1RUE4

Rhinovirus 14 site directed mutant n1219a complexed with antiviral compound win 52035
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
molecule keywords RHINOVIRUS 14
molecule tags Virus
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rue400
1NA1D 3JBG4 4Q4V4 1EAH4 1HXS4 1RUC4 1BEV4 1H8TD 1VBE4 1Z7S4 2HWC4 1RUH4 1PO24 1PVC4 1VBA4 1AL24 2RS54 4Q4Y4 1VBB4 4Q4W4 1EV14 1PO14 1ASJ4 2RM24 1AR64 1RUJ4 4RHV4 1RUG4 1RUF4 1RUE4 1VRH4 1HRI4 2R064 1NCQD 2RR14 1RUI4 1R094 4Q4X4 1AR84 1R084 2R074 4PDWD 1POV0 1AR94 1OOPD 1COV4 4GB34 1RMU4 1AR74 1PIV4 1RVF4 2HWB4 1VBC4 3JD74 3J8F4 1K5MD 2PLV4 2RS14 1D4M4 1VBD4 2R044 2RMU4 2RS34 1RHI4 1MQTD 1HRV4 2X5ID 1RUD4
chains in the Genus database with same CATH superfamily
3AEEA 2WDRA 4YTNA 4Q4V4 1RUC4 1Z7S4 1BEV4 1H8TD 5C2TA 3VRAA 1RUH4 3AE3A 1AL24 2RS54 1EV14 2RM24 3P4QA 3AE8A 4YSZA 1L0VA 2PY5A 5C3JA 2B76A 2PZSA 1NCQD 3AEGA 4YSXA 2H88A 3AECA 3SFEA 2PW9A 4YTMA 2HWB4 1AR74 3AE9A 3JD74 2PYJA 1VBC4 2PLV4 2FBWA 2RS14 1VBD4 3P4RA 1RUD4 2WP9A 3JBG4 1EAH4 1VBE4 3AEBA 2HWC4 1KF6A 3P4PA 1PO24 1PVC4 2PYLA 1VBB4 4YXDA 2EX3A 4RHV4 1ASJ4 3AEFA 3FI7A 1RUG4 3P4SA 1AR84 3AE1A 2R074 2WDQA 1OOPD 1COV4 1RVF4 1YQ3A 3AE6A 1D4M4 4YTPA 2R044 2RMU4 1HRV4 2X5ID 1NENA 1NEKA 1NA1D 1HXS4 3VR8A 2R7FA 4YSYA 3AE5A 4Q4W4 2ACZA 1ZOYA 1RUE4 1HRI4 2R064 2RR14 1RUI4 1R094 4Q4X4 1KFYA 4PDWD 1POV0 2WS3A 1YQ4A 3SFDA 1PIV4 2RS34 3AEDA 1MQTD 3AE7A 3CIRA 1XHXA 2WU2A 3AEAA 2WU5A 3VRBA 3GQKA 3AE4A 1VBA4 2WDVA 3GQHA 1PO14 2H89A 1XHZA 1AR64 1RUJ4 3SUCA 3VR9A 1RUF4 1VRH4 2WQYA 1ZP0A 3AE2A 1R084 4YT0A 1AR94 4GB34 1RMU4 1XI1A 3J8F4 1K5MD 4KX6A 3ABVA 1RHI4 4Q4Y4
chains in the Genus database with same CATH topology
1NA1D 3JBG4 4Q4V4 1EAH4 1HXS4 1RUC4 1BEV4 1H8TD 1VBE4 1Z7S4 2HWC4 1RUH4 1PO24 1PVC4 1VBA4 1AL24 2RS54 4Q4Y4 1VBB4 4Q4W4 1EV14 1PO14 1ASJ4 2RM24 1AR64 1RUJ4 4RHV4 1RUG4 1RUF4 1RUE4 1VRH4 1HRI4 2R064 1NCQD 2RR14 1RUI4 1R094 4Q4X4 1AR84 1R084 2R074 4PDWD 1POV0 1AR94 1OOPD 1COV4 4GB34 1RMU4 1AR74 1PIV4 1RVF4 2HWB4 1VBC4 3JD74 3J8F4 1K5MD 2PLV4 2RS14 1D4M4 1VBD4 2R044 2RMU4 2RS34 1RHI4 1MQTD 1HRV4 2X5ID 1RUD4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA1 D;  3JBG 4;  4Q4V 4;  1EAH 4;  1HXS 4;  1RUC 4;  1BEV 4;  1H8T D;  1VBE 4;  1Z7S 4;  2HWC 4;  1RUH 4;  1PO2 4;  1PVC 4;  1VBA 4;  1AL2 4;  2RS5 4;  4Q4Y 4;  1VBB 4;  4Q4W 4;  1EV1 4;  1PO1 4;  1ASJ 4;  2RM2 4;  1AR6 4;  1RUJ 4;  4RHV 4;  1RUG 4;  1RUF 4;  1RUE 4;  1VRH 4;  1HRI 4;  2R06 4;  1NCQ D;  2RR1 4;  1RUI 4;  1R09 4;  4Q4X 4;  1AR8 4;  1R08 4;  2R07 4;  4PDW D;  1POV 0;  1AR9 4;  1OOP D;  1COV 4;  4GB3 4;  1RMU 4;  1AR7 4;  1PIV 4;  1RVF 4;  2HWB 4;  1VBC 4;  3JD7 4;  3J8F 4;  1K5M D;  2PLV 4;  2RS1 4;  1D4M 4;  1VBD 4;  2R04 4;  2RMU 4;  2RS3 4;  1RHI 4;  1MQT D;  1HRV 4;  2X5I D;  1RUD 4; 
#chains in the Genus database with same CATH topology
 3AEE A;  2WDR A;  4YTN A;  4Q4V 4;  1RUC 4;  1Z7S 4;  1BEV 4;  1H8T D;  5C2T A;  3VRA A;  1RUH 4;  3AE3 A;  1AL2 4;  2RS5 4;  1EV1 4;  2RM2 4;  3P4Q A;  3AE8 A;  4YSZ A;  1L0V A;  2PY5 A;  5C3J A;  2B76 A;  2PZS A;  1NCQ D;  3AEG A;  4YSX A;  2H88 A;  3AEC A;  3SFE A;  2PW9 A;  4YTM A;  2HWB 4;  1AR7 4;  3AE9 A;  3JD7 4;  2PYJ A;  1VBC 4;  2PLV 4;  2FBW A;  2RS1 4;  1VBD 4;  3P4R A;  1RUD 4;  2WP9 A;  3JBG 4;  1EAH 4;  1VBE 4;  3AEB A;  2HWC 4;  1KF6 A;  3P4P A;  1PO2 4;  1PVC 4;  2PYL A;  1VBB 4;  4YXD A;  2EX3 A;  4RHV 4;  1ASJ 4;  3AEF A;  3FI7 A;  1RUG 4;  3P4S A;  1AR8 4;  3AE1 A;  2R07 4;  2WDQ A;  1OOP D;  1COV 4;  1RVF 4;  1YQ3 A;  3AE6 A;  1D4M 4;  4YTP A;  2R04 4;  2RMU 4;  1HRV 4;  2X5I D;  1NEN A;  1NEK A;  1NA1 D;  1HXS 4;  3VR8 A;  2R7F A;  4YSY A;  3AE5 A;  4Q4W 4;  2ACZ A;  1ZOY A;  1RUE 4;  1HRI 4;  2R06 4;  2RR1 4;  1RUI 4;  1R09 4;  4Q4X 4;  1KFY A;  4PDW D;  1POV 0;  2WS3 A;  1YQ4 A;  3SFD A;  1PIV 4;  2RS3 4;  3AED A;  1MQT D;  3AE7 A;  3CIR A;  1XHX A;  2WU2 A;  3AEA A;  2WU5 A;  3VRB A;  3GQK A;  3AE4 A;  1VBA 4;  2WDV A;  3GQH A;  1PO1 4;  2H89 A;  1XHZ A;  1AR6 4;  1RUJ 4;  3SUC A;  3VR9 A;  1RUF 4;  1VRH 4;  2WQY A;  1ZP0 A;  3AE2 A;  1R08 4;  4YT0 A;  1AR9 4;  4GB3 4;  1RMU 4;  1XI1 A;  3J8F 4;  1K5M D;  4KX6 A;  3ABV A;  1RHI 4;  4Q4Y 4; 
#chains in the Genus database with same CATH homology
 1NA1 D;  3JBG 4;  4Q4V 4;  1EAH 4;  1HXS 4;  1RUC 4;  1BEV 4;  1H8T D;  1VBE 4;  1Z7S 4;  2HWC 4;  1RUH 4;  1PO2 4;  1PVC 4;  1VBA 4;  1AL2 4;  2RS5 4;  4Q4Y 4;  1VBB 4;  4Q4W 4;  1EV1 4;  1PO1 4;  1ASJ 4;  2RM2 4;  1AR6 4;  1RUJ 4;  4RHV 4;  1RUG 4;  1RUF 4;  1RUE 4;  1VRH 4;  1HRI 4;  2R06 4;  1NCQ D;  2RR1 4;  1RUI 4;  1R09 4;  4Q4X 4;  1AR8 4;  1R08 4;  2R07 4;  4PDW D;  1POV 0;  1AR9 4;  1OOP D;  1COV 4;  4GB3 4;  1RMU 4;  1AR7 4;  1PIV 4;  1RVF 4;  2HWB 4;  1VBC 4;  3JD7 4;  3J8F 4;  1K5M D;  2PLV 4;  2RS1 4;  1D4M 4;  1VBD 4;  2R04 4;  2RMU 4;  2RS3 4;  1RHI 4;  1MQT D;  1HRV 4;  2X5I D;  1RUD 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...