1RUD1

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52084
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKISLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
molecule keywords RHINOVIRUS 14
source organism Human rhinovirus 14
molecule tags Virus
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rud100
4AEDC 1AL21 4RR3C 3VBUB 1C8M2 4CDWB 2XBO3 5L7OB 1QJX1 2WZR1 4EJRA 5CFCB 1MEC2 4AEDB 4CDQA 3DPRA 1PIV3 1R081 2BUKA 1FPN2 4FTSA 2WS93 1VBE2 1PGW1 1BBT3 1B35C 4JGZC 1BEV1 1HRV3 4N53B 4IV3C 3NAPA 5K0UA 2WFF1 1B35B 1TME2 4RHV2 4JGZB 1PVC1 1AL23 4IV3B 4QPIC 2WLPA 3ZFEA 1QJX3 5DDJ3 1FOD2 4QPGC 4PDWC 2MEV2 2RMU1 1RUI1 4QPIB 1R083 2RS51 1R092 1RUJ1 2R073 3CJIA 2R043 1QJY1 1POV1 4QPGB 4PDWB 1V9U1 1EAH1 1RUF2 3FBMA 3VBOC 1VBC3 2WFF3 1RHI1 4YVSA 1RMU1 3VBFC 5ACA2 1PGL2 3VBOB 1NCRC 3VBUA 4YVWC 4CDWA 4FTBA 1H8TC 1ASJ3 1QJU3 1EV11 3VBFB 1R1A1 2PLV1 4Q4V3 1NA1C 4YVWB 1RB8G 1POV3 2ZTNA 5BNNB 1H8TB 1V9U3 4IV1C 4N53A 1NA1B 1Z7S3 1ZBA2 4N43A 1AR61 1B35A 5AC92 2WWSA 1QQP3 4IV1B 1RVF2 4Z92B 1VRH3 4CDQC 1RUG3 3DPRC 4GMP1 2HWF2 4FSJA 2RS13 1IHMA 1BMV1 1HRI2 4CDQB 1VBA1 1RUC1 3NAPC 5K0UC 5A32B 4Q4Y1 1RUD1 4FTEA 1OHFA 1CJDA 3NAPB 1HXS3 5K0UB 3VDDA 2RR13 3ZFEC 2Y26A 1TMF3 1FMD3 3VBOA 1VBD1 4GB33 3JBG3 1NY71 1AYN1 3VBFA 3ZFEB 1COV3 1RUC3 1ZBE2 5BNNA 1AR91 1PIV1 1H8TA 4Q4W3 1PO13 4YVSC 3JD73 1BBT1 1RUE2 2FZ2A 1RUD3 1ND2A 1HRV1 2GSYA 1OPOA 4Q4X2 1AYM2 1AR73 4YVSB 1VBD3 3TN93 4CDXA 5J98B 2RM22 1VBB3 4WM8A 2HWC3 1RUH3 1AR82 5LK7B 2HWB3 2XBO2 1PO22 5DDJ1 4N53C 2R062 1AR93 4CDUC 3J8F3 2HWE1 3JB4C 5A32A 2R071 2R041 4N43C 2WS92 1VBC1 1C8M3 4NWWA 4N43B 3LOBA 1MEC3 1AL22 1FPN3 3ZFFA 4Y5Z0 1ASJ1 1QJX2 1QJU1 5BNOA 2WZR2 2HWE3 4NWVA 4Q4V1 4WM7A 1R082 2ZZQA 1PGW2 1TME3 4RHV3 3VDDC 1BEV2 1Z7S1 2WFF2 1FOD3 5CFCC 3VDDB 1QQP1 2MEV3 2TBVA 4CEWA 1NCQB 1PVC2 1R093 1VRH1 1RUG1 5BNNC 4Y4YA 3ZXAC 5BNPA 2RS11 4RFT0 2RMU2 1RUI2 1ND2C 4JGYA 2RS52 1X36A 2IZWA 1RUJ2 1K5MA 1QJY2 1V9U2 1EAH2 4CDXC 5ACA3 1ND2B 1RHI2 2HWD3 4WM8C 1HXS1 1RMU2 2RR11 2VQ0A 4CDXB 1TMF1 1FMD1 1WCDJ 4GB31 3JBG1 5CFDA 1F2NA 4WM8B 2QQPA 1COV1 2FZ1A 5JZGA 1EV12 1R1A2 2PLV2 1ZBA3 4Q4W1 5ABJC 5AC93 1PO11 3JD71 4LLFA 2RS31 1VB4A 5ABJB 2HWF3 1AR62 1AR71 3ZFFC 1NCQA 3TN91 5BNOC 1D4M1 3S6PA 1VBB1 2X5IA 2HWC1 1RUH1 4WM7C 3ZFFB 2HWB1 5BNOB 3VBSC 5A33A 3J8F1 4WM7B 1BMV2 1VB2A 1VBA2 1RUC2 4RQPC 2RS33 1OOPA 3VBSB 4CEWC 4Q4Y2 1RUD2 3M8LA 4CEYC 3ZFGA 1C8M1 4RQPB 1X33A 1D4M3 2XPJA 1VBD2 4CEWB 1MEC1 5C4WA 1NY72 1AYN2 1ZBE3 4CEYB 5BNPC 4BCUA 1F8VA 4JGYC 1FPN1 1K5MC 1VBE1 3HAGA 1RUE3 4SBVA 1MQTA 5BNPB 1DDLA 3JB8A 4JGYB 1AR92 1PIV2 1AYM3 4Q4X3 1K5MB 1POV0 4RS5A 1TME1 1BBT2 4RHV1 2RM23 1HRV2 5ABJA 5CFDC 1NG0A 1AR83 1HQNA 1E57A 1FOD1 1PO23 2MEV1 5JZGC 2R063 5CFDB 4CDUB 1R091 5FMOS 1VBE3 4RR3B 5DDJ2 5JZGB 1RUF1 2HWE2 3VBHA 2R072 2R042 3VBSA 1QJZA 1NCQC 5C9AA 5ACA1 5C8CA 2BPA2 1PGL1 1M06G 1W39A 1VBC2 2X5IC 4RQPA 2HWD1 5FMOL 2WZR3 4CEYA 2X5IB 2BFUS 5D8AA 4GMP0 1RUF3 1ASJ2 1QJU2 1BEV3 1OOPC 5A33B 4Q4V2 1ZBA1 5GKAC 3ZFGC 1ND3A 5AC91 3VBRC 1RVF1 4GH4A 1PVC3 1OOPB 1HX6A 1Z7S2 5C4WC 3ZFGB 2HWD2 2HWF1 5L7OA 3VBRB 1NOVA 2BFUL 1QQP2 4CDUA 2RMU3 5CFCA 1RUI3 4AEDA 4RR3A 2RS53 1MQTC 1CD3G 1HRI1 1NCRB 5C4WB 2GH8A 1RUJ3 1VRH2 1RUG2 1QJY3 5J96B 4RS5C 1EAH3 2RS12 1MQTB 1RHI3 1AUYA 1RVF3 1RMU3 4RS5B 4JGZA 4IV3A 2DF7A 1A6CA 1VAKA 1HXS2 2RR12 1EV13 1R1A3 1TMF2 1FMD2 2PLV3 4GB32 1HRI3 4QPIA 3JBG2 1ZBE1 3VBHC 3DPRB 4QPGA 4PDWA 1COV2 1AL0G 1GFF2 1RUE1 5C9AC 5C8CC 1C8NA 3VBHB 4Q4X1 1AYM1 1AR63 4Q4W2 1SMVA 1PO12 3JD72 5C9AB 2RM21 2RS32 5C8CB 3IDEA 4GMP3 5FOJB 3VBRA 1AR81 5D8AC 1AR72 2XBO1 1PO21 3CJIC 3TN92 1NCRA 4YVWA 1D4M2 2R061 1VBB2 2HWC2 1VBA3 1RUH2 5D8AB 2ZAHA 1ND3C 3CJIB 2HWB2 2WS91 4GH4C 1NA1A 4Q4Y3 3J8F2 3VBUC 4CDWC 1ND3B 4IV1A 5L7OC 4GH4B 2BBVA 1AYN3
chains in the Genus database with same CATH superfamily
1MS0A 1XJAA 1SCRA 4YZ2A 4CDWB 2W47A 3NL1A 4F83A 1W99A 3W21A 4EN0A 3UL2A 2BVVA 1J3PA 1OKQA 4M0HA 4AEDB 4CDQA 4EYUA 5FWJA 2BUKA 2E6VA 2JB8A 4PLNA 3ZXLA 3TOJA 1S2BA 4IE4A 3POJA 3CZUA 5FZCA 1BBT3 3UGFA 3WNNA 3ECQA 4FPLA 2D5FA 5IJRA 3OJBA 1NAEA 1UF2C 1LGCA 3SQOA 3I2FA 1YRZA 1GOFA 1YFWA 1SZBA 3I59B 3NNJA 4P02B 4QT6A 4AI1A 1G9FA 3BN6A 3ZYFA 5E1RA 1B35B 3Q8EA 4NROA 4R9AA 4YW7A 5JDBA 3DYOA 4IV3B 4BIFA 3QD6A 3SEPA 1QJX3 3MIEA 1V6MA 5FBZA 2K2SA 3S7IA 2Q8EA 3OBTA 1PK6C 5FZEA 1RUI1 2VZVA 2WQ4A 2Y6GA 3AP7A 1W6NA 2BWCA 2ENRA 1RUJ1 2K9ZA 3RFRA 4QPGB 1HB1A 1UOFA 4CSWA 4PDWB 3AJZA 1V9U1 2VY0A 4XQDA 3UT0A 3THCA 3WP3A 1FI2A 1K5JA 3LF7A 4YYOA 5BY5A 2UYAA 2WFF3 1SBEA 4HLTA 4P9JA 2VZOA 3H50A 5F5IA 3WVJA 1UQXA 3N9QA 5FOBB 2ZMKA 1VP6A 4UAPA 3INAA 4BWOA 3PVBB 2BYVE 2ZMNA 1H2LA 3VBUA 4XBQA 1KITA 4N9IA 4ITCA 3HQXA 4YGDA 4V2VA 1XNKA 3ZVXA 4JRLA 4IL7A 4QXCA 2VOTA 1QJU3 1EV11 3VBFB 2PLV1 4UFMA 5F9TA 1HJGA 1NA1C 4V1PA 4CVUA 4TLFA 1RB8G 1ZRFA 4FBFA 5I8SA 2ZTNA 4FOQA 2WQ8A 2SLIA 3KT1A 1UZWA 4MZUA 2WR9A 3JXSA 4QKBA 4YW3A 1UKGA 3VHOA 1OA4A 2Q8OA 4P5HA 1NKGA 3QLQA 1CPMA 2Y34A 1W8UA 4CPBA 5FR3A 5IVEA 2C26A 3RRDA 1C5IA 1IQDC 1S0BA 2Z79A 5I93A 3KV4A 3DKQA 2VOWA 4Z92B 3KSCA 5FPUA 4KG0A 3QBQA 4L8QA 2KR2A 3PMEA 4HPKA 1VRH3 5F8PA 2JD9A 3DPRC 4GMP1 4KGGA 3LA2A 4B4QA 1OQEA 3UV9A 5FZDA 1DP0A 2Y38A 1UMZA 2VVEA 3HN1A 4QDRA 5HV4A 2W87A 4CDQB 4XBNA 4B4PA 1FV3A 1GP5A 2WNVA 3NAPC 4KMQA 4ZXEA 4AI8A 4IEVA 4CP0A 5KHKA 3WQBA 1BQPA 4L11A 3B69A 3DECA 1RUD1 4GZ9A 4MGSA 1OHFA 3KLSA 4CRQA 2W68A 3VDDA 2RR13 3B02A 1IGOA 4FXKB 1S2KA 2D5HA 1YC61 4ISRA 5A3TA 1JHJA 4Z82A 1JS9A 1AYN1 2XUMA 2E7QA 3RI9A 3I2KA 5JSRA 1COV3 3BIEA 4TSVA 1Y7BA 2W9XA 3OEAA 1DYPA 2XGXA 1QEXA 4IW3A 3WF3A 4E2QA 4EN8B 1WLCA 1W6NB 5IATA 2G9GA 4COWA 3RSJA 5D21A 3KQRA 4KWUA 3AFGA 1UU5A 4YVSC 5ERLA 4AI0A 4C0BA 4K1YA 1BBT1 3ZYBA 4CCDA 3OGRA 3M70A 3KV6A 1V70A 2WDBA 3NRUA 1GQPA 4BQ2A 1HQLA 1UIKA 2VMFA 2ORXA 2XL9A 4CYDA 3M7AA 4PLOA 1K3IA 4MGYE 1JXNA 1AYM2 4Q4X2 2V5YA 5IW0A 3ZSLA 3T3YA 1VBD3 1H9WA 4YGEA 2WT2A 3LPGA 3TN93 2ZGSA 4XIOA 3POYA 1NZCA 4WM8A 2HWC3 3MEPA 5DUVA 5F37A 5FO9B 1X50A 3MICA 3H8OA 1O8PA 1US3A 2XBO2 3O1TA 1QH7A 4CCLA 1NXMA 3SC7X 3AKQA 2ZJCA 2XVKA 5LBBA 2DV9A 5A32A 1JW6A 4HK8A 1RTVA 3WDWA 3OGGA 4AVTA 5FYUA 5CADA 3VV1A 2IXCA 1PNGA 2FHRA 3H1YA 2VGDA 3ORJA 3CMGA 1UY4A 3RJ2X 2DVAA 3WNKA 5A1FA 1H6XA 5I0RA 1ZRIA 3FL7A 3SEEA 2D40A 1LNSA 4XQ4A 2YHJA 3LZZA 3BIWE 5H9SA 4AI9A 3GCWA 4YZ5A 4HN0A 1XNCA 1HW5A 2YROA 4QXBA 5F32A 1AL22 4HPKB 5HCBA 2DURA 3RJRA 4LEJA 5FJHA 4OI1A 2EA7A 2QQLA 1QJU1 5F5AA 2NP0A 1BKZA 1JZ4A 4NWVA 4F3JA 1DGRA 1UKRA 2A7AA 5CU1A 4ISQA 5FAXA 4D0QA 4X6RB 1R082 3DV8A 4LHLA 2WNVB 4QB1A 5CG9A 1DQ2A 5FYCA 4UBHA 4XUTA 3OB8A 1GQHA 4RA0A 3MDPA 4DPNA 5JPMB 1RUNA 1LU2A 3K51A 1I9RA 1UXZA 3A4UA 1MS9A 3VDDB 2ZEWA 2OPKA 5DZFA 2JKXA 2TBVA 3JU9A 4AI2A 1PVC2 3ZIWA 2ZX4A 4N7UA 5FY1A 1BK1A 4FFGA 4K6BA 1NUKA 1VRH1 5BNNC 1JU4A 1SLBA 3J9SA 4QAWA 3ZXAC 4MADA 5BNPA 1YI7A 2JDUA 1BXHA 2ORZA 2RMU2 4Y5SA 1ND2C 5FZ6A 3THTA 4BE3A 1N1YA 4R9BA 2R1BA 2B45X 4I30A 3ZSJA 1WCSA 3KD4A 1UY0A 1WD4A 4CDXC 2FDFA 3R0RA 3WY6A 3AL5A 2EIEA 5DAQA 2JIJA 2QQJA 5FQ0B 4AQ6A 3N35A 5GLTA 1OT5A 1K12A 1YI9A 2RR11 2VQ0A 1XOYA 4DUXA 2ZGRA 1F2NA 2DCTA 4A7YA 1ZRCA 4WM8B 3ZXGA 4M3CF 1VALA 2ADEA 4N7IA 4ZZ5A 2GN3A 1PM7A 2HLEA 1COV1 1HKDA 3BALA 4MHUA 1V6LA 3S7EA 4QPYA 2YB7A 1KXGA 1OH4A 2JG8A 3QACA 3J7MA 5A6XA 5CB7A 3GZTB 2CGPA 5IVBA 4LKFA 2WWJA 5ABJC 2GNTA 2Y8KA 3J4UH 1O7FA 4A41A 2J22A 5JSPA 3UK9A 1REEA 5F5CA 2VMIA 3ZFFC 3LE0A 5FYTA 2KM2A 3TN91 3M3IA 3UJQA 3AZYA 4AAXA 4FPEA 1D4M1 2XOMA 3S6PA 1W2TA 2VL4A 5IVVA 2HWC1 3CIHA 4P9IA 4BMEA 2VUDA 1AJKA 2HH9A 3NW4A 4PI2A 4HFSA 5IK7A 2AREA 1PVXA 3VBSC 1WCQA 5IYYA 1OH3A 3NVCA 1ST8A 1BMV2 3GF6A 4Q8KA 1RUC2 4HL0A 4A3XA 5K9YA 3GCXA 2W1WA 2ZHLA 1OOPA 2YU2A 3IAQA 2VOVA 3RMXA 4CEWC 1MS1A 4Q4Y2 5HPOA 2OZ6A 3CLPA 2QJVA 4DZGA 1C4RA 2PTMA 5C33A 3K48A 2QZ3A 4RQPB 1X33A 3H7YA 4QX8A 2WWUA 4QPWA 3I3MA 1JUHA 2BTVC 1BK0A 1NY72 3K2OA 4FQ4A 3FZ3A 4MYEA 3I2OA 2ZBJA 2QNKA 3HAGA 1UWWA 3AJYA 3W5MA 2PAMA 4EZ4A 3MUZ1 1XYPA 4M4RA 1MQTA 5BNPB 3RYPA 1QY4A 1SG3A 2E9QA 5LRRA 3OBAA 5LEKA 1AR92 1PIV2 1AYM3 4Q4X3 4XTMA 2WYFA 2FDGA 1POV0 3VHRA 1O3SA 1TVGA 4IE6A 1STMA 3O7OA 4IGOA 2R0FA 3NV1A 5EIYB 2JWPA 5FY5A 5ABJA 1NG0A 1GWLA 1HQNA 1F35A 5I0SA 5JXJA 5EXOA 2PQSA 1LGNA 1DYOA 3JCIA 1IG0A 4HKOA 1MZEA 3GHNA 2RG4A 5FZKA 3EHKA 4JDOA 1WW7A 2WO3A 5JOWA 4CDUB 3ZXKA 4A2UA 1VBE3 2XVGA 2C24A 1APNA 4C0HA 2E7TA 3DUIA 3HPNA 1GSLA 2J7MA 5FYZA 3H3LA 3OYWA 4QMAA 4YRDA 3ZR5A 4CP9B 5IK4A 2HWE2 4NAOA 2JG8B 4XEZA 4QKDA 3NV3A 2K0GA 4YM0A 1A8MA 2OKXA 1IS4A 4B8EA 5KHJA 3MYXA 4I0BA 3VBSA 5FZHA 4QXKA 1ULCA 1PZ7A 3JZVA 1LOBA 2V4AA 4LO8A 2PN5A 1WMFA 2PHFA 1J58A 4MUVA 4D7YA 2WNOA 2AR6A 3EB7A 5FK8A 2IVIB 2BWAA 1UAIA 3DGTA 4A3ZA 1IKQA 3Q8AA 3N7KA 5JWPA 1HB2A 2KA3A 1XXNA 2NZ9A 1JZ7A 3LDKA 5JXGA 3BU7A 1YCIA 1NLRA 4Q8LA 2VVFA 2C9KA 5EJ1B 3V64A 4HK9A 3IDCB 2ZGNA 3GJAA 4Q4V2 3MLLA 4E4HA 4NE9A 1A3KA 5A70A 5IK8A 2GZWA 4YG3A 5GZFA 1DHKB 3WT3A 4I0AA 1PVC3 1QNYA 1OOPB 3ILRA 4XFCA 1G7YA 2D93A 4AOCA 2JE9A 1B09A 2OPWA 5T3NA 3EMRA 1QMJA 1QQP2 4W4ZA 2EXKA 5FPZA 1RL3A 5CFCA 2RMU3 1Q43A 4Q0VA 4RR3A 1CD3G 1HB3A 1NCRB 4D8MA 4FPKA 1RUG2 3ZPOA 3E6BA 2YPJA 5FP3A 2FBEA 4YZ3A 4RS5C 1W6MA 2WNUA 4TZDA 5FZOA 1DGWX 1MQTB 1Y9QA 4BB3A 5CAZA 3HJRA 1H9PA 1WLTA 1WMDA 4M3CA 2DCKA 4O7XA 1RVF3 3IT8A 5LBCA 3T0AA 4NHYA 2O14A 2HKXA 4JGZA 3OY8B 1ZX5A 4BQYA 2EIGA 5A3OA 1CIWA 4M0NA 4DXRA 1ENXA 1VAKA 1ULPA 1MZ5A 1HXS2 1ZNPA 1OC1A 2ZGOA 2PHTA 4WZCA 3J7HA 2VCAA 4Q27A 4QPIA 2B8MA 3R05A 3JBG2 1O3TA 2MPFA 5FKBA 3WQ7A 2X53S 3A0NA 4QQHA 2PHWA 2QQUA 3B93A 3AYDA 3ENRA 2VUJA 5LBFA 3VBHC 1N3PA 1H2KA 2C1FA 2XH6A 1BHGA 5FP7A 5C8CC 1KFUL 3OCPA 4Q4X1 4XVHA 1AYM1 4PBOA 4XTPA 5FRAA 2VR4A 2YBSA 1DQ1A 3FLRA 2XWJB 3LCPA 1WLDA 4UW6A 4LNVA 2RS32 1VMFA 4DEVA 4LPLA 5FOJB 3H8RA 5A7NA 5FYYA 4Y26A 2VNOA 2WFPA 5FFOC 3AM2A 2XBO1 3CNAA 2W5FA 3CJIC 3AX4A 4RSUA 4XYXA 1D2SA 1OF3A 4YVWA 5BYNA 5F7UA 5EJZB 1CZTA 1VBB2 2WT1A 1AX1A 1K45A 5G04L 1F4AA 1VLNA 2WL1A 3O5SA 2JECA 2DBIA 3GZEA 4AW7A 1ODNA 4AQ2A 1G9DA 4Q4Y3 4BK4A 2DVFA 2VG9A 3CQOA 5HCHA 1X9PA 5F5QA 4CDWC 1LHWA 5KXDA 1Q8PA 3KF3A 4AQSA 2V73A 4LBQA 4Q1RA 2DYCA 4JCKA 4I3GA 2BBVA 2GU9A 1TNFA 3LFMA 1UYXA 4LUKA 5FZMA 4AEDC 1AL21 5IUQA 3PDQA 1JUIA 1C8M2 4AZZA 4ASKA 3IBMA 3ACLA 3RWNA 1IPSA 3OUJA 2IXJA 4FI9A 2Q1FA 2DUPA 2E53A 3H0OA 5CFCB 1OVSA 2IFRA 1PIV3 1R081 5FYMA 2E63A 3MLJA 4M00A 4CU7A 2VZ3A 4FTSA 3SCHA 1JYIA 2D97A 2IXLA 3NNFA 3Q8FA 4YW1A 3WG1A 4E27A 1B35C 2FQPA 3KVBA 1W6MB 2DVBA 2AH2A 2WNUB 4JTOA 4MGIE 4N53B 2D6PA 5AVAA 4IV3C 3WOGA 4E4DX 4E4SA 2LRPA 4B1LA 4CU8A 5C6CA 4PQQA 1W28A 2NM1A 4UW5A 4M3CB 4HXCA 2Z5WA 2QQIA 3WDXA 5DZGA 1TME2 1YQCA 3IIAA 4JGZB 4XF9A 1LJ7A 1PVC1 4X8PA 1WLWA 5FZLA 4TYSA 1KQRA 3HNYM 3A23A 2WLPA 1YO8A 4H7LA 1J1TA 3MW2A 1V6KA 4IQPA 1A78A 2ARCA 3IB3A 4ZU5A 4HSJA 4QPGC 2P3JA 2V09A 5A6ZA 1GWMA 4PDWC 4NRPA 1QU0A 2PELA 2RMU1 4QPIB 3BI3A 2UU8A 1QF3A 1DGLA 1R092 2BRTA 3KVAA 2A6WA 4O65A 4WBBA 1T6BX 2W1SA 3CJIA 3RZHA 2HYXA 3NWKA 1AZDA 4XACA 2Y64A 4SLIA 4QX2A 2UY8A 1FV2A 2Z69A 1RUF2 4BQ5A 3NNGA 1L7QA 5HXVA 2WO1A 3U0ZA 1RC6A 4AHXA 4LULA 5F3EA 4XFIA 3ZXFA 1KDKA 3PUHA 3VBFC 4WVWA 5CISA 3VBOB 2OVUA 4FTBA 4CDWA 5J48A 4AFDA 1ZZBA 3HT2A 4PJYA 5FIXA 4LITA 2W2IA 1S2EA 4TXWA 1U5YA 4Q4V3 4S2GA 4YVWB 1JU3A 3ZXEA 5KXCA 1LOEA 1W3XA 3HWJA 2WLQA 5FMDA 2WBKA 1HB4A 3LKJA 1JYWA 1Z78A 2GC2A 1V9U3 3RNSA 4XBLA 5A7PA 3H8UA 3UGGA 1DQ0A 1LENA 5CBLA 2ZPXA 1V6JA 3ETQA 3I59A 1ZBA2 4NVPA 1LEMA 1BCXA 2R1DA 4N43A 4DY5A 2X10A 1B35A 4LKSA 1I5PA 1QQP3 5FYIA 2B9VA 1O91A 4EE2A 4I01A 4LBQB 2W0XA 5EYXA 3K3NA 3E97A 3UKNA 1H4GA 1WBFA 1OLRA 2ES3A 3LD8A 3VD9A 2F4PA 4CDQC 1RUG3 1YHFA 2AEZA 2ID4A 2QDRA 2HWF2 1UW8A 3ZO0B 1IS3A 3WNOA 3IN9A 4CXWA 3IAPA 1IHMA 2XUEA 4Y22A 3MIGA 3TBDA 1HRI2 4XAEA 1F5JA 1YFYA 3AZVA 4DINB 1BMV1 4Q29A 3VZLA 1RUC1 1W8WA 3OPTA 4BQXA 5A1LA 5KXBA 1XU2A 2JD4A 3C7HA 3OUIA 1U5IA 3IPVA 5A7OA 3UJOA 1IQAA 3EBRA 4Q4Y1 2JB4A 3CBNA 1ZZ8A 4IEWA 2RVAA 4D6SA 3V0BB 2OQ7A 5BXXA 5FMBA 1HXS3 1W8NA 5HCAA 3AKTA 4GULA 2Y26A 4FPYA 4UYBA 4YFZA 1VR3A 5FY4A 2FDKA 3JBG3 1NY71 5JOZA 3WZ1A 3ZYRA 3ZYJB 1V6NA 3KF5A 4XZUG 3VBFA 3PUSA 3K75B 4HSLA 5L73A 1TEIA 2BVBA 3CL1A 3LSEA 1DFQA 2J1UA 3C2UA 2WA4A 3A22A 1AR91 1PIV1 2XJSA 3PIJA 3R4DB 3NJXA 4UW3A 4WZFA 5ANQA 3WNLA 2WSUA 5H9PA 1RUD3 5FTTC 4AGRA 2GSYA 4LO6B 1OFSA 2WO7A 3LEKA 4MGKE 4ATFA 2W92A 2FCTA 1AJOA 4ZZ8A 2D6OX 3S57A 5J98B 1YIFA 1H2MA 2RM22 2VZRA 3U37A 1VBB3 3U75A 1S55A 3JQWA 2HBTA 1AR82 4KG8A 4XZPA 5FPLA 3HOBA 1LOFA 5LK7B 2WN2A 4LBOA 3WNXA 2ETEA 2YGLA 2D3PA 4BM8A 2JDHA 4BISA 3MZHA 4ZY9A 2HWE1 3A7QA 4WVMB 1MZ6A 1W90A 2AGSA 5DAVA 3T0DA 1Y4WA 3D0SA 2PXJA 4QX7A 1UPSA 2WS92 4CXXA 2GAUA 4QX0A 4FFIA 1N1SA 4DRRA 2YMZA 3BB6A 3HR9A 4QDSA 1ZYBA 2ZHNA 5IK5A 3WG3A 1C8M3 2QQVA 1R1ZA 3PNAA 1YXWA 3H1MA 4N43B 1D0GA 4AF9A 2YFZA 4LTAA 3RI8A 3VZJA 5JXIA 1OMIA 3AKSA 5FWEA 1QIQA 1S0FA 4A45A 4K9SA 4QGNA 1UX7A 4DS0A 4MGQA 2WNVC 3D6EA 3C7OA 4L0PA 5CZKA 2XJQA 3TAYA 2G1MA 2WZR2 1LULA 1WWYA 3NV4A 2C0ZA 1OLQA 4Q4V1 4WM7A 1W8TA 4Y22B 2VBBA 3PVOA 1S0DA 4HOOA 3N3HA 2FDIA 4M01A 5FPBA 2NLRA 1PGW2 1TME3 2J1AA 3IPVB 3VDDC 2O8QA 3I54A 2PHLA 3I2GA 5C70A 5J3UA 1VIWB 5GLWA 4E9KA 3AP4A 1LRHA 3O0WA 2P2KA 1DQ5A 3OOXA 3PJYA 1H0BA 4Q1PA 4RGKA 3A0KA 1QQP1 1XPWA 4R8HA 1NCQB 4JKMA 3GM8A 4HMZA 4K8RB 1R093 1QDOA 4P9LA 1WCUA 5EQUA 5T50A 2AUYA 3RVHA 1RUG1 3ZSMA 5D2AA 4LO5B 4MV2A 5F2WA 2YBKA 2DUQA 1MS4A 3M2MA 3H3ZA 1KJRA 1CQ9A 1X9TA 1ZRDA 2ZHMA 3KT7A 2Y6LA 4JGYA 3WUCA 2RS52 4EZHA 4KL1A 4LE4A 4PIXA 1YLLA 1XE0A 3HNMA 1QJY2 3AMQA 1PNFA 4KU7A 3WP6A 4YSFA 1H1MA 3I2JA 4UXAA 2GNBA 4Z07A 5FLHA 4BZ4A 5A3UA 5E89A 2W94A 4OFGA 3AP9A 4P9WA 4WM8C 5FKCA 3N4MA 1W06A 4H2AA 4COYA 1HXS1 2BBAA 3QH7A 1EPWA 2AENA 1RMU2 2RDQA 4XIKA 4BQ1A 2BP6A 3THPA 1PM4A 3BCWA 4LBKA 4QX3A 3JBG1 4IE5A 4W65A 4W6XA 4XETA 4AEJA 4CXYA 5GZGA 2Y6JA 4XAAA 1XNBA 4DFSA 3LDBA 4XMAA 3N7LA 1MZFA 4JHTA 1W8OA 3ZN6A 5JZGA 1R1A2 2QQMA 1ULGA 4JVAA 5FYVA 5LASA 3FLTA 2UYBA 1ZBA3 1J83A 4U36A 4UT5A 4Q26A 4XW3A 2GP5A 4KI5M 2JICA 4LLFA 2RS31 5FZ4A 5DAWA 3U14A 5F1RA 1GV9A 5FY7A 1A8DA 1GZWA 3GDBA 5T5JA 3WQ1A 1LEDA 2ZGPA 2HWF3 3KM5A 4BA6A 2YBPA 3POFA 1HV0A 4FO9A 1LTEA 2ERFA 2BU9A 2JDAA 1OLME 1H2NA 2HEVF 5CKMA 4BPZA 1UZVA 1VBB1 5BNQA 3MLKA 1SDWA 2YYOA 1LHOA 4G9SB 4JDMA 1YEWA 4LBNA 5JSOA 3POGA 2BEOA 3EJKA 4AR2A 1CX1A 5CKNA 2NMOA 2VMEA 2Q8CA 2YDEA 4YFWA 2VH9A 3BODA 4AHZA 3KGLA 4WM7B 5IVCA 4HN1A 2MHFA 1AXZA 1VB2A 2FMDA 4PT6A 1I6XA 4S2HA 4W8JA 5FXVA 4RQPC 2EXHA 4YW5A 5CYYA 2RJLA 1SPPA 3KCYA 4LHKA 4YM2A 5FP9A 2VQUA 2WO2A 5FQ0A 3M8LA 3QCWA 4DRVA 3T2OA 1C8M1 1J3QA 1D7PM 3MO4A 2RE9A 1XB9A 4KWLA 2CSGA 4B7EA 1D4M3 4QGLA 2VCMA 5LK5A 4UW4A 4XF0A 5BNPC 4ZU7A 4CEYB 2VW2A 5DQ0A 4BCUA 1F8VA 2B7YA 1L7RA 1XYNA 1L7LA 3LOIA 2OIIA 2WAOA 1LECA 4FPCA 4IUGA 3JB8A 3OBRA 4JGYB 1XYOA 1QOOA 3VD7A 2P17A 2Z2SB 4N90A 4NR1A 3F2ZA 4URAA 4DMIA 1XBFA 1TME1 3NQHA 5DZEA 1ULDA 2VBDA 3LAGA 1GZ9A 2RM23 5JOXA 5DABA 1HRV2 2QZ2A 1MR5A 5HI0A 2VXRA 1VRBA 1AR83 4B3NA 2JG9B 4F7ZA 3AB0A 3SMHA 3ACGA 5A3MA 2VNGA 4GWJA 4YM3A 5I8YA 3FHQA 4I0WB 1W9SA 1R091 1SLLA 2JG8C 1JBCA 4QB2A 1H4HA 1POQA 1EYBA 3MF9A 4XF4A 5DDJ2 1UU4A 3ZN6B 5JZGB 1RUF1 4IE7A 3I2IA 4HANA 2PQQA 2XVLA 1JMUB 4Y1UA 4JQTA 3AYAA 4LXLA 3P3NA 1C57A 2P34A 2R042 4K7JA 5JCTA 1PZ9A 2BERA 4FOYA 4XFHA 5C9AA 1SCSA 2ARXA 3OBZA 2QE3A 3V0AB 1M06G 3SH3A 5L19A 3NNMA 1VBC2 1KJLA 2W91A 1GZWB 3D0JA 3JUUA 4RQPA 2PMWB 5GZDA 3PTRB 3USSA 3WINE 4MGTA 1O6UA 2WZR3 1DQ6A 4IEZA 4B29A 2XDVA 3B7MA 3HN3A 3OPZA 4XUPA 3UETA 3DN7A 1LKNA 1OD5A 4U2AA 5IFTA 1UYZA 3ZKYA 2BW8A 3WHTA 5B2GB 1I5ZA 4Y3OA 2GC0A 4L92A 4QB6A 1PHMA 1OOPC 1W9WA 3VKFC 3WF0A 1AXKA 1DCSA 1ZBA1 3M3QA 1O4TA 1ND3A 1XE8A 1D2QA 4FPFA 3RYRA 2F4LA 1JYVA 4C1WA 4GH4A 3J26N 4PF5A 1SPPB 1TG7A 3LFIA 3O0VA 1CAVB 3RZMA 4A44A 1MS3A 4ZKTB 2HWD2 2HWF1 4HT1T 5D1IA 3VBRB 3HT1A 4RD7A 4E4ZA 4H7MA 4E2SA 1SFYA 1WW5A 3GGLA 3N7MA 3WW4A 1IPKA 2H6CA 3AZXA 4UF0A 4CDUA 4DXTA 2RS53 1S0CA 1MQTC 1HRI1 2CNAA 1KGYA 1MS8A 2GH8A 3M1HA 3N9OA 4QU1A 4GWNA 4UFIA 1QJY3 2FDHA 4C8DA 4NRQA 2XJRA 1GLHA 1UD1A 4CP9A 3OF1A 1EUTA 5FV3A 2RS12 2G9ZA 4E8DA 3C3VA 2FDJA 2VVDA 2W1UA 3FWEA 4XFGA 1JHNA 3ZIXA 2BJSA 4LHNA 4OUMA 1RMU3 5FZ3A 3UESA 5EJ3A 1IPJA 2N7GA 3ON7A 3LEMA 1KD7A 4NHLA 1RXFA 1Q8SA 3B94A 5FUNA 3E6DA 3SNMA 1VJ2A 4H14A 4ZU4A 2JENA 4O9EA 3HNBM 4LOSA 3C7EA 4JAAA 3AP5A 4AG4A 3MW3A 3FFZA 1R1A3 1LB2A 1GWKA 1YNAA 1TMF2 1FMD2 2VQTA 4YPJA 3WP4A 3ZX7A 5IFPA 3M3CA 4AEKA 4C90A 3DPRB 5H9QA 4BLIA 1Y9MA 5T54A 1JZ8A 3FUOA 3O1MA 1W6QB 1Q8VA 4HVOA 5FXXA 2VCBA 3U4XA 3ZSKA 4ASLA 3R4SA 2Q8DA 4DO0A 4AK3A 1CX4A 4JRAA 2GC1A 1UN1A 4YARA 1YJKA 4CP1A 2WRAA 4A7KA 1OUSA 2GC3A 3GNEA 5C9AB 2R16A 2RM21 5A6YA 4OYUA 3T1LA 3VKLA 3W5NA 5DUUA 1AR81 1FAYA 1ZZ7A 4LO7A 4CUGA 5LWBA 1AR72 3AMPA 2E26A 1GZTA 3OGJA 1HDKA 3ACFA 4UWDA 4XXAA 3M3EA 1NCRA 5J7MA 2V72A 5C3RA 4HBNA 3ETPA 1IG3A 2JDKA 3CHXA 5FXWA 2B5HA 2ZAHA 1JI6A 2HWB2 2WS91 4LIUA 1W2UA 4XABA 4DEQA 5FDBA 3KZ4C 1RJ7A 4EV0A 3K77A 3J8F2 4TWTA 1DBNA 1CVNA 1RXGA 1JYCA 1GR3A 1ND3B 4EWAA 3OY8A 4IV1A 1UZYA 2A75A 1VMHA 4GH4B 1SLTA 3PVEA 4IEPA 4L9BA 2JEMA 5CFCC 4RR3C 1JH5A 5FZFA 2XBO3 2J1VA 3RZZA 1QHDA 2BGCA 2WC2A 5DUXA 5FYBA 5A7QA 4LR4A 3K3OA 1OQ1A 2EF6A 2WZR1 4EJRA 2WNUC 2Y6KA 4UF0B 2VUAA 2ET7A 2P3IA 4XMIA 3VDBA 3RWKX 3JQXA 4DQAA 4OQ8A 1PGW1 1TZOA 1K42A 4BIOA 2ZZJA 5FZBA 4JGZC 4DOUA 1ULOA 1HRV3 3WUDA 1J1LA 5EYYA 5K0UA 4ET7A 3DXUA 1BVVA 1CAXA 2NN8A 2O1QA 3AXEA 4J6GA 3ZOIA 4COVA 1VPHA 2ARAA 3ZR6A 3HQRA 2E7AA 1AL23 3H9AA 4QPIC 3VHPA 2JE7A 2IWGB 2JDPA 3RZKA 4Z8BA 1DGRN 2GALA 4KGQA 3ZFEA 5DXDA 5DDJ3 1U5XA 2ZXQA 4JHZA 2P3KA 2Q1MA 2MEV2 1CONA 2K46A 1DQ4A 2B4KA 1R083 3OUHA 2RS51 2OUJA 1EY2A 4MGZE 3URFA 1BJQA 1T6GC 3DKWA 1UY2A 2DBNA 3WW1A 2R043 1QJY1 1POV1 4IEOA 3N7JA 4LBJA 4I09A 1S0IA 2JIGA 4QM8A 3DEMA 4R9DA 3FBMA 2YY1A 1LESA 3ZXJA 4HVQA 2WQZC 1LR5A 4PF1A 4Y24A 3VBOC 1VBC3 4JDNA 3AP6A 1YQ6A 4BK5A 2HEWF 2HBUA 3TB0A 1RMU1 4JC1A 3KB5A 1ZRRA 2JDMA 5ACA2 3O1VA 1Q56A 1W6PB 1S4CA 4YVWC 3NO8A 4Q5OA 4XURA 3WX5A 2OXBA 5LY1A 1NQJA 5SV5A 4EWDA 3GBFA 1PMIA 2VOXA 1R1A1 1JN2P 5JOYA 4FPJA 3P1IA 4YGCA 4Z2WA 4ES8A 4CA9A 1DLCA 5BNNB 2DCZA 3I2DA 1H8TB 4MXWA 1W6OB 1EP0A 1O4YA 2QQWA 4N53A 4PQ9A 3MFCA 3WG4A 4A4AA 3A21A 2YU1A 3VD4A 2CTVA 5DMYA 4HKLA 2XQRA 3BTAA 5JPNB 4OQ9A 3H42B 1GBGA 1Q8QA 1OQDA 4IV1B 1QJEA 4R52A 4Z1VA 4Y4RA 3ILFA 4YG6A 1GNHA 5FZAA 2DVDA 3WDVA 3MV11 2GMPA 2VMCA 4EN9B 2OW4A 3LEGA 4OMDA 2QCSB 1ONAA 2VNVA 3Q8BA 5E6HA 4FSJA 2RS13 4KH9A 2XL7A 3SLIA 2XHNA 5JAXA 3GZUC 1W3VA 2XJUA 3C8XA 3MFAA 3T08A 4A6SA 2GN7A 3K4AA 1HIXA 2IFWA 3OGVA 4QU2A 3H3UA 4GXLA 4GAZA 4OHVA 1SFNA 3B9CA 3IKWA 4LQRA 1W8HA 1CJDA 4NHMA 2ZKNA 5K0UB 1C28A 1CAXB 1YQ8A 1S0GA 1OVPA 1ULEA 3WV6A 1TMF3 1FMD3 3VBOA 1GMMA 4NIIA 2HJIA 2VPVA 3NJZA 2VW0A 2AC1A 3ZDSA 3T2PA 3RG0A 2XQXA 2PYTA 4PHZA 4AAPA 3E6CC 3ZFEB 3MPBA 3SITA 5FZ9A 2C9AA 5JMOA 1RYYA 3UGHA 3ZPYA 4PIZA 4EROA 2VQAA 1RUC3 1ZBE2 4OZOA 2CWMA 2ZEYA 3ZMNA 2IXKA 4XOGA 4K3UA 3T2QA 1H1AA 4BHPA 1JOBA 1RUE2 4CCJA 5KHHA 5E16A 2WSVA 3D5OA 4MO3M 1HRV1 2YG0A 1OSGA 1AR73 3MI8A 2VO5A 2DTYA 4ORFA 1CAWB 5I0UA 4ZPIA 1HN1A 1RITA 4KU8A 1Y9GA 3ES4A 4XF1A 4XJAA 2JDYA 4XFAA 4IEYA 1CZVA 5AFEA 2C5DA 4NUBA 2HWB3 5DDJ1 5CKQA 1ZZ6A 3VUOA 2RV9A 4Y1VA 4GD4A 3VZNA 1AR93 2ZGUA 3J8F3 3JB4C 4LIVA 1IZ3A 4ARYA 1DIWA 2XLFA 4N8MA 1NQDA 2R041 4N43C 2OA2A 3Q8CA 2H0VA 5DAXA 3BOPA 4MXWB 3RZGA 5LA1A 1WUVA 4HETA 3S30A 4DXZA 3PUAA 2C4XA 2X8KA 1VBC1 5FREA 4NWWA 2ZOEB 2GH2A 3RGBA 2VMDA 4NAMA 4FP3A 5FO7B 3FFQA 2RDRA 4XUOA 3I4IA 1OBNA 5F2SA 1W0PA 2DU1A 1V00A 2Q1ZB 2W08A 3GBWA 4Y5Z0 1FXZA 1KS4A 5BNOA 1QJX2 4P08A 3WD5A 5LA0A 1AXYA 2HWE3 5KR7A 2YZ4A 4LHSA 1OA2A 1RINA 4BQ4A 5E88A 4DIQA 2WZEA 3AMMA 2ZZQA 2VMHA 1UX6A 3AMHA 4WVVA 4AVCA 5C3SA 5FUIA 4QQ2A 4OULA 3AL6A 4S2DA 1WGPA 2FD8A 5CNAA 2TEPA 1BEV2 5JMCA 4EQVA 4G3YC 1NLQA 2UY9A 3I8TA 2ZX3A 2WFF2 3U07A 2Q0AA 2IVJA 2E31A 2MEV3 4BXSV 4AEMA 4XJ8A 3BGAA 4AE2A 3O12A 2BNNA 3O1RA 1DZQA 2WA3A 5GM0A 2B39A 3THDA 3MIDA 5KBFA 1US2A 3CDZB 3ILNA 4YW2A 4LT5A 2RS11 4RFT0 1UNBA 4WVMA 1UYPA 5JR2A 5KWRA 1X36A 2MNGA 3B9IA 2IZWA 1K5MA 3VL8A 1W04A 3KT4A 4OI0A 1F15A 3AYEA 1EAH2 1ENQA 1TNRA 1WBLA 3AMNA 3MIHA 4UFJA 3RMYA 5ACA3 4OLLA 2A3YA 2D43A 2O0OA 1GKBA 1RHI2 2ET1A 1W0NA 2Q30A 2A71A 2JE8A 4IDZA 1CPNA 1LOFC 3WHUA 2GDFA 2QKDA 4UFLA 1TMF1 1FMD1 2Y60A 5HBAA 1H1IA 2H6BA 5CFDA 3BUCA 3HMYA 3APBA 4Y20A 3SCFA 2PAKA 2QDNA 1UYYA 2J1TA 4LLOA 1LHVA 1MVEA 4R4XA 2P6CA 3WDUA 2FZ1A 1PX3A 5G05L 2W1QA 4QHZA 3U78A 1G9AA 4AFMA 2DTWA 2V5DA 4AVVA 4OUSA 4CU9A 4HG6B 1HLCA 3CZJA 1QOSA 3KQ4B 1CAUA 4OMCA 3MW4A 3WDTA 1VB4A 2HYKA 1GNZA 1XNDA 1P8JA 2CGOA 2XJVA 4JZRA 4WVZA 3R6SA 3ZYPA 1AR62 1AR71 2BGOA 1TQ5A 2G19A 1NCQA 2P5BA 5KC6A 2UWCA 1AX2A 3NJYA 4RGAA 3FC0A 4BYYA 5C5UA 2X5IA 3N9PA 3DF0A 3LEIA 4FPHA 4WM7C 4DNYA 5K4LA 1UOBA 2DU0A 4DXSA 1JZ3A 2HWB1 5BNOB 2XKPA 5A33A 4GJYA 1WW4A 3J8F1 4A7ZA 4IEUA 3VDCA 1VBA2 1X8MA 2ZABA 4AVAA 4MG2A 4JKKA 1L3JA 2YXSA 1SFPA 3K46A 4KBBA 3ZN4A 1IKPA 1N3OA 4ES9A 5HCFA 2EICA 2RS33 4YGBA 4FFHA 2VZ1A 5DG2A 4CEYC 3ZFGA 4OHYA 3SXWA 1BYHA 1GQGA 2DCJA 2XKOA 4LBLA 4W6WA 4X6QB 1HJFA 3S5QA 5KC5A 3WQ0A 1UOJA 4LE3A 1VBD2 1QXPA 2A6ZA 4CPBD 5JXHA 4F8AA 2XPJA 1C1FA 5C4WA 1ZBE3 4JGYC 1ODMA 5GJ6A 2WT0A 3OTFA 1NE6A 4AXOA 1RUE3 4MHRA 5FZ8A 5A7WA 1OXCA 2R30A 3ZM8A 3C7GA 1VAVA 3AVRA 3BTZA 5C5TA 2A3WA 3WF2A 3WF1A 3WCSA 1K5MB 2E32A 2UWBA 3X29B 2ILMA 1N1VA 4GIQA 4XPVA 3USUA 3RZJA 4XDPA 3H8XA 1OPMA 4IGQA 5L9BA 5JVVA 4CE8A 4FAGA 1VAMA 3VZOA 5B4XA 5CG8A 5T5PA 3IDAA 1FX5A 2MEV1 5JZGC 1UMIA 2JX9A 2AACA 1DGWA 4DB5A 1Y3TA 2WNEA 5CFDB 4PI0A 4Y20B 5IAVA 4FT8A 4DUWA 4FOWA 2JDZA 4NHKA 1LHUA 1XC6A 3TEXA 5GLZA 2DCYA 3LQCA 4CUAA 3W20A 5F39A 3HBKA 1FYUA 1O5UA 3BTXA 3VGIA 1FATA 4GALA 1NX9A 1ZZ9A 4AGVA 4FCAA 4LK6A 4NPLA 3TNPB 1GYKA 3AVSA 5FLIA 2R072 2NYYA 4DUVA 2BDRA 4LBMA 1YIPA 3IMNA 1QJZA 3V56A 3AYCA 2WN3A 3NV2A 5ACA1 2X05A 2W95A 2I45A 1CAUB 1W39A 3GBGA 4ZS2A 2VXJA 4NPMA 4AQTA 5FMOL 1O3QA 2DUOA 4P5YA 5EP9A 4CEYA 3H7JA 3NJVA 4CCNA 4Y5TA 1QNWA 3KV5A 5HV0A 2X5IB 4E2GA 5D8AA 1JOJA 4GMP0 4H55A 2P1BA 2R7EB 4XUQA 2BNOA 3PU8A 4C1XA 1RUF3 1ASJ2 2WIIB 4KQ7A 2VE1A 4CUBA 1BEV3 1OURA 1ACCA 5A33B 3OGSA 3I3DA 3POIA 4CP2A 4MVTA 5GKAC 4HZFA 4FPGA 2XLAA 4CCMA 4FPOB 3I49A 2D6LX 3I3QA 4RFRB 1ZM1A 3VBRC 3VZKA 3WG2A 2ZCWA 3KWVA 1F5FA 4IGPA 4E8CA 3HBZA 1OFNA 1N1TA 3M4FA 1Z7S2 2JG9A 2Y6FA 5JLVA 1C5HA 3UYJA 2VC9A 2LM3A 3ZFGB 5J36A 4BDVB 3TEZA 2PHRA 3EYPA 1OI6A 2KXLA 1UZZA 3LB9A 2BFUL 4D3WA 5L7OA 2W46A 2PHUA 2XG3A 2NPIA 5FY8A 4FOVA 4OHXA 5C4WB 3G6JB 4LKDA 1KDMA 2RJKA 4UBGA 3Q9OA 2OZJA 2P6HA 4Y1ZA 4YW4A 2VMGA 3B00A 3AXDA 3FLPA 5F3IA 2H0BA 2CYFA 2RDNA 1EAH3 3UKTA 1WCKA 2PFWA 1JODA 5A7WB 3VKNA 3O1SA 4ZS3A 5IVJA 1RHI3 5CIRA 1WMXA 3POBA 1AUYA 4IEXA 5A3PA 2YC2A 1WA4A 4AI3A 1LOGA 2VU9A 3USUB 3V0AA 3V0BA 1QDCA 1XU1A 4J1WA 4XCAA 4ONUA 3SKJE 3ACIA 3VL9A 2D98A 3QOPA 5JUVA 2D3SA 3WNMA 1ZA4A 1DU3D 3KHBA 3H1WA 1SLIA 4GB32 4L97A 1HRI3 4XILA 2O8OA 4AYUA 1ZBE1 3ZLIA 5AFBA 4AHYA 2Z4FA 1SLCA 3VKOA 1PK6A 2DVGA 1RUE1 4ATEA 5LCWL 5C9AC 5JIUA 3IZOA 1C8NA 5IT6A 3MUY1 1AR63 1UOGA 1V6IA 2Y0OA 1LU1A 4Q4W2 1PO12 2ZX1A 3JD72 2VJXA 1NXD1 2BGPA 1CAVA 3LSDA 5A3NA 5ANNA 3IIIA 2VUCA 3IDEA 1ENSA 3KV9A 3VBRA 2WZ8A 2OQ6A 4LJHA 2ZEXA 1VMJA 4OZXA 5LA9A 3EXUA 4IERA 3RS6A 3U4SA 2CWSA 3GYDA 5CEHA 1YWKA 2ZGMA 4Q0SA 1VBA3 1RUH2 3NNLA 4RGGA 2XHKA 5D8AB 5EWSA 3WDYA 2QVSB 1ND3C 4KWKA 4QXHA 5FMCA 4J25A 4QHBA 5GZEA 3WW2A 3ZKUA 2EAKA 2RHPA 5J1XA 4GH4C 1NA1A 5DPNA 3VN4A 3CEWA 4M3CE 4YG0A 3I7DA 3IMMA 1EPZA 3FHIB 1PX4A 5DAPA 3LPFA 3U1XA 4PIYA 5FK7A 5T5LA 2A6XA 3POWA 4OVEA 4BH9A 5C3PA 1OA3A 4CDUC 3MIBA 3LWCA 1NZIA 4Q2FA 3VBUB 4CCCA 3HEIA 2CY6A 4AHWA 5L7OB 1QJX1 3ASIA 1SQ4A 3IM0A 4FP2A 1MEC2 2QBXA 1URXA 4MH0E 3DPRA 5J37A 3NKTA 4QHOA 1FPN2 4JX0A 3TNQA 1W6QA 4D7SA 2CGNA 1VBE2 2WS93 3W58A 1U0AA 1LAJA 1W8ZA 3WXPA 3ZYHA 1BEV1 1KFXL 3VB9A 4IESA 4NIHA 4Q0PA 5C3OA 3NAPA 1JYNA 3ME2A 2WFF1 1QGLA 3I3EA 2C6SA 2AYHA 4BQWA 3LDRA 4RHV2 3BYWA 3KCCA 4XJZA 5A7SA 2FCUA 4QQLA 4QX1A 3VHNA 5TSWA 1F31A 3K4DA 4K8FA 1WMEA 2YC4A 2G4IA 1LOAA 1O5LA 5C7GA 5IHRA 1FOD2 4O61A 3CF6E 3FBYA 3ELNA 1UO9A 2W3JA 1D0HA 4NPRA 3C7FA 3K4ZA 5FUPA 5H9RA 3RPQA 5JI9A 3L2YA 1DG6A 2R073 3M3OA 1H30A 3OG2A 4K1ZA 3HD8B 4AWDA 1EAH1 1PK6B 4GA9A 2NMNA 3AC0A 3DXTA 3FX3A 4CZSA 4CU6A 3HVDA 1RHI1 2BV4A 4GKXA 4YVSA 1PZ8A 2A70A 5DN2A 1N47A 4BJ0A 2D44A 1PGL2 1NCRC 4EWEA 1W05A 2EIBA 2ZGLA 3FJSA 1X82A 4CCEA 5FCCA 1REDA 2Y0IA 4LORA 1GP4A 1H8TC 1ASJ3 5LBEA 3TRSB 1W8FA 3WW3A 4XHXA 3PVNA 4IETA 4INDA 3BVCA 5F6KA 2DDUA 5FYHA 2B46X 3O1PA 1POV3 2QUOA 2XR4A 4DY3A 1GOHA 5EZWA 4CCKA 2A73B 3J7LA 2F6BA 1GP6A 1E5HA 4IV1C 2XB6C 2DFCA 2ZHKA 1NA1B 1Z7S3 2VM9A 2VW1A 2ZA9A 2ADDA 2LS6A 1O59A 1O8SA 4UOJA 1AR61 5A6QA 3AZZA 3N36A 1S0JA 2WWSA 5JI7A 3VZMA 3F95A 5AC92 5LW9A 1RVF2 4NHXA 2VULA 5LB6A 4MXVA 5LA2A 1CIYA 1W2AX 5F6LB 1W0OA 3VKMA 1UZ0A 3WCRA 2JKBA 5M0TA 5I0TA 2IXHA 4D94A 3LGRA 4Z2AA 1W9YA 3ZYGA 1JYXA 1EUUA 3AKRA 1VBA1 4URTA 5FZ7A 1GZCA 3E5QA 5FZGA 3RQ0A 5K0UC 5A32B 4KBZA 4MOAA 4MX3A 1GNYA 3MV01 4FTEA 3CKHA 3R4UA 3NAPB 3ZFEC 1CZSA 2CDOA 2WINB 3T09A 1VBD1 1MACA 1W6PA 4GB33 4NIAA 3KCXA 5FJKA 5LATA 2AEYA 4RN5A 2VBPA 3E5XA 2A5ZA 4H3WA 4B7KA 2A3XA 4NOTA 4FQZA 3SCGA 3VD3A 2VZQA 3PHMA 1I1EA 2HEYF 3MBWA 5C3QA 1YFUA 1ZA7A 4BMBA 1YQ2A 1FNZA 5BNNA 2PA7A 3WEZA 1H8TA 1O4ZA 4P9XA 4Q4W3 1W6OA 1WKYA 1NLSA 1PO13 3MPPG 3JD73 2ZMLA 5GALA 5ISLA 1E5RA 4XJ9A 2A1XA 2FZ2A 3OD0A 2OX0A 1ND2A 2EXIA 1CJPA 1OPOA 3D82A 5EFUA 3BPSA 5I91A 4YVSB 2J1RA 4ARXA 3BKZA 4NIDA 2D6NA 3I3BA 3ZDVA 4CDXA 1RJ8A 2VZSA 1HN0A 4C91A 3VD5A 1RUH3 1ENRA 3OPWA 5BUVA 4TTGA 3U10A 4MLOA 3DL3A 1PO22 2NQYA 5IWFA 1MS5A 4N53C 2R062 5KXEA 4GKYA 2JDNA 5IAXA 2Z42A 2YV8A 5E8AA 3LA3A 2R071 1W2NA 4W50A 3PJQA 2QQKA 4P9GA 3O0XA 4OI4A 2A6VA 2OT7A 3T2TA 5F3GA 3D8CA 3NKGA 1UCXA 4COUA 1DZRA 1UY1A 4V2WA 3B3QE 5K7PA 1G86A 3OEBA 1RIRA 1DYKA 2D6KA 3T4HB 3TYJA 3LOBA 3S5AA 3V65A 2OS2A 4LMFA 2ZX2A 1MEC3 1SACA 2TNFA 4QQOA 1FPN3 4GWIA 3ZFFA 4XF3A 3BTYA 2LALA 3E1F1 4D6QA 3AKPA 4K21A 3T30A 1ASJ1 4B4RA 4L2NA 4OUEA 1UMHA 4HKWA 3J7NA 1V6OA 1XNTA 4QKNA 1GANA 2LTNA 2KD7A 3N9MA 1CESA 1XNAA 2QQOA 5L36A 3VDAA 1F9KA 1RGSA 3P3PA 4RHV3 4P00B 1KEXA 2QFEA 1W2OA 1Z7S1 4PCRA 4NIGA 2CHHA 3CJXA 4FAHA 2J1EA 3D3AA 5JIAA 4YZ1A 1FOD3 1CAWA 1GUIA 1YQ5A 2PAEA 3TEYA 4GWMA 1J59A 4AL9A 4CEWA 2E51A 4Q0UA 3IDBB 4J1XA 5FP8A 1OLMA 2F17A 1G9BA 2GMMA 4Q0QA 4LBQD 3SH5A 3GZAA 4Y4YA 4CTEA 3KS7A 1UXXX 1LGBA 3PURA 1LHNA 4XJUA 4META 2XJTA 4AFAA 1RUI2 3P6BA 2VCCA 2BZDA 2ZGKA 2VNRA 1W03A 2I74A 1RUJ2 2VZUA 4R9CA 5FP4A 2XONA 1F4HA 3W9AA 2XMLA 4I3PA 5K8SA 3ZMOA 1QWRA 1V9U2 3MIFA 3PIGA 5DG1A 1JZ2A 4ZONA 5FZ0A 1ND2B 3TEWA 2UURA 2HWD3 3WNPA 4OI2A 2LW8A 1OD3A 2CU5A 4QKFA 4XXPA 4AVSA 4R4ZA 4MSVA 4CDXB 3FN9A 1HV1A 1WCDJ 2D3RA 4GB31 1DLLA 5IVFA 1CGPA 3CU7A 2CV6A 3G7DA 4TN7A 1QOTA 4ZHNA 1DF0A 1BVP1 3T1MA 3AK0A 4AFBA 4IEQA 3RDIA 3SISA 4UI9L 5EPAA 2QQPA 2I07B 4ZXKA 4YZ4A 4AGGA 1EV12 5FYSA 1GICA 1QH6A 4G4FA 1BZWA 2PLV2 4RL7A 5GLUA 4D7TA 1YJLA 3PUIA 4XJWA 2X29A 5EHDA 1KS5A 4Q4W1 2W52A 3I97A 5AC93 1PO11 3FE5A 1E5IA 3JD71 1NT0A 2BOIA 1H6YA 1ULFA 2VTFA 3ST7A 3WSOA 2R0HA 4BXFA 2LUWA 3PL0A 3WP5A 3LA7A 1NE4A 4K20A 5ABJB 3NSTA 5T55A 3GALA 2XXZA 3AZWA 3EO6A 2WJSA 4GJZA 4XDOA 4JTNA 3EQEA 2E33A 4YNIA 4CUCA 4EN6B 5BNOC 1BLZA 4LUMA 2G9FA 4QQPA 1G6NA 5DUWA 2YFUA 2X09A 1H8VA 1RUH1 1U12A 2GMEA 2EIDA 4HONA 4HVRA 4QD2A 4QX5A 3DCQA 1W9FA 3ZFFB 1GOGA 1JOPA 4BQ3A 1TE1B 5IVYA 2XLGA 2WUHA 2OYZA 5CA6A 5I8TA 1OKOA 3OYWB 1ZZCA 2EALA 4BOWA 4BLJA 3GXUA 4B1MA 2ZS6B 4WV8A 5C71A 5HXMA 2VD7A 4OHZA 3U11A 1MVQA 3FHAA 2CDPA 2XWBB 4XUNA 4P9YA 2FCVA 5CVRA 3VBSB 1N3QA 4A42A 3AFKA 5I0DA 1JZ6A 1X7NA 1AF9A 5FO8B 1RUD2 4NO4A 3DYMA 4COZA 1WD3A 4JV4A 4L99A 3QH6A 3PTYA 2ZKLA 4FXGB 4QDQA 1Q5OA 4CEWB 1HQWA 1JTZX 3L9JT 4X8NA 1MEC1 3D4KA 3T4VA 1AYN2 4BU2A 1VE0A 1FPN1 3GJBA 4XCBA 2PHXA 1E5SA 3MGUA 3ZN5A 3O14A 1K5MC 1M4WA 1VBE1 5J09A 4AVBA 4LA2A 4LOTA 1Q3EA 4YM1A 5FPVA 4SBVA 1ZREA 3KMHA 5FY0A 4XFBA 1DDLA 1SEFA 5AVPA 1CN1A 3B01A 2R32A 4YWAA 3ZSEA 1FT9A 3MHZA 4XC9A 1IS5A 4GQ7A 4RYDA 3MF6A 3NMBA 3POEA 4RS5A 4LO4B 4NN0A 3SHRA 1JYTA 2FMYA 4RHV1 1BBT2 5BPXA 3FUQA 4Y1YA 2VZPA 5FZIA 1X8EA 2YGMA 3GHMA 5CFDC 2WYSA 2BNMA 2VZTA 1E57A 1FOD1 1PO23 1REFA 2L9LA 2ZGQA 4P14A 5LY2A 3VLBB 4YW6A 3SH4A 4UFHA 2R063 4NMIA 1DZTA 1YUDA 1XRUA 5FMOS 4RR3B 1C3HA 5L9RA 2BQPA 1XSRA 5EV7A 1JZ5A 1LODA 4LA3A 4ASMB 1PMHX 3T0BA 3LIGA 5FLJA 1J84A 2GNDA 1WA6X 5FZOB 4NRMA 5APAA 4W6YA 3VBHA 2IXIA 2RJ2A 2W39A 1S1AA 1W9TA 5A1AA 2D6MA 2RDSA 4JQRA 4UFKA 1A34A 1NCQC 1ZVFA 4IXLA 1RUOA 2A6YA 5C8CA 2BPA2 1PGL1 2P3YA 2J1SA 1IS6A 2Q5TA 5LEJA 2DWRA 1YYNA 2EXJA 2X5IC 2HWD1 5SV8A 4K40A 5T52A 5FXZA 1WZXA 3L2HA 1XQNA 2VTXJ 4LKEA 2QTWB 3ALQA 1SHWB 4LK7A 5A3WA 2R49A 4N9HA 1Y43B 2ZAAA 4S2FA 2D7FA 3UKVA 2BFUS 3RZLA 3HIFA 2ZACA 2Y33A 5LZ6A 1R64A 3CO2A 1ALYA 2EVXA 1QJU2 2OUHA 4XE9A 2JJ6A 4OHWA 2ZX0A 4QM9A 3ZFGC 1SDDB 2QQNA 5C8WA 1IOAA 3ITQA 5AC91 1XE7A 2B9UA 1RVF1 5T5OA 1Z0HA 2LROA 4A6OA 5A3LA 1U5ZA 1UIJA 3UNPA 2Q4SA 1HX6A 3E5UA 5FY9A 5JR7B 2ZEZA 5L9VA 5C4WC 1KRIA 1UY3A 4EN7B 1CR7A 3BOWA 1NOVA 2J42A 2Y6HA 3BU0A 1NYWA 2YUEA 2PHDA 3N9NA 2YC0A 5KHGA 3LIHA 1RUI3 2ARBA 4AEDA 1CWPA 1SBFA 5GZCA 1OUXA 4M4PA 1RUJ3 1VRH2 3PUQA 1S0EA 3W59A 5F3CA 5FPXA 3KHCA 4OCTA 2IC1A 5J96B 1MPXA 3O1OA 4D6RA 3DYPA 3RYKA 1G9CA 2UWAA 1FNYA 2I2SA 3FMGA 2V4VA 2BOJA 4FFFA 2VOKA 2CL2A 4RS5B 4YLZA 3ZYIB 5BV6A 1AVBA 1V0AA 2XJPA 2CAUA 1A6CA 2DF7A 4IV3A 1G8WA 4JKLA 3TWIA 1AHSA 1C1LA 4PBPA 1QXRA 5A80A 3OD4A 3PLQA 4KNCA 5FBJA 1QJFA 1J3RA 1UL9A 2RR12 2SBAA 1EV13 2ATFA 2P4EA 3ACHA 3I2HA 4XDQA 5KHIA 2PLV3 2P37A 1QKQA 4PLMA 2GNMA 4NJ4A 2YPDA 5B4NA 2VECA 4QPGA 4PDWA 5FZ1A 1COV2 1AL0G 1GFF2 4XFFA 2B42B 3ES1A 3OSDA 3WR0A 2VAUA 4D69A 2IUWA 3ZXDA 4AFCA 3BPZA 4KWJA 3VBHB 3P5BA 4Y33A 3HQUA 1WW6A 1SLAA 2GP3A 1SMVA 4XHBA 3O1UA 1QXJA 3PU3A 3B5LB 1LCLA 3WF4A 5LRSA 2JXAA 5C8CB 1GU3A 4TLGA 3ATGA 4CCOA 4O9GA 2R6QA 1OF4A 1SBDA 4GMP3 3WLUA 1O3RA 3N9LA 5D8AC 1XSQA 1PO21 1T2XA 2DFBA 4XQWA 3TN92 2CAVA 1D4M2 2R061 3KGZA 2VTXA 2HWC2 5GLVA 1PGSA 2WABA 3SKVA 4IE0A 4QGMA 2ZGTA 3CJIB 3ABZA 2WKKA 4I02A 4FVVA 3POSA 4QWNA 5FPAA 2WZPP 4I2OA 1PMJX 1D4VB 1I3HA 1UPIA 3IWZA 2EAAA 4Y1XA 1YFXA 1LOCA 2JG9C 3PMSA 3S0MA 3VBUC 1Q8OA 3ROUA 5L7OC 2WAAA 2AZ5A 2TUNA 1AX0A 1UU6A 1AYN3
chains in the Genus database with same CATH topology
1MS0A 1SCRA 4YZ2A 4CDWB 3NL1A 4F83A 4EN0A 3UL2A 2BVVA 1J3PA 1OKQA 4M0HA 4AEDB 4CDQA 2BUKA 2E6VA 4PLNA 3ZXLA 3TOJA 1S2BA 1BBT3 3ECQA 4FPLA 2D5FA 3OJBA 1UF2C 1LGCA 1YRZA 1YFWA 3I59B 4QT6A 4AI1A 1G9FA 5E1RA 1B35B 4R9AA 5JDBA 4IV3B 4BIFA 3QD6A 1QJX3 3MIEA 1V6MA 5FBZA 2K2SA 3S7IA 3OBTA 1PK6C 1RUI1 2WQ4A 3AP7A 1W6NA 2BWCA 2ENRA 1RUJ1 2K9ZA 4QPGB 4PDWB 3AJZA 1V9U1 2VY0A 4XQDA 3WP3A 5J09A 1FI2A 4YYOA 5BY5A 2UYAA 2WFF3 1SBEA 4HLTA 4P9JA 3H50A 3WVJA 5FOBB 2ZMKA 1VP6A 3INAA 4BWOA 3PVBB 2BYVE 2ZMNA 1H2LA 3VBUA 4XBQA 1KITA 4N9IA 4ITCA 3HQXA 4YGDA 1XNKA 3ZVXA 4JRLA 4IL7A 1QJU3 1EV11 3VBFB 2PLV1 5F9TA 1ZRFA 1NA1C 4V1PA 4TLFA 1RB8G 4FBFA 5I8SA 2ZTNA 4FOQA 2SLIA 3KT1A 4MZUA 3VHOA 4YW3A 1UKGA 1OA4A 2Q8OA 4P5HA 3QLQA 1CPMA 3RRDA 1C5IA 1S0BA 2Z79A 5I93A 2VOWA 4Z92B 3KSCA 4KG0A 3QBQA 4L8QA 3PMEA 4HPKA 1VRH3 3DPRC 4GMP1 4KGGA 3LA2A 4B4QA 1OQEA 3UV9A 2Y38A 1UMZA 2VVEA 3HN1A 4CDQB 4XBNA 4B4PA 1FV3A 2WNVA 3NAPC 4AI8A 4IEVA 4CP0A 5KHKA 1BQPA 4L11A 3B69A 1RUD1 1OHFA 3KLSA 4CRQA 2W68A 3VDDA 2RR13 3B02A 1IGOA 4FXKB 1S2KA 2D5HA 4ISRA 4Z82A 1AYN1 2XUMA 2E7QA 3RI9A 5JSRA 1COV3 4TSVA 1Y7BA 1DYPA 2XGXA 4E2QA 4EN8B 1WLCA 1W6NB 2G9GA 4COWA 3RSJA 4C0BA 3KQRA 3AFGA 1UU5A 4YVSC 4AI0A 4K1YA 1BBT1 3M70A 1V70A 1HQLA 1UIKA 2XL9A 4CYDA 3M7AA 4PLOA 4MGYE 4Q4X2 1JXNA 1AYM2 2V5YA 3ZSLA 1VBD3 1H9WA 4YGEA 2WT2A 3TN93 2ZGSA 4XIOA 3POYA 1NZCA 4WM8A 2HWC3 3MEPA 5DUVA 5FO9B 1X50A 3MICA 2XBO2 1QH7A 1NXMA 3AKQA 2ZJCA 2XVKA 2DV9A 5A32A 1JW6A 4HK8A 1RTVA 3WDWA 3OGGA 4AVTA 5CADA 3VV1A 2IXCA 1PNGA 2FHRA 3H1YA 2VGDA 3RJ2X 2DVAA 5I0RA 2D40A 4XQ4A 2YHJA 3LZZA 3BIWE 5H9SA 4YZ5A 4HN0A 1XNCA 1HW5A 2YROA 5HCBA 3RJRA 1AL22 4HPKB 2DURA 4LEJA 4OI1A 2EA7A 1QJU1 2NP0A 1BKZA 4NWVA 4F3JA 1DGRA 1UKRA 2A7AA 5CU1A 4ISQA 5FAXA 4X6RB 1R082 3DV8A 4LHLA 2WNVB 5CG9A 1DQ2A 4UBHA 1GQHA 4RA0A 3MDPA 4DPNA 5JPMB 1RUNA 1LU2A 3K51A 1I9RA 3A4UA 1MS9A 3VDDB 2OPKA 5DZFA 2TBVA 3JU9A 4AI2A 1PVC2 3ZIWA 2ZX4A 4N7UA 1BK1A 4K6BA 1VRH1 5BNNC 1SLBA 3J9SA 3ZXAC 5BNPA 1YI7A 2RMU2 1BXHA 3THTA 4BE3A 1ND2C 1N1YA 4R9BA 2R1BA 2B45X 4I30A 3ZSJA 1WCSA 3KD4A 1WD4A 4CDXC 3R0RA 3WY6A 5FQ0B 3N35A 5GLTA 1YI9A 2RR11 2VQ0A 2ZGRA 1F2NA 2DCTA 4A7YA 1ZRCA 4WM8B 3ZXGA 4M3CF 1VALA 4N7IA 2GN3A 1PM7A 1COV1 1HKDA 3BALA 1V6LA 3S7EA 4QPYA 1KXGA 2JG8A 3QACA 2CGPA 5CB7A 3GZTB 5ABJC 2GNTA 3J4UH 1O7FA 5JSPA 3UK9A 1REEA 2VMIA 3ZFFC 2KM2A 3TN91 3M3IA 3UJQA 3AZYA 4FPEA 1D4M1 3S6PA 2HWC1 4P9IA 4BMEA 1AJKA 3NW4A 5IK7A 4HFSA 2AREA 1PVXA 3VBSC 3NVCA 1BMV2 3GF6A 4Q8KA 1RUC2 4HL0A 4A3XA 5K9YA 2ZHLA 1OOPA 2VOVA 3RMXA 4CEWC 1MS1A 4Q4Y2 2OZ6A 3CLPA 2QJVA 4DZGA 1C4RA 2PTMA 5C33A 3K48A 2QZ3A 4RQPB 1X33A 3H7YA 1JUHA 2BTVC 1NY72 4FQ4A 3FZ3A 4MYEA 2ZBJA 2QNKA 3HAGA 3AJYA 2PAMA 1XYPA 1MQTA 5BNPB 3RYPA 1QY4A 2E9QA 5LRRA 5LEKA 1AR92 1PIV2 1AYM3 4Q4X3 4XTMA 1POV0 3VHRA 1O3SA 3O7OA 2R0FA 3NV1A 5ABJA 1NG0A 1HQNA 5I0SA 5EXOA 1LGNA 3JCIA 4HKOA 1MZEA 3GHNA 3EHKA 4JDOA 1WW7A 5JOWA 4CDUB 3ZXKA 4A2UA 1VBE3 2XVGA 1APNA 4C0HA 2E7TA 3DUIA 1GSLA 3OYWA 4QMAA 4YRDA 5IK4A 2HWE2 2JG8B 4XEZA 3NV3A 2K0GA 4YM0A 1A8MA 4B8EA 1IS4A 5KHJA 3MYXA 4I0BA 3VBSA 4QXKA 1ULCA 1PZ7A 3JZVA 1LOBA 4LO8A 2PN5A 1WMFA 2PHFA 1J58A 4MUVA 4D7YA 2AR6A 2BWAA 1UAIA 3DGTA 1IKQA 3N7KA 5JWPA 2KA3A 1XXNA 2NZ9A 3BU7A 1YCIA 1NLRA 4Q8LA 2VVFA 3V64A 4HK9A 3IDCB 2ZGNA 4Q4V2 3MLLA 5IK8A 1A3KA 2GZWA 4YG3A 5GZFA 1DHKB 3WT3A 4I0AA 1PVC3 1QNYA 1OOPB 3ILRA 4XFCA 1G7YA 2D93A 2JE9A 1B09A 5T3NA 1QMJA 1QQP2 5FPZA 2EXKA 1RL3A 5CFCA 2RMU3 1Q43A 4Q0VA 4RR3A 1CD3G 1NCRB 4FPKA 1RUG2 3E6BA 2YPJA 2FBEA 4YZ3A 4RS5C 1W6MA 2WNUA 4TZDA 1DGWX 1MQTB 1Y9QA 5CAZA 4M3CA 1H9PA 1WLTA 1WMDA 2DCKA 1RVF3 3IT8A 4JGZA 2HKXA 3OY8B 1ZX5A 2EIGA 1CIWA 4M0NA 1ENXA 1VAKA 1MZ5A 1HXS2 1ZNPA 2ZGOA 2PHTA 4WZCA 4Q27A 4QPIA 2B8MA 3R05A 3JBG2 1O3TA 2MPFA 3WQ7A 2X53S 3A0NA 4QQHA 2PHWA 3B93A 3ENRA 3AYDA 3VBHC 2VUJA 4EROA 1N3PA 1H2KA 2C1FA 2XH6A 5C8CC 1KFUL 3OCPA 4Q4X1 5FRAA 1AYM1 4PBOA 4XTPA 3FLRA 1DQ1A 3LCPA 2XWJB 1WLDA 4UW6A 4LNVA 2RS32 5FOJB 4Y26A 2VNOA 2WFPA 5FFOC 3AM2A 2XBO1 3CNAA 3CJIC 3AX4A 4RSUA 4XYXA 1D2SA 4YVWA 5BYNA 1VBB2 2WT1A 1AX1A 1VLNA 2WL1A 3O5SA 2JECA 1G9DA 4AW7A 4AQ2A 4Q4Y3 2DVFA 2VG9A 5F5QA 4CDWC 1LHWA 5KXDA 1Q8PA 4AQSA 2V73A 4LBQA 4Q1RA 2DYCA 4JCKA 4I3GA 2BBVA 2GU9A 1TNFA 4LUKA 4AEDC 1AL21 5IUQA 1JUIA 1C8M2 3IBMA 3ACLA 3RWNA 2IXJA 2DUPA 2E53A 3H0OA 5CFCB 2IFRA 1PIV3 1R081 2E63A 3MLJA 4M00A 4FTSA 3SCHA 1JYIA 2D97A 2IXLA 4E27A 4YW1A 3WG1A 1B35C 2FQPA 1W6MB 2DVBA 2AH2A 2WNUB 4JTOA 4MGIE 4N53B 2D6PA 5AVAA 4IV3C 3WOGA 4E4DX 4E4SA 3V0BA 5C6CA 2NM1A 4UW5A 4M3CB 2Z5WA 3WDXA 5DZGA 1TME2 3IIAA 4JGZB 4XF9A 1LJ7A 1PVC1 4X8PA 1WLWA 4TYSA 1KQRA 2WLPA 1YO8A 4H7LA 1J1TA 3MW2A 1V6KA 4IQPA 1A78A 4ZU5A 4HSJA 4QPGC 2P3JA 2V09A 4PDWC 1QU0A 2PELA 2RMU1 4QPIB 2UU8A 1QF3A 1DGLA 1R092 2A6WA 4WBBA 3CJIA 3NWKA 1AZDA 4SLIA 2UY8A 1FV2A 2Z69A 1RUF2 5HXVA 3U0ZA 1RC6A 4AHXA 4LULA 4XFIA 3ZXFA 1KDKA 3VBFC 4WVWA 3VBOB 2OVUA 4FTBA 4CDWA 5J48A 4AFDA 1ZZBA 3HT2A 4PJYA 1U5YA 4Q4V3 4S2GA 4YVWB 3ZXEA 5KXCA 1LOEA 3HWJA 2WLQA 3LKJA 1Z78A 2GC2A 1V9U3 3RNSA 4XBLA 3H8UA 1DQ0A 1LENA 5CBLA 2ZPXA 1V6JA 3ETQA 3I59A 1ZBA2 4NVPA 1LEMA 1BCXA 2R1DA 4N43A 4DY5A 1B35A 1QQP3 1O91A 4I01A 4LBQB 2W0XA 5EYXA 3E97A 3UKNA 1H4GA 1WBFA 1OLRA 2ES3A 2F4PA 4CDQC 1RUG3 1YHFA 2QDRA 2HWF2 1UW8A 3ZO0B 1IS3A 3IN9A 1IHMA 4Y22A 3MIGA 3TBDA 1HRI2 1BMV1 1F5JA 1YFYA 3AZVA 4DINB 4Q29A 3VZLA 1RUC1 5KXBA 1XU2A 2JD4A 3UJOA 1U5IA 3IPVA 1IQAA 3EBRA 4Q4Y1 4IEWA 1ZZ8A 3V0BB 5BXXA 1HXS3 5HCAA 3AKTA 4GULA 2Y26A 4FPYA 4YFZA 1VR3A 3JBG3 1NY71 5JOZA 3WZ1A 3ZYRA 3ZYJB 1V6NA 3VBFA 4HSLA 5L73A 1TEIA 2BVBA 3CL1A 3LSEA 1DFQA 3C2UA 2WA4A 1AR91 1PIV1 2XJSA 3R4DB 4UW3A 4WZFA 2WSUA 5H9PA 1RUD3 5FTTC 4AGRA 2GSYA 4LO6B 1OFSA 4MGKE 4ATFA 1AJOA 2D6OX 5J98B 1YIFA 1H2MA 2RM22 1VBB3 1S55A 3JQWA 1AR82 4KG8A 4XZPA 5LK7B 1LOFA 4LBOA 3WNXA 2ETEA 2YGLA 2D3PA 4BM8A 3MZHA 2HWE1 4WVMB 1MZ6A 2AGSA 3D0SA 1UPSA 2WS92 2GAUA 4DRRA 1N1SA 2YMZA 3BB6A 3HR9A 1ZYBA 2ZHNA 5IK5A 3WG3A 1C8M3 1R1ZA 3PNAA 1YXWA 3H1MA 4N43B 1D0GA 4AF9A 4LTAA 3RI8A 3VZJA 1OMIA 3AKSA 1S0FA 4K9SA 4QGNA 4DS0A 2WNVC 3D6EA 2XJQA 3TAYA 2WZR2 1LULA 3NV4A 2C0ZA 1OLQA 4Q4V1 4WM7A 4Y22B 3PVOA 1S0DA 3N3HA 4M01A 2NLRA 1PGW2 1TME3 3VDDC 3IPVB 2O8QA 3I54A 2PHLA 5J3UA 1VIWB 5GLWA 4E9KA 3AP4A 1LRHA 3O0WA 2P2KA 1DQ5A 3PJYA 1H0BA 4Q1PA 3A0KA 1QQP1 4R8HA 1NCQB 4HMZA 1R093 1QDOA 4P9LA 5T50A 2AUYA 1RUG1 3ZSMA 4LO5B 4MV2A 2DUQA 1MS4A 3M2MA 3H3ZA 1KJRA 1CQ9A 1ZRDA 2ZHMA 3KT7A 4JGYA 3WUCA 2RS52 4KL1A 4LE4A 4PIXA 1YLLA 1QJY2 3AMQA 1PNFA 4KU7A 3WP6A 4YSFA 1H1MA 4UXAA 4Z07A 2GNBA 5FLHA 4BZ4A 5E89A 4OFGA 3AP9A 4P9WA 4WM8C 3N4MA 4COYA 1HXS1 3QH7A 1EPWA 2AENA 1RMU2 4XIKA 4BQ1A 3THPA 4LBKA 3BCWA 4W65A 4W6XA 3JBG1 4XETA 4AEJA 5GZGA 1XNBA 4DFSA 4XMAA 3N7LA 1MZFA 3ZN6A 5JZGA 1R1A2 1ULGA 4JVAA 3FLTA 2UYBA 1ZBA3 4U36A 4Q26A 4XW3A 2JICA 4LLFA 2RS31 5F1RA 1GV9A 1A8DA 1GZWA 5T5JA 3WQ1A 1LEDA 2ZGPA 2HWF3 3KM5A 4BA6A 4FO9A 1HV0A 1LTEA 2ERFA 1H2NA 2HEVF 4BPZA 1VBB1 5BNQA 3MLKA 1SDWA 2YYOA 1LHOA 4G9SB 4JDMA 4LBNA 5JSOA 2BEOA 3EJKA 2NMOA 2YDEA 4YFWA 2VH9A 3BODA 4AHZA 3KGLA 4WM7B 4HN1A 2MHFA 1AXZA 1VB2A 2FMDA 1I6XA 4S2HA 4RQPC 2EXHA 4YW5A 2RJLA 3KCYA 4LHKA 4YM2A 5FQ0A 3M8LA 3QCWA 4DRVA 1C8M1 1J3QA 2RE9A 4KWLA 4B7EA 1D4M3 4QGLA 5LK5A 4UW4A 4XF0A 5BNPC 4ZU7A 4CEYB 2VW2A 1F8VA 4BCUA 2B7YA 1XYNA 3LOIA 2OIIA 1LECA 4FPCA 3JB8A 3OBRA 4JGYB 1XYOA 1QOOA 2P17A 2Z2SB 4N90A 4NR1A 4DMIA 1TME1 5DZEA 1ULDA 3LAGA 1GZ9A 2RM23 5JOXA 1HRV2 2QZ2A 1MR5A 5HI0A 2VXRA 1AR83 4B3NA 2JG9B 4F7ZA 3AB0A 3SMHA 5A3MA 2VNGA 4YM3A 5I8YA 4I0WB 1R091 1SLLA 2JG8C 1JBCA 1H4HA 3MF9A 1EYBA 4XF4A 5DDJ2 1UU4A 3ZN6B 5JZGB 1RUF1 4HANA 2PQQA 2XVLA 4Y1UA 3AYAA 3P3NA 1C57A 2P34A 2R042 4K7JA 5JCTA 1PZ9A 4FOYA 4XFHA 5C9AA 1SCSA 2ARXA 2QE3A 3V0AB 1M06G 3SH3A 5L19A 5GZDA 1VBC2 1KJLA 4RQPA 1GZWB 3D0JA 3JUUA 3USSA 3WINE 2WZR3 4B29A 1DQ6A 4IEZA 3B7MA 3OPZA 3DN7A 1LKNA 1OD5A 4U2AA 2BW8A 3WHTA 5B2GB 1I5ZA 2GC0A 4L92A 1PHMA 1OOPC 3VKFC 1AXKA 1ZBA1 3M3QA 1O4TA 1ND3A 1XE8A 1D2QA 4FPFA 3RYRA 4C1WA 4GH4A 3J26N 4PF5A 3O0VA 1CAVB 1MS3A 4ZKTB 2HWD2 2HWF1 4HT1T 5D1IA 3VBRB 3HT1A 4RD7A 4E4ZA 4H7MA 4E2SA 1SFYA 1WW5A 3WW4A 3N7MA 1IPKA 2H6CA 3AZXA 4CDUA 2RS53 1MQTC 1MS8A 1HRI1 1S0CA 2CNAA 2GH8A 3M1HA 4GWNA 1QJY3 2XJRA 1GLHA 1UD1A 3OF1A 2RS12 3C3VA 2VVDA 3FWEA 4XFGA 1JHNA 3ZIXA 4LHNA 4OUMA 1RMU3 5EJ3A 1IPJA 2N7GA 1KD7A 4NHLA 1Q8SA 3B94A 3E6DA 3SNMA 1VJ2A 4H14A 4ZU4A 2JENA 4O9EA 4JAAA 3AP5A 4AG4A 3MW3A 3FFZA 1R1A3 1LB2A 1YNAA 3ZX7A 1TMF2 1FMD2 3WP4A 3M3CA 4AEKA 4C90A 3DPRB 5H9QA 4BLIA 5T54A 3FUOA 1W6QB 1Q8VA 4HVOA 3U4XA 3ZSKA 4ASLA 3R4SA 4AK3A 1CX4A 4JRAA 2GC1A 1UN1A 4YARA 1YJKA 4CP1A 4A7KA 2GC3A 3GNEA 5C9AB 2R16A 2RM21 3T1LA 3VKLA 5DUUA 1AR81 1FAYA 1ZZ7A 4LO7A 1AR72 3AMPA 3OGJA 1HDKA 4XXAA 3M3EA 1NCRA 5J7MA 4HBNA 2B5HA 2ZAHA 2HWB2 2WS91 1W2UA 5FDBA 3KZ4C 1RJ7A 4EV0A 3J8F2 4TWTA 1DBNA 1CVNA 1JYCA 1GR3A 1ND3B 4EWAA 3OY8A 4IV1A 1UZYA 2A75A 4GH4B 1SLTA 3PVEA 4IEPA 4L9BA 2JEMA 5CFCC 4RR3C 1JH5A 2XBO3 3RZZA 1QHDA 2BGCA 2WC2A 5DUXA 4LR4A 1OQ1A 2EF6A 2WZR1 4EJRA 2WNUC 2VUAA 2ET7A 2P3IA 4XMIA 3JQXA 4DQAA 1PGW1 4BIOA 2ZZJA 4JGZC 4DOUA 1HRV3 3WUDA 1J1LA 5EYYA 5K0UA 1BVVA 1CAXA 2NN8A 2O1QA 3AXEA 4J6GA 4COVA 2E7AA 1AL23 3H9AA 4QPIC 3VHPA 2JE7A 2IWGB 4Z8BA 1DGRN 2GALA 4KGQA 3ZFEA 5DXDA 5DDJ3 1U5XA 2P3KA 2Q1MA 2MEV2 1CONA 1DQ4A 1R083 2RS51 2OUJA 1EY2A 4MGZE 3URFA 1BJQA 1T6GC 3DKWA 3WW1A 2R043 1QJY1 1POV1 4IEOA 3N7JA 4LBJA 4I09A 1S0IA 4QM8A 4R9DA 3FBMA 2YY1A 1LESA 3ZXJA 4HVQA 2WQZC 1LR5A 4Y24A 3VBOC 1VBC3 4JDNA 3AP6A 2HEWF 3TB0A 1RMU1 4JC1A 3KB5A 1ZRRA 5ACA2 1Q56A 1W6PB 4YVWC 3NO8A 3WX5A 1NQJA 5SV5A 4EWDA 3GBFA 1PMIA 2VOXA 1R1A1 1JN2P 5JOYA 4FPJA 4YGCA 4Z2WA 4ES8A 5BNNB 2DCZA 3I2DA 1H8TB 4MXWA 1W6OB 1EP0A 1O4YA 4N53A 4PQ9A 3MFCA 3WG4A 2CTVA 4HKLA 3BTAA 5JPNB 1GBGA 1Q8QA 1OQDA 4IV1B 4R52A 4Z1VA 3ILFA 4YG6A 1GNHA 3WDVA 2DVDA 2GMPA 4EN9B 2OW4A 2QCSB 1ONAA 4FSJA 2RS13 4KH9A 2XL7A 3SLIA 5JAXA 3GZUC 2XJUA 3MFAA 2GN7A 1HIXA 2IFWA 4QU2A 3H3UA 4GXLA 4OHVA 1SFNA 3B9CA 3IKWA 1CJDA 4NHMA 2ZKNA 5K0UB 1C28A 1CAXB 1S0GA 1ULEA 3WV6A 1TMF3 1FMD3 3VBOA 2HJIA 2VPVA 3NJZA 2VW0A 3ZDSA 3RG0A 2PYTA 3E6CC 3ZFEB 3MPBA 3SITA 2C9AA 3ZPYA 4PIZA 2VQAA 1RUC3 1ZBE2 2CWMA 3ZMNA 2IXKA 4XOGA 4K3UA 4BHPA 1H1AA 1RUE2 5KHHA 5E16A 2WSVA 3D5OA 1HRV1 1OSGA 1AR73 3MI8A 2DTYA 4ORFA 1CAWB 5I0UA 4KU8A 1RITA 4XJAA 3ES4A 4XF1A 4XFAA 4IEYA 5AFEA 2C5DA 2HWB3 5DDJ1 1ZZ6A 3VUOA 4Y1VA 3VZNA 1AR93 2ZGUA 3J8F3