1RUC1

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52035
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKISLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords RHINOVIRUS 14
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruc100
2RM23 1F2NA 2ZTNA 4IV3B 4GMP0 1WCDJ 2Y26A 2DF7A 4GH4A 2R071 1X33A 1HRI1 1BMV2 5ABJA 4N43A 4CDQB 2BBVA 2X5IB 3VDDB 1IHMA 1HXS1 4CDUB 1Z7S3 2HWE3 1PIV1 1HRV1 4GB33 4AEDA 3VBHC 1PGW2 4N43C 1PGL1 5C4WB 4JGZC 4QPGC 1BEV1 4GB32 4GH4C 4CDXB 2GH8A 3CJIA 5CFCB 4RHV3 1RUE2 1QJU1 1VBA1 5D8AB 4IV1C 4NWVA 5BNOC 1EAH3 2HWF3 1AYN1 1RUF3 1NY72 1VRH1 4RR3A 5C8CB 1NCQA 5DDJ2 1AR63 4CEWB 1NG0A 1QJY1 1OPOA 2IZWA 1R093 5LK7B 4Q4Y2 1D4M3 2VQ0A 3ZFEC 1HRV2 5J96B 1POV1 5CFDC 1NCRC 1RUJ3 3TN92 5ACA1 2MEV1 1AR82 4NWWA 3VBFC 4CDQA 1RUC3 3CJIB 1OHFA 5K0UA 1TME1 1VBB3 2QQPA 3J8F1 5C9AA 3ZFEA 1NA1B 1R1A2 1RUG1 1RVF1 1R082 1NA1C 4JGYA 5CFCA 1H8TB 4CEYC 1NCRA 1RUH2 1RUD1 5A32B 5AC93 1B35A 3CJIC 2WS93 3VBRA 1CJDA 1VBE2 5CFDB 1EV11 4RHV1 5C9AC 3NAPA 1AYM2 3VBOC 2WWSA 3JD73 3VBUC 2HWD1 1RUG2 3VBHA 4JGZA 3JD72 1VBD2 1AR93 1AR81 1TMF3 1HX6A 1PGL2 2WFF1 4Q4W1 2PLV3 2RS33 1QQP2 4Q4Y1 4YVSA 5L7OC 5ACA3 2R041 4QPGB 1RUH3 1D4M2 1RUC1 4RR3B 1QJX3 2RS11 3VBHB 5BNNC 4SBVA 1NCRB 3ZFEB 1V9U3 2HWD2 1RUD3 1QJU2 1AYM3 5K0UB 5BNNA 2HWB3 4CEWC 4GMP3 5C8CC 2HWC3 1MEC3 1AR71 1C8M2 4IV3C 5BNOB 5D8AC 4FTSA 4RS5B 4IV1A 5A33A 5ABJC 5CFCC 1RB8G 3M8LA 1R081 4YVWC 1FOD3 5A32A 4CDXC 1E57A 4Q4X3 2ZAHA 4N43B 1PO11 3JB4C 5ACA2 1TMF1 3TN91 1K5MB 4RFT0 1ASJ2 4WM8C 2HWE1 3VBOA 1FOD2 1W39A 2RS31 3NAPB 1OOPB 4RQPB 1AL22 4CDXA 3ZFGB 4CDQC 1PVC3 4YVSB 1RUF1 5BNPB 2R061 1RUI1 1MQTC 2WLPA 1ZBE2 4RS5A 1NCQC 1ND3C 1QJY3 1C8M1 1ZBA1 4QPIB 2RM21 1VRH2 1R091 2RR13 1BBT2 2WZR3 1MEC2 5C8CA 1V9U1 1FMD2 1ASJ3 2HWF1 1F8VA 4AEDC 1RUE1 3ZFFA 2HWB1 4GMP1 3ZFGC 1A6CA 1OOPC 4QPGA 1C8NA 3VBFA 2RM22 5FMOL 1NOVA 4WM8B 1D4M1 4WM7B 1FPN1 4N53B 1RUJ1 1Z7S2 1BEV3 4QPIA 1AL0G 1COV1 2RS32 1RMU1 4JGYB 1FOD1 1COV2 4YVWB 1NA1A 4CEWA 1QQP1 1HXS2 1QJZA 2WS91 3S6PA 3TN93 1VBD3 1TMF2 1K5MA 4QPIC 1PO12 1RHI3 2XBO2 1MQTB 4EJRA 5JZGA 3JBG1 2HWF2 4FSJA 4PDWB 4RQPC 3NAPC 2HWC2 3VBRB 4CDWC 1B35B 1C8M3 1VBC3 1AR72 1ZBA3 1ZBE1 1HXS3 2RS53 1K5MC 3VBSB 1PIV3 1HRV3 1ND2A 3FBMA 4RR3C 3JBG2 2XBO1 5FOJB 4FTBA 4N53A 3VDDA 1TME3 1VBB1 4LLFA 4Q4V2 1R1A3 2RMU1 1AR91 5FMOS 1RUG3 1PO22 1QJX1 1RVF2 1TME2 4Q4V3 5ABJB 1AL23 4RS5C 5CFDA 5C4WA 2RS12 1FPN3 2R042 1RUC2 4YVWA 2WS92 1AUYA 1EAH1 1FPN2 2R043 2MEV2 5K0UC 1HQNA 5J98B 3IDEA 4WM7A 1GFF2 2FZ1A 5DDJ1 2ZZQA 4CEYA 2R073 5BNNB 1QJX2 1BBT1 5D8AA 1NY71 1FMD1 1MEC1 1AR73 1ZBA2 2WFF3 5L7OB 1H8TC 2HWB2 1V9U2 1BEV2 4GB31 1QJU3 1EV12 1VBA3 1VBC1 1ZBE3 1RVF3 2RS51 2BPA2 2TBVA 1R083 1RUH1 1RUI2 5AC91 4FTEA 1PVC1 1PGW1 1X36A 2GSYA 2FZ2A 2HWE2 2RMU3 3VBUB 3VBSC 1PO13 1VB2A 4PDWA 1EAH2 4Y4YA 3VBOB 1B35C 2WFF2 1POV3 4CDWB 1AL21 1BMV1 5C9AB 2RR11 2BFUS 3HAGA 4BCUA 3JD71 2RR12 5L7OA 1PO23 2HWD3 1VB4A 3JB8A 5AC92 3J8F3 1RUI3 1PVC2 4IV1B 5A33B 4CEYB 5BNPA 3ZFGA 3LOBA 2MEV3 1AR62 1VBE3 2XPJA 1VBC2 1CD3G 4WM8A 1H8TA 2RS52 2PLV2 3ZXAC 2X5IA 1BBT3 4JGYC 1RUE3 1AYN2 1RUD2 1RMU3 5C4WC 3VBFB 1FMD3 1SMVA 4Q4X2 4WM7C 2RS13 1MQTA 3J8F2 1R092 3VBRC 2X5IC 4PDWC 5GKAC 1HRI3 3DPRA 2BFUL 3VBUA 2R062 4AEDB 4Z92B 1PIV2 1RUF2 1AR83 1EV13 3JBG3 1QQP3 2WZR2 1RUJ2 1Z7S1 5JZGC 1RMU2 4Y5Z0 1VBD1 2WZR1 4CDUA 1ASJ1 1HRI2 1QJY2 4Q4Y3 1POV0 3DPRC 3ZFFB 1AR92 5BNPC 2RMU2 4IV3A 4Q4W2 4YVSC 2R072 1PO21 4GH4B 2XBO3 4JGZB 4Q4W3 1VBA2 4CDWA 4Q4X1 1ND3A 1M06G 1RHI2 1ND2C 4N53C 2PLV1 3VBSA 1VBB2 4Q4V1 1ND2B 4CDUC 1COV3 1AYN3 1VBE1 1VRH3 1AYM1 3VDDC 1DDLA 1AR61 4RHV2 2HWC1 1OOPA 2BUKA 5BNOA 1R1A1 3DPRB 3ZFFC 2R063 1VAKA 1RHI1 5JZGB 4RQPA 5DDJ3 1ND3B 1NCQB
chains in the Genus database with same CATH superfamily
3ILRA 2BU9A 1RL3A 4A4AA 2OVUA 3B9IA 2YDEA 4CCLA 2CHHA 3OGSA 3GBGA 2ZACA 2BDRA 4JAAA 4N43A 4X6RB 1AXYA 1HJFA 3ECQA 1E5HA 1L7LA 3RVHA 4Z1VA 5C33A 2G9FA 3AK0A 5C8WA 4LO7A 4LO6B 4YGBA 4E4ZA 1YO8A 1O4TA 3A0KA 2MHFA 3H0OA 3ZYRA 5LA0A 3QH7A 4XETA 2HLEA 1ULFA 1TZOA 2BEOA 3VBHC 2B42B 3IB3A 4N43C 1PGL1 2ZX0A 5CG9A 3V64A 5DUUA 4I0WB 2D5HA 3I2DA 5FK8A 3ZXEA 4AQ6A 4ZZ8A 5C4WB 3KWVA 1GZ9A 3LA3A 1H4HA 1TEIA 2XDVA 4XBLA 5I8YA 4DPNA 1OPMA 2W47A 2QDNA 4XACA 2AR6A 2B46X 3THDA 1K5JA 3I54A 3WNPA 3ZN6A 5F1RA 3LFMA 1GP6A 2HYKA 1QJU1 3WF1A 3NNFA 3N7KA 4I2OA 1VBA1 1ZZ7A 4YZ3A 3VKNA 4IV1C 5L19A 2W9XA 1K12A 3LQCA 3MF9A 1GWKA 1PVXA 5KHHA 3RYKA 3FMGA 4CEWB 4N90A 2VVDA 3RYPA 4NMIA 4CVUA 4BK5A 1NLRA 1DHKB 2CY6A 1OPOA 2I2SA 1DG6A 4FQZA 4META 3PVNA 5FYTA 3USUA 1Z78A 1WKYA 3RWKX 2QQOA 1SLCA 4E8CA 5B4NA 1YRZA 2VXJA 3MIBA 3MHZA 1HRV2 4NUBA 5C5UA 2CGNA 2FMYA 5FKBA 5CFDC 4HL0A 5G05L 2DVGA 3B94A 3POBA 1C4RA 4YW3A 3VD3A 3BTYA 4HKLA 3ZM8A 4OUEA 4NWWA 4CTEA 4OQ8A 2ZX2A 3MFCA 5GLVA 1MZEA 4LITA 1XNDA 5FP4A 3WVJA 4YZ1A 2XKPA 1OXCA 4KG8A 1Y9QA 2H0BA 2ZKNA 4LUKA 2P5BA 1J1LA 2FDGA 5C9AA 3ZFEA 2C9KA 2IWGB 2XONA 5FTTC 4BA6A 4LBQA 5FR3A 2D3SA 2WN2A 2ZCWA 1H8TB 1YJKA 5GZEA 1NCRA 1RUH2 3FHQA 3RS6A 2OIIA 5ERLA 3MBWA 5JOYA 2W2IA 3CJIC 3RYRA 4ZZ5A 1W2NA 3SH5A 3KGLA 4WVMA 3UESA 3ZPYA 3LSDA 4AI1A 3B69A 5A3PA 1JHNA 2RDRA 1C5HA 3CO2A 4YGCA 4GWMA 1LEDA 4UI9L 3MLKA 4Q2FA 5C9AC 5JDBA 3NAPA 5EWSA 5FZLA 3VBOC 2WWUA 5E88A 5FAXA 4DRRA 1NZCA 3AMPA 4QHZA 2C1FA 2VTXJ 1ZZ9A 2GAUA 2HWD1 2VVEA 4OUMA 4ARYA 3MW4A 4AL9A 1BVP1 3C7EA 2CV6A 1XSRA 2NM1A 3WCRA 4AI0A 1ZRCA 1QNWA 3N9QA 3LEGA 1VBD2 1XE0A 3TB0A 2EXKA 1N1TA 3TWIA 4XILA 3N36A 1CQ9A 1TMF3 1WMDA 1REEA 3PU3A 4BQ1A 3H7YA 1OLQA 1O5LA 2HJIA 3VKFC 5K4LA 2Q1MA 2PHUA 3GHMA 4ISQA 4Q1RA 5FZKA 2DCKA 1QQP2 2RS33 4IE4A 4BQ2A 4PIYA 4Q4Y1 4QKBA 4Q0SA 4XOGA 2OUHA 5C3QA 1K42A 1UYZA 3TBDA 2EIEA 5ACA3 4M01A 4MHRA 4LKEA 4NOTA 1W6PB 4QPGB 4XFCA 3MIFA 4AR2A 3T2OA 3RNSA 4Y20B 1QJX3 3U78A 1QOTA 2RS11 4Y5TA 3P3PA 4HBNA 2YG0A 2KM2A 2L9LA 4BIOA 2YU1A 4KBBA 5KBFA 3ZXFA 1GNZA 1ZRRA 5F3GA 1GKBA 4ISRA 2VNVA 2BGOA 3KHCA 3KB5A 4BOWA 1ENRA 1V9U3 5GZGA 1W05A 1UOGA 3NNGA 1RUD3 4XUQA 1WGPA 4LLOA 4DOUA 4CUAA 5K0UB 4ZU4A 5A1FA 4A42A 2W95A 4YLZA 2A6VA 1ZA4A 1ZRDA 4MLOA 4IGQA 4MGIE 1MEC3 1N1YA 3VZOA 3OGJA 1JZ8A 2JICA 5L9VA 5BNOB 5FO7B 4YNIA 1LR5A 3T0AA 4NR1A 2QVSB 4RS5B 4MSVA 3EXUA 3NV2A 5D1IA 1KFXL 3KMHA 1DQ1A 5ABJC 1NX9A 4XCAA 5JOZA 3FWEA 1QH7A 2XLFA 1C1LA 3KHBA 1Y3TA 3Q8FA 2D40A 4FP2A 1CWPA 1ZNPA 1W8FA 3IDCB 4XE9A 3VKLA 3ILNA 4O65A 4Q4X3 2JG9C 1JH5A 3NQHA 4NJ4A 3S30A 2ZGOA 2ZPXA 4XBQA 1AVBA 3UKVA 1SPPA 1ASJ2 2XOMA 1XYOA 4WM8C 2B7YA 1FOD2 1YQ6A 3VZKA 3IDBB 2AYHA 3NAPB 4UF0A 1OOPB 3H3UA 3N9NA 4RQPB 4INDA 1W2TA 1YEWA 2FBEA 5FP9A 5FPLA 4QKFA 5L9BA 2DYCA 2VNRA 1H2MA 2OPWA 1RINA 5FY8A 4DXSA 2DCYA 2XHKA 3KCXA 1NYWA 2DUQA 1SFNA 2O0OA 4XJ9A 1JZ3A 3ES4A 2BVBA 4LNVA 4QX0A 4RS5A 1ND3C 4HOOA 1ZBA1 2RM21 4Y4RA 5CA6A 2HEYF 4JKKA 4QXCA 5CG8A 2NPIA 4V2VA 3ZXKA 1LU2A 1W9WA 3LGRA 4DUWA 5E89A 5C8CA 1V9U1 5FZ3A 4FAHA 4BB3A 2B45X 2VCAA 3AP4A 1VLNA 2HEWF 5DAXA 1RUE1 2HWB1 4L8QA 1XNBA 2VZSA 2GC2A 1A6CA 4XQ4A 2RJLA 4JZRA 4ASMB 1OOPC 4QPGA 1OVSA 5IWFA 3UYJA 4LBJA 5CYYA 3NKTA 1D7PM 4MVTA 3WF0A 4DS0A 3PURA 1XYNA 1NOVA 1D4M1 3A22A 3N35A 4HMZA 4FPCA 5L36A 3N7JA 4W8JA 2ZA9A 4OHZA 1Z7S2 2EA7A 3TNPB 4QPIA 1ZREA 4B1MA 1AL0G 3WG1A 3N9OA 2RS32 4JGYB 4KG0A 3DGTA 3I3BA 1UQXA 2D93A 3RMXA 4YVWB 3HOBA 3CZJA 2AZ5A 2LTNA 2ZS6B 2X05A 5A6YA 5LA1A 4Y3OA 4Y1XA 3KM5A 2VNOA 4RGAA 4WV8A 3V65A 1WCSA 2A7AA 2J1AA 1IKPA 1PO12 5J36A 4C90A 1UL9A 3RI9A 4IDZA 1O3TA 1DLLA 2V09A 5T50A 5SV5A 1CZVA 1H0BA 2VTFA 3JBG1 5GZFA 2HWF2 5LWBA 3T30A 2E6VA 4YFZA 3ZYJB 1PGSA 1G8WA 4KQ7A 2ARAA 1OD3A 1UOFA 2YC2A 3I2FA 4BWOA 2CGPA 2A3YA 4QHBA 2HWC2 3LIHA 3VBRB 1DBNA 2PA7A 4AEMA 2MNGA 1PM4A 4FFHA 1DQ2A 1VBC3 1ZBA3 4LUMA 4MGQA 3WUDA 2EF6A 5IFTA 2R30A 2ZGLA 5FYBA 5C5TA 2RS53 1RUOA 5F2WA 4XJAA 5A3TA 2D6OX 1UXZA 1BKZA 3AZVA 5DPNA 1AXZA 2WKKA 1SBEA 2XUEA 2RG4A 3POJA 2VUJA 4UW5A 5A1AA 1IPSA 4O7XA 2SBAA 3HR9A 1W0OA 3NV1A 2RMU1 1QJEA 4MGZE 1W90A 2E9QA 4IEPA 1PO22 2PQSA 1QJX1 2W39A 1TME2 4Z07A 3C7HA 5C71A 3BYWA 2ZGSA 2ZKLA 3O1VA 5KC6A 3I49A 2QFEA 3AFKA 2IXIA 3A21A 3NVCA 2VW2A 1X9PA 4KWLA 2BWCA 5CFDA 4Y1ZA 4EZHA 1VIWB 1LAJA 5FZ8A 2J1VA 4P9GA 2R042 1O7FA 1IKQA 1RUC2 2D98A 2WS92 4IERA 1D0GA 4DB5A 4QGLA 3H8XA 4AAXA 5FLIA 4D7TA 4KBZA 1EAH1 3AZYA 2WABA 1X50A 5LY2A 4XEZA 3AYCA 1LCLA 4F3JA 2XH6A 1JZ6A 5J98B 4LE3A 3I97A 5JXHA 5LB6A 4PT6A 4WM7A 4AHZA 1UZVA 1GFF2 1DGWX 2XGXA 1Y43B 5LEJA 4PHZA 4FPOB 4XF1A 4LA3A 1UU6A 4XF3A 2IXLA 3SH3A 3PTRB 4DFSA 1LU1A 1U5ZA 2ZGKA 3LDRA 4FPLA 3ITQA 4OLLA 3BCWA 3DN7A 1O4ZA 4XXAA 5D8AA 4QKDA 3O1TA 1NY71 2EXJA 1UY0A 2OKXA 4IL7A 5L7OB 1AR73 1Q8VA 3H9AA 3Q9OA 1BK1A 1KXGA 1UAIA 5IVBA 2HWB2 3I3QA 1BEV2 2Z4FA 4QX3A 1JI6A 2K2SA 3TEWA 1VBA3 3FL7A 3E1F1 3LA7A 1JYXA 1S0BA 1RVF3 2RS51 3OY8A 4L92A 4Q0VA 1WW5A 5A80A 2W08A 3MV11 4UFIA 4COVA 4R9AA 1RUI2 2WO7A 3AXEA 2VCCA 3DEMA 2R7EB 3OTFA 1WWYA 3H3ZA 4XC9A 5FMBA 1D2SA 2JDKA 4CXXA 1APNA 2Y34A 3VBUB 3VBSC 2Q0AA 2VZ1A 4D3WA 4K21A 5FREA 4ES8A 4XF4A 1ZZ8A 4FXKB 4IETA 4O9EA 1JYCA 2XJPA 3ZIXA 3O5SA 1KDMA 2VZOA 3KZ4C 2VZVA 5A7OA 1EP0A 1QOSA 1UWWA 2RR11 1XOYA 4OHWA 3HAGA 3NL1A 1F9KA 5FYZA 4D7YA 4CCMA 3JD71 2RR12 5F9TA 3WDVA 2V72A 3KLSA 3VZLA 1AJKA 4CCCA 5L7OA 2WO3A 3POIA 2NZ9A 4NAMA 5EXOA 1IS6A 1WA6X 2V5YA 4XFFA 1UOJA 5L73A 3W9AA 1CAWA 1YYNA 5DXDA 2YY1A 3I7DA 1W6OA 4IV1B 1JYNA 4PI0A 3PUHA 1ODMA 2VMDA 4P9WA 2ZGRA 5IK5A 5J09A 2E7TA 4LHNA 1CZSA 5CADA 1BJQA 2VD7A 4E27A 4URTA 1GZCA 1MS4A 3KT1A 4K8FA 4FOQA 1Y4WA 5A7NA 1U5XA 3BPZA 3W5NA 3TNQA 4CSWA 2RS52 3PMSA 5BPXA 1YUDA 2QUOA 3ZXAC 5LBFA 3U14A 4NIGA 4JGYC 1RUD2 3HEIA 5C4WC 3VBFB 4JRLA 2WNVA 1FV3A 2VULA 3L9JT 2WT1A 3WV6A 4Q4X2 1OFSA 5CU1A 2OX0A 3WHTA 1S2KA 3PJQA 1MS5A 4H2AA 1MQTA 2C4XA 3J8F2 5EZWA 3WF2A 4BQYA 2QQMA 1V6MA 3E97A 4ZXKA 3SQOA 2D43A 3EO6A 4CPBD 4PDWC 3M4FA 1HRI3 1RIRA 2BFUL 3DPRA 5AVAA 2R062 4Z92B 3UK9A 4P9XA 1PIV2 3I2GA 4EN0A 3JBG3 4HPKA 4EWEA 3MO4A 4XUOA 2X09A 2JDAA 3I3DA 2A71A 4NO4A 1RUJ2 1WCKA 4TZDA 2WNEA 1OH3A 1YQ5A 4Y5Z0 3D3AA 4FFFA 4WVVA 4QU2A 2X29A 1ULEA 3AKQA 5DUVA 1KS5A 3WQ0A 4Q4Y3 1POV0 2VMGA 3DYMA 2RV9A 2D6NA 4BIFA 1ZRFA 2QQVA 3OCPA 3SEPA 4AFDA 5FY9A 5M0TA 3OPTA 3ROUA 4YW2A 3POEA 4K6BA 2OW4A 2BZDA 5JI9A 1J3QA 1YXWA 3GF6A 3P5BA 1CVNA 2D6KA 2ERFA 5F5IA 4CDWA 1JZ5A 3DL3A 2X8KA 5DAVA 4QDRA 5FXZA 2W5FA 4DEVA 5FUIA 4Q27A 4H3WA 1CIYA 1S4CA 1OBNA 4NROA 1VE0A 3F2ZA 5FZ0A 5A3MA 1ND2B 4YG6A 5GM0A 2YV8A 3AKSA 5FZ9A 4S2DA 2YFUA 4XYXA 5KHGA 4GA9A 1J3PA 4Y20A 3VDDC 2JB4A 1G9AA 1W2AX 2C0ZA 3E5QA 1FNYA 4M4RA 2HBUA 1VP6A 1OOPA 2RJKA 3I2HA 3AP5A 5FIXA 1XYPA 1LNSA 4A41A 2VR4A 3TYJA 3WP3A 1IG0A 3IM0A 3R05A 4L99A 2PELA 1XRUA 1BLZA 5GLUA 1OQEA 1ZZBA 2GU9A 2YBKA 3GHNA 4M3CF 4SLIA 5FJHA 3WDTA 3WP4A 4A45A 1NCQB 4LA2A 1PZ9A 2YGLA 1F2NA 5HBAA 1WCDJ 2ZMKA 2Y26A 1U5IA 2ZX4A 4LBMA 4FP3A 3VD5A 3CHXA 3PUAA 1HRI1 3S5QA 3ACHA 2DCTA 3WZ1A 4IE6A 2PAEA 1LHOA 4IUGA 4YYOA 5JLVA 4A7KA 2Q8DA 4LHLA 1J3RA 4IEQA 3ZDVA 2VOTA 5JWPA 2BNOA 3B00A 2B9UA 4HLTA 3NKGA 2LS6A 2LW8A 4PQQA 2RDNA 4IXLA 5J1XA 2VOWA 3CF6E 3MUZ1 3DKWA 3J7LA 4RSUA 3UJOA 3S5AA 4OHVA 1HW5A 2EIBA 2WZEA 1OQDA 4LBQB 4COZA 4GB32 4CDXB 1V6JA 5T5JA 4AF9A 5K8SA 5FZDA 1RITA 4JKLA 3RMYA 1W6QA 3WW4A 4QX5A 3CJIA 1GICA 5CKQA 5CFCB 2ARXA 2ZEYA 3POSA 4IEWA 1HN0A 3K48A 3O0XA 4LK7A 4QX8A 2IFRA 3OF1A 1W8NA 1UMHA 1DIWA 5D8AB 3ZSEA 3AKRA 4Y1YA 1NXD1 1EAH3 1O8PA 1RUF3 5FCCA 1NY72 5T55A 3E6CC 1W2OA 3WR0A 2W52A 4RR3A 1I5PA 1JW6A 4GULA 3SCGA 2GH2A 2Q1FA 4R52A 3WQ7A 2EVXA 4TWTA 1NAEA 1YIFA 4ZU5A 2KXLA 5LK7B 1FAYA 1SCSA 2A73B 1DF0A 1X9TA 2VQ0A 4I01A 4QPYA 1SFPA 1DCSA 2YXSA 2W92A 3OJBA 4P00B 5H9RA 1RUJ3 4QAWA 4W6WA 3TN92 3VBFC 1O3SA 5JXJA 3WOGA 2BVVA 2EICA 1RUC3 5I91A 5E6HA 3CJIB 4EN7B 1CR7A 2V4AA 5K0UA 4YM3A 4TLFA 5EQUA 3P6BA 4AE2A 4KI5M 3ACFA 2DFCA 1VALA 5A7PA 1F35A 1O59A 3ZYBA 1RUG1 3ACGA 3WXPA 4AXOA 4URAA 2WSVA 5HI0A 3FC0A 2CAVA 4JGYA 1V70A 5DAQA 2PAMA 5A32B 3BOWA 4IEUA 4B4PA 1B35A 4XQWA 4BJ0A 4AW7A 3DV8A 5CISA 4LE4A 3WDYA 4R8HA 2WS93 3N4MA 4QX1A 1ZRIA 4B4RA 2WYFA 3O1RA 4CP9A 1UKRA 4XTPA 1KITA 3ZKUA 3WNNA 4GKYA 2F6BA 3OGVA 1LHVA 2CDPA 4QDQA 2A6WA 3HQXA 3ZXGA 5K7PA 4EQVA 4AVAA 5FZ1A 2ZMLA 5FBZA 2QTWB 1EUUA 1MPXA 1L7RA 2VH9A 3PVOA 4NPMA 5T52A 3NMBA 1MS0A 1RUG2 2YGMA 3BUCA 2ZGQA 5I93A 1NT0A 5FK7A 4DXZA 2NMNA 3ZN6B 1UOBA 3MICA 4HN0A 4P08A 1PK6A 4JTNA 2NQYA 1AR81 1UZ0A 3PNAA 4NIDA 3VKOA 4HVQA 2YZ4A 2IXHA 4Q4W1 3ATGA 3KF5A 3ZSMA 3T0DA 1OA2A 4FPFA 4YWAA 1DYKA 3USSA 2B5HA 2ZHLA 3PHMA 1IS5A 3CU7A 4TLGA 5FY5A 2R32A 4YVSA 4E9KA 1LOCA 1GQHA 4MGKE 1H4GA 5L7OC 3W5MA 3ZIWA 3OY8B 4UF0B 2P1BA 4TYSA 1RUC1 4QX2A 4RR3B 3AKTA 3HNMA 3RZZA 4G4FA 4K8RB 5FQ0B 4ORFA 1SEFA 3VBHB 1XB9A 4LO8A 1SCRA 5BNNC 4FPEA 2KR2A 1UYPA 2X10A 4LHKA 4MOAA 2AREA 4HN1A 3ZFEB 2JIJA 3LB9A 2JD4A 1RC6A 2QQNA 3M3CA 3MIGA 4BPZA 1JMUB 1VMJA 4DEQA 2HWD2 3PU8A 3THPA 3ACIA 1AYM3 4OI1A 3THTA 1KRIA 5BNNA 4AQSA 4XDPA 4GMP3 3AJZA 1GLHA 1XQNA 2HWC3 2BNNA 1AR71 2Q4SA 4JCKA 5EJZB 1DP0A 5FP8A 1C8M2 3PTYA 5C3PA 1ULOA 5D8AC 2AENA 1A8DA 1PNGA 2VZ3A 4R9BA 1ST8A 2DCJA 2EXHA 3H8UA 4P02B 4YM2A 2J1TA 1FATA 2HBTA 4IV1A 4PJYA 4XURA 4XJUA 5CFCC 1RB8G 1LOEA 1IOAA 2GNTA 1JBCA 3OPZA 1X7NA 4YG3A 2DVDA 4QGMA 5A32A 1RYYA 4CDXC 3APBA 4COUA 4JHTA 1E57A 4Z8BA 5A70A 2GDFA 3GM8A 3J4UH 5GLTA 1JOPA 1FT9A 1PO11 2CGOA 2JDZA 3JB4C 5ACA2 4Q0UA 3BODA 4WVZA 1K5MB 4JDMA 3D0SA 3LAGA 4RFT0 3J7HA 2PHTA 4XVHA 4EROA 4OI2A 2JECA 3RZMA 3BI3A 4LMFA 1LHUA 1PMIA 1AL22 4B1LA 3ME2A 2VMHA 4ZS2A 3ZFGB 1PVC3 2IFWA 2WNUA 1F31A 3VL9A 5ANNA 3EJKA 1GANA 2ZGPA 5BNPB 1NLQA 3D5OA 1UYXA 3NRUA 3V0AA 2R061 3KSCA 1RUI1 1GMMA 1C3HA 1CPNA 2WLPA 2JDHA 1LGBA 4K1YA 2JJ6A 1F4HA 4C91A 1NCQC 1MS1A 1C8M1 3LIGA 4A44A 1P8JA 3V0BB 1N3OA 3WW2A 4XIOA 3QOPA 3HPNA 1ASJ3 4ZXEA 4R4XA 1MZ5A 5F8PA 4OI4A 4G9SB 1D4VB 4AEDC 4C0HA 1IZ3A 5A7QA 5AFBA 2OS2A 5DMYA 4AI9A 4GZ9A 1NE6A 4Y22A 3ACLA 2IVJA 3S0MA 2RM22 1U5YA 3DKQA 2IXJA 4Y1UA 4LO5B 3W20A 3AVRA 4WM7B 4D69A 3LZZA 4N53B 1UZWA 4A7YA 1BEV3 4PLOA 3KV5A 4P9JA 2VO5A 3UT0A 3LD8A 2G19A 5FYSA 1COV1 4H55A 5EJ1B 1F8VA 3FUOA 1COV2 2J1SA 2QBXA 3WQBA 3T4HB 1XU2A 5EIYB 4BQ3A 3EQEA 3LFIA 3C8XA 4CEWA 1QQP1 4GWJA 5FMDA 5FKCA 1AZDA 2DU1A 2WS91 3A4UA 3S6PA 3HNBM 2D3PA 5CB7A 4ONUA 1LGCA 2QQJA 2RDQA 2WT0A 1F4AA 4LKFA 4MGSA 4QPIC 2WBKA 4W4ZA 2E63A 4EJRA 1JHJA 3KVAA 3WX5A 4AFCA 4KGGA 2LM3A 1H6YA 5B2GB 4QU1A 3OGGA 4PDWB 1N3PA 3HQRA 5FRAA 5IVCA 3ORJA 4LT5A 1JYIA 4RQPC 2ORXA 3I3MA 4S2HA 2CWSA 4X8PA 4CDWC 4FOVA 4N7UA 1B35B 1C8M3 2VC9A 1FYUA 1AR72 4HSLA 4IGPA 3WHUA 1HXS3 1ONAA 3IAPA 3M70A 1PIV3 1HRV3 2QZ2A 3FBMA 3M3QA 2XWBB 4QXBA 4RR3C 1CIWA 2XBO1 3IMMA 4WZCA 4AG4A 4ATEA 5FOJB 1QOOA 3ON7A 3VDDA 2W1QA 4LLFA 1QWRA 2YHJA 5BXXA 3U11A 5A3NA 1DYPA 1YQ2A 5FPBA 2DTYA 3FHIB 2K9ZA 2ZX3A 4M3CA 4Q4V3 4DIQA 1YNAA 4JC1A 4LORA 1N47A 2JDYA 1UY4A 4RGKA 2RS12 1WMXA 2VGDA 1LULA 1AUYA 4I09A 5KXEA 4HANA 5DZFA 3EHKA 3BN6A 1FPN2 4JTOA 1UXXX 1AX2A 2ZOEB 3FLRA 3GBWA 4I30A 5K9YA 5FY1A 1JXNA 4NVPA 5K0UC 3VZMA 4BE3A 5LA9A 4CU8A 4IW3A 1WW7A 4CRQA 5FZIA 4R9DA 5DDJ1 1H2LA 2ZZQA 1IGOA 1W8TA 5LASA 4GD4A 2BYVE 1IPKA 1URXA 4IE5A 4MYEA 1W9TA 1LOAA 3GALA 3WINE 1HIXA 1S2EA 3DXUA 3SC7X 1W6MB 3UKTA 4AVTA 1QJX2 2P34A 5H9SA 4AQTA 2QZ3A 1BBT1 5T5PA 3VUOA 4LIUA 2F17A 3DXTA 3C7FA 2UY8A 2WFF3 4COYA 4PLMA 1IPJA 5SV8A 4Z2AA 4EN8B 2BGCA 1V9U2 4UYBA 4FOWA 2ILMA 5H9QA 1JZ7A 1GQGA 1O91A 2ZHKA 2A1XA 5F32A 1WD3A 1QXRA 3VDBA 1ZBE3 1CGPA 4B3NA 2A3WA 4GXLA 1KQRA 3BTAA 2VBDA 4XF0A 4UW4A 3SHRA 3WDUA 3ZOIA 4FPGA 1WW4A 5AC91 3NNJA 3USUB 3FBYA 2PFWA 1K3IA 3FN9A 2W87A 2C5DA 4YG0A 2VJXA 2FZ2A 1G9CA 1OUXA 1O8SA 5FZEA 3BGAA 1REFA 2RHPA 4PDWA 4QHOA 1EAH2 2ADDA 3VHNA 4UFLA 4AFAA 2DURA 4CDWB 4BK4A 4D94A 4ZKTB 2A6YA 1E5SA 2F4PA 1EPWA 3T0BA 1HN1A 2B8MA 2GNDA 3OSDA 4F83A 3BU7A 1YLLA 5JSOA 2HWD3 1XNTA 2XJVA 3IN9A 2XJTA 4ZPIA 1VB4A 5AC92 5JMCA 1C57A 1AJOA 3LWCA 5IFPA 1ULGA 2AC1A 3ZFGA 4JQRA 3LOBA 4CZSA 1NLSA 3ZVXA 3Q8AA 1W03A 1VBE3 1HB3A 2UY9A 3FLPA 3WT3A 4WM8A 2EAKA 3K4ZA 1UU4A 3KQRA 3SKVA 5F5QA 4UBHA 2PLV2 1OT5A 2X5IA 2AEYA 2P6CA 4NHMA 2VOVA 1RGSA 1RUE3 3KV6A 3WNLA 1RMU3 3ZXDA 1FMD3 5FBJA 3K3OA 3URFA 3AZZA 2DBIA 4MO3M 4BQXA 3RGBA 1D0HA 4WM7C 4E2QA 4IEXA 1W04A 1Y9GA 5HXMA 5JOWA 4CP1A 3FZ3A 4Q0QA 2BW8A 2XUMA 2ZMNA 5A3UA 3VBRC 5EYYA 2WR9A 4BXSV 1I6XA 4IE7A 4O9GA 2QJVA 5IT6A 1UIJA 3WP5A 4NHLA 2QQLA 3H1WA 4JV4A 2GP3A 3NSTA 4AFBA 3OBTA 3BIWE 1ULPA 2PAKA 3P1IA 2WZ8A 3EYPA 1JOJA 3SXWA 2R16A 4GKXA 1WLWA 2WZR1 5CEHA 2WL1A 4LR4A 4BDVB 3AMQA 1ASJ1 1HLCA 1HRI2 2DCZA 1GOFA 4DUVA 1NQDA 3DPRC 5GZCA 4CCKA 5BNQA 1CJPA 2GN7A 2P6HA 1S0FA 2Y8KA 2RVAA 4IV3A 2JKBA 1UPIA 4E4HA 3U0ZA 1PO21 1AXKA 2BBAA 4JGZB 4AAPA 5KXDA 1RJ7A 4XBNA 4Q4X1 5J37A 1SBFA 1ND3A 3JXSA 3OYWB 5ANQA 2RDSA 5FLHA 1F5FA 2OQ6A 2PLV1 5H9PA 4AQ2A 4PF1A 1UY2A 1X82A 5FO8B 1ZX5A 4Q4V1 5CNAA 1UW8A 2VZRA 3T2TA 1COV3 4R4ZA 4RFRB 5DAWA 1AYM1 1GOHA 2Z69A 2DUPA 1OI6A 2FDKA 4JX0A 1GWLA 4RHV2 3S7IA 4UFJA 2HWC1 2VECA 3GCWA 5JSPA 2Y38A 4NRQA 2GMPA 1R1A1 4ITCA 4AVVA 5BNOA 2K0GA 5JAXA 4MXWB 1GBGA 2Y6KA 4L0PA 3MZHA 2VE1A 1JS9A 1CAXA 5KR7A 1LGNA 4AGVA 2WSUA 2BGPA 3IWZA 1RHI1 1GYKA 4AEKA 5JZGB 1QJFA 3O0VA 2ET7A 3HD8B 2RM23 5FZBA 1S0DA 4IV3B 1LKNA 4EWAA 3ZYPA 3UV9A 3SISA 3GBFA 2DF7A 3NNMA 5L9RA 4D7SA 3ZKYA 4YSFA 2JDPA 4A2UA 3ZR5A 1H2NA 2C26A 1X33A 1XE8A 2Q30A 5A3LA 3IPVB 4KU7A 1JZ4A 2BBVA 1VPHA 2X5IB 3WG4A 4KWJA 1IHMA 1OH4A 3AL5A 5FY0A 4IEOA 2BNMA 3M2MA 3EB7A 1HXS1 2GZWA 3I4IA 4XCBA 4AYUA 3W59A 3O1SA 2Y6HA 5C3RA 3IDAA 2HWE3 1PIV1 1V6LA 2Q8EA 1HRV1 4YARA 4DUXA 4GQ7A 2J42A 3JUUA 1PGW2 3ZO0B 2XJQA 1WA4A 3PIGA 4JGZC 2YC4A 2BTVC 4TN7A 1N1VA 1SHWB 3VHRA 4I0BA 5FMCA 3JQWA 3OD4A 3C7GA 4Z82A 4CCJA 5KXBA 1QDOA 4TXWA 3U4XA 4LK6A 3ETPA 2GH8A 3OYWA 4WBBA 4JDOA 3T2PA 4UWDA 5FZCA 1JU3A 3ST7A 4Y5SA 1QU0A 1RUE2 1FXZA 1O3RA 3AKPA 4D8MA 1GNHA 3ZX7A 1FNZA 3J7MA 3QBQA 1Q3EA 4CXYA 2G4IA 4AVCA 3R4DB 1ZM1A 2R1BA 1Q8QA 4NWVA 3X29B 4CE8A 5BNOC 5I8TA 3M1HA 1I1EA 3KV9A 1AYN1 2I45A 4QQOA 5DDJ2 1AR63 3NV4A 3IAQA 5HV4A 2GC0A 2PHLA 4PCRA 3AYDA 3GCXA 1R093 2CSGA 2CWMA 3AXDA 5LBEA 3PUQA 3FHAA 2RJ2A 3LEMA 2HEVF 1POV1 5J96B 2XQXA 1SZBA 3WD5A 4LBKA 1G9BA 4P5YA 5ACA1 2MEV1 5CKNA 1AR82 2PHDA 1LHWA 3IZOA 2UURA 4RYDA 1OHFA 5DG2A 5FP3A 5JUVA 5FPAA 4MGTA 1UCXA 2ID4A 1TME1 1VBB3 4PIZA 4C8DA 3J8F1 1NA1B 4LOSA 2GMEA 3SKJE 1OF4A 1R1A2 2VQUA 4MHUA 5F7UA 1UIKA 1W9SA 4QX7A 1B09A 1V6IA 2SLIA 3QH6A 3B01A 3SCHA 4V2WA 2BOIA 4FBFA 1OFNA 1GU3A 5IVJA 2FDIA 1RUD1 2FQPA 5AC93 5EP9A 3HBZA 3K3NA 2WZPP 1VMHA 1WLTA 1DU3D 2XWJB 3BB6A 3T08A 4AVSA 3VBRA 3UGHA 2O8QA 3C3VA 3T1LA 1GP4A 2VCBA 1VBE2 3N3HA 4UW6A 4P14A 2WJSA 1OUSA 3VHPA 2ARCA 2WWSA 1PMHX 2RE9A 3NV3A 2WAOA 2FDFA 3AVSA 1Q43A 3RPQA 3T2QA 5JVVA 2DDUA 2Z42A 3BOPA 3K51A 2A70A 2V73A 3PLQA 4DXTA 3JD72 4PBPA 4XXPA 4OULA 1DYOA 1QEXA 2VUCA 4AGGA 4KL1A 5GALA 1AR93 1CAUB 3MI8A 3S57A 4IQPA 2E26A 4PQ9A 1Q8SA 2VPVA 1PGL2 4QKNA 4YM1A 3V0AB 1KJRA 3U37A 3N7LA 2YBPA 4DY3A 3HT1A 1GV9A 3MPBA 2PLV3 3IIAA 3AYAA 4NPRA 3TOJA 4EYUA 2FD8A 2Y6FA 1KDKA 4EZ4A 2R041 2E32A 4LKDA 5LA2A 4AHXA 1PK6C 4FFGA 1BZWA 3NO8A 1RUH3 1VR3A 1D4M2 3OG2A 4KU8A 3E5UA 4PF5A 1J84A 4K40A 1O4YA 5I0TA 1WW6A 4FOYA 4SBVA 4CU6A 3O1PA 4KWKA 3SNMA 4D6RA 2Y6GA 4DO0A 4C0BA 4QDSA 5GJ6A 5LZ6A 1TE1B 2XXZA 2IC1A 3JU9A 1ALYA 1DZQA 1QJU2 5F5AA 2WO1A 4QM8A 3LSEA 2HWB3 3AL6A 2DVBA 3PUIA 4XJZA 2HKXA 4CEWC 5JR2A 2QQIA 1HJGA 2WAAA 2Y6LA 5E16A 1OURA 3ETQA 1H9WA 4U36A 2WINB 1T2XA 4ZY9A 2OQ7A 4IEZA 4DINB 5J3UA 5JIUA 1V6OA 3WY6A 5FYHA 1TNRA 2ES3A 1S0GA 5DN2A 3UETA 2ZX1A 1XU1A 1V0AA 1DZTA 2LALA 4YW7A 1ZZCA 2IVIB 1PNFA 1LHNA 3I2JA 4NHYA 2XR4A 4QXHA 4D6SA 5IVEA 3OB8A 2IUWA 4AHWA 1LECA 4JKMA 4YVWC 1FOD3 3RFRA 3E6BA 2WQ8A 5FZOB 1N3QA 4MGYE 4N8MA 2ZAHA 5F3IA 3UGFA 3WUCA 4KWUA 4N43B 4N9IA 1WCQA 1TMF1 2D6PA 2DFBA 2VAUA 5FLJA 3TN91 4YPJA 4K1ZA 2VCMA 1XPWA 4L11A 4W6YA 5FZ7A 5C3SA 1ZA7A 5JOXA 3VBOA 5E1RA 5F3CA 4ATFA 5DG1A 2RS31 2P4EA 2WQ4A 1UY1A 2KD7A 4WVWA 4NHKA 4CDXA 5F6LB 3PIJA 4KH9A 4YVSB 1L3JA 1XE7A 3OD0A 5KHJA 4GWNA 4MV2A 4FXGB 4HSJA 3T4VA 4N7IA 1W99A 4XUNA 2B39A 1MQTC 2ENRA 4OZXA 2G1MA 2TNFA 5IUQA 2R0FA 3UKNA 1LOGA 1IG3A 4QPIB 1HKDA 5CVRA 1R091 4EN6B 2QQKA 2RR13 2ZGTA 3CZUA 1BBT2 2E7QA 1J83A 1DZRA 3GJAA 3CEWA 1FX5A 2ZGMA 3MF6A 4XMIA 2R6QA 4XDQA 2HWF1 2XL9A 1R64A 5FZMA 4YW4A 4QQHA 3VZJA 3VDAA 5JIAA 5I0SA 2Y6JA 3I8TA 3MPPG 2PHRA 3DYOA 3HBKA 3K46A 4MH0E 2NLRA 3AB0A 2D6LX 3TEYA 3AX4A 3UJQA 4AGRA 4BQ5A 3CKHA 1V6NA 3MIHA 3WW3A 3FFQA 4WM8B 1PMJX 2TUNA 2W94A 1FPN1 3MLJA 3POGA 3SCFA 1ENXA 2DWRA 1RUJ1 3I59B 1GZWA 4FPKA 4RGGA 2W46A 3POYA 5JR7B 1M4WA 4HPKB 3MFAA 4KMQA 3UGGA 1LESA 5JCTA 1FOD1 1H1IA 3GGLA 4UOJA 4Q1PA 4QQ2A 1H6XA 3ZYHA 3OBAA 1QJZA 1NUKA 1QDCA 3B02A 4QD2A 1CESA 2G9GA 3TN93 1VBD3 2JE9A 5DABA 2E51A 4Q8LA 1K5MA 1NKGA 3BPSA 3MW2A 1HDKA 2XBO2 2NN8A 5FZ4A 5JZGA 1ENSA 4CUCA 3D82A 2CTVA 3K4AA 3RJ2X 3JCIA 4XPVA 4ET7A 2OPKA 4AI3A 5DZGA 1HQWA 2VG9A 1Q8OA 4GJYA 5FXXA 1QNYA 1MZFA 1R1ZA 4P5HA 3MEPA 4ASKA 3HIFA 1W8WA 1G7YA 3C7OA 3HT2A 4LJHA 2Q5TA 1CZTA 4NE9A 2CL2A 4TSVA 5FYUA 1GOGA 1K5MC 3VBSB 5A6QA 3T1MA 5FUNA 2VU9A 3RWNA 3H50A 3KVBA 4WZFA 1J59A 1JTZX 2XKOA 3JBG2 1O3QA 2D44A 1PK6B 2JB8A 1TME3 1VBB1 1R1A3 1OSGA 2VOKA 3G7DA 3IT8A 1WLCA 1TNFA 2WIIB 3EBRA 1MZ6A 3KCCA 4HKWA 5T3NA 1RVF2 3KD4A 3RQ0A 4XZUG 2WNUC 3ZXJA 3A0NA 2WUHA 3SEEA 4D6QA 1J1TA 3WCSA 1JYTA 1CX4A 5FP7A 1JZ2A 2WLQA 3DF0A 5C4WA 1FPN3 4FO9A 3N9PA 4CYDA 2VBBA 3VD4A 2XJSA 3LDBA 4M0NA 1EPZA 2VQAA 2OZJA 4QB1A 1C1FA 3NWKA 1F15A 1OF3A 1QHDA 4DRVA 1CAXB 1A78A 3H1YA 4L97A 2FCUA 1YWKA 1W6PA 4CCNA 1IS3A 2A5ZA 3IDEA 1KS4A 5C3OA 2I74A 1QH6A 4NAOA 3WG3A 2XB6C 1YQCA 4OYUA 4CEYA 3RJRA 3RZGA 4ZONA 4M3CE 2R073 2JWPA 5FYYA 2B9VA 4ES9A 2VTXA 5BNNB 3PJYA 3L2YA 3NJZA 1YI9A 4HETA 4IGOA 5HCAA 5CIRA 3OBZA 3LF7A 4KGQA 1WMEA 2Y60A 3MLLA 4JHZA 4BM8A 1YC61 1GUIA 1U12A 2D6MA 3AZXA 1SLIA 2HH9A 1POQA 1H8TC 1JN2P 4K9SA 1LOFA 4Q5OA 2BP6A 1OVPA 1UKGA 4GB31 1WLDA 1QJU3 1S1AA 3CJXA 1EV12 3I2IA 2DBNA 4Y1VA 4DQAA 1XNCA 1VAMA 1VBC1 2JG9A 3OEAA 4JQTA 4QM9A 5EYXA 1KD7A 4S2GA 3GZAA 4RA0A 5T5OA 4C1WA 2BPA2 2FMDA 1AX0A 1R083 4FFIA 1RUH1 1W8OA 1OKQA 1TQ5A 3NNLA 4FTEA 2YFZA 5KWRA 2GALA 3RZKA 1GZTA 2AGSA 2C6SA 1F5JA 2RMU3 3A23A 1LEMA 1PO13 1QGLA 4GALA 4XFAA 1SFYA 2OYZA 3U07A 3W21A 3O12A 1PZ8A 5BUVA 2ZABA 1IQDC 4Y4YA 4M3CB 5LATA 4DNYA 5LRSA 3MIEA 1POV3 4BZ4A 1BXHA 4XFGA 1SPPB 1H1AA 4OHXA 2WN3A 5DUWA 4COWA 4E8DA 1U0AA 4BCUA 1NXMA 1VJ2A 5I0RA 3POFA 4IEVA 3ZSKA 2PHXA 3QACA 4CP0A 3NJYA 1QY4A 3JB8A 1MVEA 4B7KA 1SQ4A 1RUI3 3J8F3 1PVC2 3OBRA 5FXWA 4BU2A 1HV1A 1G6NA 4CEYB 5A33B 5CAZA 2GNMA 1PX3A 5FXVA 1IS4A 1YCIA 4FPYA 3G6JB 4L2NA 4MXVA 2H6CA 5IAXA 1SLAA 3B93A 3H3LA 4MXWA 1JYWA 4BQWA 1AR62 2YMZA 2JG8A 1DQ4A 3FX3A 4XJ8A 5G04L 2XPJA 1H8TA 2WYSA 4NRPA 5LBCA 2OT7A 4FVVA 2JKXA 3W58A 3CLPA 1YI7A 2C9AA 4LULA 4J6GA 5ABJA 4GJZA 3CBNA 2QCSB 3VD7A 2XL7A 4ASLA 1A8MA 4JRAA 1KEXA 1N1SA 1RJ8A 1GR3A 3V0BA 4J1XA 3KS7A 1YFYA 2X5IC 5J48A 5GKAC 4QGNA 4Z2WA 1GSLA 1SLTA 1YHFA 3MUY1 2TEPA 3PMEA 4YGEA 5JMOA 1UMZA 3ABZA 4FT8A 1RUF2 1YIPA 4OFGA 3K2OA 4XZPA 1EV13 4OVEA 2E31A 1QQP3 4GAZA 5FYMA 5FPXA 3BU0A 5A3OA 1Z7S1 2BRTA 1BVVA 2VM9A 1JOBA 1RMU2 4I02A 5JZGC 1CAWB 4CDUA 3BTXA 3OOXA 1DFQA 1NZIA 5IVYA 3ZFFB 4P9YA 1CAUA 2RMU2 5DZEA 4YVSC 2R072 3HWJA 4GH4B 2A6ZA 2FDHA 4K20A 2GC1A 4LBNA 1UX7A 4FPJA 5FDBA 1W9FA 3FFZA 4Q4W3 1VBA2 1UYYA 1Q5OA 4N53C 3LPGA 2PYTA 4X6QB 1VBB2 2JG8B 2IXCA 4UFHA 3VV1A 1S2BA 4CDUC 4AEJA 4PLNA 1W0NA 1C5IA 1D2QA 2JXAA 3HN3A 3MV01 4OMDA 5BY5A 1VRH3 3D6EA 1AF9A 1W8HA 2YROA 1DDLA 3NW4A 5APAA 4CUGA 2E7AA 4FCAA 1BHGA 5I0DA 5KC5A 2PQQA 5IK4A 2BWAA 3DPRB 5GLZA 4CCEA 2XHNA 2R063 3PVBB 3Q8CA 2ZAAA 1AX1A 2O1QA 2V5DA 4AFMA 2YU2A 4RQPA 4XDOA 4OCTA 4OUSA 4NIHA 4QQPA 1JYVA 2ZTNA 2QE3A 4GMP0 4OMCA 3ZMNA 4CU9A 1A34A 3I2KA 1A3KA 3FJSA 4B8EA 1W6QB 4GH4A 1WUVA 2R071 3V56A 1W28A 1BMV2 3IBMA 5JPNB 4CDQB 4Q26A 3VDDB 4C1XA 1SG3A 3MYXA 1OQ1A 3VDCA 5LK5A 2P2KA 1H2KA 1VMFA 4CDUB 1Z7S3 5I8SA 2NMOA 2FCTA 3U1XA 4GB33 5IW0A 2Q8OA 1CN1A 4AEDA 5D21A 1HB1A 1T6BX 4YZ4A 2VMIA 4BYYA 3E5XA 4F8AA 5LCWL 3GXUA 1E5RA 1BEV1 3AYEA 4QPGC 2FDJA 3JQXA 1ULCA 2H6BA 3I59A 3IMNA 3POWA 4GH4C 2GMMA 1GP5A 1UX6A 4LO4B 2WFPA 2JX9A 5FFOC 5FWEA 5IAVA 1OD5A 2J1UA 2PHWA 4DMIA 3BKZA 4RHV3 2XVGA 3ZN5A 3I3EA 3WNKA 4ZHNA 2UWCA 5B4XA 5LY1A 3BVCA 5EFUA 4EN9B 5HPOA 3HJRA 2HWF3 2VY0A 3O0WA 2N7GA 5IJRA 1VRH1 4BXFA 2OXBA 4HZFA 5C8CB 1NCQA 3O1UA 3RSJA 4CP9B 4UBGA 5JI7A 1NG0A 2WDBA 4RN5A 2YYOA 1OA3A 2HYXA 4MZUA 1QJY1 5TSWA 2IZWA 4HK9A 1UU5A 4EE2A 4Q4Y2 1W6NA 5AVPA 3VGIA 1WZXA 1D4M3 3ENRA 4LIVA 3U4SA 4NIIA 1RXGA 3ZFEC 4YW1A 3ZPOA 1NCRC 2XJUA 2GNBA 4CCDA 2NYYA 5FZGA 1DGRN 2QQUA 4XAAA 3WNMA 5IK8A 2PHFA 1RUNA 3M7AA 4E2SA 1IQAA 4IE0A 4QT6A 4V1PA 5T5LA 4CDQA 1RTVA 2VVFA 5LEKA 4OHYA 1X8EA 5EV7A 4I3GA 4Y26A 3H7JA 2QQPA 4HONA 5FZAA 4BH9A 5KHIA 4QB6A 3D0JA 1FV2A 1O6UA 2QKDA 4QXKA 3ZYIB 3I2OA 2XVKA 3N7MA 1RVF1 2A75A 1R082 1SLBA 1US3A 1NA1C 2AH2A 2C24A 3CL1A 3N9LA 5CFCA 4LEJA 4CEYC 1OLMA 1WBFA 4P9LA 1AHSA 1S0CA 2O8OA 3R4SA 2EIDA 3HQUA 3SITA 3WSOA 2WNVC 4EWDA 2AUYA 3HNYM 2R1DA 4K3UA 1HV0A 3KCYA 3AZWA 4HVOA 1OLME 1CJDA 3LOIA 4UFMA 3AM2A 5FPZA 5FV3A 2LROA 1BCXA 5CFDB 1EV11 4DZGA 4RHV1 4CCOA 3WEZA 1CAVB 1Q8PA 3BTZA 1AYM2 1LTEA 3ZYFA 1ACCA 4FQ4A 2JDUA 2PTMA 1Q56A 3JD73 3PDQA 3WNXA 1PM7A 3VBUC 5F39A 4YFWA 3B9CA 4XFHA 3U10A 5FZHA 3VBHA 2CNAA 4JGZA 5A6ZA 5FQ0A 1KFUL 4AVBA 3TRSB 1GWMA 4LXLA 4O61A 5JXGA 4XHBA 3QLQA 4Y24A 3KT4A 1I3HA 2ZZJA 4XMAA 2J22A 1K45A 4BLJA 1HX6A 2WFF1 1UZYA 2XG3A 5FZOA 4Y33A 1Z0HA 1LB2A 3H8OA 3JZVA 1PHMA 2J1RA 1REDA 4XFIA 5FWJA 5F2SA 4BHPA 3B7MA 2P3JA 3M3OA 2VZPA 1XJAA 4UW3A 3KT7A 1UF2C 4UXAA 2JD9A 2VZTA 5FYVA 5C70A 2EAAA 5HCBA 3TEXA 3VL8A 1WMFA 3ZSLA 3AC0A 2PMWB 2WQZC 1NCRB 1BQPA 5DQ0A 5A7SA 3QD6A 1DQ5A 1S0EA 2VBPA 1STMA 2BERA 4HK8A 1H30A 5BYNA 4P9IA 4W50A 4LBLA 4XUPA 3ILFA 3GYDA 4NIAA 1KJLA 2W91A 3WG2A 3DECA 3M3EA 5F6KA 5F5CA 5C8CC 4MG2A 1BK0A 5KXCA 1ULDA 2VNGA 2J7MA 2K46A 2P3KA 1YJLA 4IV3C 4B4QA 5CBLA 1PX4A 3ES1A 5LW9A 4CU7A 1ZYBA 4IESA 5A3WA 3RZJA 3H42B 4FTSA 1YFWA 3DCQA 1LOFC 4B7EA 2EXIA 3WF4A 5A33A 3O1MA 1KGYA 2D97A 2WNUB 5CKMA 4WVMB 4AWDA 3M8LA 2JENA 4FPHA 3K4DA 1R081 3AP9A 4LQRA 2VZQA 3IPVA 3LDKA 3TEZA 2H0VA 3O1OA 2ZHNA 5HV0A 5IHRA 2A3XA 5HCHA 2Y33A 1XSQA 4EV0A 1V00A 1TVGA 5C6CA 3IIIA 1YFUA 1VAVA 3H1MA 5GLWA 5I0UA 3S7EA 2DV9A 3GZEA 2XQRA 4FI9A 2HWE1 4QWNA 3OGRA 4RD7A 1CAVA 1W39A 2VQTA 2UU8A 1JUIA 2VW0A 4Q0PA 4QMAA 4CDQC 4ZU7A 1G9DA 1DGLA 3LCPA 2ZEXA 1RUF1 1UY3A 2JIGA 2YPJA 1X8MA 4HXCA 2ZHMA 3FLTA 2UWAA 3EMRA 4I0AA 3WNOA 4YZ2A 1ZBE2 2QNKA 4AK3A 5EPAA 1QJY3 5JSRA 3K77A 1VRBA 3SMHA 3C2UA 1VRH2 4CA9A 3DUIA 2DUOA 4XFBA 2BOJA 5FJKA 1UZZA 1JU4A 2WZR3 1MEC2 1FMD2 2ZEZA 1HB4A 3KF3A 3VD9A 2R0HA 2VMCA 4GWIA 4D0QA 3ZFFA 1LJ7A 1I5ZA 2DVAA 4GMP1 3J9SA 3ZFGC 2QDRA 4S2FA 2G9ZA 3LKJA 2QQWA 4XF9A 2BQPA 1C8NA 3MW3A 4A3ZA 3ASIA 3VBFA 4XUTA 5FMOL 1MVQA 3T3YA 4HFSA 4H14A 4AZZA 2GN3A 5HCFA 1EUTA 1MS9A 2O14A 2E53A 4NPLA 2VZUA 2XMLA 1DGWA 3F95A 4UT5A 1XBFA 4QB2A 3N9MA 3CMGA 1RMU1 1RXFA 4QQLA 2JE7A 4YRDA 3TAYA 4MUVA 3MIDA 1W6NB 2WC2A 5JPMB 2XJRA 1H8VA 1NA1A 3AMHA 5FY4A 2WA3A 1HXS2 2VUAA 4YM0A 2ZJCA 2E33A 2YUEA 5KHKA 3AMMA 2B4KA 4K7JA 2ADEA 3OUJA 4Y22B 1W8UA 1TMF2 1UO9A 3MGUA 3ZN4A 5EJ3A 1DGRA 2NP0A 3AJYA 1OC1A 1RHI3 4W6XA 1MQTB 5AFEA 2XLAA 1CONA 3VLBB 1XC6A 1NE4A 4CP2A 3CNAA 5DAPA 4CPBA 2FHRA 2VMEA 4FSJA 1XNKA 2BJSA 5FPUA 4BMEA 4XJWA 2P37A 2Y0IA 3VB9A 3WP6A 3UNPA 3NAPC 3LE0A 5FYIA 1OLRA 4PI2A 2W1WA 2W1SA 2JDNA 1ZBE1 2F4LA 3Q8EA 1OMIA 2YBSA 2DVFA 2D7FA 2P3IA 3ELNA 4BLIA 1ND2A 2EALA 2Z2SB 4YGDA 1MS3A 3WQ1A 4FTBA 2JG9B 1LRHA 1WBLA 4N53A 3U75A 1Y7BA 5F37A 4Q4V2 4PIXA 4R9CA 2PXJA 4FAGA 2KA3A 2WRAA 4F7ZA 1H1MA 1AR91 2CAUA 1RUG3 1GNYA 1SDWA 5FMOS 4E4SA 3RZLA 2J1EA 3FE5A 3KQ4B 4LHSA 5ABJB 1QXJA 2ET1A 1AL23 3ZSJA 4RS5C 4YZ5A 1H9PA 3MDPA 2Q8CA 3L2HA 4X8NA 3ZMOA 3WF3A 3J7NA 4YVWA 1UMIA 3OEBA 3WLUA 2WA4A 1HQLA 2R49A 2VL4A 2Y64A 1MACA 2R043 2Y0OA 2MEV2 1UD1A 3O7OA 3VKMA 1QXPA 4A6OA 1HQNA 1GQPA 3GNEA 2WWJA 2ATFA 1LODA 2MPFA 1JODA 2FZ1A 3IKWA 1MS8A 3WDWA 2I07B 4A6SA 5LBBA 3O14A 4N9HA 3UL2A 4CUBA 3LA2A 4HT1T 2LRPA 5T54A 2UYBA 4H7LA 1XNAA 1E5IA 3A7QA 1OA4A 2EIGA 3P3NA 5HXVA 2AEZA 1V6KA 1MR5A 2ARBA 2WNVB 2ZXQA 3NJVA 4ARXA 4BISA 2OUJA 1US2A 3SH4A 1FMD1 4DY5A 4W65A 3OUHA 1MEC1 1S55A 1ZBA2 3AFGA 3QCWA 4HVRA 5DUXA 3HN1A 3PL0A 2DU0A 2AACA 3KGZA 1DLCA 4UAPA 3GZUC 1G86A 4LTAA 2IXKA 2YPDA 4HG6B 2GP5A 3VZNA 4RL7A 1CX1A 2D3RA 5CZKA 2TBVA 3ZYGA 1DQ0A 3RI8A 3J26N 1WCUA 1BYHA 3B3QE 4XIKA 1ODNA 4MX3A 1W06A 1SACA 3OPWA 4LOTA 1SLLA 1PVC1 4XHXA 1PGW1 1X36A 3H8RA 2GSYA 1QMJA 3VHOA 2W0XA 2CU5A 2HWE2 3KV4A 4E4DX 1VB2A 2D5FA 1QF3A 3R4UA 3VBOB 1B35C 1W0PA 2P3YA 2WFF2 3LPFA 5BV6A 1AL21 1BMV1 1CPMA 3LEIA 5C9AB 5IVVA 3D4KA 3FUQA 1FI2A 2BFUS 1W2UA 4G3YC 4MADA 5EHDA 4QPWA 2JDMA 4J1WA 4XTMA 2ZGNA 3RRDA 1PO23 5D2AA 2Z5WA 2ZEWA 1S0JA 2V4VA 3RG0A 1NQJA 1W6MA 3AP7A 4KNCA 2UWBA 1ZZ6A 5C7GA 5FOBB 3NJXA 5IYYA 2W3JA 1HB2A 1W8ZA 4M0HA 5JXIA 5A7WA 4Q8KA 5BNPA 5A6XA 4AHYA 4TTGA 4J25A 1W3XA 3AMNA 3OUIA 2VW1A 2WO2A 1GZWB 3PUSA 2GC3A 4ZS3A 1LENA 3AP6A 2ZBJA 1EY2A 4A7ZA 3BIEA 4NRMA 1QKQA 2MEV3 4CXWA 1ZVFA 4M4PA 1SBDA 1VBC2 1CD3G 2OA2A 5FUPA 1W3VA 3R6SA 1TG7A 3ZLIA 1LOBA 1BBT3 5ISLA 1AYN2 2Q1ZB 1YQ8A 1I9RA 1SMVA 3ZR6A 4E2GA 3ALQA 3T09A 2JEMA 3INAA 2YC0A 4GIQA 4NN0A 4OQ9A 3RZHA 2RS13 3CQOA 3HVDA 4YW5A 2ETEA 1OKOA 1WD4A 4UFKA 5FZFA 3R0RA 1T6GC 1UNBA 3VN4A 3DYPA 1R092 4Q29A 4LBQD 4BMBA 2FCVA 3K75B 4HKOA 3M3IA 3ZXLA 4XABA 1PZ7A 2ZGUA 5FYCA 1YFXA 4YW6A 3BALA 4LKSA 2LUWA 5J7MA 2PN5A 1DQ6A 4LPLA 5FZ6A 3VBUA 4AEDB 4DXRA 4OI0A 3GZTB 1XXNA 2VUDA 1AR83 1UPSA 2VMFA 2X53S 1SDDB 3Q8BA 1S0IA 4H7MA 5IATA 2CDOA 2JE8A 2WZR2 4LBOA 2W68A 4I3PA 1L7QA 3ZDSA 1VBD1 1Y9MA 2UYAA 3CDZB 1QJY2 2XVLA 4JDNA 1ENQA 2XLGA 2BV4A 1AR92 1W9YA 4A3XA 4AI2A 1G9FA 5BNPC 4Q4W2 5FPVA 2CYFA 2WT2A 2XBO3 4L9BA 5A1LA 2DTWA 2VXRA 5GZDA 3PVEA 2VOXA 1UN1A 2ORZA 4XW3A 4XQDA 3WDXA 3HMYA 5F3EA 1M06G 1O5UA 1ND2C 1RHI2 2JG8C 1JUHA 3VBSA 5LRRA 4NHXA 3B5LB 2Z79A 5FY7A 4AOCA 4BQ4A 2A6XA 4JVAA 3GDBA 4PBOA 3RDIA 2P17A 5IVFA 2OZ6A 1AYN3 5IK7A 4IEYA 4OZOA 1VBE1 3CIHA 5FO9B 5E8AA 1AR61 1EYBA 2W1UA 4U2AA 4AI8A 1W6OB 2YB7A 4B29A 2BUKA 2WNOA 3SLIA 3D8CA 3WW1A 3E6DA 3THCA 1QIQA 3ZFFC 3GJBA 1C28A 4XAEA 1J58A 3LEKA 4M00A 1VAKA 5A7WB 5DDJ3 1ND3B
chains in the Genus database with same CATH topology
3ILRA 1RL3A 2OVUA 3B9IA 2YDEA 3GBGA 2ZACA 4JAAA 4Z1VA 4N43A 4X6RB 1AXYA 5ABJA 3ECQA 5C33A 2G9FA 3AK0A 5C8WA 4LO7A 4LO6B 4YGBA 4E4ZA 1YO8A 1O4TA 3A0KA 2MHFA 3H0OA 3ZYRA 3QH7A 4XETA 1ULFA 2BEOA 3VBHC 2B42B 4N43C 1PGL1 2ZX0A 5CG9A 3V64A 5DUUA 4I0WB 2D5HA 3I2DA 3ZXEA 4AQ6A 5C4WB 1GZ9A 3LA3A 1H4HA 1TEIA 4XBLA 5I8YA 4DPNA 1OPMA 2QDNA 2AR6A 2B46X 5F1RA 3I54A 3ZN6A 2HYKA 1QJU1 3N7KA 4I2OA 1VBA1 1ZZ7A 4YZ3A 3VKNA 4IV1C 5L19A 3MF9A 1PVXA 3RYKA 5KHHA 4CEWB 3FMGA 4N90A 2VVDA 3RYPA 1NLRA 1DHKB 2CY6A 1OPOA 2I2SA 1DG6A 4FQZA 4META 3PVNA 3USUA 1Z78A 1SLCA 1YRZA 3MIBA 1HRV2 2CGNA 2FMYA 5CFDC 4HL0A 2DVGA 3B94A 4YW3A 1C4RA 4HKLA 4CTEA 4NWWA 2ZX2A 3MFCA 5GLVA 1MZEA 4YZ1A 1XNDA 3WVJA 2XKPA 4KG8A 1Y9QA 2H0BA 2ZKNA 4LUKA 1J1LA 5C9AA 3ZFEA 2IWGB 5FTTC 4BA6A 4LBQA 2D3SA 2ZCWA 1H8TB 1YJKA 5GZEA 1NCRA 1RUH2 5JOYA 3RS6A 2OIIA 3CJIC 3RYRA 3SH5A 3KGLA 4WVMA 3ZPYA 3LSDA 4AI1A 3B69A 1JHNA 4YGCA 1C5HA 3CO2A 4GWMA 1LEDA 3MLKA 4Q2FA 5C9AC 5JDBA 3NAPA 5EWSA 3VBOC 5FAXA 5E88A 4DRRA 1NZCA 3AMPA 2C1FA 1ZZ9A 2GAUA 2HWD1 2VVEA 4OUMA 3MW4A 1BVP1 2CV6A 2NM1A 3WCRA 4AI0A 1ZRCA 1QNWA 1VBD2 3TB0A 2EXKA 1N1TA 3TWIA 4XILA 3N36A 1CQ9A 1TMF3 1WMDA 1REEA 4BQ1A 3H7YA 1OLQA 1O5LA 2HJIA 3VKFC 2Q1MA 2PHUA 3GHMA 4ISQA 4Q1RA 2DCKA 1QQP2 2RS33 4PIYA 4Q4Y1 4XOGA 4Q0SA 2OUHA 3TBDA 5ACA3 4M01A 4NOTA 1W6PB 4QPGB 4XFCA 3MIFA 3RNSA 4Y20B 1QJX3 1QOTA 2RS11 3P3PA 4HBNA 2KM2A 4BIOA 4KBBA 5KBFA 3ZXFA 1GNZA 1ZRRA 1GKBA 4ISRA 3KB5A 4BOWA 1ENRA 1V9U3 5GZGA 1RUD3 1WGPA 4LLOA 4DOUA 5K0UB 4ZU4A 1ZRDA 4YLZA 2A6VA 1ZA4A 4MLOA 4MGIE 1MEC3 1N1YA 3VZOA 3OGJA 2JICA 5BNOB 5FO7B 4YNIA 1LR5A 4NR1A 2QVSB 4RS5B 4MSVA 3EXUA 3NV2A 5D1IA 1KFXL 3KMHA 1DQ1A 5ABJC 5JOZA 3FWEA 1QH7A 2XLFA 1C1LA 4FP2A 1Y3TA 2D40A 1ZNPA 4XE9A 3IDCB 3VKLA 3ILNA 4Q4X3 2JG9C 1JH5A 3S30A 2ZGOA 2ZPXA 4XBQA 1AVBA 3UKVA 1ASJ2 4WM8C 1XYOA 2B7YA 1FOD2 3VZKA 3IDBB 2AYHA 3NAPB 1OOPB 3H3UA 4RQPB 4INDA 2FBEA 2DYCA 2VNRA 1H2MA 1RINA 2DCYA 2XHKA 3KCXA 1NYWA 2DUQA 1SFNA 2O0OA 4XJ9A 3ES4A 2BVBA 4LNVA 4RS5A 1ND3C 1ZBA1 2RM21 5CA6A 2HEYF 5CG8A 2NPIA 3ZXKA 1LU2A 3LGRA 5E89A 5C8CA 1V9U1 4FAHA 2B45X 3AP4A 1VLNA 2HEWF 1RUE1 2HWB1 4L8QA 1XNBA 2GC2A 1A6CA 4XQ4A 2RJLA 4ASMB 1OOPC 4QPGA 4LBJA 3NKTA 4MVTA 4DS0A 1XYNA 1NOVA 1D4M1 3N35A 4HMZA 4FPCA 5L36A 3N7JA 4OHZA 2ZA9A 1Z7S2 2EA7A 3TNPB 4QPIA 1ZREA 1AL0G 3WG1A 2RS32 4JGYB 4KG0A 3DGTA 2D93A 3RMXA 4YVWB 2AZ5A 2LTNA 2ZS6B 4Y1XA 3KM5A 2VNOA 4RGAA 4WV8A 3V65A 1WCSA 2A7AA 5J36A 1IKPA 1PO12 4C90A 1UL9A 3RI9A 1O3TA 1DLLA 2V09A 5T50A 5SV5A 1H0BA 3JBG1 5GZFA 2HWF2 2E6VA 4YFZA 3ZYJB 1PGSA 1G8WA 4KQ7A 2CGPA 4BWOA 2A3YA 4QHBA 2HWC2 3VBRB 4AEMA 1DBNA 2PA7A 2MNGA 3WUDA 1DQ2A 1VBC3 1ZBA3 4LUMA 2EF6A 2R30A 2ZGLA 1RUOA 2RS53 4XJAA 2D6OX 1BKZA 3AZVA 1AXZA 2WKKA 1SBEA 4UW5A 2VUJA 2SBAA 3HR9A 1W0OA 3NV1A 2RMU1 4MGZE 2E9QA 4IEPA 1PO22 2W39A 1QJX1 1TME2 4Z07A 2ZGSA 2ZKLA 5KC6A 2QFEA 3AFKA 2IXIA 3NVCA 2VW2A 4KWLA 5CFDA 2BWCA 4Y1ZA 1VIWB 4P9GA 2R042 1O7FA 1IKQA 1RUC2 2D98A 2WS92 4IERA 1D0GA 4DB5A 4QGLA 5FLIA 4D7TA 1EAH1 3AZYA 1X50A 4XEZA 3AYCA 1LCLA 4F3JA 2XH6A 5J98B 4LE3A 4WM7A 4AHZA 1GFF2 1DGWX 2XGXA 1Y43B 5LEJA 4FPOB 4XF1A 4LA3A 1UU6A 4XF3A 2IXLA 3SH3A 4DFSA 1LU1A 1U5ZA 2ZGKA 4FPLA 4OLLA 3BCWA 3DN7A 1O4ZA 4XXAA 5D8AA 1NY71 2EXJA 4IL7A 5L7OB 1AR73 1Q8VA 3H9AA 3Q9OA 1BK1A 1KXGA 1UAIA 2HWB2 1BEV2 2K2SA 1VBA3 3LA7A 1S0BA 1RVF3 2RS51 3OY8A 4L92A 4Q0VA 1WW5A 2W08A 4COVA 4R9AA 1RUI2 3AXEA 3OTFA 3H3ZA 1D2SA 1APNA 3VBUB 3VBSC 2Q0AA 4D3WA 4K21A 5FREA 4ES8A 4XF4A 1ZZ8A 4FXKB 4IETA 4O9EA 1JYCA 2XJPA 3ZIXA 3O5SA 1KDMA 3KZ4C 1EP0A 1QOSA 2RR11 4OHWA 5F9TA 3HAGA 3NL1A 1F9KA 4D7YA 3JD71 2RR12 3WDVA 3KLSA 3VZLA 1AJKA 5L7OA 2NZ9A 5EXOA 1IS6A 2V5YA 4XFFA 5L73A 3W9AA 1CAWA 1YYNA 5DXDA 2YY1A 3I7DA 1W6OA 4IV1B 4P9WA 2ZGRA 5IK5A 5J09A 2E7TA 4LHNA 5CADA 1BJQA 4E27A 4URTA 1GZCA 1MS4A 3KT1A 4K8FA 4FOQA 1U5XA 3BPZA 3TNQA 2RS52 3PMSA 5BPXA 1YUDA 2QUOA 3ZXAC 4JGYC 1RUD2 5C4WC 3VBFB 4JRLA 2WNVA 1FV3A 2VULA 3L9JT 2WT1A 3WV6A 4Q4X2 1OFSA 5CU1A 3WHTA 1S2KA 3PJQA 1MS5A 1MQTA 3J8F2 5EZWA 1V6MA 3E97A 4ZXKA 2D43A 3EO6A 4PDWC 3M4FA 1HRI3 3DPRA 1RIRA 2BFUL 5AVAA 2R062 4Z92B 3UK9A 4P9XA 1PIV2 4EN0A 3JBG3 4HPKA 4EWEA 2A71A 4NO4A 1RUJ2 1WCKA 4TZDA 2WNEA 4Y5Z0 4WVVA 4QU2A 2X29A 1ULEA 3AKQA 5DUVA 1KS5A 3WQ0A 4Q4Y3 1POV0 2VMGA 4BIFA 2D6NA 1ZRFA 3OCPA 4AFDA 3ROUA 4YW2A 4K6BA 2OW4A 5JI9A 1J3QA 1YXWA 3GF6A 1CVNA 2D6KA 2ERFA 4CDWA 3DL3A 2X8KA 4Q27A 4H3WA 5A3MA 1ND2B 4YG6A 5GM0A 2YV8A 3AKSA 4S2DA 4XYXA 5KHGA 4GA9A 1J3PA 4Y20A 3VDDC 1G9AA 2C0ZA 3E5QA 1FNYA 1VP6A 1OOPA 2RJKA 3AP5A 1XYPA 3TYJA 3WP3A 3IM0A 3R05A 4L99A 2PELA 1XRUA 5GLUA 1OQEA 1ZZBA 2GU9A 3GHNA 4M3CF 4SLIA 3WDTA 3WP4A 1NCQB 4LA2A 1PZ9A 2YGLA 1F2NA 5HBAA 1WCDJ 2ZMKA 2Y26A 1U5IA 2ZX4A 4LBMA 4FP3A 1HRI1 2DCTA 3WZ1A 2PAEA 1LHOA 4YYOA 5JLVA 4A7KA 4LHLA 1J3RA 4IEQA 5JWPA 2BNOA 3B00A 2B9UA 4HLTA 3NKGA 4IXLA 2VOWA 3CF6E 3DKWA 4RSUA 3UJOA 4OHVA 1HW5A 1OQDA 4LBQB 4COZA 4GB32 4CDXB 1V6JA 5T5JA 4AF9A 5K8SA 1RITA 3RMYA 1W6QA 3WW4A 4QX5A 3CJIA 1GICA 5CFCB 2ARXA 4IEWA 3POSA 3K48A 3O0XA 2IFRA 3OF1A 1DIWA 5D8AB 3ZSEA 3AKRA 4Y1YA 1NXD1 1EAH3 1RUF3 5FCCA 1NY72 5T55A 3E6CC 3WR0A 2W52A 4RR3A 1JW6A 3SCGA 4GULA 2GH2A 4R52A 3WQ7A 2EVXA 4TWTA 1YIFA 4ZU5A 2KXLA 5LK7B 1FAYA 1SCSA 2A73B 1DF0A 2VQ0A 4I01A 4QPYA 2YXSA 3OJBA 5H9RA 1RUJ3 4W6WA 3TN92 3VBFC 1O3SA 3WOGA 2BVVA 1RUC3 5I91A 3CJIB 4EN7B 1CR7A 4YM3A 5K0UA 4TLFA 4AE2A 2DFCA 1VALA 1RUG1 5HI0A 3WXPA 4AXOA 2WSVA 3FC0A 2CAVA 4JGYA 1V70A 2PAMA 5A32B 3BOWA 4IEUA 4B4PA 1B35A 4XQWA 4AW7A 3DV8A 4LE4A 3WDYA 4R8HA 2WS93 3N4MA 4B4RA 1UKRA 4XTPA 1KITA 4GKYA 2F6BA 1LHVA 2A6WA 3HQXA 3ZXGA 5K7PA 4AVAA 2ZMLA 5FBZA 3PVOA 2VH9A 5T52A 1MS0A 1RUG2 2YGMA 2ZGQA 5I93A 4DXZA 2NMNA 3MICA 4HN0A 1PK6A 4JTNA 2NQYA 1AR81 3PNAA 3VKOA 4HVQA 2YZ4A 2IXHA 4Q4W1 3ATGA 3ZSMA 1OA2A 4FPFA 1DYKA 3USSA 2B5HA 2ZHLA 3PHMA 1IS5A 3CU7A 2R32A 4YVSA 4E9KA 1LOCA 1GQHA 4MGKE 1H4GA 5L7OC 3ZIWA 3OY8B 4TYSA 1RUC1 4RR3B 3AKTA 3RZZA 4G4FA 5FQ0B 3VBHB 4ORFA 1SEFA 5BNNC 4LO8A 1SCRA 4FPEA 4LHKA 2AREA 4HN1A 3ZFEB 3LB9A 3M3CA 2JD4A 1RC6A 3MIGA 4BPZA 2HWD2 3THPA 1AYM3 4OI1A 3THTA 1KRIA 5BNNA 4AQSA 4GMP3 3AJZA 1GLHA 1XQNA 2HWC3 2BNNA 1AR71 2Q4SA 4JCKA 1C8M2 3PTYA 5D8AC 2AENA 1A8DA 1PNGA 4R9BA 3H8UA 2DCJA 2EXHA 4YM2A 1FATA 4IV1A 4PJYA 4XJUA 5CFCC 1RB8G 1LOEA 1IOAA 2GNTA 1JBCA 3OPZA 1X7NA 4YG3A 2DVDA 4QGMA 5A32A 4CDXC 3APBA 4COUA 1E57A 4Z8BA 2GDFA 3J4UH 5GLTA 1FT9A 1PO11 2CGOA 2JDZA 3JB4C 5ACA2 4Q0UA 3BODA 4WVZA 1K5MB 4JDMA 3D0SA 3LAGA 4RFT0 2PHTA 4EROA 4OI2A 2JECA 1LHUA 1PMIA 1AL22 3ME2A 2VMHA 3ZFGB 1PVC3 2IFWA 2WNUA 1F31A 3VL9A 3EJKA 1GANA 2ZGPA 5BNPB 3D5OA 3V0AA 2R061 3KSCA 1RUI1 1C3HA 1CPNA 2WLPA 1LGBA 4K1YA 2JJ6A 4C91A 1NCQC 1MS1A 1C8M1 3V0BB 1N3OA 3WW2A 4XIOA 3QOPA 1ASJ3 4R4XA 1MZ5A 4OI4A 4G9SB 1D4VB 4AEDC 4C0HA 1IZ3A 5AFBA 1NE6A 4Y22A 3ACLA 3S0MA 2RM22 1U5YA 4Y1UA 2IXJA 4LO5B 4WM7B 4D69A 3LZZA 4N53B 4A7YA 1BEV3 4PLOA 4P9JA 1COV1 4H55A 3FUOA 1COV2 1XU2A 3EQEA 4CEWA 1QQP1 1AZDA 2DU1A 2WS91 3A4UA 3S6PA 2D3PA 5CB7A 4ONUA 1LGCA 2WT0A 4QPIC 2E63A 4EJRA 3WX5A 4AFCA 4KGGA 2LM3A 5B2GB 3OGGA 4PDWB 1N3PA 5FRAA 4LT5A 1JYIA 4RQPC 4S2HA 2CWSA 4X8PA 4CDWC 4FOVA 4N7UA 1B35B 1C8M3 1FYUA 1AR72 4HSLA 3WHUA 1HXS3 1ONAA 3M70A 1PIV3 1HRV3 2QZ2A 3FBMA 3M3QA 2XWBB 4RR3C 4ATEA 1CIWA 2XBO1 4WZCA 5FOJB 4AG4A 1QOOA 3VDDA 4LLFA 1QWRA 2YHJA 5BXXA 3U11A 1DYPA 2DTYA 3FHIB 2K9ZA 2ZX3A 4M3CA 4Q4V3 1YNAA 4JC1A 1N47A 2RS12 2VGDA 1LULA 1AUYA 4I09A 5KXEA 4HANA 5DZFA 3EHKA 1FPN2 4JTOA 1AX2A 2ZOEB 3FLRA 3GBWA 4I30A 5K9YA 1JXNA 4NVPA 5K0UC 3VZMA 4BE3A 1WW7A 4CRQA 4R9DA 5DDJ1 1H2LA 2ZZQA 1IGOA 2BYVE 1IPKA 1URXA 4MYEA 1LOAA 3GALA 3WINE 1HIXA 1W6MB 3UKTA 4AVTA 1QJX2 2P34A 5H9SA 4AQTA 2QZ3A 1BBT1 5T5PA 3VUOA 2UY8A 2WFF3 4COYA 4PLMA 1IPJA 5SV8A 4EN8B 2BGCA 1V9U2 4FOWA 2ILMA 5H9QA 1GQGA 1O91A 2ZHKA 1WD3A 1QXRA 1CGPA 1ZBE3 4B3NA 2A3WA 4GXLA 1KQRA 3BTAA 4XF0A 4UW4A 3SHRA 3WDUA 4FPGA 1WW4A 5AC91 3USUB 3FBYA 2PFWA 2C5DA 4YG0A 2FZ2A 1G9CA 4PDWA 1REFA 2RHPA 1EAH2 3VHNA 4AFAA 2DURA 4CDWB 4D94A 4ZKTB 2A6YA 1EPWA 2F4PA 2B8MA 2GNDA 4F83A 3BU7A 1YLLA 5JSOA 2HWD3 2XJVA 3IN9A 2XJTA 5JMCA 1VB4A 5AC92 1C57A 1AJOA 3LWCA 1ULGA 3ZFGA 4JQRA 3LOBA 4CZSA 1NLSA 3ZVXA 1VBE3 2UY9A 3FLPA 3WT3A 4WM8A 2EAKA 3KQRA 1UU4A 5F5QA 4UBHA 2PLV2 2X5IA 4NHMA 2VOVA 1RGSA 1RUE3 3ZXDA 1RMU3 1FMD3 3URFA 3AZZA 1D0HA 4WM7C 4E2QA 4IEXA 5JOWA 4CP1A 3FZ3A 4Q0QA 2BW8A 2XUMA 2ZMNA 3VBRC 5EYYA 1I6XA 4O9GA 2QJVA 5IT6A 1UIJA 3WP5A 4NHLA 3H1WA 4JV4A 3NSTA 4AFBA 3OBTA 3BIWE 2PAKA 1JOJA 3SXWA 2R16A 4GKXA 1WLWA 2WZR1 2WL1A 4LR4A 3AMQA 1ASJ1 1HLCA 1HRI2 2DCZA 1NQDA 3DPRC 5GZCA 5BNQA 1CJPA 2GN7A 1S0FA 4IV3A 2JKBA 1UPIA 3U0ZA 1PO21 1AXKA 4JGZB 5KXDA 1RJ7A 4XBNA 4Q4X1 5J37A 1SBFA 1ND3A 3OYWB 4AQ2A 5H9PA 5FLHA 1F5FA 2PLV1 1X82A 5FO8B 1ZX5A 4Q4V1 5CNAA 1UW8A 3T2TA 1COV3 4R4ZA 1AYM1 2Z69A 2DUPA 1OI6A 4RHV2 3S7IA 2HWC1 2VECA 5JSPA 2Y38A 4AVVA 2GMPA 1R1A1 4ITCA 5BNOA 2K0GA 5JAXA 4MXWB 1GBGA 1CAXA 1LGNA 4AGVA 2WSUA 3IWZA 1RHI1 1GYKA 4AEKA 5JZGB 3O0VA 2ET7A 3HD8B 2RM23 1S0DA 4IV3B 1LKNA 4EWAA 3ZYPA 3UV9A 3SISA 3GBFA 2DF7A 4D7SA 4YSFA 4A2UA 1H2NA 1X33A 1XE8A 2Q30A 5A3LA 3IPVB 4KU7A 2BBVA 2X5IB 3WG4A 4KWJA 1IHMA 4IEOA 2BNMA 3M2MA 1HXS1 2GZWA 3I4IA 4AYUA 3W59A 2HWE3 1PIV1 1V6LA 4YARA 1HRV1 4GQ7A 3JUUA 1PGW2 3ZO0B 2XJQA 1WA4A 4JGZC 2BTVC 1N1VA 3VHRA 4I0BA 5KXBA 3JQWA 3OD4A 4Z82A 3U4XA 1QDOA 2GH8A 3OYWA 4WBBA 4JDOA 3ST7A 1QU0A 1RUE2 1FXZA 1O3RA 3AKPA 1GNHA 3ZX7A 1FNZA 3QBQA 1Q3EA 2G4IA 4AVCA 3R4DB 1ZM1A 2R1BA 1Q8QA 4NWVA 3X29B 5BNOC 5I8TA 1I1EA 3M1HA 1AYN1 2I45A 4QQOA 5DDJ2 1AR63 3NV4A 2GC0A 2PHLA 4PCRA 3AYDA 1R093 2CWMA 3AXDA 2HEVF 1POV1 5J96B 3WD5A 4LBKA 1G9BA 5ACA1 2MEV1 1AR82 2PHDA 1LHWA 2UURA 1OHFA 5DG2A 1UCXA 1TME1 1VBB3 4PIZA 3J8F1 1NA1B 2GMEA 1R1A2 1UIKA 1B09A 1V6IA 2SLIA 3QH6A 3B01A 3SCHA 4FBFA 1OFNA 1RUD1 2FQPA 5AC93 3HBZA 2WZPP 1WLTA 1DU3D 2XWJB 3BB6A 4AVSA 3VBRA 2O8QA 3C3VA 3T1LA 1VBE2 3N3HA 4UW6A 4P14A 2WJSA 3VHPA 2WWSA 2RE9A 3NV3A 1Q43A 3RPQA 5JVVA 2Z42A 3BOPA 3K51A 2A70A 2V73A 3PLQA 3JD72 4PBPA 4XXPA 4OULA 4AGGA 4KL1A 5GALA 1AR93 1CAUB 3MI8A 4IQPA 4PQ9A 1Q8SA 2VPVA 1PGL2 4YM1A 3V0AB 1KJRA 3N7LA 4DY3A 3HT1A 1GV9A 3MPBA 2PLV3 3IIAA 3AYAA 4NPRA 3TOJA 1KDKA 2R041 4AHXA 1PK6C 1BZWA 3NO8A 1RUH3 1VR3A 1D4M2 4KU8A 3E5UA 4PF5A 5I0TA 4K40A 1O4YA 1WW6A 4FOYA 4SBVA 4KWKA 3SNMA 4C0BA 5GJ6A 1TE1B 2IC1A 3JU9A 1ALYA 1DZQA 1QJU2 4QM8A 3LSEA 2HWB3 2DVBA 4XJZA 4CEWC 2HKXA 5E16A 3ETQA 1H9WA 4U36A 2WINB