL 1FZMA 3FKUS 3QDHA 3ZKXB 4LLUB 3LQAH 4Y4HA 5K9QG 1N59A 4LSSL 3S34L 3O6LL 2CLZA 2E7LA 1DSFH 3GK8H 2BOCB 4NKOB 3FQTA 1EHLH 5JW3H 3HNSL 3GSNH 5GJTH 5I18L 3PWNB 3HE6C 1B4RA 4IIQA 4OB5H 5J4MA 4CL7A 2C26A 4LGPB 4ZG1A 1P4LA 2DLGA 4NOBA 3PWLB 2C3XA 2GUOA 3FN9A 2Y72A 4HT1H 4OSUH 4XRCA 1P6FA 5F9WC 1IVLA 4TTGA 4OLZL 1XGTA 1NSNH 3CVIL 4XCCL 1MSPA 4PJBE 4G9FD 5EZLB 4YUEH 4I77H 1RFDL 1S7SA 4HXBH 4XVUC 1UYWL 2ZCLL 4ZS6D 3PG2A 1QKZL 4D3CH 4XNZC 3ULUC 2YRZA 4KK9D 3GJEA 4Z7OE 4M43H 1DL7L 3JV0A 4IRJA 3T77B 5I1GH 1SBBA 3DJ9A 4DUWA 2J8HA 2CR6A 2RFXB 3S3JA 3U46A 4CW1B 2KL6A 4GRMA 4MMZC 3HI6H 2BNUB 2CKBH 2OR9L 3AGVA 3PDOB 1WF5A 1OPGL 4YXLH 1P7QB 3RGHA 3MV8E 3N9GH 4HIHA 3UP1A 5HYSA 4P46A 4MA3B 4GXUM 4OGYL 5ACMA 3G9AB 3UBXI 2JJUA 1D9KA 3Q6GL 4IRSB 5HJ3B 1XF2B 4NWUL 3U36A 5BVPL 5FYJE 2HLFD 1DANT 3I3BA 4WI9A 4F57L 4GKNA 1T22B 4OAWA 4Z0XB 1ORQA 4G8GA 1UWXH 3EFFB 3H9YA 2YRPA 4QCIA 1W2KT 3BEWA 4RMUA 1A1MB 5GS0L 3S35H 1XAUA 4D0BB 1JJUA 4XBGB 5D7IF 4KI1A 2NY1D 5I30H 1UCBL 5E94A 1BOGB 4PJEA 3FO2B 3UYPA 5DD3L 4KGJA 5DLML 2EXWC 3IDYB 1EFXB 3U1SH 1GAFH 4JDTL 4JQVA 1GC1H 3L5WB 3EYQD 2QLVB 1DBMH 3FT2B 3MRQB 4M02A 2WINB 1T5XB 4APQD 1YEKH 3U4BL 2QHLA 1QEWB 2X4RB 3PGCB 1EJ6A 3ULUL 3VFVB 2GFBB 5DK3A 2ZKHH 3VRIA 4QRRE 3KPTA 2KQMA 3VD7A 1R5WB 2VSCA 4FXKA 3MLYL 4FQCL 5HHMD 1RVFH 4HWZA 1IEAA 1Q94B 1IM3B 1AHWA 3DROB 4TOYH 4JFFD 1RJLA 3TA3A 3FQRA 1OWRM 3EYOA 4P9ML 1JVKA 4RDQG 4YPGB 4PIRF 4GKSA 2MCPL 3QDJD 4NQUA 5I1AB 3QHZH 1LEKA 5LKNA 2P1YA 1R3LA 3G5YA 3VXSB 5J13B 1I3GL 1G1CA 2DDQL 4FP8H 4YHOH 4WW2A 1JN6B 2XN9A 1BF8A 2NY7H 3GJFB 2PYEE 5FUZL 2YZ1A 4QXTB 5D6CA 3QUYA 2NTSP 1EEZB 4MJ5A 5CSZB 5J11C 2DM2A 1NCBH 1CFBA 5A16A 1I8IA 2V5RA 2Y06L 1MFBL 2AEPH 1EPFA 4DJMA 3X3GH 3DVIA 43C9B 5MI0C 3SE4C 4UDUB 2Z8VC 3IRZA 4GSDH 1A4KB 1D5XA 2HP4A 2J8UB 3CIQA 3EFDL 4CVZA 3PWPE 4NDMA 3ZT7A 4Y2DD 5BS0E 4MD4B 3K8MA 4LLUA 2XZCL 2CRZA 4HK3N 5B4MC 3MCLL 4WHYH 5I15H 4MLSA 2BOCA 4NKOA 3GMQB 2WBKA 4LSQL 3SEPA 4OCSH 1YECH 4ONGH 3O3EB 2XRAL 5EIVA 2ZPKH 3PWLA 4RMSA 4K07A 4DOHB 1H3GA 1UXSB 2SEBB 5F7EL 5F96L 3C5ZD 3WFBH 1WCBB 1Y6KR 1MLBB 2VL4A 4M6MH 3V6FB 4N90D 1A9BB 3DVGB 2EDOA 3MSPA 4NO2B 3AU1B 5EZLA 4TVSa 3ZSTA 5J1SC 3LKOB 4NFBA 3C8HA 3LS4H 4DGIL 5L88L 3SQBA 3QZWB 4NJAL 4OZHE 2D7OA 2CRIA 3T77A 3B9KD 5KAQG 3EAKA 4CW1A 1N64L 8FABB 2P44B 4D0CB 2BNUA 4FQXD 3PDOA 5DZLA 2OCFD 1PKOA 3KR3H 1I1CA 1P7QA 4DW2L 4JGUA 1Z9OA 3QAZC 2ZUQC 4YBLB 4OZGF 3IKKA 2HFTA 3ZTNL 1JGLH 1CDJA 4X6BB 4AM0A 2QQLL 4IRSA 5GRUL 5HJ3A 1XF2A 4KK5D 4Q0XH 1CD0A 1T22A 3D1MC 1YUHA 2DAVA 4Z0XA 15C8L 3WNNA 1NFDE 2FD6L 3EFFA 5BV7C 2IG2L 1A1MA 3M45A 1S7RB 4D0BA 4XNYH 3EKCA 2XFXA 4XBGA 4Z7UB 1KJ2H 5C0BB 4Y5VB 1OGAD 4LVHB 3UX9B 1BOGA 5C6WH 3FO2A 4NP4H 5A2IH 1PD6A 3JUYA 4ODSL 4Z18A 3VFUB 1EFXA 2DM3A 1KXQE 1MCOL 1CQKA 4AL8H 3RVTC 1UACH 3VFPB 3U7WL 3L5WA 3BT2H 3FT2A 3MRQA 2FHBA 3JWDC 3AREB 2WINA 1BD2D 2V17H 3MRGB 2E8ZA 2ARJQ 4FQJL 1QEWA 2X4RA 4BFEA 2G5RA 4XHQA 2G60L 2J4WL 3VFVA 4JVUA 2GFBA 2PKDA 3QG7L 4PJIF 2IAMA 1FL5B 4X6FB 5JTWA 1Q38A 1F6LL 2EH8H 3FOMB 3BISA 3E6FB 4U0RB 5D2NB 1G7PB 4NC0B 1INEH 4POUB 4MSWB 1IM3A 1S78C 3PQYB 4LNRB 1QP1A 2GJ6B 3LKRB 3HLAB 4MXVE 3DNKA 3DETC 4PBVC 2FNBA 4LVEA 4YPGA 2DL9A 5JUEH 4M1CD 5C3TA 1QFPA 5I1AA 2DIBA 4DVBB 1E4XH 3OHXB 4JFDB 3GI9L 4F9LA 4TSAL 3VXSA 4M48H 3PHOB 4LCCB 3K4AA 2OS7A 5ITBL 3I2CL 1JN6A 3MRMB 4V1DB 1RZKC 3CSBA 1JI2A 1P84J 1IQWL 5BV7L 4QXTA 5I66B 4KXZI 4P2CG 1I7ZB 1HNFA 3QG6B 2R39A 1EEZA 3VDCA 1DE4B 2LAAA 5CSZA 4S2SB 2WK2A 3E2HC 3WJLC 2CKNA 1T66C 4DAGH 5EU5B 4M3JA 1BFOB 2VLLB 1RUMH 3WFEL 1CS6A 4NZRH 3BAEL 2V2XB 4W4NA 1CICB 2E6JA 4UDUA 2VSDA 1A4KA 4P49A 2D0HA 4EBQL 1MAJA 4BZ2H 2YA2A 1SVZA 4UQ3B 5E24E 1MVUB 4OFDA 3TO2B 3K7UA 4MD4A 4PJ5B 5SWZA 1Z6JT 4L3EB 4WTXA 3HMXL 4JG1H 1QFHA 4U1LB 5HHOE 2FEEL 3IJYB 3O3EA 2NXYB 4PLNC 1TVBB 1MF2L 4M5ZH 3SY0A 2K7QA 4G80B 2SEBA 4WUUB 1KSRA 4GH7B 5GS2H 1WCBA 1MLBA 3V6FA 3DVGA 3FB5A 3CFCL 3AU1A 2BXZA 3AS2A 2Q8BL 5D7LE 1LO3H 2VXVH 3LKOA 4P59H 4L8DB 1QSFD 4YEFA 2A0LC 1N5YH 4L1HA 3QZWA 1LP9B 4ZS6C 4KK9C 3TVMB 5D1XC 5AZ2L 3SDYL 1RZKL 4P3DB 1WUNT 3BJ91 1GGCL 1GRWA 8FABA 4D0CA 1WZLA 5IBUG 2Y6SD 4KKAD 5LGHH 1LK3L 1NCTA 2YPVL 5KSBE 1ADQA 3SE9H 2FECL 2R0ZH 4P4RB 5IGXL 4UDTB 1B3JA 1K9TA 2BZDA 1YMMB 4LASL 4X6BA 1ZVHA 2QKIB 3D39E 3L1OL 5DD6B 4NQXB 1B4JH 2HLFC 4L8SB 2OI9C 5GGQL 3TNNB 1KENH 3O3UN 1MWAB 1EZVY 4XVTL 4HC1H 1UZ6E 1S7RA 2NY6B 1EERB 1YYMH 4WFHD 3GI8L 3W2DH 4UTAH 4Z7UA 5C0BA 1FZJB 2VDNH 4W4OA 4LLYB 4Y5VA 3FB8B 5HGAB 3T2NL 2ICEB 3ROOA 2NY1C 4PRNB 1CVRA 3QIBD 2GSIB 4YZFF 4UIMB 2FATL 3BMWA 4YGVB 1WK0A 2R56L 3VFUA 3DV4B 3VFPA 5GRYA 3L6FB 2XV6B 1UKTA 2NY6C 5EWIH 4M1DL 4A2MA 5C7XH 3EYQC 1MHHA 1NEZG 2BRQA 3AREA 5HDOA 3MRGA 3Q6FB 2QBWA 1WIUA 1CLYH 1KGCE 5HHVH 5DQJA 4APQC 1JPSL 1S3KH 4NUGH 4WW2F 4EDWH 2O5ZL 3U9UB 3HC3L 1Q0YH 4YQXL 1MIEH 4KTEH 1MRFH 4H0IA 1FL5A 4X6FA 4U6HA 1OTUD 2Z93B 3A6CL 3FOMA 3E6FA 5D2NA 1G7PA 5E8EB 5IFHH 1K4CB 1FL3A 4MSWA 4LNRA 3PQYA 2GJ6A 2WAHA 3LKRA 3O0RH 1JTTA 1JZ6A 1FC1A 3C87A 1CDBA 4YWGH 1ROWA 4K71C 1BZ9B 2Y36H 3D9AL 2GK0B 2H2SD 3VXMB 5I73B 4DVBA 3OHXA 2OBGA 4IRJD 4JFDA 1A7RH 2XTJD 3QIWB 4OD3L 3CUPB 4MNGE 2AJVH 3PHOA 1KN4L 4LCCA 3MX0A 2B0SL 2HTLD 5FM5M 3EOTL 5HHQB 2W9EL 5AZEL 1QHOA 3ZLQC 5HXMA 5EORL 4X9BA 3L3KB 3BO8B 1I7ZA 3QG6A 1PGRB 4V2CB 5SWQB 1LDPL 4S2SA 4G9FE 3WFCH 3BD5A 4MXQD 5EU5A 4JFHD 3QQ4B 2VLLA 3S37L 5ICXB 4OLUL 3GGWA 4WI5A 4LRIC 5ADPH 1MWAL 2V2XA 4ZXBD 4OF7A 3SBWC 1YPZE 4OCNC 1CICA 2PYFB 3IGAB 3QDGD 2VZVA 4JPVL 4ZTPH 1AP2B 4UQ3A 1MVUA 5EZOH 4KDTA 4G6AD 2HT4D 3TO2A 4PJ5A 4NNPL 1UJTA 4Y2DC 4L3EA 4R8WH 1EGJH 4QT5B 3GDBA 1NLBL 5I71C 2RR3A 4H25B 4RRPA 4XP4L 3N85L 3CSPA 3IJYA 1F6AB 4NZTH 1KJVB 2YK1H 5KVEL 3S7GA 4KVCL 3H3PH 1TVBA 5E5RB 3SGDH 3DECA 3SOBL 4G80A 5GRVK 5D5MB 1ZGLB 3S98A 3MGAA 1GGYA 2G5BB 5GRWA 1HSBB 4HSQA 3C5ZC 5DRWB 3OKNB 4HAGA 2B2XH 1B0WA 2F58L 1G7IB 5D2LB 1K6QL 4OTXH 5H37G 3VI3E 3HMWH 1LP9A 1YQVH 2QQKH 3TVMA 4YBQD 2EYTB 4XMLH 3D5OF 4B0MM 4JRXE 3WO4C 1DQLL 2HVKA 4XPBL 3DHJA 3REVA 1MQ8A 2ADGB 3MXVL 4FQXC 3P0YH 4NQCD 2AJSH 2F8VA 4H20L 2DRUA 3PWVB 1U8QB 1M1SA 1QLEH 5L8LB 3ZE2F 1MIML 4P4RA 4U2ZA 4WEUD 3KLHD 1YMMA 3OG4B 3GBLA 4Y16B 2QKIA 1C7SA 2X1WL 1M71B 4QO1A 4KK5C 5HHME 4NQXA 5IKCB 2VN7A 4N5UA 3S3SA 4L8SA 1VSCA 4OZIE 3TNNA 4KHXH 1RZGB 4JFFE 1IKFH 4X4YB 3QDJE 5L0QB 3S8WA 4PJ7F 1FZJA 4LLYA 5HGAA 2ICEA 2LU4A 4PRNA 3KPNB 4HCRH 3OXSB 2GSIA 5H8DA 4UNVA 1XR8B 2Y5TB 4UIMA 4F33B 4OI7A 4LARL 5ALBH 3DV4A 2EDFA 3HZMB 3QEGH 3L6FA 3MLPA 1W0WA 1IC1A 2V7HB 3Q6FA 3QPXH 1JGVH 3BGFB 1ZS8B 2AXJA 4ELKB 1EUTA 3U9UA 4XMPL 1YNKL 3THML 1ONQB 2XA8H 4M1GL 3I6KB 2JCCB 2RIKA 4PLOB 4HWEH 4HUMB 1BECA 2Z93A 3MTRA 5E8EA 4KQ4L 3CXDL 1I75A 1K4CA 2NXZB 4MNQB 5HI5D 1PAMA 2PNDA 4RISL 4NZUL 4YK4B 4CADB 1TZHB 2FHFA 1B2WL 4GW1B 4HF5H 1BZ9A 2GK0A 2ZG1A 2Z31D 5E6ZA 4M1CC 3QIWA 4WI6A 3CUPA 5LXGH 4ZQKB 1U8OB 5IEKB 3EDDA 4PPTA 5GGTH 2WIIB 3FB6B 5E03A 3TIEB 5HHQA 1R6VA 4OKVB 5DZNA 3TO4B 5C9JB 5F6HJ 3WS6A 2MTPA 3UJTH 5JDJA 4JKLA 3L3KA 4PGJA 4KRLB 1URLA 3KPPB 4N90E 2VE6B 5SWQA 4P4KD 4UOJA 3CU1A 4NKDB 4MQSB 4HMCA 5ISZB 4XNXL 5D7JC 2WZPD 2NNAB 4I18B 2BNRD 2P5ED 1U41A 3QQ4A 2XACC 1VADB 5E2WH 5ICXA 3UTTB 3ZKMD 3WCYA 1P6AB 1I8KB 4QGYA 2F19L 4JFYA 1JYXA 1E6OH 1KPUB 3IGAA 4N0YH 1PX4A 5CUSL 5EOCJ 4JO4L 1AP2A 4YX2L 1Z9LA 4KMTL 4YAQB 1D5IL 4QT5A 1B90A 1RUAH 3T2PA 4JPKL 4YEEA 4P2QB 3AB0C 4H25A 4QRPB 3RI5F 1NH6A 3HHRB 5DK0B 1KJVA 4FABL 4R4FH 4M6OL 2VOTA 2E27H 4M6AA 4F8QA 3RVWC 2FYYB 4PJFE 1I9IL 5D5MA 1ZGLA 3PGFL 4FMKA 1JZ3A 1BX2B 4GQ9L 2G5BA 1HSBA 1A9EB 3S88H 3H6JA 2DQGH 4HS8H 1JGEB 1OGAE 4R0LA 1EA9C 1G7IA 2IAMD 4PR5A 3MACH 4JVWA 1B6DA 3P30L 3H3KA 2Z8WC 3CK0L 3H2WA 1F90L 4TSBH 4Z7UF 2B7DT 4ZFGL 5ETUB 2Q87A 2ADGA 3K3QA 4LSTH 1BD2E 2NZIA 2Y6SC 3GEWB 3LMJL 1RIVL 3PWVA 1U8QA 4P9HL 4EZMA 5CCKL 2AXFB 3TJEH 4O5LL 3BKYL 2AEWA 4KHTH 3BPLC 3GKZA 2BXYA 3IFPB 4JB9H 4U1SB 4M9OA 4Y16A 5C71A 5IW3A 4XP9L 1A5FH 5CINL 2QQNH 1FNSH 3D2UB 3NCJH 5IKCA 4XVSH 5E7FA 1DLHB 4PGZA 2BSED 3MRNA 1RZGA 2MWCA 1FGVH 4FXGB 5KVFL 4L5FH 2AKRB 4X4YA 5AWNL 4TTDD 1I9RL 1KB5H 1KCLA 1JFQH 5GISL 5J1AB 1LNUA 2P8PB 1SMOA 3QCUH 2HWZL 4N1CA 3BN3B 3KPNA 3MLZH 3OXSA 4I3SH 1N5AB 4LHQB 1XR8A 2Y5TA 2DM4A 3QIBC 1NMAL 5E2JA 1CYGA 2ZUYA 3HZMA 2BHUA 1BFTA 2WSKA 4Y0GA 4M61B 5ANME 4OLWH 1L6XA 1SEBB 4O2FB 4OCWL 5SWZD 2V7HA 2YUWA 3NH7H 2GIYA 2VERN 1WC7B 3BJLA 4ELKA 4H1LB 5CILH 12E8L 5T1DL 3WEXB 4EIZC 3QHFL 1CXFA 1ONQA 3KAAA 4FQ2L 3V0AC 3W82A 4S1DD 3QDMB 2ZUWA 3I6KA 2JCCA 4AMKL 1KJMB 5L7XH 2LAGB 1OARL 1R5IA 1TNNA 1NFIB 2ESVB 4W6YB 4HQQL 5IVOA 5TF0A 5CS7A 1KIRB 4MNQA 4OIAA 3IXTB 3PABB 4N0UE 4CADA 1TZHA 4GT7A 5J12C 3O6FB 1ZK9A 2D2OA 5LVEA 1JHTB 4GW1A 3S36L 1T0MA 5IBLD 2MFNA 2B5IC 4OZGE 3NFPA 1U8OA 2XTJC 1QRNB 5IEKA 4OM0L 1NUDA 4Z77B 1GGBL 2WIIA 2E5EA 4KY1H 5CEYB 3FB6A 3QUZB 4Y1AB 3TIEA 4CAGA 2E3VA 4OKVA 3TO4A 5C9JA 5CHNB 3VI4E 3KPPA 3FN0H 4QKXB 2VE6A 2ENYA 4NKDA 2FJHB 2PF6A 5GGRB 4P5MA 5D8JL 3UJIH 1IFHH 1T89A 1PJ9A 1QSFE 2NNAA 4I18A 4PJ8B 1EHNA 1EEQA 3FAXA 1VADA 3QUZC 5E8DH 3UTTA 3DUSB 5H2BB 4IDJL 2EO9A 2E6PA 1I8KA 3NACL 4I1NB 4J6RL 4I0KA 4Q9QL 5J06A 1GGIH 4X6CB 4X6EA 3QB7C 1F42A 3CSGA 4ZXBC 4P5TC 1KPUA 2Q6WA 1OCWH 3HRZB 3ROLB 4TPRH 1C1EH 1I1AD 3GSVB 3MJ9H 2MOVA 4G6AC 3FQNB 2HT4C 4YAQA 3O9WD 1RQ5A 1RU9L 4HAFA 2NQCA 4P2QA 4QRPA 1T6VN 3CX5K 1IZJA 5DK0A 3C09B 4X6DE 2YUXA 3GMRB 4PJIE 1LE9B 3UJJH 1J86A 3MXWL 3HAEH 1T7WA 3KS0J 4GAGH 4XP5H 1FC2D 2AQ3A 2EH7L 5SX5K 3NZ8A 1A9EA 2D31B 2VH5L 3BKML 1HYSC 4WFHE 1GCFA 2FX9H 3LHPH 4LVOB 1JGEA 1ND0A 3E3QC 1HH9B 5JHLH 4NQEA 5TFSL 4POZC 2O61B 2GI7A 1DR9A 1TTFA 2FEEI 1JIBA 3PQYD 1XIWB 1C08B 1G6RL 1YEDB 1K5NB 2HMID 4JEGB 2H32B 5ETUA 3X3FH 4DGYL 3QO0B 4M4RA 3VXPB 4ENEC 2Q3ZA 2NY3B 2VDLH 1UEYA 1FYTB 3JV5A 4X9GA 4Y5XA 4KDVA 2VXSL 2AXFA 2D7TL 3F65A 3OAUL 5HVGB 1DBBL 3HG1B 4MDIB 3R1GH 4G6JH 1XGYL 2VDRL 3IFPA 3KLHC 2Y9RT 1BZ7B 4U1SA 3DMMD 4ODHH 3E0GA 4UT7L 4MJ2A 4YXHH 2Q8AL 3D2UA 4PJDF 5AEAA 2APTA 5I1EH 1OAYL 4FXGA 5EZIL 5LWYH 5MEQB 2AKRA 4OIIL 1CDYA 4IS6B 3P4MB 2K3TA 3MRPB 4PB9H 5FO9B 4WU5B 5J1AA 5FB8A 1SJHB 4WW1B 2AJZB 5ACZB 2P8PA 4JM2D 3X14B 3G5ZB 1DCLA 4RFNC 2XTJE 5SX4I 1UM4L 3RA7H 1N5AA 1CICD 5JDSB 4UBDC 3ULVF 1DQDL 1KBGL 1OSZA 2JJTC 2M26A 2YKLH 3UPAA 4YFLF 3D6GA 2RHEA 1U6AH 2ILLA 3VGFA 4NM8H 2QHRH 1SEBA 1N6QH 5E9DB 4O2FA 3QRFM 4CVUA 5JPNB 3MFGB 3F7QA 2H1PH 2NZ9D 3OAYK 2W0LA 4H1LA 2RQ8A 3IFLL 1T2QL 4JFHE 1XF5A 2PETA 4NN7B 5FHAH 3WEXA 4Y5YB 4W6XB 5IV2B 3K2UL 3QDMA 1J8KA 2N7AA 1HDMB 1KJMA 2LU7A 4QNPF 4L4VB 1JZ5A 1JF5A 1NFIA 2ESVA 1ZSDA 4WUKL 1QACA 3QDGE 4EUPH 1KIRA 2VZUA 4NHCH 4OM1L 2YMXL 1NCCH 3HI1B 4ZOBA 5TE6L 3IXTA 4FA8A 5HI5C 3O6FA 5DJXB 1JHTA 5C0RL 5FXCH 4WU7A 3HFMH 1NAKL 2Z31C 4XWGL 1X3DA 5H35B 3SCMB 1QRNA 2VLJB 4Z77A 2DMKA 5CEYA 4Y1AA 5SX5H 4JFZH 4JM4H 1J1XH 3LD8B 5SV3A 1LK2B 3WD5L 4DCQB 5CHNA 5DJYB 5FFLA 4IRZL 5IVXB 4L4TB 4X7DC 1QPPA 1MH5B 3D18B 5TPWL 3E3QE 2FJHA 4P4KC 2JLLA 3IU4L 5GGRA 3SDDA 4KJQD 1WT5C 1VPOH 5ESVB 3V8OA 4Y4FB 2VDQL 1CLOH 3IS1X 4ZD3L 4PJ8A 5JW4Q 4QEGA 4KXZH 5E4IA 2DD8L 4PB0L 2HKHH 2IPTL 3OKYA 1F4YH 5H2BA 3WIIL 3LD8C 5LQBH 2LVEA 1RUQH 5IFAH 3ZKMC 1JYNA 5D71L 1G9EA 3WV0A 1AI1H 4X6CA 4QHUB 1EHAA 1IC7L 3BZDA 5IJKA 4IBLT 5HGHB 3KPSD 4NQCE 3HRZA 3ROLA 1JUFA 3G04B 3GSVA 4Y4FC 3T65B 1S9YB 4WTZG 3MLXL 1T7ZA 3C60B 2AVGA 2HRPL 3BP6B 3H3BC 5IF0B 3MLSH 5BW7A 4X7FC 1TJHH 1SM3H 3GMRA 3CXHK 5A3ID 1LE9A 1Q9LB 2I9LB 3GBML 5IMKB 2WLYA 2FB4H 4X5LA 3GSNB 4ZOCA 3TCLB 4LEXL 2D31A 5C0CB 3WIHA 3ARXA 4K3EH 4JHWH 4NN5B 4IJ3C 2IWGA 3KDMB 1T03H 5IB2B 4HBCL 3K1DA 1HH9A 1CK0H 4GMTH 3P4LA 1O7VA 2UWEB 3KLDA 3LKQB 2O61A 4GRWH 3IDGB 2NTFB 1XIWA 4FQ1L 1C08A 5FA3B 1K5NA 4Q58C 4U7MA 2H32A 1R3HB 5KTEL 1JL8A 1YNLL 3QO0A 3TIDB 5E1AB 3VXPA 3ULVD 3VD4A 2IBZY 3OAYH 4PJCE 3VE0B 4YE4H 4HKXB 5H94B 1FYTA 2ICES 4ONHB 3QIWD 5I1JL 3HG1A 4MDIA 2C9AA 1JGUH 2DJUA 4RMRA 2APXA 1BZ7A 1SY6H 2E7HA 5IHLB 1CFVL 4WDIB 5J8OA 1VDGA 5GS1A 3CAFA 1CGTA 4LAQL 1ACYL 3SGEI 1U2CA 4U31A 3FCTA 1A6TB 5MEQA 2OK0L 3JV4B 4IS6A 3P4MA 3BUYB 3FZUD 3EIFA 4CBPA 1CDHA 5FO9A 4TTDC 4WU5A 3RY6A 2IGFH 1SJHA 2DLHA 4WW1A 2AJZA 5ACZA 3X14A 3G5ZA 4O00A 4M9PA 1HKLL 3U0WL