1RUAH

Crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
221
Chain Sequence
RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ruaH01
2VB5A 1JRHI 1CCZA 3IFOA 1V3KA 4JHWH 4JFED 2GJ6E 2L7UA 3SO5A 4KK8D 1N4XL 4KKLC 4M9OA 4XCEB 1F5WA 3TV3L 3KYAA 5TPWL 3HZKB 1F8TH 3B5TA 1XGUA 4ZPVA 4MA8L 2Q8BH 4K8RC 4U6YA 2V7NA 4MDJB 2C3HA 3QUKA 2R1XA 4Y1AB 3TBTB 3HFMH 4G8GA 1E4KC 3FOMA 3R1GH 5BOZG 3F5WA 3NMEA 5E99L 5IHUL 3LIZL 4R90H 3OJ2C 4XB8A 3D5OF 4JO4L 3DUUB 4WHTB 3L1OH 2D0FA 5AD0A 3JWNC 4J4PD 1HHIA 3OGOE 1QOKA 1ODAA 2XKUA 5GPRA 2GCYB 3KG5A 4KJPC 3LKRA 1R3LB 3QXDB 4I8DA 5TF1L 5ITBL 1ZVHA 2ED9A 2CSPA 4N90E 4NZUH 4E41D 5E8EB 1G0DA 3VE0A 4G8EA 3KYKH 1YDPA 5E03A 4P23B 1X5XA 3KDMB 2FRGP 1NC4A 5DRWA 4MJ6A 3EFDL 1J86A 4NRZA 5E00B 5C0GB 2Q20A 2WLZA 3H3PH 4PFEA 5JQ6L 2J8UA 5DJYA 5JO5B 4MXWL 1QR1B 1U3HD 4IIQC 5SX4I 1T2QH 1L0XA 4HW6A 3VA6A 1G6RB 4MSWA 4F3FA 4JPVH 2JB6A 1X5FA 3VMPA 3TFKC 5TGBB 2HFFB 1KTDB 1ZSDB 2VZTA 5DUMH 3K2MC 1NCCH 3MBEB 1I7UA 2ADGA 4OQTH 4PP1D 2DM3A 1AR2A 4Z0XB 1YPZA 4NJ9L 4FZEL 4ZS6D 3B9KC 1D5XA 3MJ9L 1FO0H 2WQ8A 4M5YH 4ZD3H 5C70A 3JSSA 3BIAX 4WFEE 3U4BL 5C07B 1FGNL 2NY2D 4PTTB 3MUY1 1YEGL 1HH6A 4HBQA 2R9HC 2HT3C 4HPOL 2MQ3A 4C54A 4Z5RA 2D31A 3T04D 1AQKL 4Z95H 2B1AH 2I5YL 1YN7B 2B4CH 3T65A 1F4XL 1WFOA 1T66D 1EEQA 5HYJA 3ET9F 1B2WH 4Y4FB 4OZIA 3DMMB 1Z5LA 3OF6A 4N8VB 5KANG 1LE5B 2AGJL 4WY7H 3V0VA 3BZDA 2NTFA 4W6XB 5DO2C 4X7EC 5CSZA 3QUYC 5EZJA 4YAQA 4KY1L 1Z9MA 1AXSA 1TVHB 4LFHD 4KVNH 4MD0A 3QIWD 4BZ1L 3BVNA 3AM8A 3HMWL 5GS3A 2NX5A 5IVOA 3J8F7 1Z6JT 4HF5H 1IM3A 3KXFB 4JFYA 5TDPB 4DFIA 4XPAH 5F1IA 3SJVA 3UPRB 2P8PB 2ESVE 2XTJD 3DIFB 4XP6H 1U8LB 2FJFA 3H0TA 3VXOA 1XF5A 3VH8G 4KVCL 4M93B 5F89A 4M7KH 1VKXB 3U0WL 5L2KB 1QSFD 2BK8A 5D1ZD 4DVBB 1ZANL 3HPLB 3NCBB 3CFDA 4RNRB 1IAMA 3HNVH 3WLBA 5HHQA 1Q9LB 3VD5A 1I3UA 3DVGA 3SDDD 2EKSB 4JB9H 3RPKA 5AG9A 1RZJC 2IPKA 1L7IH 1NUFA 1UB6B 4YZFF 3D0VB 5HHPB 1NQBA 5SV4A 3NCFB 2DICA 4QKXB 3H8NA 3WDIA 3GMOA 5CMAA 2JTDA 2R4RL 4X6CB 3SPVB 1Y0LB 3NCCB 4CGTA 2VITA 5IW3A 1OAUH 1X4XA 5KS9B 3PJSB 1S7TB 1VACA 2GYSA 5FUZL 4NM4H 4MAYA 4XNZC 3OZ9L 1DQQA 4Z8FL 5BQ7B 3GJFK 1FVDA 4HXBH 3S36X 2AABL 4BSJA 1IQWL 4QHNB 1K8IA 1BJMA 5K9JL 1JFQL 3I2CH 3UROR 2CUHA 1JHTA 4EDWH 5KZCD 1PG7L 2EDNA 5FYKD 1I3RB 1MFBL 1PYWB 3FRUA 3ZKSD 2P5EB 3MRIB 4PRPD 2NY0B 4BZ2H 3ZSTA 3TVMB 2XYCA 4IOSD 5FYJU 1WZ1H 4XMLH 1BEYH 4C56A 2R0LH 1R5VA 1WV7T 4HFWA 5ESAA 1TZGL 1I9EA 3V5DB 2HA1A 4E9LA 3V6OE 4PGCA 1R0AL 3KPOB 4TTDD 4HKXB 1N3NA 2EYSA 4N1HB 4NP4H 3IGAB 5FAAA 4NQEE 4EOWL 2OZ4A 5IKCA 1S3KH 3AREA 2DIAA 2VLRA 3V52L 3WS6A 4PJFF 1DBAH 3QEHB 3OAYH 3X11B 1CZ8L 1EFXA 5D6CB 3G5VB 5C7XH 1S9VB 5I19H 4G8GD 4Y4HB 3CFKB 4WW2A 1I7RA 4OLWL 4DAGH 3C2AL 4YPGA 2EC9T 2WK2A 1F4YL 3ZTJG 1I9IH 1KIUA 4EUPB 5AZ2H 3FB8A 3V8CA 2XRAL 4HPYL 5EZLA 1MHCB 4NUJA 3FQRB 4ZSOA 1R3IH 3CLFH 3VRLF 5D7IE 4P4RA 1E4WH 1G9ML 2CD0A 1BD2A 4CVWA 5BS0A 4QF1A 1VFOA 5C0FA 5FUCE 1BZ7A 3MBEC 3ARFB 3SDAB 4ZTPH 3UTSA 1IKFH 5I30H 1QHOA 1RFDH 3CVIL 2DRUA 43CAB 2DQFB 4M4PA 5IMMB 2L7JA 3VFMA 3RWJB 2DQHL 1JGEA 2FR4B 4WCYH 2VABA 3WNLA 2EICA 5TQ2H 1XF3B 3E3QE 1H3UA 5HHOE 4G8FA 4PJ7F 4S2SA 4Z7VB 1FCGA 4ONGH 5T1DH 5MEPA 2CK0L 4OCRH 4PJDF 4RMVA 1N0XL 1VFAB 5DJDA 2GFBA 4MQ7B 2IPTH 3PHQA 2LVEA 2D0HA 3KNBA 5FYJL 4F7MA 5DS8A 5C3LD 5EU5A 5CP3H 1R3KB 1KGCE 4Y4FC 2IQ9L 5D71H 3MRLA 4X6BB 1FV1A 3CZJA 3TP4A 4FA8A 3K4AA 4PJFE 1QD0A 2WV3A 1VFMA 5TDOA 3V5KB 1BFOB 5D7KE 2FEDC 3GSOA 2W9EL 5KAQG 1IEBA 1GGIH 4MNQE 4WDIA 3GI8H 4HBCH 5JPMB 3SBWC 1FSKC 1SVCP 3KPPB 2HMIC 1O7VA 1QO3A 1Q1JL 2RHEA 3OKLA 3BPOB 4L3CA 3LQAC 4G8IB 4JFDD 3VRLE 5HYJD 5CEYB 3I6LD 1DJSA 2F54D 3IAGC 3MRNB 4KKNA 4WI6A 4X9HA 3GSNH 2AVGA 1TTGA 4QRUB 1DQLH 4KKBD 5DD5L 1T7WA 5GS0L 3MV9E 4NHCH 4JQXA 1AD9B 5T3ZL 2APBA 1DLHA 5E4EC 3PGDB 5FHBH 5HYSA 3QFJA 1CF8H 2FO4A 1XCTB 1MCOL 4YHPB 2NX5D 2AJYH 1FZJB 4EVNB 1GIGH 2VIRB 4K23H 1U8OB 2GQHA 3FTGB 3PGFH 3BIKA 2NY5C 4XBEH 4K3DL 2PO6C 2R8SL 5DDHB 1VSCA 4ODHH 1H3GA 3RPIA 4PJDE 1K3IA 4HH9A 2VISB 3BRGC 3CD4A 2X4NB 4M1GL 1FZMA 5A2FA 4ZTOH 4M3JA 4H26B 3G5YA 5F44A 1EDQA 4KRMB 1JPGB 1SY6H 1EJOH 2ZUVA 1IEAA 5IQ7L 2NY1D 2LTQB 2OLDA 2E6PA 3I6GB 4MNHB 3WV0A 3EGSB 3E8UH 3U4EA 3T1FB 1RUKH 2B39A 3F6LA 4LCUA 3LQZB 3MROA 5FGRA 2EE3A 3D1MC 5JDSA 4U1GC 2NY0C 1CL7L 3TVMC 1LEGB 2OM5A 3S3SA 1WAAE 1RQ5A 1I85C 3MJ8A 1SYSB 3VFGL 4XPFL 1E4KA 3AXLA 4LPWA 4NT6B 4ZFGH 1DQJB 2VWEC 4Q58C 4MAYD 1YMME 5SX5K 2FJGA 5CBAA 4PY7B 1MVUA 2F5BH 3C9NA 3WLWC 4EJ1C 4M6OL 2BNUB 2A9NL 2ICWB 1S7UB 3QDJE 2DLHA 2X7LA 4CL7A 1JNHA 3U82B 1BVLB 2CH8A 3ZO0A 3FQWB 1AFVH 1DCLA 1T22B 3QEGH 4I3GA 1M7DA 3SKJH 5IW6B 2EEBA 2IANE 4N1EA 4G6ML 1CIDA 4O58L 2FYYA 1FL6B 3BKYH 3RNQB 3VFUA 4QRTA 5J1SC 2OP4L 4WFGD 2SEBB 3VXRB 5KSBE 3QBTB 4C56D 2KQMA 4OM1H 4YGAB 1I1FA 1MCPL 4IDLA 1YECH 3B8SA 4GUPB 3BXNB 1CDYA 2NY3C 5GGVH 1GGTA 1A22B 2ZSWA 4RMQA 5EUOF 4N0UE 5J56B 1HZHL 5GRVL 2XIDA 1YN6B 1BOGB 3F7VA 4NQDE 3RI5F 4LBEA 4O9HL 4FQJL 1TJHH 3MRGB 2VLRD 3QXAB 4WFFD 2DI7A 5GSVA 1EVTC 4Q9RH 5DD1L 1GC1L 1EFXD 3SO3B 3ARFC 3SE8L 3MJ7B 1UB5A 4XI5D 2BVUA 1M05B 3ARPA 3OJMB 3OKNB 1RULL 3S88L 4ENED 2WSKA 4RZCB 1CU4L 4KJQC 3BH8A 1KIQA 2EO1A 4F7PB 4OGZA 1HDMB 2ZG2A 5DLML 2XKSA 4JDVA 3LVEA 1WFUA 3I9GL 4PD4J 1T2JA 1IAIH 4MJIB 3QUZB 3B9KA 4JZJB 3B4NA 3KPNB 4XCFL 1MLCA 4NO3A 2VXQL 3BJLA 4JAMA 5IG7B 1DL7L 2C4FU 5C0RH 15C8L 5T1LB 3MRJA 2Z92A 5D6DC 5JIPA 4XPTL 3GJFH 1JN6A 2ZCHL 3P77B 1BD2D 4RWYL 5BS0D 2UZIL 2UVEA 3KPSE 4PYHA 5I1EH 5JMOC 3GK8L 5FM4A 6FABL 5C0CB 3Q5YA 3PWNB 3ZTJH 1J0JA 3RWIA 3QR2A 4E5XA 3DX7B 1CFSB 4NQUA 5JA9A 1WITA 5EU6B 1MY5A 3ECBB 3IB4A 1BHGA 2PCPA 1QQDB 4N68A 1OM3H 5D8JH 4HWBH 4O51B 5D7LA 1CGSH 1AGCB 3OAZH 1YNTB 1YEHL 2V17H 3BI9X 2QHRL 3MRMB 1I8IA 3OG6B 4W4OC 4CDGC 4GBXC 5IR1B 4JFOA 3MLPA 2WBJB 1A7PH 3BPOC 3TBSA 5AAWA 1BLNA 3QNYA 1I7ZB 4JPKH 5ETUA 3TCLB 3QRGL 1FIGL 1U91B 3JTSB 1BPVA 4UT7L 4DKFH 2AK4B 5EUOE 4LMQE 2IALA 1U92A 4R4BA 1LMKA 1LO0L 3VMNA 5CZXC 5CLWA 5I1IH 1X4YA 1LNUA 2V2XB 5I1AB 1ZS8B 2VO5A 3HAEG 4HFUH 4F58L 3TO2B 2R1YA 4L8CB 2YN3A 2A6DA 3DYOA 2D4DA 1I8MB 4YBQD 4ORGA 4XWGL 3G6JF 3T0WA 4I0PC 3WE6B 3H9SA 4MJ5B 4ZYKB 3DO7A 5I1CL 5DHVB 2PW1B 5J6GB 1QSEE 5GGQH 5TE7L 1QFWH 4PRHD 1BFVH 1V7NH 2P5WA 4WU5B 3MOAL 2ORBH 3ISWA 5EOTB 1MRCH 3H9YA 1HXYB 5J89A 3I02B 5HGAA 2QSVA 3OBAA 3GMQB 4PJAA 4ELMA 4RX4A 3BP5A 3KPRA 1E28B 4TUKL 2CKNA 4HIEB 1K5NA 4CN4A 4J8RB 4Y16C 4BK4A 4ACPA 3QFJD 3OKEB 4DZ8B 2D03L 3QB7C 4L4TE 1MIEL 1X7QB 4GXUM 2GK0A 3QDGB 4QCIB 2P43B 5FUOL 1AP2B 4G9DB 1BQLL 4XCEA 5JXAL 2V5RA 1I4FB 1JRHH 1P4BH 3VXNB 4W70A 4MDJA 4Y1AA 3TBTA 3MLVH 4RISL 3VI3F 2YRPA 4OM0H 1FVEB 3MA7B 2EDXA 3C5SB 3UJJL 3KLAB 3LMJH 3OHXB 1JGDB 1AE6L 3Q5TA 3I50L 3DUUA 3QHFL 4FQ1L 4WHTA 1TENA 2YD5A 5HHMD 2HT2D 4GAYB 1A0QH 4A6YB 4R4NC 3ULUC 1L4IA 2OL3B 2GCYA 4MA1C 1R3LA 3X12B 3HZYB 4U0RB 3CFBB 3VI4F 3C60B 4ZO9A 3CDGB 5I1KH 1F11B 3EKCA 3G6JE 4RFNB 4P23A 3KDMA 5HYQB 5L8KB 3O2DA 4JFEE 3U7YL 3P0VH 3VFPB 5E00A 1MLBB 1YUHA 3SEPA 5C0GA 1WISA 3WDJA 3BPLB 5IV2B 3ILPB 3WXWL 5JO5A 4FOMA 1QR1A 3FOLB 3IYLW 4TVPH 1J0ZA 1QHPA 2VLKB 4Y0GA 4FNLL 1URLA 1WLHA 5J9PB 4PJHF 1G6RA 2CO7B 4H0HB 4NRYB 1VGEL 4YQXH 3BGMA 5I2IB 5SX4H 2CMRL 4P46D 5HYEA 5EOQL 5TGBA 2HFFA 3RU8H 1KTDA 1ZSDA 5CUSH 1JWUB 1I1CA 3IFNH 4ZS7L 2VLJE 5MEND 3MBEA 3QDHA 3F7PC 5CFHA 1OARL 4OD3H 4NKOB 4Z0XA 2EYRB 5GGTA 1A3LH 1FRGL 4OD1L 2V6HA 4JZJC 1TZIB 2X2YA 5T3XD 4LLMB 1O5DT 1T1XB 3OB8A 4PGDB 4X7SH 5C07A 1Q94B 2DDQH 1A6VH 3OR7B 1EHLH 3VI3E 4PTTA 2RIKA 4ERSL 5ISZB 5HVHB 3V0WH 4NWUL 4U1IB 4LRNH 1F6LL 3BPCB 3G5ZB 3MODL 5L8JB 1UG9A 5GS0D 4KV5F 3F8UB 2J7LA 4YXLH 3TJEL 2EXYD 4OCYH 2FX9H 1EUTA 1OB1B 3DMMA 3QQNA 5SWZB 3U30B 4N8VA 1S9XB 3VI4E 4IMKC 4AZ8A 2BDNL 3T1WA 4LVHB 5SX5H 2NY6B 1RJLB 5E08H 1RU9H 4N0YL 4KZDH 3X3GL 4LDOB 4QYOB 2PUQT 4HSQA 2H1PH 1UXWB 4PJHE 4MB5A 2B5IC 5C0EB 5TDPA 4LLVB 4ZMAT 4KHTH 4POZC 4YXKH 2ZSVB 2YA2A 4OF6A 1GPOL 2P8PA 1UZ6F 1LEIB 4HJGB 4LSSL 1MRDL 5D7LD 1U8LA 5D1QB 4OI8A 4F9PC 5E8DH 3RWDB 1UA6L 1VKXA 5AWNL 4FQ2L 2DM7A 3DRQB 2D7NA 3ARVA 5L2KA 4DVBA 3BEVB 3VWJB 3VD4A 5DMKB 4RNRA 1JF1B 1Q9LA 4MQTB 4FQXB 4LNRB 5I8OL 1YZZA 5IFJB 1A8JH 2EKSA 1NBVH 1KEGH 2ZUUA 2Z9TA 1W0WB 1Z9SA 2NXYB 4GS7B 1KT2B 1UB6A 5DJ0B 3ZHLA 5D72L 5HHPA 1YEDB 3O3BB 2V5SA 5FXCH 3VG0L 1A1NB 4E42B 3SPVA 1Y0LA 2A74B 4CUCA 4GQ9L 12E8L 4KV5E 5KS9A 1EEUA 2GW5A 2ITDB 3PJSA 5HGDB 1S7TA 3TGXA 4PJIA 2XTJE 2B0SH 3JVGC 4KQ4L 3H9SD 1D9KB 3TC9A 4UTBL 2FSEB 5E5UB 4QHNA 4AL8L 1NL0H 5D7SL 5IM7B 1QSFE 4JY5H 3HAEH 3WO3B 3PF2A 3TA3C 5FCSH 3IDGB 1I3RA 4X8JB 4FMFA 5I15L 3FO1B 1PYWA 2X4OA 4NRXB 2Q8AL 1JWSA 2P5EA 3X17A 1LEKB 3MRIA 4MB4A 3TVMA 2VSCA 1S78C 1A6WL 1FL3B 3KPRD 3GHEH 1JYVA 3V5DA 1N0LA 2EDHA 3KPOA 1IM9B 2X9WA 1D5BB 5L2JB 1UZ6E 3V0AC 1LQSR 3S37L 3BE1H 3BYTA 3VWKA 3IGAA 4PBVC 4KTYA 4U0RC 2C3GA 2YPKB 2D7OA 4RFNC 5F7UA 3X11A 3CX5K 1BM3L 1NCWH 5FO9B 5D6CA 2APXA 3G5VA 5CILL 4BQBA 1S9VA 3HKFA 4TRPL 4Y4HA 2VMFA 3CFKA 3ARZA 2ZNXA 3DUSB 3O3DB 5FYKE 4NDMB 2JELH 3MQIA 1Y18B 5A16B 1IBGL 4UAOC 4LL9A 1A6AB 4WTXA 2J4WL 4PRPE 4JHBA 5BMFL 1T83C 1MHCA 3FQRA 1KCUL 1QFHA 1KV3A 5J57B 1T0NA 4D9RD 4Z0BH 2UWEA 3BP4B 2JCCA 2B20A 5HY9B 4MCYB 3QUXB 4YHML 5FF6B 2B1HL 4P23D 4X7DC 5IEHB 1YPZF 3SDAA 2DS4A 1UCBH 4KRPB 4XNUH 4YEEA 2A6KB 43CAA 5KVMC 3AUVA 2RCSL 4N9GB 3O6KL 4CU7A 1GGCL 4RMUA 3RWJA 5E7BA 5BCAA 2FR4A 3EOTH 1XF3A 3HMXH 4PLNC 2AI0H 5LGJB 3HC4H 5D70L 1RV6X 1P84J 4Z7VA 3EUUA 3H3BC 1MREH 4K7PL 1XR8B 5HVHC 3O11B 4I13B 4OGXH 2CIKB 2DB8A 2N56A 3M45A 1N8ZB 1VFAA 4MQ7A 4HUWB 4P4KB 1MFEL 1YEFL 2C1OB 2HG5B 3C8HA 4QXUL 5DF0A 4Z78B 3MRHB 1MCWM 4XNYH 1R3KA 2JKXA 1XF1A 4X6BA 2GTWB 1IGCH 5DMJB 3V5KA 1A4JA 1BFOA 5IUSA 1A7QL 4HG4J 2OI9B 2H2PC 4Y4KA 1AH1A 4LVHC 2J8UE 4PRDB 3IJHB 5JPMA 4ESKA 2D7TH 3KPPA 2P24B 4WWKC 2LU7A 5GJSL 1OTTC 3F7YA 3ZDXF 1CXFA 1MFAH 5FECB 3IDIB 3FN0L 3IKKA 3N1GC 1WIOA 3KHOA 3GSWB 4P9HH 5CIPB 4G8IA 4JEGB 4XC3H 1IGJB 3DMMD 4S1SL 4F2MB 3MOBH 5D1QC 1VFUA 1EBPA 3V4VL 3RZWA 3G6DL 1A14H 3GMNB 4KK6C 4G9FB 1YPZE 4F57H 4UV4L 3VWJC 5DI8B 1AD9A 2A1WH 1YJDL 4RMSA 1AO7A 3PGDA 4M48H 5BVPH 1XCTA 4YHPA 2JF1A 4KDVA 1FZJA 2YS4A 5HHVL 2VIRA 2XA3A 3L3DB 2NXYC 4PP2B 4NO0B 1U8OA 5D5MB 3LH2H 3FTGA 4GRWF 4H0GA 4OFIA 3MRDB 1MCQA 1BVKB 1WSST 2FIRT 4KTDH 3U7WH 5DDHA 4TUJB 3HR6A 5HVFB 4LSRL 2VISA 4XWOC 5DK2A 4JFDE 3RVVD 3MGOB 4R26L 2BHZA 4QTIL 2CXKA 4C59B 4XP1L 5L2KD 4OZIE 3I6LE 2F54E 1KJMB 1JGUH 3EJJX 4LGPB 1D9KC 3UP1A 1MCFA 1YA5A 1JPGA 2FD6L 4FG6C 4KAQH 2G60H 2FIKB 1J1XL 2VJXA 3I6GA 4MNHA 1CICB 3U7AA 3V7MA 4LHUA 5ANMA 1B0GB 2A9MH 1DVFB 1UACL 3PWJB 3LQZA 3M17B 4HWEL 4N5ED 2VR4A 1C12B 4OJFL 4R4FH 1B4JL 5DD0L 4F9LC 1LEGA 3EYVB 3ZDXE 4BQ9A 2HVKA 3W2DL 1SYSA 2XICA 4CAGA 5IHZA 2R0KL 1IC5L 4OLYH 4XP4H 1KULA 1C5CL 2AJXL 2YMXH 3FAWA 4UUJA 3NTCL 4MDIB 1G9MC 2MCPL 3WFEL 5KVGH 5CGYD 3JWOL 2ICWA 1FNAA 5EZOH 1QBML 1LP9B 3WIHH 1BVLA 3PWPA 2X1XR 1MHEB 4XGZB 4AMKH 1VEMA 3MLTB 3FQWA 3BDYL 1T22A 3HI6L 5IW6A 1UWGL 5L9DL 2XI9A 2P5ED 3RNQA 1FL6A 4OFPA 4K2UH 2OTUB 3RAJL 2SEBA 3VXRA 3N85L 4NIKB 5BW7A 2VDLL 2J8OA 4X9GA 4HJ0D 4L8SB 4GUPA 5DVNA 4AEIL 3U0TB 4GRWE 4XVUD 4YX2H 4DUWA 3EYOB 1PSKL 1UQSB 5IMOB 2EIDA 3FONB 4FFWC 3VWKD 2Q86A 3FHAA 5FA3B 1YN6A 1BOGA 3DPBA 2XZQL 3ETBF 5HDBF 1SEBB 3MRGA 1L7TL 2J1KA 3LOWA 1PX3A 4S0SD 3CDYA 4PGJA 4TOYH 1K6QL 1KCSH 3MYJB 4ZFOL 4GT7A 1M05A 2CKBL 4Y4HD 2DTSA 3OKNA 1JUFB 2Z31B 3GUTB 4RFOH 2NYYD 4F7PA 4FQLH 1HDMA 3WKMH 1KBGH 1HOCA 1JPFB 3ZDZF 4LLWA 4GXUN 1P69B 2BRRL 4MJIA 3QUZA 4XNXH 4JZJA 3KPNA 4WFGE 5EIQA 5LQBH 3MLUL 3OSKA 5IG7A 1ZA3B 4HMDA 5T1LA 3FQUB 4ONFH 4XPHH 5HYSG 4TULL 3ZE1F 3P77A 2EYTB 1NLBL 1WCQA 2NR6C 4P4KC 5C0CA 3SDAD 3PWNA 2E7MA 5LG1A 3UZVB 3T3PE 1OTSC 1Q9WB 3DX7A 3ZKMC 1CFSA 1CFBA 2VLRE 4K7PY 5EU6A 3ECBA 3O45B 3AGVA 4JO2L 5K9QI 4O51A 2YR3A 4JFFB 4KKAC 1BGXH 3MBXH 1INDL 3CVHA 1AGCA 2OI9C 4AT6B 4M9PA 1BJ1J 3BKCH 4DVRL 4BZYA 3MRMA 5E8NB 4U1HB 2CDEB 2KKQA 4KROB 1D5ZB 5IR1A 2WBJA 1P5VA 4ZSOE 3V4UL 2VXSH 1IZKA 1I7ZA 4JQVA 3TCLA 9CGTA 1U91A 3JTSA 4U6XB 4AQ1B 2AK4A 2NY4C 4OZGA 2Y6SC 4JRXA 1FL5B 4GW1B 3OKYA 5E94B 2FL5B 2IFFL 5GS2H 1S7QB 1LE9B 5E1AB 5BS0E 5HDBE 4U3HA 1FO0B 5HDOA 5HYFA 5I1AA 4IOFC 4Q2ZB 1ZS8A 2G5BB 1J88A 1MJJB 3TO2A 3UDWA 4L8CA 1JZ8A 4Y4KD 5H8DA 1CFNB 1I8MA 1OL0A 1J1PH 2X5PA 4JR9H 3DBXA 2M8XA 3JWDH 1T6WA 1EPFA 5F1OB 5IEKB 4MJ5A 4ZYKA 1BWMA 3MNVB 5L6YH 3ZDZE 1ADQL 4DKEH 1CXLA 2PW1A 1BQHG 1RJCA 4JN1H 5J6GA 1XR9B 4GKOA 4KK9D 4HK3N 4K55A 2B8OT 1E6OL 3QUMB 3TYFA 4ODUA 4WU5A 3ZE1E 4UTAL 2IJ0C 2NZIA 1NFIB 1HXYA 2BVPB 1QACA 2DQUL 4WTZA 2ZPKH 3GMQA 4MAUL 1KB5H 4JCLA 1NPUA 1CD1B 3TO4B 5FIEA 1E28A 4HIEA 3KS0J 4J8RA 3LB6C 1AO7D 5KJRL 2WLYA 5E6ID 3HE7C 3ULVH 3CXHJ 2QSQA 3PIQB 3OKEA 2YOCA 3P4OB 1X7QA 1DBKL 4OIIH 3KPQB 4X4MA 5DT1H 1JMZA 3QDGA 4QCIA 1AP2A 4G9DA 1CICC 4KK5C 3WHE1 3UTZB 1IAOB 1I4FA 1DVFC 3ESUF 2ATKB 1LDPH 3VXNA 3N9GL 1CI5A 4HUKB 2Y7QA 2Y9RT 3MA7A 4LOUD 3C5SA 4PRHE 3KLAA 1X5JA 2WUCH 3ALXA 2OR7A 3JV0A 1UENA 4JZOB 3T0XA 1BQSA 4NCC2 4YC2B 1KEML 3WNMA 2PYFB 4GAYA 4A6YA 1CK0H 2OL3A 4XVSL 3E2HC 5DJXB 1TJIL 4R7NB 3B8YA 3O2VL 5D7JC 1I9RL 1OGAB 3X12A 3HZYA 1RVFL 4LHUD 3CFBA 3C60A 3CDGA 3QFJE 2AP2A 2P1YA 2X05A 1XCQB 3DOSA 4GFTB 2PYEB 5HYQA 4R8WL 3MZGB 3VGGA 3VFPA 5ALBH 1ZVSA 4OCXL 5KOVC 3LZFL 3VDBA 1MLBA 3U4AA 3GM8A 3O4OC 3LKQB 4JG0L 4L8SC 3ILPA 4XHJD 4P57B 5IV2A 3FOLA 5DGRA 2VLKA 4QNPF 1ZLSH 3HS0A 4IRZL 3QO0B 5BXFB 2MNUA 5F8RC 4NRYA 5GZNC 3VXUD 3MRQB 3PWPD 5GHWL 2F58H 3A67L 5I2IA 1EO8L 2H2SC 2XA8L 4LIQE 2VH5L 1J1OL 2GUOB 3FZUD 4JO3H 4KTEH 4ZFZA 5HHME 1JWUA 1RUAL 2BHUA 2ZWLT 4YDJB 2A6IB 3ARGB 2W9DL 2H32B 2XZCH 2Z31C 3S9DB 3VXRD 4HKBB 4EN3B 3NIDF 4LSUL 4NKOA 4GOSA 1QBBA 1T7YA 4TSCL 5EOCH 4DOHB 3GO1H 3ARBD 3HNTL 4GAGH 1TZIA 5J1TC 4LLMA 3A6BL 1LO4L 1T1XA 1SJEB 5B38A 4PGDA 4MVBC 1Q94A 4B50A 3OR7A 2BSSB 2X42A 5JHLL 5ISZA 4Z7UB 3RA7L 3VFVB 4PJCF 1AI1L 3OKOA 4U1IA 4YHNB 1MAML 3MV11 3BPCA 3G5ZA 2FO1A 4L9LB 2JB5L 4UINH 1T1ZB 2JK5B 4MQSB 4JKMA 4L4JA 3MFFB 2LFGA 2Y06L 3CFEB 1OB1A 1T89C 3KR3H 4LLDB 4LQFH 3QUZD 5MENE 1S9XA 3IFPA 5J1AB 2P44B 1MFCH 1KXTB 1SVZA 3AB0B 1CWVA 5BV7L 1RJLA 4FFZL 2CQVA 5F1SA 1J11A 3MXVH 3TT3L 5LGHH 5T3XE 3WN5B 4PB0H 3LPGA 4YXHL 1Z2KA 4YPJA 4QYOA 5HI4C 4QNPE 4APQD 2R0ZL 1MOEA 2QQKH 1UXWA 3GRWA 4PJBF 3ZTNL 2W0LA 3S35X 1YQVL 4LLVA 1ZKAA 3OAUH 1J0YA 2CRYA 2BVEA 2ZSVA 3DYPA 1LEIA 4HJGA 4PLOB 4NHUB 3CGTA 5D1QA 4MMZC 2VDOH 3RWDA 3C2SA 2AEQH 1HEZB 3PP3K 3NIDE 1ZLWK 3BEVA 3LEVL 3VWJA 5I17B 2WBJD 1PBYA 4JKLA 5DMKA 1JF1A 4JJHA 2I9LB 5I18H 1MCJA 4FQXA 4LNRA 4KQ3L 1RJZB 2AK4D 4K7FB 4NCDA 4JRXD 4XVTL 2YD7A 5F96H 4UT9L 1BMGA 1W0WA 3H9HB 3NH7H 5DJ0A 3UJTL 4JDTH 1YEDA 4XAKD 1TPXB 3HC0B 1DFBL 3O3BA 5CZVH 3PXHA 5TJWK 1A1NA 2A74A 2EEDA 1FAKT 5CJ8A 1AGDB 1OSPL 5HGDA 5E2TL 3I3BA 3VD7A 1VDGA 5D7LE 1QYGL 1D9KA 5D2LF 4K8RH 1MCWW 1X44A 2FSEA 4HIHB 3P73B 1KJVA 5IM7A 1WGOA 5HDQH 2W38A 1KTLB 4L5FL 4QXWA 4X8JA 2DL2A 2EDOA 3FO1A 4NRXA 1LEKA 1KELL 1IVLA 3WFBH 1ZHKB 3BWAB 1DQTA 5B22A 1FL3A 2VXVH 4H1LH 3NFSH 5DMIL 5KN5A 2WUBH 3RVXD 1IM9A 3L5JA 4U6VL 5L2JA 3NCEB 3QDGD 2X4UB 3RFZC 4C4KT 1S7XA 3H9SE 1T2XA 1UZ8A 5ADOL 5E56A 5T5NF 5FO9A 2ZOLB 2FB4L 2NW2B 1RUPH 1UH3A 2E6JA 4N8VG 2ADFH 2ZKHH 4G5ZH 3DUSA 3O3DA 1RJYA 1J7VR 4G6KL 4WI5A 2XKNB 5KVEL 5A16A 1BIIB 5F97E 4FABH 3SGJC 5I73B 1KN2H 2O5XH 1AXTH 3I84A 1CGUA 4ELME 3ALWA 3JXAA 4FHBD 3VH8B 3KPRE 4YUEL 1CDCA 1IARB 3RL1B 5LAXB 1QA9B 2HRLA 3BP4A 2EXWD 4D94A 3C60D 5HY9A 3QUXA 3K1DA 5FF6A 1X3DA 3ARGC 4I48B 3B5HA 4XCCL 5IEHA 5K9QG 4WUKH 4HJJL 5D2LE 4XAWH 4C58B 1HSAB 4YDKL 2A6KA 1HYRC 1QFUH 4UIKL 2VLKD 4HIXL 4U1SB 1YNLL 1MEXH 2Z8WC 3CUPA 1MJUH 4QY8B 4LSVL 3GSXB 5LGJA 1WEJH 2WWMD 5DR5H 3FB7B 4D9LL 4UT6L 7FABH 2OMNA 2BZDA 3O11A 4ODXB 4RGNB 4LVEA 2CIKA 3PL6B 1N8ZA 4WI2A 4JRYB 4R2GB 3IJYB 4HUWA 3REWB 4D9RE 5DA4A 5KVDL 2HG5A 2C1OA 3O2WH 4Z78A 5IB3B 3MRHA 1L9MA 4U1KB 2BNRB 4HS3B 5I6XC 3LKSB 1FFQA 2GTWA 1RZFH 1AJ7L 2XN9A 4EIZC 3FT3B 3AB0C 3C6SB 4XMKH 2VDNL 3IJHA 5ISZD 1P6AB 2OTWB 2P24A 1SM3H 2OJZH 4XPGH 1XGYL 4M1DL 4BQ8A 5FECA 1QEWB 2E7BA 3IDIA 3GSWA 3MO1A 5CIPA 5B3JF 3UC0H 4NWTL 1MWAL 3QT2A 1OLZA 4LSPH 4HWZA 3MLWL 1B0WA 3NCMA 3AVEA 4F2MA 1Q0YH 2Q8BL 3MLRH 2NTSP 3ARDC 3GMNA 1PEWA 5LWYH 3QPQD 1FDLL 4G9FA 3OWEA 3GJFB 1RZJH 1NDMB 2NY6D 3BZFA 4PS4L 2XPGA 1CR9L 5DI8A 2DBLL 3UXFA 1TTUA 3SQOH 3ZZ1A 3CSGA 3BO8B 3S36L 2JE8A 5F7KC 5KW9H 1RURH 2O61B 1UKQA 3LV3B 3PV7A 1SHMA 3L3DA 4PP2A 5D5MA 4YHLH 3MRDA 1EUUA 4NZUL 1BVKA 4O4YL 5CINL 3Q5OA 4TUJA 2W0KA 5T1KD 4PJIF 1DE4B 3MGOA 4U0QB 2OXHA 3SDYL 3CCHB 1DANT 4Z76A 4EUPG 2H3NB 1KJMA 4L4VB 1ZLUH 5F88B 1FYTB 4FQXD 5B4MC 2Q3ZA 2FIKA 4P2RB 4JPVL 4J3XA 1OAKH 4KZEL 3IXAB 1B0GA 1DVFA 3PWJA 3M17A 5EZIH 4JKPH 3IU4H 3EYVA 2BY1A 4NC2B 1K4CA 4NN5B 3L5WB 2C3WA 3GJEA 4MLIA 4FQIH 5B3JE 3HC3H 3U2SB 2Y72A 4MDIA 3BUYB 4EBQL 3O2DH 3LKPA 1CDJA 1LP9A 5L2KE 2ZG1A 3BSZH 1AGEB 1MHEA 4XGZA 4NM8L 4QXTA 2DJ4A 2ZJSL 2GSIB 4Y5YB 1CLOH 1S8DB 4Z9KB 3H7BB 1HKFA 4O02H 5CEZL 4OCWH 3O6LL 2B1AL 4KXZI 5GQBA 1IGFL 2OTUA 1CE1H 3EBAA 5D4QA 1MCRA 4QRRE 3K0WA 3S4SB 3HUJF 4L8SA 4X6FB 4PRAA 3U0TA 5I73C 1IM9D 3QPXH 2BOCB 4L29B 3GI9H 4DK3A 3EYOA 5CSGA 5DTFB 1UQSA 2UWEF 2WBWB 5IMOA 2JCCF 2QV2A 4I5BB 5J3HD 1ZLWH 2ZOKB 1RIUH 1KYOJ 4PJIE 5GGRY 3ZDYF 2EC9U 1ZHLB 1G1YA 3AFLA 1OP9A 2CLZB 1FORL 2MFNA 1CLZH 1Y6MR 4CU8A 3MYJA 2LAAA 3MLXH 2F74A 1W72H 2Z31A 3TESA 1VADB 4MNGB 3GUTA 3GSUB 4LSTH 4YIQB 1CE6B 1FPTL 3EJYC 3TN0B 4QXGH 5EC2A 3SGKA 1JPFA 3Q0HA 2HTLC 3RIAK 2O26U 3RZCA 2P5EE 1TIUA 4G6JH 4XP6L 4PUBH 3TPKA 4P9MH 3KVQA 2QQNH 1ZA3A 1MCCA 3LEYL 1D6EB 4OZFB 3FQUA 5JTWA 1N7ML 1ZHBB 4RGNC 5A40E 2QKIA 2R29L 3VFRB 5DJ8B 3PL6C 3QUXD 2EYTA 5DWUL 3NFNB 3RVUD 1UJ3B 1IKNC 2R2CA 2MQ0A 5DK0B 1P7KA 5I1JH 2AJZB 3C5JB 4DGVH 3IDJB 1Q9WA 4KRPD 5T33H 3MLSL 2XZAH 4JB9L 4PJXF 4Q9QL 1DUZA 2C3VB 4M7LT 4B0MM 2AXJA 1I9JH 5D2NE 3SE3C 3V4PH 4PRIB 4KPHH 1YJDC 4AT6A 2WINB 1QRNA 1L9NA 4OF0A 3LQAH 1JZ4A 5I66B 5EOCJ 5FGBC 1CXIA 5E8NA 4U1HA 2CDEA 3HG1D 3JUZA 4G7VL 1F02I 4IMLB 4NM4L 4UOW1 1KPUB 3HUJE 5ID1B 4OQTA 4XPBL 3QH3B 3KJ6H 4U6XA 3KPLB 3BAEH 2UWEE 3V8OA 4DK6A 1JHLL 1FL5A 2JCCE 4GW1A 5E94A 2FL5A 1S7QA 1U6AH 5E1AA 3WCYA 1LE9A 3ZDYE 4APQC 1FO0A 3DX9B 1BIHA 5F6HJ 4DGYH 2XN9D 4JFZH 4Q2ZA 2BY3A 2G5BA 2VAAB 1MJJA 1P1ZB 3F62A 4BZ2L 1CFNA 5TH2B 4XMLL 4DTGH 4GO6B 5IEKA 2HRPL 2NY5H 4P2YA 2GY5A 4XNQB 4Z7VE 2Y23A 5D9SB 1A1MA 1XR9A 4M1CC 4U7SA 2RFXB 5HYIA 5FOBB 5GRZA 3QUMA 3H42L 4KI5D 1U2CA 1PX4A 1NFIA 4NQCA 3BHBB 3TLRA 1NCDH 2BVPA 4OFYD 2OYPA 5I19L 4G9FD 3T2NL 3JWOC 1CD1A 4DAGL 3TO4A 2YA1A 1HXMB 4PJXE 3H6JA 4XHQA 1FNSL 4JM2D 1I9IL 1JNLH 3P4OA 3KPQA 4F7TB 2I60L 5GZOD 1NCBL 3OPZH 3QJFB 2AAVA 1N6QH 3UTZA 1C8PA 5IVXB 1FGVL 2ATKA 1RIHH 5E2JA 2XQBL 2Y5TB 1JTTA 3DURB 1FYHB 4LLAA 1OTUD 4RBPK 2VDRH 2QSCH 1W0VA 2VZOA 5DJAB 1SBBA 3QIUB 3RY6A 5DFVC 1GOHA 4JZOA 5E2UH 4RDQG 4XTRD 2CR6A 2PYFA 3D48R 3MLYH 3H2WA 1MCLA 4PJ9B 2FDBP 4ZXBB 4JFXA 4EI5B 1GAFL 4R7NA 3S5LA 3VGHA 2VDMH 1OGAA 3B9EA 3C8KA 4V2BA 3FT4B 5INDB 4R7DB 1AO7E 3BJ91 3V5HB 1HQ4B 4EUPH 1OCWH 5M94B 2PYEA 1PLGL 1AHWB 4JVPA 2J88H 3FN9A 4I2XE 5K9KB 5K9OA 1XFPA 3LKQA 2CGRH 4DGIH 1NAML 3V95A 1TZHB 1R3JB 1F3RB 3QP3A 1U8NA 3U1SL 1PVHA 1WZKA 3QO0A 3VGEA 5BXFA 2DQCH 4BSWA 3TWCH 1PDKA 3HAEB 3MRQA 3GZKA 2K7QA 1GGIL 5AUMB 3GI8L 5T1MB 2GUOA 5EG6C 4UILL 3LPWA 5F7DB 4KJWD 2A6IA 3ARGA 3OKKB 2H32A 2E7CA 5GIRB 1H3TA 4EN3A 5ANME 5C0BD 2AKRB 3TN0C 2PNDA 4V1DB 1QBLH 2OS7A 3RUGB 4TNVK 4JHZA 1NSNL 2EE9A 4XH2B 2N4IA 3ZT7A 5D93B 4LSDA 4N8CH 1SJEA 2DQEH 3DX6B 5HGHB 1DQLL 2BSSA 1M4KA 1B90A 3VFVA 5FM8A 5AZEH 3SE9H 5I1DB 4YHNA 1F4WL 5FHBL 5I71B 3CU1A 1Q0XL 3VXUE 3FO2B 3PWPE 4L9LA 2Q6WB 1MQ8A 1T1ZA 2Y07L 4TPRL 2AJYL 5E5RB 3RTQB 1A9BB 3MFFA 4YBLB 1VGKB 3CFEA 4X8XA 3PGFL 4ODTL 3V9FA 3RZCD 4LLDA 5J1AA 2BC4B 3VXRE 3MZTA 2DLGA 4AEHL 2GSGB 1RZGB 1JNJA 1CG9A 4ZUVB 3W0WE 3UBXI 1T6VN 3WN5A 4OZGF 2DQGH 2CIIA 4PG2A 1EJOL 2X44D 4CJ0A 2AXFB 3B2VH 4NZDA 3LSOB 3LEXB 4PJGA 2V9RA 3FB6A 3LPFA 1SEQL 2YKLH 2Z8VC 5EWIL 3OG4B 4NHUA 1X4ZA 5FO8B 4F37F 2YD3A 1JZ6A 1QRND 4YK4B 4CJ1A 1HEZA 2YN5A 3RWEB 3GSVB 1V3LA 2AEIT 4KROD 5JW4M 4U1NB 4L1HA 5I17A 1NJ9B 1M71B 5JORB 3IFLL 3K2UH 4ODSH 2I9LA 1MQKH 1ACYH 2HKHL 3MNWA 4FFYL 2GTZB 1NCAL 1RJZA 2AJ3B 4K7FA 2OQJB 3MJ6A 4IBLT 5F71A 3TBVB 5JOFB 5JDJA 5JIKA 2X89A 4YHZL 3P11H 5AYUH 4I3SL 3CSBA 3HC0A 4L8DB 4Q97A 5EA0H 1UGNA 5FB8B 4YHKL 4GLRI 5KVFL 1AGDA 5J13C 4OM1L 3U9PL 2N7BA 4ZUWB 2EE6A 4HIHA 4F33B 4TSBL 1Q38A 3P73A 2Y4SA 1A6UL 1OW0A 3OR6B 3LS5H 1ZT7B 3L6FB 1KTLA 5ICZB 3VDAA 1MRFH 1KCVH 4U33A 3FN3A 4NQCD 4KHXH 2AK4E 4OZGE 2VKXA 4Z7WB 3NZHH 3PHSA 4JRXE 4RAHA 3SOBH 4CVUA 1Z0NA 3ULUH 3RVTC 4HGMA 1YEKH 3TO4D 3BP6B 4XAKE 2HKFH 3GSQB 1BX2B 5INCB 1QG3A 4X80L 3D39B 1IGIL 1ORQB 3EYUL 4OFDA 5ABDE 5I1HH 5EUKB 2D7PA 3KJ4C 5FKPB 4DFHA 3MV01 5I1EL 4AG4L 1AHWC 1NGXB 4I3RH 1G6VK 2MMXA 2ZOLA 2JJSC 2NW2A 3D9AL 1F90H 4R0LB 2X09A 4J3WA 1QLFA 3MRBB 2XKNA 1VHPA 1BIIA 3C6LB 3E0GA 2FH8A 1SY6A 4PRNB 1OM3L 4X4XB 1CS6A 3C5ZB 1BFTA 2FGWL 1AKJB 3CIQA 3KWWB 4MA7L 3VH8A 1U8IB 4G6FD 2DLFL 3RL1A 4BYHA 2WIIB 1QA9A 4JGMA 3O3UN 3PABA 5LJYH 4I48A 5HTSA 2PYED 4X4ME 5F3BB 3QDGE 5KSUB 5DVLA 1PQZB 4JPKL 4HUVA 2AEPH 1DQDL 4MCZB 1TDQA 5F21B 4C55A 1M7XA 1U2HA 5CJOL 5BV7C 3IS1X 4U1SA 5C0AB 5KSAB 7CGTA 3HE6B 1JYNA 1J5OL 4HFUL 3Q6FB 2BVYA 1T3FB 4QY8A 3ROLB 4XXDB 1I3GH 3GSXA 3VXMB 2CLVB 3FB7A 3UAJD 4CVZB 4IRSB 3N1QC 4ODXA 3GMLA 3NOIA 3DLQR 1MWAB 5I71C 2ZCKL 1NFDF 4S1DD 3TIEA 3QI9A 4QOKB 4JRYA 1D5MB 3REWA 1NLDL 3GIVA 4EN3D 5GGSY 4U1KA 2BNRA 4HS3A 3UJIL 3LKSA 4AYFA 5J4MA 4RMWA 4HUUB 2IFGA 4GSDL 5F9OL 1QVOB 3PV6B 4G43B 2VAJA 4NOBA 4RBPH 4I18C 1PAMA 3Q2CA 3SE3A 4PGEA 3FT3A 5AG8A 1P9MC 3C6SA 4ZAKB 2AERT 2HFTA 4TQEH 3ZL4L 2VLKE 1Z3GH 4HV8B 2OTWA 3TT1L 3ZKXB 4GAFB 1VENA 1QEWA 3LN9A 3QZWB 1JZ2A 4FXKB 1E27B 5EBWB 2V2TB 2ARJB 3QEQB 4N5UA 1K2DA 1CGTA 1N4XH 5GXBB 3TV3H 4X5WB 1VEOA 5DHVH 5TF0A 5TPWH 1MH5B 4F7CB 4YK4C 4Y5XB 4HCRL 5F9WB 1TVDA 4MA8H 2CO6B 1S7VB 4KUZL 3GJFA 4FQQB 1YYLH 4LLQB 4U3XA 3P0YL 1A6TA 4YHOL 3D0LB 4HT1H 2EZ0D 4J3SA 3OXRB 5E99H 3Q1SL 5IHUH 3LIZH 3VXQA 3BO8A 4HK3J 1RIVH 4NO2B 2WIMA 4JO4H 4JFHD 3QNXB 2O61A 2DYPB 1KUMA 5ISZE 5E9DA 2KH2B 3N1PC 4G80B 2IF7A 4HWBA 4NN6B 4KDWA 3T0AA 5TF1H 5ITBH 1OVZA 5CJXC 3LKOB 5JIIA 1XH3B 2VLLB 1O0VA 1NFDE 3QHZH 3MA9H 3P0VL 1DE4A 5GRWA 3CCHA 3DECA 1P4IL 5CS7A 1FJ1B 3MV8B 3EFDH 1ZLVK 1DTUA 4BQ6A 3IXTB 3U48A 2I25N 4L4VA 1OWRM 1T1WB 2VYRE 4TSAL 1FYTA 5F88A 4ZDHA 4MXWH 1OAYL 3ZHKA 5JQ6H 2I24N 4BA8A 3CMOL 4P2RA 3MRCA 1H0DB 1SBSH 3IXAA 4XP9H 2XFXB 1R6VA 2FNBA 4KKCC 1WZLA 2X89D 1Q9OB 2MPAH 3LS4L 4JG1H 4N0CD 4P5TC 4UU9B 5GGVY 4GMTL 4LU5L 1JIBA 2E8ZA 3L5WA 2W92A 4UI2A 3VXSA 3BH9B 2X4RB 2HFEA 4HKJA 1FLRL 3U2SA 3LQMA 3BUYA 2D9QB 4NJ9H 4FZEH 4NC1C 4D3CL 3C08L 4PG9A 3MJ9H 4NNXB 4Z6AT 3DI3B 1AGEA 1KG0A 2GSIA 4Y5YA 3U4BH 4BFIB 1S8DA 2MKWA 3SHSA 1FGNH 3H7BA 4LRNL 1YEGH 2J2ZA 4HPOH 4Q7DA 1V3JA 3BN9D 1AQKH 1AR1D 1JWMB 2I5YH 4Y5VB 4YXLL 2DTMH 4JCMA 5D1XA 1VEPA 1I75A 2GK2A 3C6LC 1CD8A 1F4XH 3WNPA 4KXZH 4X6FA 3BZEB 4UNUA 3MCKA 4L29A 2BOCA 2YPVH 5DTFA 1U93B 1KCLA 2BOBA 3FQTB 3O3EB 2AGJH 2ZOKA 2A0LC 4OIAA 4LCCC 1ZHLA 4HAGA 4KFZC 1YEIL 3DO3A 4FP8H 2CLZA 5F6IC 3CFJB 1MCBA 4KMLB 4KY1H 4IHOB 4NCC1 5L8LB 4BZ1H 3BD5A 1VADA 4MNGA 4X0KB 1ZOXA 3HMWH 1CE6A 2E9JA 2Y25A 4KHTL 4EZMA 1OHQA 2H26B 25C8L 3OKDB 4IDJL 2EDLA 3CFCH 3UBXG 1J8HB 1G7PB 3VD3A 1D6EA 5E8DL 4OZFA 4ZOEA 5E1HB 5E6ZA 1ZHBA 4KVCH 3U9UA 3VFRA 2DL9A 5DJ8A 4MXVE 1F13A 1UJ3A 3U0WH 4K3EH 4LSQL 2F15A 1ZANH 5B8CA 3PDDA 2AJZA 3C5JA 3IDJA 1R5IB 1IQDA 5IESL 3GIZL 2J6EA 2C3VA 4M3KB 1NBVL 1LO5B 4JPIB 3DHJA 4GMSL 5JW3H 2WQRA 3D3VB 3FFCB 4P3DA 43C9B 3DXAB 1F58H 1E4XL 1FP5A 3ARTA 2WINA 2WP3T 4ZAKC 4Y88A 4OFVA 3RQ3A 5I66A 5DUPL 4O00A 4I77H 2R4RH 3MRFA 4PJ8D 5A3IC 3ZKXC 4IMLA 3QRFM 2B0SL 1KPUA 3W39B 5ID1A 3QI9D 4JRYD 4R2GD 2IAMD 5FUZH 3WO4C 3OZ9H 3QH3A 4NZRH 4Z8FH 2HT4D 3KPLA 4KI5F 1U8JB 1XF2B 2FGZA 1UEYA 1MNUL 5DRNB 5K9JH 1JFQH 4ZQKB 3MACL 3ULSB 1MCSA 1PG7H 2VAAA 4RGMC 1P1ZA 5JA8B 5F9WC 3LDBB 3BWUC 1MFBH 5GRJL 3BQUB 3QDMA 1YY9D 3EYSL 4JM2F 5TH2A 5JR1H 3TZVA 3TH4T 3ZYOA 3MRPB 3BPNC 3F58L 3ARUA 4XNQA 1TZGH 2QBWA 1XIWB 2V7HB 5D9SA 3AC0A 1R0AH 3T4YB 4NGHL 3VRJB 2RFXA 4PLJC 3L7FB 4IS6B 4HX1B 5FOBA 3HG1E 5CCKL 3MLZL 1S9WB 4NN6C 5H35B 5SWSA 4EOWH 4WUUA 1FAIL 1U3JA 2EH7L 2CLRB 5DRXA 3N1MC 5DEFB 3BHBA 3V52H 1BAFL 4PD4K 1S7RB 1CZ8H 4CNIB 3CK0L 5JW4R 1OD9A 3W5MA 1HXMA 5F7EL 2XN9E 3ELAT 4OLWH 5DVOA 3C2AH 1II4E 1MIML 5C09B 1JYXA 4F7TA 1FQ9C 3NZ8B 3QJFA 2XRAH 4HPYH 5E9DD 2YUVA 2FHBA 5IVXA 5FYKU 1G9MH 3QCUL 2Y5TA 2BVOB 4Q9BA 3DURA 1GVIA 4WI4A 3BX7C 3QIUA 3IDNB 4KI5E 4OZHB 4LQ1A 1UWEH 4NZTH 5C9JB 3CVIH 4CMHB 4L4VD 3OX8B 5LCVL 1UH2A 3T0EA 1N5YL 4G9FE 2DQHH 3U46B 2IADB 4PJ9A 4ZXBA 4K3HA 4EI5A 3HC4L 3FT4A 4OGYL 3MUJA 5INDA 4BFGA 3RDTC 3DETC 4QWWC 3V5HA 1HQ4A 3JTTB 2VUYA 3IAQA 2VE6B 4WNQB 5F7LB 4NQEB 4UOJA 1AHWA 2CK0H 5CWSB 1BF2A 3ARWA 5JW4N 3FO0H 5K9KA 4Q0XL 2JJSA 2NW3B 3EYQC 1DLFH 1ONQB 3VXSD 2APTA 5FYJH 1XGQB 1ETZB 1TZHA 1KJ2L 4PY8J 4Y2DD 4QGTA 4OZ4B 1IGCL 1UM4H 2MJWA 3IJSB 3TEUA 3HAEA 1XT5A 1NC2B 5AUMA 3SKNB 2W9EH 5T1MA 3B5GA 2G2RB 1DUYB 1I8KB 5F7DA 1HKLL 5IJVB 4BUGA 2F53A 2DLIA 1A7RL 3OKKA 4X6DB 5E2VL 1JJUA 5GIRA 1HI6B 1Q1JH 4TYUA 1BQHB 4H1LB 3AMKA 5D1XD 3AROA 5L88L 4QT5A 3BT2H 3RUGA 3HNSH 2L4OA 1JMXA 3PGCB 4XH2A 3UEZA 4U6TA 5EDXA 1ZLVH 3DX6A 4XBGB 4Q6IB 2FWOB 5FYKL 4IIQB 1H8NA 2BNQE 5I1DA 5DC9B 2DM4A 2IPUG 4WO4D 1LP9E 3ARYA 3FO2A 5T3ZH 1U8MB 1K4DB 2NPLX 3A6OA 5KOMC 2Q6WA 4XX1E 1RHHB 4JVWA 3RTQA 3LN5B 2CPCA 1MCOH 1U8QB 2FCBA 4D0CB 1VGKA 3ILQD 1IAII 2BC4A 1P9MA 5C0BE 5L7XL 4K3DH 5JXEA 3EHBC 2R8SH 2GSGA 1RZGA 2AS5M 3SCMC 5ENWB 1RZKL 4ZUVA 2WBKA 4AEFA 1OT1A 1NANI 4PJFB 4M61B 1JPST 4M1GH 1P7QB 1T7VA 2FATL 3L3HB 3LSOA 3LEXA 4C83B 3CSYB 1ULVA 1HYSD 1HCFX 4TVPD 5IQ7H 1ZGLP 3MUHL 4EIGB 1VB9A 2A9ML 5MI0B 2YEZB 2KBGA 3HMXA 1H3XA 5JW5B 1GOGA 1QTYT 4KGLA 3AY4C 2A38A 4MS8D 3RWEA 3GSVA 4U1NA 1AIFB 4IRJC 3VFGH 5MEQB 1NJ9A 4XPFH 5AAMA 5JORA 5HPMB 4DN4L 1XIWC 2PXYA 1AC6A 2LU4A 2ARWA 2GTZA 5IMKB 5EZOL 2AJ3A 4YHIB 3QUYB 4QHMB 4M6OH 2OQJA 2JLLA 2A9NH 2QQLH 5DA0B 5DQJA 5JOFA 4PLKC 2JJUA 3WMSA 2D0GA 1YY8B 4DQOH 4K2UL 4ELKB 3SE4C 4L8DA 2D4FA 5FB8A 4PJ7B 2P48B 3QDMD 1N5AB 1I1AB 2QADC 3RGVB 3TZVD 2OP4H 5C0ND 1TITA 4ZUWA 1ZE3C 2VN7A 4PJDB 1REIA 4ZOBA 2YD9A 4GLRH 3KLDA 1MCPH 1MHPL 1QRNE 3EO0B 3G5XB 5IGXH 3OR6A 3W9EB 3L6FA 1KC5L 4OGAC 5ICZA 1HZHH 5SWSD 4WUUD 5A2IH 35C8L 4MXQC 5DRZB 4O9HH 4FQJH 1A6PA 3PUCA 4WIQA 1MY7A 4KMQA 4PJ5B 4Z7WA 2PR4L 5DD1H 3IF1B 4ZODA 3CAFA 5BO1L 3BP6A 4N0CC 2HVJB 3WKML 1RULH 3S88H 1H5BB 2DD8L 1CU4H 3WIFA 3GSQA 4BM7A 4BH7B 1I8LA 4XNXL 1BX2A 3N0PB 5INCA 5DLMH 5GRXG 2DQIL 3QIBD 3I9GH 2HTKD 2Z8SA 1B6UA 1QNZL 3D39A 4XCFH 1YMMB 1ORQA 3EZJB 4XPHL 2VXQH 4P2QB 3WNKA 1DL7H 4M43H 1TJGL 1KFAH 5EUKA 4PGBB 15C8H 4EEEA 5FKPA 1BBDH 2G5RA 3QDJB 4XPTH 5J6HB 1NGXA 2ZCHH 1RZ7L 3EDEA 4RWYH 1RK1B 4LRIC 2UZIH 2XG4A 5CKAA 3GK8H 4R0LA 6FABH 3QIUD 3I75B 4YO0B 3T2PA 1IGTB 4KGJA 3C6LA 1MFDH 2Y36L 4NQCE 2D7QA 1BF8A 4X4XA 1U3YA 3C5ZA 3DYMA 3T0ED 3LD8C 4PJ9D 1AKJA 3KWWA 4ZXBD 4EI5D 1U8IA 3CNKA 1NMBH 1G7MB 1QR4A 2WIIA 5GJTL 5ELIA 1YEHH 5FM5O 2E27H 4N0UB 4G42B 2GJJA 3SKOB 4NQDB 1WWBX 4GKZB 1L0YA 5F3BA 1EA9C 4MCZA 5FUCC 4AEEA 3QRGH 2GT9B 1FIGH 4JPWH 4MMXC 4XCYB 5JIHA 5GSRA 1FH5L 2XNAB 1ED3A 3NCJL 5KSAA 1LO0H 3DTXB 4GG8B 3HE6A 5IT2L 3WIHA 1LK3L 1QLRB 1T3FA 3MV7A 3Q6FA 3ROLA 4XXDA 4K94L 3ABZA 1U8HB 3VXMA 4Q6IC 4F58H 4CVZA 4IRSA 1CDUA 3E3QC 4MB3A 1HHHB 4P59L 1QP1A 2F53D 4QOKA 1D5MA 2FJHB 5AYQA 2PTUA 3L5XH 3WIIL 1JE6A 1CXHA 3O9WC 1YC8A 3S35L 5I1CH 1PKQB 1C08A 3RKPA 4HUUA 2GY7B 5TE7H 1QVOA 3PV6A 4G43A 4LKXB 1UM5L 4LCWD 3QXUA 3MOAH 4X6EB 3QQ4A 4ZAKA 1OSZB 1WT5C 3TJHC 4HV8A 2BFVL 4PJGF 1YNKL 4AM0B 4TUKH 3TNNB 1W72B 3QZWA 4OIIL 1WF5A 3RTQD 1E27A 3J7HA 2V2TA 4KMTL 2ARJA 2D03H 3QEQA 1MIEH 2BSRB 1ZV5A 5MI0C 1NKOA 3X13B 1G1CA 4NYLB 1BQLH 3MXWL 4NFCA 4X5WA 5JXAH 5EUOB 3EZ8A 4GG6F 5ALCL 3DGCR 1MH5A 4F7CA 4Y5XA 1CDIA 5JXED 4LLQA 1S7VA 2OZ4L 5HHXL 3QUMH 4DOHE 2WUCL 4RISH 3D0LA 4GKSB 3SKMB 4XXCC 1B3JA 3OXRA 5TE6L 3UJJH 1OF2B 5K33A 1T04B 5ERWA 5I8KL 1AE6H 1F6FB 1FBIL 3O8XC 3I50H 4FQ1H 3QNXA 1CK0L 2DYPA 4JLRA 5GGUB 4R96B 1MI5B 5DYOB 1FSKB 3QHTC 4G80A 1QSEB 2CDGB 4R3SB 5IBLC 1XH3A 2VLLA 4DKDC 1I1AC 3VGAB 1NMAL 3RGVC 3U7YH 2QJDA 3MV8A 3PWLB 4JREB 1QLEL 2UVFA 1P84K 1FG2B 3FHQA 1CBVL 1T1WA 2PXYD 3PHOB 1DEDA 1UJTA 5IB2B 5A2KH 4FNLH 1H0DA 4X7FC 2D9CA 3CZFB 4HZAA 1VGEH 1C5DB 2XFXA 5F72S 4L4TB 5E4EB 1R3HB 1T7XA 3WNOA 2CMRH 1Q9OA 2FZ3B 4NPYB 4PJGE 4UU9A 4JFHE 5EOQH 4XZUB 4G7YH 3RX8A 1T1YB 1UYWL 3K8MA 2UY6A 4ZS7H 1V7ML 2X4RA 3BH9A 1H5BC 1OARH 2VQ1A 2PO6B 3GO1L 3L7EB 5D7IF 2QHLA 4CBPA 1FRGH 3P9LB 4GAJL 4GG6E 4NNXA 2NXZC 3IU3B 2K3TA 4BFIA 3F12B 3BUTA 4GKNB 4NWUH 1KB5A 3QSKB 3WFDL 5ECJE 4Y5VA 2BSTB 3C09B 5H94B 3MODH 3G6JB 5DZOA 4JFEB 3BZEA 3SDCC 2W0PA 3TJEH 4U1GB 1KCRL 4NUGL 3ZKND 2EDWA 1U93A 2H32H 1MFCL 1U8KB 3FQTA 3OAZK 3ZE2F 3BEWB 1WWWX 1T0MB 4LCIL 3EOBB 4S1QL 1CLYH 2IC2A 3NN8B 4AIZB 4BH8B 2BDNH 4S0TD 3MXVL 4HHAB 4NO5B 3CFJA 5CD3A 4IHOA 1EXUB 5C6PB 4UNTA 2P7TB 4N0YH 4WENB 4JHAL 5JZ7C 2DWEA 2QQKL 4PV9B 4X0KA 3X3GH 3H9ZA 3LHPL 2VLJB 3OAUL 3WHE0 2H26A 3OKDA 5H37G 5HHNB 3B2UC 1Q72L 3C5ZD 1J8HA 1G7PA 1GPOH 3NABL 4LSSH 1MRDH 2XQYK 5DQDH 2AEQL 1U95B 2CDFA 1K3ZA 4ALAL 2NY3B 5AWNH 4FQ2H 1AQDB 1A7OL 4M7JL 2ENSA 4QGYA 1J0HA 1IEHA 3SDXF 1NH6A 1ITCA 5EBLB 3MCG1 5I8OH 1LO5A 4JPIA 3EJZC 5IWLC 5KG9B 4P2OC 2DQTL 3D3VA 4LIQL 1EERB 1NC4D 1JGVH 1IGML 3FFCA 4JDTL 5KSAD 1QPPA 43C9A 3DXAA 5M7QA 1Q9KB 1CGXA 3HE6D 3ARXA 3MV7D 5DJ2B 3TF7C 2CR3A 3IRPX 2GIYA 3JV4B 3VXMD 2NZ9C 4HXAL 3RVWD 2X6MA 4IRSD 3BGFC 3VG0H 3PWVB 3NGBB 3O6FC 2VUOA 3D2UA 12E8H 4GQ9H 4FXLA 4BKLB 3RWCA 1NEUA 1JBJA 3ROOB 1U8JA 1XF2A 1AD0A 1TTFA 4UTBH 3ZE2E 4AL8H 4NKDB 1SQ2N 2XQYG 5FHAL 4ZQKA 4UZGA 2DQJH 3DV4A 3PXJA 3ULSA 1TCMA 4FFVD 2NY2B 2CRIA 4PJHB 2FH6A 4RWHA 2Q8AH 2BSED 3BQUA 4FTVB 3AY4A 3HB3C 2JJTA 1FNFA 3VFWA 1QSVA 2ZCLL 3I3EA 3QQ9D 3MRPA 1FFOA 4R97C 4JVUA 4FRWA 1A6WH 4OBRA 1IRAY 2IQAB 4UBDC 5C2UB 1XIWA 5ESVB 5CD5D 2V7HA 1X5YA 1CYGA 3VRJA 2ZUTA 3V6BR 2A83B 3QNZB 3L7FA 4IS6A 4HX1A 1TCRB 5CJQH 4GBXB 1S9WA 3S37H 5HI3D 5I75C 5H35A 1WAAF 4JRYE 2CLRA 5DHXB 5DEFA 1D6VL 5T3XL 3S4SG 3U79A 1S7RA 3SE4A 3VGAC 1BM3H 4CNIA 1GJIA 5IVZB 1F3DJ 1A3RL 2AV7B 3C8DA 4MHHI 3SDXE 1YEEL 4JREC 3OF6D 4TRPH 5B39B 4ONHB 4UDUB 4LLUB 1T03L 3S98A 2QLVB 5C09A 1IBGH 1DANU 5BMFH 2J4WH 2DYPD 1DBJL 4QRPB 2XTJB 2MWCA 1KCUH 4I0PB 2HLFC 5KSBF 1KLGB 2PW2A 2VC2L 3IDXH 2BVOA 4P48A 5D1ZB 5GISL 1KJ2B 2OXGA 4YHMH 2B1HH 4YNYB 5F7FA 3IDNA 2AK1L 3SJVD 3CPLB 4OZHA 3SDDB 5C9JA 4HS8L 3OX8A 2RCSH 5KAQF 4OZFG 3DJ9A 4QRQB 3O6KH 4YEFA 5C8JB 5C9KA 3SKUD 3U46A 5ESQA 4GRLC 1RUQL 5ILTL 5GS2D 3V6OA 5TFSL 4Y16B 5D70H 3W11D 1W8OA 3JTTA 1FVCB 2WZPD 4K7PH 1QPXA 5EBGA 5MP6L 2VE6A 4WNQA 4NQEA 5CWSA 5E9DE 1J87A 3C09C 4KH2A 2NCMA 2NW3A 2DM2A 1ONQA 1MFEH 1YEFH 1XGQA 1ETZA 4KK8C 4JO1L 1RZFL 4OZ4A 3MGTB 4UV7L 3IJSA 1JPTL 1NC2A 5FA4B 1UKTA 4PBXA 2AJSL 4AQOA 1A7QH 3SKNA 1DBBL 2G2RA 4OUUB 1DUYA 1I8KA 3QXVA 4XRCB 4L4VE 4JKKA 4OF5A 2HFGL 4DCQB 5IJVA 1P4LB 3CFIC 3VD9A 4X6DA 1OAQH 4MA1B 5GJSH 1HI6A 1MCIA 1MJ8H 4N90D 5E5MB 1BQHA 4H1LA 4YH6A 4ZNCD 4J4PC 2XTLA 4LSPL 1KJ3L 3FN0H 4OLVL 5C0DB 3CLEL 3ORJA 3ULVD 2K7PA 5HI5D 3PGCA 4PREB 4LP4A 2XXCB 5F1NA 1FNHA 3VXSE 4XBGA 2R2HB 5IJKC 3V4VH 2FWOA 3G6DH 1FNLA 4OLUL 2G9HB 4IIQA 3F5WB 3OTTA 4UV4H 2V5TA 1C1EH 1U8MA 1H3PL 4PRBB 1K4DA 1U3HC 1XF4B 1YJDH 3P4LA 1IC7L 1TQCC 2VZVA 1RHHA 3ARED 4XC1L 3LN5A 5MEOA 1V3MA 5AD0B 3UZQA 1HHIB 1X9QA 5HHVH 3HLAB 2GJZB 3OGCB 1J8HD 3OL2A 1NBZB 5ENWA 1HINL 2RJMA 4LSRH 1VPOL 3NGBC 4PJFA 1WT5A 4PP1C 4QTIH 4NRZB 3L95B 1OOAA 1IAIM 4XP1H 4WFED 1P7QA 3CH8A 4K71B 4ZS6C 4HDIB 3L3HA 1NANH 5H37H 4C83A 4GQPH 3CSYA 2FD6H 2EDDA 3RX7A 1ZVYA 5JW4Q 2Q1EA 3DVNB 4MSWB 3D3VD 4GW5A 1J1XH 3FFCD 3B9AA 2NY2C 1A7BA 3OQ3B 3DXAD 3UTSD 1JVKA 4WFHD 3WFCL 1UACH 4HWEH 4OJFH 1NGPL 5DD0H 1B4JH 1CD0A 4YFLI 1I7UB 1AIFA 1T66C 3W2DH 5MEQA 4HUXA 3RKDD 3D2UD 1WBZB 3TBYB 5HPMA 5IB4A 2R0KH 1IC5H 1C5CH 2AJXH 3O2DL 4LPUA 3TIDB 3NTCH 5GS1B 5DMGD 1G9EA 2MCPH 1TQBC 4YHIA 3WFEH 3WSQL 3QUYA 4QHMA 2HJKB 4FZ8L 4K3JH 3JWOH 2VSDA 1D7FA 1QBMH 1KENL 3AAZB 4LGRB 2FX8L 4OV6F 2DJUA 5C08B 3BDYH 1VA9A 1YY8A 2XT1B 3HI6H 3QIWC 1G6RL 1UWGH 5BJTB 2B5IB 3D85A 4PJ7A 5L9DH 4TVPE 3BQUD 1N5AA 1I1AA 2R2BB 3PP4L 3RGVA 3RAJH 5ACLA 3N85H 4PJDA 1G9NL 2VDLH 4JFDB 3O0RL 3EO0A 3G5XA 2DWDB 5IVXF 2F54B 2XTJC 2RGSA 2H45A 4TUOB 1PSKH 5GGTL 4AIXA 1CTOA 2PTTB 4CKVX 2XZQH 5CSZB 1CTNA 1UXSB 1CLZL 3MX0A 5D1ZC 1L7TH 4PJ5A 4MQXD 4NQSB 3STLA 4M7LL 3NA9H 5HVGB 3IF1A 2VDKL 1OLLA 1QFWM 2CKBH 3SDDC 2HVJA 4OCSL 3GBML 1IM3B 5I1LB 4BH7A 4NN7C 1FNEB 4HGKC 5C09D 4OCNC 3QDME 2BRRH 4FS0A 1YMMA 4CN6A 1H9VA 3MLUH 4P2QA 3PWUB 4W68A 5F89B 4G6AD 4PGBA 4AK1A 4DZBB 3JV6B 5J6HA 4TULH 4MD5B 4L1DA 1G84A 1RK1A 4ZO8A 3DVIA 4RRPG 5DD3L 1NLBH 5SWSE 3TA3B 3I75A 3HZKA 4WUUE 5FDWB 4YO0A 3DVGB 1IGTA 3LAFA 2NY1B 2O5YL 4NSKB 4JO2H 2DMKA 2VZUA 1HSBB 5E24E 1G7MA 1INDH 1EBAA 4GRWB 3WJJC 5EU7E 4DVRH 3DI2B 4N0UA 4G42A 3SKOA 4NQDA 4GKZA 1VACB 4ONOA 4MAYB 3QXDA 4TTDC 3RUGF 3V4UH 3BAEL 4KKLD 4OZFH 1HIML 3GHBL 5IVXE 5E8EA 1F4AA 1K8IB 4JJ5B 4XCYA 3VGFA 2XNAA 1RZKC 4PV8B 4K8RD 1JHTB 1MF2L 3DTXA 4GG8A 2IFFH 1B4RA 2JJWA 4Q9CA 5CKGA 2W07A 1U8HA 3AMLA 1F97A 2J6EH 5F70A 4DTGL 4UAOB 4ZPTB 3T0EE 1R5VB 4YHYB 2FJHA 3BIBX 1A47A 5BVJB 3V6FB 4KJPD 2EEAA 1NKRA 1ADQH 1N3NB 1PKQA 3ARQA 2MCG1 3X14B 2E9WA 3QDAA 3HRZB 4LKXA 1E6OH 3GBNH 1NFKA 3IETB 2EC8A 4UTAH 4X6EA 4X7CC 1BJ1H 4E41E 1EFXB 2YZ1A 1FE8L 1OSZA 2M1KA 2DQUH 1I7TB 2YBRB 4U1MB 4K71C 4AM0A 3TNNA 1W72A 1X5KA 5F6HI 5KJRH 3Q6GL 3OPZL 4J6RL 5EZLB 1DBKH 2BSRA 4ZSOB 4YLQT 3TFKD 3X13A 4K07A 4NYLA 2F53E 4MHHG 2KQNA 4OLXL 1YN7A 4ZUSB 5F9JB 5LBSL 4YBHA 5C0IB 4QF1B 3P4MB 4LARL 1P2CB 2CRZA 3N9GH 4Y4FA 1BZ7B 1J9CT 2C1PB 3RUGE 4S11A 1I3VA 1LE5A 1W2KT 3SKMA 1DZBA 1GL4B 3B9KD 2P49B 4HQQL 2DKMA 3NCYS 1OF2A 1P7QD 4LKCB 1T04A 4LCWE 1UVQB 5A2LH 5GS1C 5DXWA 2GI7A 2J8HA 2H41A 1KEMH 4BSVB 3QFDB 5GGUA 2FBJH 1TVHA 4R96A 1MI5A 1X5IA 2R9HD 3SBWA 2HT3D 3HI5L 4WWKB 4XVSH 1TJIH 1I9RH 2P47B 4G8FB 1RVFH 4R3SA 2YUWA 3DVFA 3KXFA 5KTEL 4R8WH 2FEEI 5IF0B 3UPRA 4OCXH 3PWLA 2CGRL 3LZFH 4HWUA 3DIFA 3KS0H 5EU5B 1FG2A 1RMFL 2VDQH 4JG0H 3PHOA 5CBEB 5DO2D 5IB2A 1FV1B 3QUYD 4IRZH 3BOVA 2EDBA 3CZFA 3HPLA 4ZNEA 4WGWB 4KKBC 4DN3L 1C5DA 4RAVB 4L4TA 1KXQE 5EO9B 1R3HA 3A67H 5GHWH 1EO8H 2XA8H 3R06B 3D18B 1S5IL 2VH5H 1J1OH 2UY7A 3O3AB 4H20L 3W5NA 4UOW0 4XZUA 3D85D 1T1YA 3AM8C 4Z7OE 4OLEA 3VFSB 1JNNL 2W9DH 3D0VA 4WRLA 1QBLL 4L3CB 4LSUH 2PO6A 2BXYA 3L7EA 1CFTB 5E2WL 3P9LA 4X6CA 4PRHB 4TSCH 3WBDA 4N8CL 3T0VA 3A6BH 4MZ3A 3IU3A 4KI1A 4GRMB 1LO4H 2CJUL 3FQNB 1L6ZA 4HULB 5BQ7A 2O5ZL 3F12A 2NMSA 4D0BB 5JHLH 3RA7H 4GKNA 4PJ5D 3UYOD 3MR9B 5I9QB 1AI1H 1CQKA 3KYNB 4CW1B 1MAMH 2BSTA 3QFJB 4NKMB 5H94A 5C2BL 1ZHNB 3G6JA 2KZWA 2HLAB 2P5WD 4K94C 5ACMA 1I1YB 2NY1C 5JPNB 1PD6A 5C0JB 2Y06H 1U8KA 1I85A 3BIKB 2ICEB 4RX4D 1T0MA 1DDHB 3EOBA 4LHQB 4AIZA 3NN8A 4BH8A 4P2QD 3INUL 1UM6L 3QZWG 4HHAA 5BV7H 4HKXA 2YSSB 3F7RA 2Z91B 4M8QB 1EXUA 4MAYC 3TT3H 2FHFA 1CFVH 4DEPB 1IAKB 4WEBH 1P5UA 4PV9A 1T7ZA 5HHMB 2P8LB 4PIRF 3BN3B 4PB9L 5HGGS 2R0ZH 3QEHA 2VLJA 3EYFB 4H8WL 1YQVH 5HHNA 4Y1AD 2J8UF 3DROB 2NY7L 3VXTB 2ADIB 5A43C 1U95A 2ICWJ 2DQDL 4UB0L 4EUPA 3EAKA 2DIJA 1AQDA 3AXLB 4J2XA 2UUDK 4NQDD 4YHYC 3LEVH 5EBLA 2R23B 3BKJL 4Z18A 5C6TL 2YUZA 3OB0H 4KQ3H 4OLZL 5EPMB 1EZVX 2X7LB 4XVTH 3ARFA 4UT9H 2AJVL 1INEL 1Q9KA 4P46B 2F19L 3UJTH 2DQFA 4XI5C 1DFBH 5IMMA 5MENB 4QRTB 3QWRA 3PWVA 4ENEC 3A6CL 4BKLA 4G8GE 2XWJB 1OSPH 5HJ3B 3LCYA 5E2TH 1T0PB 5IBTL 1I1FB 2VERN 4OSUL 1QYGH 5DURB 3ROOA 2IBZX 5D6DA 4HC1L 4NBZB 3PDGA 4ODVL 5CZKA 4M02A 2OR9H 4N0RA 3F7VB 4LASL 4LBEB 3MBED 4PJHA 1CXKA 4L5FH 4OZIF 2X4QB 2BVQB 2X41A 3BRFA 4FTVA 1UB5B 1KELH 3DSNA 2APVA 3CXDL 4Z7NF 3HCVB 1KYOK 1YC7A 5IMLB 3MV7E 1TNNA 2IQAA 3W81A 4OB5L 5C07D 3VXME 3QCVL 2A83A 2K1MA 4EI6B 4U6VH 3P30H 1TCRA 4W4OA 1MLCB 4GBXA 4M03A 5ID0B 1C5BH 4WHYH 4IEFB 2B2XL 2YD1A 2BMKB 1ZK9A 5GRUL 2NY4B 3KPMB 5ADOH 3ZYZA 1F90L 5IVZA 5CEYA 5F1KC 4Y4FD 3NPSC 1UCTA 2AV7A 2VR9A 5B39A 2FB4H 1ZEAH 2J3SA 4PJCB 3MRNA 5B3NA 4ONHA 4UDUA 3BKML 4LLUA 3M8OH 4G6KH 4QRUA 2FEDD 5KVEH 2W0FB 3UBXB 4QRPA 3K3QA 1NAKL 2FX7L 1MI5D 4OFKA 2HMID 1J10A 5IIEB 2VZ1A 4I0PA 4NQTA 4YUEH 4YBQC 1KLGA 5FYLH 3P2TA 5D1ZA 4EVNA 3LKNB 3KXFD 4JFOB 1PFCA 4BELD 1XGTB 4XCCH 5ADPH 4HJJH 1UWXK 5ETUB 3CPLA 4M6NL 1ITBB 4W6WB 4R4BB 3T77B 4QRQA 2X4NA 5HYJE 4UIKH 5C8JA 4HIXH 4PJBB 1YNLH 1I3GL 4LEXL 4H26A 4LP5A 4LAQL 4Y16A 4RA3A 3HE7B 4D9LH 1NEZG 2H9GB 4Z7NE 3UTQB 3WKNA 4JQXC 2YRZA 3O41B 5I9QC 3CVHL 3GNML 3E1F1 1F2XK 3ULVF 3EGSA 5I1GL 1IC4L 3T1FA 5KVDH 3S6CA 2QR0B 2NX5E 2PO6D 4DW2L 3JV5A 5FCUL 3MGTA 4FN0A 4NT6A 1AJ7H 1DQJA 1EEYB 3N1FC 3SJVE 5FA4A 4RGOH 1GGBL 4PY7A 4OCMC 4XRCA 5H2BB 4DCQA 3T3PF 2BNUA 1P4LA 1S7UA 3KPRB 2ERJB 5IOPB 4DEPC 1K5NB 3E2HB 1XGYH 3QG7L 5D7JB 5E5MA 4M1DH 2HT2C 1V8HA 2M2DA 4POUB 2BJML 3QQ3B 2GK0B 5DFTA 2KPNA 4WW2F 5C0DA 1J8KA 4NWTH 1MWAH 5D2LB 2YPLB 4MX7B 2NY0D 3CDCA 3CC5B 3TVMD 3MLWH 4PREA 3O4OB 2R2HA 1YYLL 5EORL 3BXNA 5BRZB 2G9HA 1FDLH 4H88L 4HT1L 3WLWD 4PS4H 1CR9H 3VG9C 1RIVL 2DBLH 4PRBA 1XF4A 3P9MB 5TE4L 3S36H 4NOFA 3IKCB 3QXAA 3LRHA 2YK1H 2VLJD 3HLAA 2GJZA 1J0KA 3MJ7A 1H8SA 4WTWA 3T0BA 3K46A 3OGCA 4P46C 4RCAA 3WXVL 3G6AB 1A4KB 4RZCA 4LPVA 3QHZL 4K9EL 3MA9L 1NBZA 4LMQI 1QKZL 4O4YH 5CINH 1A3QA 4P3CL 3MGAA 4RMRA 4HZLB 3ULVE 3SDYH 3L95A 2NY3D 1YUHB 5L0QB 3K8LA 4HDIA 4C56E 2R4SL 3GM0A 3DVNA 1SBSL 3FB5B 4XP9L 4LPTA 3UO1H 2W59A 1Q8MA 3ARFD 3BGMB 3WD5H 4KZEH 3UYRL 2MPAL 4A6YL 4JG1L 2V2WB 4OT1L 3QAZC 3DV6B 3KLHD 2OL3L 4WFFE 1PGRB 4KJQD 2H6PB 5GS0C 1DSFH 1QQDA 4M8VA 3QWRD 1WBZA 3TBYA 2EXYC 4IMKA 1J8HE 1YNTA 3X3FL 4KDTC 3T2OA 3TIDA 4GW4B 5GS1A 5FKAB 4EBQH 4CVXB 2HJKA 4B7LA 1GHFH 1IJ9A 4WEUD 3QA3B 4CU6A 3AAZA 4AENB 3S34L 1AY1H 4NM8H 5C08A 4LDLB 2ZJSH 5BJTA 1BD2E 5EN2B 5CEZH 3O6LH 4FXGB 4FTVD 2R2BA 5HXMA 1IGFH 2DTML 3REVB 3D3VE 2LAGB 2V2XA 3FFCE 3DXAE 3PQYB 4HGWB 4JFDA 3UTSE 4JQIL 4WFHE 2LABA 1OAZL 5LXGL 2YPVL 4FQCL 4F9PA 5BZWB 1NGYB 2DWDA 1LK2B 2F54A 1GZQB 4TUOA 4GBXD 2PTTA 3NIFF 3WE6A 2UUDH 5DC4B 5JHDB 3TNMB 4FP8L 2RBLA 1UXSA 1YYML 5DHVA 2VR5A 3QEUB 4H1LG 4QLRA 2X1PA 4NQSA 1FORH 4OZHF 5ICYB 1EIBA 3M07A 5CZXD 4S1RL 5EOTA 3FRPG 1WC7B 1DQMH 5I1LA 4LEOB 5J8OA 1FPTH 1W0YT 2UZYB 1FNEA 3I02A 1RUMH 4X9FA 3CFCL 1AC0A 3EO9L 4QRPD 4O2EB 1FC2D 3FMGL 3PWUA 3JVGA 3LEYH 4I0PD 3GB7B 4L3EB 4DZBA 1FN4B 3JV6A 4OQ1A 4DZ8A 1N7MH 4K3EL 4MD5A 3ZLQC 2R29H 5DWUH 1G7LB 3VW3L 5J12B 1JHKL 3MCLL 3TA3A 8FABB 5FDWA 4OD2B 4XNMB 4JM4L 5JW3L 3MLSH 1E4XI 4Q9QH 2ZP0T 4NSKA 1F58L 2V5MA 1FVEA 3NIGF 4QRRB 1HSBA 1GOFA 3GRWL 3OHXA 1JGDA 4HEME 1KPRB 4YWGL 4I77L 4X6DF 4Y16D 1IE5A 1HN1A 3R4DA 1S7WB 5C09E 2ERJC 1GC1C 3PE9A 4G7VH 4PJIB 4XMPL 4M5ZL 4NZRL 1EVUA 1ND0B 2HWZH 3BYYA 4O5LL 4XPBH 1F11A 4JJ5A 1DBMH 4PV8A 3NIFE 1JHLH 1XMWA 1YEJH 4IOIB 3MJ9A 3P4NB 1X5ZA 1D5IH 3VFOB 4RAUB 2X4OB 1JWSB 4OZHE 5JR1L 4H0IA 5IVNA 2JIXB 4WV1B 4ODWB 1H8OA 4ZPTA 3SY0B 3RJQB 3U36B 5J9PA 1T83A 2OX5A 4R4ND 3ULUD 3WEXB 5BVJA 2MOVA 4W81A 5I8CB 3V6FA 2HRPH 3G9VA 3KLSA 2XOTA 4AIOA 5FGCB 3BZ4B 4MZ2A 3VWKB 3X14A 3CSPA 1BWWA 3HRZA 3IRZA 1CGWA 1U9KA 3DSFL 3H42H 2DLTA 3IETA 1OP3K 1UWXH 2EYRA 4P23C 4RIRB 1I7TA 5D2NB 2YBRA 1KSRA 2F5AL 5L0QC 4HKZB 3T2NH 4U1MA 4P5MB 1N6VA 5ICXB 3GSRB 1ZLUK 4HK0B 4I9WD 1FNSH 2C7UB 3MJGX 3B43A 2CXGA 4YZFE 3NIGE 5ITFB 3HUJB 5HD8D 2I60H 2X1QA 3MC0A 1T0NB 1MUJB 1NCBH 1S9KC 4ZUSA 3Q3GB 5F9JA 4X6DE 1ZTXL 2DI9A 2UWEB 4PGZA 1G9NC 1FGVH 3WDHA 5C0IA 2JCCB 2XQBH 3THML 4CADB 3P4MA 5I6XB 1P2CA 1CDGA 2C1PA 5SWZA 4MJID 5D96B 5T5FL 3QWQB 3CX2A 4NZTL 1UWEL 4LKCA 1EV2E 1UVQA 2A77L 2CK2A 2BY0A 3UTTB 5T1LD 5LGKA 3K4ZA 3DX8B 4BSVA 3QFDA 1LO2H 2AQ1A 4J7RA 1ZGLB 4WWKA 1GAFH 3QJHB 1FC1A 5C0CD 3EOAB 2L0DA 3BD3A 2VDPL 2LV4A 5C0EA 2YHGA 3FO0L 5EU6D 1PLGH 3UTOA 5IF0A 1DLFL 1LGVA 1EGJL 4FQPA 2VXUL 3HPJB 2XWTB 5FGSA 4LF3B 2I26N 5DC0A 1UM4L 3DMMC 5CBEA 1NAMH 3ARDB 3U6RB 1WBYB 3U1SH 1S9YB 4PJXB 3DRQA 2IG2L 1A4JB 2R56L 2ZUWA 4RAVA 4Y4KB 5EO9A 4M6AA 4BJLA 5C08D 3R06A 3D18A 5IFJA 3O3AA 4UILH 3NACH 2ZNWA 1IFHL 3F7YB 3VFSA 1KT2A 4POZD 2X1OA 2PKDA 4PJAF 3SQBA 4ELMF 3BT2L 5HPOA 3HNSL 4XP5L 1CFTA 4WU7B 3K74B 4E42A 1E6JL 1PZ5B 4PRHA 4I4WB 2FECL 1EHXA 1NSNH 2ITDA 3TYGH 1JPSL 4GRMA 3FQNA 3K7UA 4M93C 3RVVC 3RI5K 1NCNA 1GZPB 4D0BA 4RQQB 1RZ8B 3MR9A 2WM0A 4PY8I 2YC1B 3KYNA 5J12C 5I8EB 1KB9J 1AO7B 1F4WH 4CW1A 5E6IB 1Q0XH 2VN4A 4NKMA 3IDGA 1EJ6A 1ZHNA 3S3PA 2AQ3A 2KZ1B 2HLAA 4TPRH 2Y07H 1I1YA 1A7NL 5JPNA 4I2XB 5C0JA 4F9LA