1RUG1

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLSHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rug100
5BNOB 1AR72 5A33B 1NOVA 1PVC1 1B35A 2WZR2 1MQTA 1QQP3 1RUJ2 1R081 4JGZB 1NY72 5FOJB 3J8F1 4QPIB 1H8TB 5ACA1 1VB4A 5J98B 1HRV1 5L7OA 1RVF3 1BEV2 3ZFGC 2WLPA 1BBT2 1ND3A 2HWF1 2X5IB 4AEDA 4IV1C 1AR61 3ZFFB 2RS11 3M8LA 2MEV2 5BNPC 4FTSA 1ND2B 1D4M3 4CEWC 1X33A 1HXS3 1MEC1 4WM7A 1F2NA 2XBO3 5K0UB 4WM8C 2RM21 2HWD3 3JD73 1POV3 1NCQB 1RUI1 1PO21 1TMF1 1VBE1 1COV2 1R091 4N43C 1AL23 4LLFA 3CJIC 3VBRB 5JZGB 1B35C 2R073 1MQTC 5DDJ2 2RR11 3JBG2 4CDWC 1ZBE1 1AR83 5L7OB 1QJY1 1RUH1 2R043 5D8AB 1RVF2 1ND3B 3VBUA 1AYN1 1NG0A 1RUG2 2BPA2 4FSJA 1AYM2 1OOPA 1RHI1 3VBFA 1AR91 2HWE3 2R061 2XBO2 4RQPA 5CFCA 4AEDC 1C8M3 1FMD2 2WFF2 4Q4X1 1RUC2 2FZ2A 1R1A3 1FPN2 4YVWB 2BFUS 1NA1B 4WM7C 2RMU1 4Q4Y2 1EV13 1PGL1 1ZBA1 2HWC1 2HWB1 2TBVA 1RUF1 2RS51 4RFT0 1VBD1 5C8CB 5CFCB 1HQNA 3ZXAC 3VBUC 1VB2A 4GB31 1OOPC 3VBFC 3VBOB 1VBA1 2WZR3 1VBC1 1RUJ3 4RQPC 5CFCC 2VQ0A 4JGZA 1EAH3 4RHV2 1FOD1 1OHFA 4QPIA 1ASJ3 1H8TA 4Q4W2 3VBSB 2XPJA 1RUE1 4CDXA 2RS32 1RMU1 1VRH1 3VDDB 5CFDB 2PLV2 1QJU2 1IHMA 2WS91 3HAGA 1BBT3 1PO12 5ABJB 2X5IA 1RUD1 2MEV3 5A32B 3ZFFA 3TN93 1ND2A 4FTEA 1QJX1 2WWSA 5K0UA 1PVC2 1HRI1 1AL0G 1COV3 1NCQA 2QQPA 1EAH2 1R082 5BNOC 2GSYA 4CDXB 1ASJ2 3VBRA 5JZGA 1AR71 5DDJ3 3J8F2 3JBG3 5ACA2 4CDQA 1VBB1 4JGZC 4CEYB 1HRV2 4RS5A 5D8AA 1RUG3 5C4WB 1QJY3 4QPIC 1H8TC 1PIV3 1AYM3 1DDLA 5AC91 1Z7S1 2HWF2 3TN92 1AR62 1V9U1 2RS12 4BCUA 1TME1 1MEC2 2X5IC 1CD3G 1F8VA 1FMD3 2WFF3 3ZFFC 1RUC3 4Q4V1 4RR3B 2RM22 1ND2C 4IV3A 1FPN3 1RUI2 1PO22 1TMF2 1VBE2 4YVWA 1R092 1NA1A 1W39A 4CDQB 1K5MB 4Q4Y3 5K0UC 1C8NA 2GH8A 4GH4A 1NCQC 1QQP1 4RS5B 2RR12 1ZBE2 1QJY2 1RUH2 3VBHB 3VBRC 1PIV2 5JZGC 2ZZQA 1AYN2 3JB4C 5C8CA 5L7OC 4JGYB 1RHI2 1AR92 5D8AC 1NCRB 1ND3C 4EJRA 1RVF1 2R062 4IV3B 3VBOA 4CDUB 2DF7A 4Q4X2 1D4M1 3DPRA 1HXS1 4GH4B 4RHV3 5C9AA 2RMU2 4Q4W3 2ZTNA 2HWD1 3JD71 1POV1 3VBSA 1WCDJ 1FOD3 4YVWC 2RS33 1NA1C 1AL21 1PGL2 1ZBA2 2PLV3 1QJU3 2HWC2 2R071 2HWB2 5CFDA 3VDDA 1RUF2 2RS52 2IZWA 1PO13 1VBD2 5ABJA 1AR81 2R041 4GMP3 1PGW1 5A32A 1M06G 4YVSB 4GB32 5C8CC 4GMP0 1PVC3 3DPRB 1VBA2 5FMOL 1X36A 5C9AB 2HWE1 1VBC2 1R083 3VBOC 2Y26A 4PDWB 1C8M1 3J8F3 1FOD2 5ACA3 5BNNB 1R1A1 1HRV3 4CEYA 5GKAC 1AUYA 3ZFEB 1GFF2 4N53B 1RMU2 5C4WA 4Y5Z0 1EV11 3VBSC 2WS92 3S6PA 2HWF3 4QPGB 1AR63 3NAPB 2RS13 3VDDC 1RUD2 5CFDC 3ZFGA 2BBVA 1MEC3 5ABJC 5BNPA 1BMV1 1QJX2 2RM23 4RR3A 1RUI3 1PO23 1TMF3 1HRI2 1VBE3 1R093 2BUKA 5FMOS 2WZR1 1K5MA 4N43A 1RUJ1 3CJIA 2RR13 1ZBE3 1NY71 1VBB2 1RUH3 1EAH1 4CDXC 3VBHA 4CDWA 1AYN3 1ASJ1 3ZFGB 1RHI3 1AR93 4CEYC 3FBMA 5AC92 4JGYA 1Z7S2 4IV1B 1NCRA 5BNPB 5C4WC 1V9U2 2R063 1BEV1 4CEWB 1BBT1 1TME2 2MEV1 4WM8B 3JB8A 4CDUA 4Z92B 4Q4X3 3TN91 4Q4V2 4N43B 2RMU3 3CJIB 4FTBA 1B35B 4RR3C 1MQTB 3IDEA 2BFUL 1COV1 1QQP2 4CDWB 1A6CA 5J96B 1ZBA3 4NWWA 2HWC3 2HWB3 4CDQC 1K5MC 1RUF3 2RS53 5DDJ1 1VAKA 3JBG1 1VBD3 4RS5C 1POV0 3VBHC 2ZAHA 1RUG1 1PIV1 1AYM1 4GB33 4YVSA 1HX6A 1CJDA 1QJZA 4AEDB 4JGYC 1VBA3 1NCRC 1VBC3 2XBO1 1D4M2 1OPOA 4WM7B 4IV3C 1HXS2 4PDWA 1FMD1 2WFF1 4CDUC 1RUC1 3LOBA 5BNNA 2HWD2 3JD72 1FPN1 1RUE3 4GH4C 1AL22 1RMU3 1VRH3 3ZFEA 4N53A 4Q4Y1 2R072 2WS93 2FZ1A 4QPGA 1AR82 1RUD3 2R042 3NAPA 1PGW2 3VBUB 4NWVA 4SBVA 1OOPB 1QJX3 3VBFB 1HRI3 4RQPB 2HWE2 1RB8G 4YVSC 3DPRC 1AR73 1RUE2 1C8M2 1SMVA 5A33A 5BNOA 5C9AC 1VBB3 1R1A2 1VRH2 4RHV1 4PDWC 4Q4W1 5BNNC 1EV12 4Y4YA 5AC93 1Z7S3 1E57A 2RS31 4IV1A 2PLV1 1QJU1 1V9U3 4N53C 3ZFEC 1PO11 4CEWA 1TME3 5LK7B 4QPGC 1BMV2 1BEV3 4GMP1 3NAPC 4WM8A 4Q4V3
chains in the Genus database with same CATH superfamily
1GWMA 1IKQA 1NOVA 5JXIA 1W6OB 4Q29A 4L11A 2OA2A 1RUJ2 3VL9A 4CPBA 4XCBA 1F5FA 2D40A 5A80A 3X29B 4FP3A 5FZIA 2VOTA 4BU2A 4BXFA 4LIUA 1E5RA 1GSLA 5J98B 2BGOA 1GV9A 1HRV1 5KHKA 2YHJA 1QH7A 3W9AA 4IE0A 5LRSA 5L7OA 1CIYA 3WLUA 3HN3A 4PBOA 3CQOA 3ZPYA 1OC1A 1RVF3 1CESA 3HQUA 3MLLA 5IK4A 1W3VA 2YFZA 3A23A 3VD4A 4X8NA 4C0HA 4IV1C 1AR61 5IK8A 2JXAA 2VVEA 3FHQA 2VOXA 2XVKA 3IPVA 3MO4A 3ZFFB 1UIKA 1ND2B 4XJZA 4FTSA 1D4M3 4YW2A 3R05A 2YGMA 1X33A 2JWPA 2E33A 4TYSA 1W06A 2DBIA 3ATGA 2VOWA 3KT7A 3OY8B 2RM21 1JYTA 3OB8A 4QPYA 1SZBA 3DUIA 3LWCA 3A4UA 4XUTA 2O14A 3LFMA 4ATFA 1QXPA 4V2VA 5T5LA 4LLFA 1O7FA 3CJIC 3ZN6B 4BISA 3GF6A 1B35C 2WT0A 1QOSA 1W6MA 2YZ4A 3ZM8A 1LECA 1MQTC 1WLTA 1W9FA 4BWOA 4A45A 2RR11 4CDWC 4LK7A 1QDCA 5A70A 1ZBE1 1AR83 4W8JA 1FV3A 4KMQA 2ARCA 1RUH1 2OW4A 5D8AB 2Y33A 1LB2A 1QGLA 2VBBA 4QXCA 5A7NA 1ND3B 3ACFA 1NG0A 4V2WA 2VTXA 1JUIA 1UF2C 1AYM2 2UWCA 4M3CF 3ZXLA 1RHI1 3VBFA 2CSGA 2DYCA 2AACA 5FZ4A 5FP7A 3ME2A 4J6GA 3IIIA 4COWA 4EV0A 5FBJA 5AVAA 2QZ2A 5CFCA 5DPNA 2ORXA 4WVVA 3MLKA 2ZGMA 4NUBA 2HKXA 4Z82A 1UY2A 1NLSA 1YI7A 3N9QA 4NMIA 2TNFA 2VMCA 4IEQA 2WZEA 3M3EA 4L97A 1UW8A 1VR3A 3F95A 2D5HA 4L99A 2LUWA 4GD4A 4G9SB 3G7DA 1ZM1A 4YVWB 4AOCA 1YLLA 1IKPA 2QQVA 4QHOA 4Y5TA 1JODA 1AHSA 3AKPA 5LBBA 2SLIA 3G6JB 4TTGA 1GP5A 2FQPA 3THCA 3LDBA 3L9JT 5LBEA 1W6PB 2WSVA 2I2SA 3U4SA 3CZUA 5C33A 2FCVA 3ZMNA 1OA2A 2ATFA 3HQRA 3IDAA 5HV0A 3PURA 1W2NA 4P9IA 1WCSA 4UYBA 3CHXA 5JPMB 3AM2A 2JDZA 2ARAA 2QUOA 4HANA 3ZXJA 3ZXAC 4EN9B 1VB2A 1UXZA 5FZ3A 1Q5OA 3GXUA 1MPXA 3MUZ1 4GB31 5EV7A 4EN7B 2AR6A 3PUSA 1UKRA 3O1PA 3T09A 4AHXA 2WZR3 3WP3A 1WUVA 4FAHA 2JIGA 3C7OA 1VBC1 1FT9A 2E6VA 2V4VA 5FYCA 5T55A 2XJTA 4UT5A 1R64A 2NN8A 1O5LA 4DB5A 3LSDA 2DUOA 4QPIA 2XKOA 1JMUB 2VL4A 3TAYA 5IVJA 2XPJA 4CDXA 4N7UA 1CAVA 4HPKA 5LEJA 3MPBA 4FQZA 3WG4A 2OUJA 2UYBA 4XURA 4CXWA 1BK1A 1RMU1 3CJXA 1VRH1 1YHFA 2A73B 3GZAA 3D4KA 2BQPA 3KZ4C 4N7IA 5BNQA 4Y1YA 3H8UA 3M3OA 3HAGA 1BBT3 1PO12 1JU4A 2E26A 4PBPA 5ABJB 5A3PA 1W2UA 3DGTA 2D5FA 5FREA 2PELA 1VE0A 2XHNA 4XJWA 3WW1A 5DMYA 1RUD1 2MEV3 3GBGA 4N9HA 1AJOA 5EJZB 3T2QA 4L2NA 1HN1A 1NYWA 1Y9MA 3MW3A 3WNXA 2W1SA 4NRPA 3S5AA 1NCQA 1COV3 1RINA 4OUEA 2XUMA 3POJA 4H2AA 3OUHA 3P6BA 4QB2A 4BQ4A 4C91A 5BNOC 4IEOA 3AKQA 2VZUA 4K8FA 5DDJ3 5LA0A 5FKBA 2PHDA 3J8F2 5LA1A 2VH9A 4L9BA 3KVAA 4L0PA 4QGLA 4XF9A 3VL8A 1CWPA 2GN7A 4CDQA 4JGZC 4UAPA 5F5QA 1CGPA 2ZGNA 4CUCA 4ATEA 1S0IA 1HDKA 4JQTA 3H8RA 5C4WB 1VRBA 3WR0A 1QJY3 3ZKUA 4AEMA 2HBTA 1DIWA 3RNSA 1O59A 3ILNA 4BM8A 3WUCA 4CYDA 5CG8A 1Z7S1 1CPNA 1ULFA 1YNAA 2PHFA 1SDDB 4LUMA 3TN92 4NROA 1W9TA 3E1F1 1DF0A 2JD4A 4Q8LA 3WP5A 5FMBA 3GCWA 2RS12 1WCUA 1KFUL 4XOGA 4NHMA 3B7MA 4LBQA 4L8QA 4BCUA 2P3JA 1C57A 2X5IC 3E6DA 3WW3A 3DYOA 2WFF3 1XNBA 3WSOA 3BU0A 1RUC3 4Q4V1 2ZKNA 4JDOA 2DTWA 2YY1A 3ELNA 1RUI2 4DIQA 2O1QA 5I93A 4JHZA 1VBE2 3D8CA 1R092 1XNDA 2VMDA 3E5UA 4FFHA 1LOGA 1S0BA 2YBPA 3TRSB 2BBAA 4QGMA 3ZLIA 2PAKA 1C8NA 2PHTA 3PTYA 5J36A 4GH4A 1QQP1 4RS5B 3H3ZA 4YFZA 5FQ0B 3LIGA 1NQDA 1E5SA 1JYIA 1UMHA 1S0DA 1C5IA 2Q1MA 4CCJA 3VBRC 1QWRA 5JZGC 5FTTC 2DCYA 3HJRA 3UKTA 5EZWA 4CCDA 1AYN2 1AXYA 3JB4C 4CA9A 3KGZA 3POGA 3LE0A 4W6YA 4ES8A 5JAXA 4D69A 5KC5A 4CP1A 4EJRA 2BGPA 3ASIA 5F3EA 4A7YA 4JDMA 1UYYA 5A6YA 4IV3B 3RFRA 2PHUA 3DXTA 4ARYA 1D2QA 3IB3A 5FY1A 4CDUB 1CQ9A 1DQ5A 1W9YA 2DF7A 3AMPA 4Q4X2 2VUAA 3KCXA 3DPRA 5LASA 1GP6A 1RL3A 3ES4A 4OYUA 3O0XA 5FZAA 5C9AA 3PUQA 1I9RA 1ACCA 2Q8EA 2WWJA 3ZN5A 1KFXL 1L3JA 2ET1A 2BVBA 5M0TA 3JD71 1POV1 1ZRIA 3T4VA 3VBSA 3W5MA 1WD3A 1UN1A 2DCKA 4Y5SA 4HLTA 1AL21 1D4VB 3FUOA 3PVNA 4LO8A 5IAVA 3T08A 3WNPA 3SCFA 2PLV3 1QJU3 2D7FA 2ZEZA 4FAGA 2HWB2 3BI3A 4YWAA 3FLRA 3ZXDA 3AZZA 5IATA 5FZHA 4ZS3A 4JKMA 4UFMA 2B4KA 5FUPA 1H0BA 2HYKA 5A32A 2VZSA 4NIIA 4FVVA 1WZXA 4NPMA 2XGXA 1RGSA 2YGLA 5APAA 3POEA 4HSJA 5F1RA 4GQ7A 1VBA2 1X36A 3GNEA 4LHSA 4P9LA 1G9AA 4QQ2A 2CNAA 3PDQA 1FXZA 2GC3A 1Q8OA 2YFUA 5L9RA 2D6KA 4FFIA 1C8M1 3LDRA 3RZJA 4RGAA 1FOD2 3UK9A 4TLFA 2HH9A 3NSTA 1AX2A 4LULA 5KXCA 1GZTA 4JX0A 1HRV3 2WN3A 1RXFA 3WDUA 1DGRN 1U12A 3VKFC 1QOTA 1X82A 2R0HA 1OSGA 1JN2P 1NQJA 4NHYA 5GZDA 3ZFEB 4F3JA 4E8DA 1EV11 2AENA 2JKXA 5GLUA 2QJVA 4AFDA 2WNVB 5J48A 1LESA 1AR63 1Q8VA 4O7XA 3VDDC 1O8SA 1H9WA 1LHVA 2R32A 2ARXA 3WQBA 4MHUA 3J7HA 4QX2A 5FYVA 4GULA 1M4WA 4Q0VA 4AR2A 4A7ZA 5I0RA 1YFXA 3S7EA 1US2A 2LALA 2RM23 2WO1A 3MDPA 1HRI2 1IS4A 2DDUA 2XJPA 3IDBB 3FFZA 1ST8A 2D44A 1SHWB 1C1LA 1K5MA 3LB9A 3LPFA 3PMSA 4LITA 2W3JA 3CDZB 3K2OA 3NMBA 3CJIA 2RR13 3I59B 4XJAA 3VUOA 3USUA 1A34A 1ZBE3 1DQ6A 1NY71 5LB6A 1RUH3 2FCTA 3T2TA 4CDWA 4AFBA 1ODMA 1UO9A 2XJQA 4LO4B 1QH6A 5H9SA 1MS5A 1HKDA 4B4PA 1ASJ1 2Y34A 1OA3A 4EWAA 4P14A 3ZFGB 1RHI3 1SBEA 4CEYC 1SFPA 4JGYA 5BV6A 3MUY1 1H1IA 1OMIA 5H9QA 2J1RA 1CAUB 4WZFA 4YZ2A 1Q8SA 4HETA 4FXGB 2GN3A 4AEJA 2WT2A 3S30A 3THDA 3Q8EA 2ID4A 4ZPIA 4AQSA 5FZOA 4BIFA 4QB1A 4WM8B 5BXXA 1X9PA 3ACLA 3JB8A 3U11A 2JIJA 1PZ8A 3OD0A 3CMGA 3I8TA 3LPGA 3B5LB 3TB0A 2IC1A 5A1FA 3WF4A 4EN0A 4XVHA 3U75A 2AYHA 2GZWA 4HMZA 5LA2A 3E6BA 4MHRA 4CCLA 5GALA 4BQ5A 1OQ1A 4GXLA 5J96B 1S2EA 4XIOA 2OVUA 3SNMA 4P08A 3AK0A 5KWRA 4D7SA 2AUYA 3WW2A 3BKZA 2UYAA 1VAKA 3OBZA 1IPJA 3E5QA 4MG2A 1DGRA 1FYUA 5FP3A 3GCXA 3RYRA 3TNPB 1QNWA 2CWSA 2OUHA 2VD7A 4NRMA 1PVXA 4IL7A 2RJLA 4XBLA 1W8TA 1DU3D 1K42A 1KITA 5FMCA 1RUG1 3ZYGA 3MF9A 3M1HA 1PIV1 4GB33 1MR5A 4YVSA 4ZXEA 2FDFA 1CJDA 3CNAA 3NNMA 4XZPA 3UKVA 1IPKA 3MPPG 5L9BA 3SH5A 1QOOA 3TOJA 4AL9A 2W46A 4DFSA 3IPVB 1DLLA 1W9SA 2J1EA 1V6MA 1LR5A 1VBC3 1NLRA 1OLRA 4ZXKA 4O61A 4FO9A 1D4M2 4AF9A 5J1XA 3OYWA 1SLLA 4HG6B 3CO2A 4FPFA 2V73A 5GLVA 3BUCA 1LKNA 4K8RB 5BNNA 3ETQA 5GZGA 3C8XA 5C3RA 2LTNA 2A3XA 1W3XA 1GQHA 1PNGA 4QD2A 4RL7A 4UBGA 4YW6A 1RMU3 3D82A 5F2SA 1VRH3 2ZPXA 3KSCA 2P3YA 3QOPA 1SBFA 3B93A 2GAUA 4UW4A 4QPWA 3GZEA 2JICA 4B4QA 1IOAA 3DF0A 2PN5A 3ILFA 3AMHA 5F8PA 5C5TA 5ISLA 4OHYA 2CAVA 1AR82 3NKTA 4QPGA 1UU6A 4MGKE 1C5HA 1RUD3 1H4HA 4IERA 4AAXA 1PGW2 3IMMA 4SBVA 3ZKYA 1CIWA 3LAGA 2E63A 1CX4A 1AVBA 3VBFB 4UWDA 2VW0A 5GLZA 4IQPA 3DL3A 4NOTA 4AVCA 3I3MA 5CISA 5EIYB 4B1MA 1MZEA 4YARA 4M3CA 1VMJA 4Z2AA 3RRDA 5IFPA 1CAXA 3OGSA 5EYXA 2WO2A 1W8OA 1RUE2 5DZEA 3DXUA 5JR2A 3AMQA 1SMVA 4MGSA 5FIXA 1WBFA 2BJSA 3M7AA 5BNOA 1XE7A 2ARBA 1RIRA 4ZY9A 4LHNA 1XNCA 5KHHA 1TQ5A 1D0GA 2PHXA 5C3QA 3L2HA 2WBKA 4Q4W1 1L7LA 2PHRA 4YGCA 1HIXA 2DTYA 1JZ7A 1G9DA 1L7QA 1Z7S3 1E57A 2RS31 4JHTA 3H50A 2DBNA 5GLTA 3ZSLA 2VQAA 3FWEA 2EALA 4N53C 3WW4A 1EUUA 4QWNA 4WBBA 1SLCA 4AHYA 4GAZA 2YMZA 5E8AA 3RZLA 4ASMB 4CEWA 3DECA 2WABA 3DKQA 2BVVA 1AXZA 4J1WA 4XIKA 1BEV3 1LOFC 2JG8C 3NAPC 4XQ4A 3AX4A 1LEMA 2GNDA 3JU9A 3D0JA 2IVIB 3I3EA 3MIHA 3N36A 4NR1A 4Q4V3 5A3NA 3SLIA 3OBAA 3R4UA 2KA3A 4XXPA 4LO5B 2GNMA 3ZSMA 1X8EA 2TUNA 4LJHA 2J1SA 2WZR2 5T54A 4AK3A 1QQP3 2WNUC 1O4ZA 3NV3A 2WR9A 2Y6FA 5HCBA 2R0FA 2NQYA 1CZTA 4BMEA 5FOJB 1YCIA 5HCFA 1S2BA 4QPIB 3V65A 4AG4A 5IJRA 2HBUA 3CKHA 1TG7A 4XEZA 5FZFA 1CAVB 2DURA 3LIHA 4HPKB 1VIWB 1NX9A 1SLIA 2E7TA 2W2IA 4E2SA 1DBNA 1UCXA 2WN2A 4A2UA 4P9WA 1KDKA 5EJ1B 1C28A 1GMMA 2A75A 2J22A 1MS8A 2ZGUA 5GM0A 1SG3A 2WLPA 1BBT2 3POBA 4BQXA 4AEDA 2MNGA 1ULPA 5AVPA 2VVDA 2VMGA 2MEV2 5FZMA 3OBRA 3JUUA 2BNMA 5FUIA 3I97A 1MEC1 4WM7A 5I8SA 1F2NA 2J1UA 2QQUA 1MVEA 2B42B 4FXKB 2JE8A 5DG2A 3PTRB 4R9CA 1MVQA 4Y26A 2AC1A 1POV3 1NCQB 3JD73 1PO21 5CZKA 4XTMA 1UY1A 3DN7A 1COV2 4NAOA 1IQDC 3FBYA 4N43C 1AL23 3GDBA 4S2DA 2HEVF 4S2FA 1O3TA 4QQPA 5DDJ2 5IVVA 1OVPA 1PZ9A 1Q8QA 3E6CC 4O9GA 4K40A 1QJY1 3I54A 4ZZ5A 3TEYA 4OI2A 1UZVA 2BV4A 4AW7A 1OQEA 1OURA 3P3PA 1R1ZA 2VE1A 2ZBJA 2IXHA 3A0NA 5CADA 1O8PA 2EIBA 3RQ0A 4BQ2A 5K7PA 3T3YA 2LM3A 1HB2A 2R061 4NAMA 2XBO2 4BPZA 2YPDA 4D7TA 3JQXA 1ULGA 1KQRA 2G4IA 1C8M3 4FPLA 5DZGA 1X50A 4XBNA 3RZZA 3K4DA 2WFF2 1JZ6A 3LEKA 4A6OA 1RUC2 2FZ2A 1Y4WA 4U36A 3BTZA 1XU1A 2CYFA 3RVHA 2BFUS 4P9YA 3ILRA 3LA2A 5KC6A 4I01A 3AVSA 1C1FA 1EV13 2VNRA 5FO7B 3MLJA 3LA7A 3MICA 4LHKA 3ZIXA 1ZBA1 4AQ6A 1PGL1 1OLMA 2A1XA 2OX0A 1YO8A 1RUF1 2EIEA 4MUVA 1MZ6A 1VBD1 3BCWA 4OULA 4D6RA 2G9GA 1QEXA 3AZYA 4FQ4A 4ET7A 1C4RA 1JW6A 4HFSA 4BE3A 2Q30A 3N3HA 4J1XA 3VBUC 5E1RA 4FOYA 4RD7A 3WINE 1D2SA 1J3QA 2NM1A 2OIIA 5FFOC 3PUIA 1OOPC 4TSVA 4PF5A 2O8QA 4WVZA 1YUDA 1KJLA 3T4HB 3ZR6A 3BN6A 4PIYA 3ACGA 1ENRA 4RQPC 2PA7A 3ZDVA 1UY4A 4MH0E 3T2PA 1A8DA 4MZUA 4DXRA 2VC9A 1W28A 3C7HA 5F6LB 3WZ1A 5E16A 1ASJ3 1H8TA 5ANNA 3VBSB 4BLIA 1CAWA 1O5UA 1V6IA 1J84A 2ES3A 1FX5A 3J7MA 4QQLA 3H42B 3HEIA 5A7WA 2PLV2 1QJU2 2F6BA 1ENXA 2P3IA 1HN0A 2WS91 3HOBA 3VKNA 1TZOA 3V64A 4WV8A 2G9ZA 4CRQA 4A7KA 1WD4A 2QQLA 3VDAA 5KHGA 1GU3A 3RMXA 5A32B 3LSEA 3WHTA 5JI9A 2YV8A 2ETEA 4PLMA 4EN6B 5FXXA 3ZPOA 3SISA 2WWSA 1W6NB 3AC0A 4D94A 4AWDA 2CU5A 5K0UA 1AXKA 4JVAA 3U07A 1AL0G 1F4HA 2WA4A 4LXLA 4UI9L 5JOXA 3WNMA 1EAH2 4FCAA 4KWUA 5FXWA 2GSYA 4IETA 1T6BX 2VAUA 3WF2A 4E4ZA 1W9WA 3DYPA 3EBRA 4LUKA 3WVJA 1JBCA 4LQRA 4KG8A 2WQZC 3V0AA 3K46A 1VBB1 4IE4A 1HRV2 4BJ0A 3ZN4A 2LW8A 2FMDA 1RUG3 3KM5A 1UL9A 1MZFA 1PIV3 5CVRA 2VCAA 3IZOA 4Q0QA 5AC91 5LZ6A 1AX0A 4XXAA 5FLJA 1SQ4A 1AR62 1V9U1 2IWGB 4XDPA 2W52A 3POWA 2VECA 5IHRA 4CCKA 5DUXA 2H6CA 5JOZA 4LOSA 4D6SA 4YZ1A 5JXJA 1F8VA 2DCTA 1KEXA 3ZFFC 4Z8BA 4FP2A 2RM22 1ND2C 4DRRA 3NRUA 3AL6A 2FMYA 1NA1A 3ACIA 1YQ5A 3IIAA 2DU0A 4AGGA 1W6QA 1K5MB 4YFWA 2GH8A 4COVA 5EP9A 2I74A 1OD5A 3USUB 4E4SA 4YYOA 2RR12 3TWIA 2DV9A 1ZBE2 5C71A 3KT4A 1RUH2 4YZ4A 4EZHA 3WQ7A 1WW7A 1GOGA 2ZZQA 1SFNA 4URTA 3MF6A 2DVGA 3K48A 1DCSA 3ECQA 5C8CA 4JGYB 5HXMA 1RHI2 4N90A 5D8AC 2UWBA 4M0HA 4AHZA 4R9AA 2Q8CA 1ND3C 2WLQA 3WF3A 2A6WA 1POQA 3OCPA 1W2OA 3C7EA 3THTA 4HXCA 3VBOA 3URFA 5C3SA 4HVOA 5FZOB 5H9PA 4CCOA 2W94A 2B5HA 3ENRA 3OD4A 3H8XA 4AVAA 3T1MA 2XKPA 1ODNA 1LRHA 3I2GA 2MPFA 4B7KA 2D6NA 4L92A 3U14A 1O4TA 1N47A 4Q4W3 2JECA 5GJ6A 5F5AA 2YU1A 2FDJA 2W5FA 3ON7A 4W6WA 4YVWC 1VALA 2RS33 4IEVA 1DLCA 2JB4A 4OQ9A 2R071 5F37A 1NT0A 3R4SA 4M0NA 3ZYJB 5FYBA 1QKQA 2Y60A 1Y43B 2ZX4A 3OF1A 1QNYA 2VCCA 1V6LA 4LTAA 4CU9A 2VW2A 4CP9A 1ENSA 1XNKA 4YNIA 3VKMA 1UOJA 4EROA 1M06G 3I3QA 1UPSA 4QDQA 2W68A 1W8NA 4YVSB 1A8MA 5LEKA 4YM2A 4GB32 3AP9A 1RJ7A 4GMP0 1ULDA 5FR3A 5FPLA 4Z1VA 3MV01 1AF9A 1XOYA 4GKYA 2QFEA 1NAEA 1VBC2 2OZJA 3RYKA 3KCCA 2X09A 1OFSA 4XFHA 5A6ZA 3OYWB 2WNUA 2Y26A 1HB4A 4OMDA 1YWKA 2KD7A 3A0KA 3B9CA 1WW4A 5CKQA 5KXBA 5BNNB 2Q4SA 3B9IA 3LKJA 3CU7A 1R1A1 4F83A 1G6NA 1Y3TA 4DEVA 1WMFA 3K3OA 3N9OA 4MYEA 1AUYA 1GWKA 2OPKA 4CE8A 5A3UA 1K12A 1RMU2 2EXHA 5DQ0A 3OOXA 4X8PA 3S6PA 3AKSA 2EAKA 2OQ6A 3WUDA 4QPGB 4Y1VA 3TEZA 2DU1A 3RZMA 5CFDC 1RUD2 4KI5M 3C7FA 2YBSA 4QX8A 1GYKA 3IN9A 2IXKA 3KF5A 2OYZA 2PXJA 4OMCA 3INAA 4Q5OA 5I0UA 1MEC3 1S0EA 1WCKA 4LMFA 5ABJC 1ZREA 2D6PA 4BQ3A 3RJRA 2CY6A 5IK5A 3UGGA 1F5JA 2R1BA 4LHLA 2P2KA 4PJYA 4RR3A 1PO23 5TSWA 3ZR5A 1GUIA 4M3CB 4CXYA 1JUHA 5C3OA 1DYPA 4YW3A 4ZU5A 4OI4A 5FMOS 2XOMA 4N43A 1FV2A 1QXJA 2WQ8A 4KBZA 4QX3A 3RI8A 4Y22A 1GICA 2VUJA 3AFGA 3OG2A 4SLIA 4BQYA 3O1SA 4K1ZA 4FOVA 5FY4A 3VBHA 4ISRA 4UF0A 2W92A 3QH7A 4UFHA 1QHDA 2BERA 3HQXA 4KH9A 3AVRA 3GALA 4N9IA 3HPNA 2GNTA 1AJKA 3FBMA 3POIA 3QH6A 1Z7S2 2P34A 1H9PA 1NCRA 5BNPB 2VULA 2J42A 4A4AA 5C4WC 2R063 2CL2A 5ANQA 3E5XA 4IGPA 3VD7A 1BEV1 2QQWA 3WP4A 4AI8A 4CEWB 3CBNA 4JKKA 2AGSA 1XSRA 4XHBA 5DG1A 2ZX1A 3VHNA 4HKWA 2JG9A 3B02A 2Z4FA 4XFCA 5IVEA 3TN91 4Q4V2 3W58A 3ZYHA 1J3PA 1CPMA 3OGRA 3IAPA 3QACA 1OUXA 4ZS2A 2WT1A 4IE6A 1K45A 3BU7A 4Q0PA 1TEIA 4XE9A 4QX5A 5FRAA 4E4HA 3LD8A 1MS4A 2A6XA 2VTFA 3NW4A 2OT7A 2BFUL 1ULEA 2ERFA 2Y6GA 3IDEA 1QQP2 4Y33A 5JOWA 3Q8BA 1WLDA 1XJAA 4M00A 1ZBA3 1HW5A 1LTEA 4I0AA 1O3RA 5L19A 2GP5A 3N7LA 2EIGA 1RUF3 1IS6A 3HIFA 3N7MA 4HOOA 4XJUA 2W91A 3JBG1 1BK0A 1VBD3 1EYBA 3MFCA 4M01A 4RS5C 4XTPA 3WQ1A 2C5DA 1HB3A 4XUQA 1DQ4A 5JSPA 3N35A 4MADA 4C0BA 5CBLA 2UY8A 1S0CA 4KBBA 3H3LA 4CVUA 2WO3A 1ZZBA 1QJZA 3ZMOA 4AEDB 4RFRB 3VLBB 2ZGOA 1JZ4A 2VVFA 5D21A 1IS5A 1PM4A 3ZXGA 1XBFA 4RYDA 2JDYA 4K3UA 3WG1A 1S55A 2IXLA 2KXLA 4WM7B 2B39A 4IV3C 4AVBA 4D8MA 3OGGA 2W87A 5J37A 4FFGA 4PDWA 1FMD1 3EB7A 3MW4A 4YRDA 4CDUC 3LOBA 4PHZA 5FWJA 3JD72 1FPN1 1WBLA 3K4ZA 3WT3A 3A7QA 5KHIA 3I3DA 4IGQA 4JCKA 2Q1ZB 1AL22 1CONA 3N9MA 4YZ3A 5A6XA 3WCSA 1NXMA 1PK6A 3I7DA 4Q4Y1 2WS93 5D2AA 4G4FA 4P5YA 3LF7A 5CFDB 3ZYPA 1XPWA 2RHPA 2VCMA 1UOGA 4ZU7A 2F17A 2XJSA 1T2XA 5KBFA 2DUQA 2VZRA 3PIJA 4B1LA 1YXWA 1LJ7A 2QDNA 4K1YA 4CZSA 1N1TA 3LEMA 1LOBA 1XXNA 1V70A 2VR4A 3CZJA 1RJ8A 4I3GA 1BVP1 1ZZCA 2C26A 2P3KA 4YW4A 4LKSA 3O1OA 4KQ7A 4XF3A 3ROUA 2NPIA 2VMFA 2JDNA 1RB8G 2GMPA 1GZWA 5FZ9A 2QE3A 4G3YC 5CEHA 1WMXA 5KXDA 2VZ1A 5B2GB 1STMA 3LGRA 2FDGA 3C3VA 1C8M2 4BQWA 2WO7A 5B4NA 4MXWA 2J1TA 1VBB3 4PI0A 4KG0A 1W6OA 1EPZA 4RHV1 3NVCA 4XHXA 4EWEA 1OD3A 1VLNA 3VGIA 2BOIA 4E2GA 4WVMA 1EV12 3OTFA 3B69A 5AC93 3U37A 1X7NA 5EWSA 2F4LA 1I5PA 3B00A 5BY5A 5K9YA 4IV1A 1H6XA 3H0OA 2VMHA 1V9U3 2QKDA 2R1DA 3NL1A 3ZFEC 5BUVA 2CHHA 4KU7A 3ZSKA 3DV8A 2R7EB 3FLPA 3SHRA 1QDOA 1X9TA 3V0BA 2XDVA 4BMBA 2WNVC 2ZMNA 4GMP1 3RMYA 3ZX7A 4HKOA 4LT5A 4PCRA 3CEWA 4HT1T 4IEUA 1AR72 1RXGA 1VAMA 5A33B 1UY0A 2WQ4A 2VXJA 1PVC1 1UWWA 1B35A 1YJKA 4XABA 3JZVA 5FY8A 3ST7A 3VHPA 2ZAAA 4DINB 5F9TA 1MQTA 2W9XA 3O1RA 1XYOA 3AYCA 1R081 3EQEA 1MS9A 5FXZA 1GP4A 1W03A 4LEJA 5FJHA 4TN7A 3E97A 5C70A 1NY72 2B8MA 1OT5A 1G9BA 1LGNA 2WDBA 4B8EA 1H8TB 5ACA1 1KRIA 4QKNA 4RA0A 4K21A 1CAWB 1OBNA 3FHAA 2GALA 5FY5A 2JX9A 1KXGA 5I0TA 4LO6B 5DZFA 2ZABA 4IXLA 4HVRA 3OPTA 2H0BA 4LR4A 5I8YA 2VOVA 2ZEWA 4DOUA 2VOKA 4V1PA 2P6HA 1W8FA 2XJUA 1H2NA 1N3PA 1ND3A 2XHKA 2HWF1 1F31A 3I2IA 4XW3A 5T50A 1XE8A 2BNNA 1IG3A 2FDIA 5IWFA 1QJEA 1YQCA 3WOGA 1PM7A 2O8OA 4UFIA 4DXSA 3BVCA 1S4CA 2XG3A 3WX5A 5FY7A 3LOIA 2UU8A 2YBKA 1XNTA 2JENA 4PIZA 3ZSJA 4A3XA 1QJFA 5F3CA 2NMNA 4WM8C 3N9PA 4HZFA 4IEXA 3R0RA 1W8WA 5F3IA 1TMF1 1OI6A 3D3AA 4GZ9A 4JZRA 1WMDA 3NO8A 3WXPA 2ZACA 3OUJA 3RDIA 4YG3A 2GC1A 1LOAA 3AYEA 3O14A 2C24A 2R073 4K7JA 4YG0A 3BODA 3RWKX 3SCHA 3V0AB 1GKBA 5LCWL 4HN0A 3N7KA 4Q1RA 3N7JA 4AZZA 5L7OB 3S0MA 1MS1A 1RYYA 3AYAA 3NJZA 4KGQA 1RVF2 1YC61 2F4PA 2I07B 3BOPA 1RUG2 1W6PA 2ZXQA 3H8OA 1H8VA 3JQWA 5B4XA 4CPBD 2FDHA 2V4AA 4O9EA 2A5ZA 3TYJA 4D3WA 2P5BA 4KU8A 1AR91 4PIXA 3O0WA 1JYWA 2QQKA 5JR7B 4XAAA 2QNKA 2XL9A 2WWUA 3GBWA 3WCRA 4QM8A 4DXTA 1I1EA 5IVFA 3ZSEA 1W8HA 3UJOA 1V6NA 5A7SA 1Y9GA 3FC0A 3PL0A 4HK9A 4YG6A 3BTYA 2GC2A 4HVQA 5LW9A 4I2OA 3VZNA 4LE4A 4DEQA 1R1A3 4P9XA 2RG4A 4P00B 1GQPA 1G86A 1H1AA 1NA1B 1W6MB 5FP9A 5T5PA 2RMU1 3VZJA 4CU7A 1W99A 2J1VA 4ARXA 1W6QB 1E5HA 4FPKA 2A71A 4R9BA 4K20A 5G04L 1UZ0A 1D0HA 2A7AA 4MGZE 4YGDA 3U4XA 2HWC1 4M4RA 4QXKA 2YPJA 2TBVA 5DAXA 4DUXA 2RS51 3AZWA 4RFT0 4BQ1A 1Q43A 4RGGA 2C0ZA 1RC6A 1UYPA 5C8CB 3SKJE 3ZYBA 4FBFA 3UYJA 4H3WA 3IBMA 4AFAA 4UFKA 5CFCB 4OUMA 2Y0IA 5LATA 4MGQA 3WQ0A 4QU2A 1O3QA 5EPAA 4AQ2A 3USSA 2Z79A 1O3SA 4YSFA 1OKQA 1SPPA 4JTOA 2X05A 3VBOB 3VBFC 1QMJA 2W0XA 3EHKA 4YM3A 3DKWA 4ISQA 1LU1A 1JZ8A 3I2OA 2D3RA 2W1WA 2QCSB 2WZ8A 5L73A 3EXUA 5A3WA 5CFCC 2NYYA 2VQ0A 4JGZA 3ABZA 4QM9A 3ES1A 3WNOA 3I2FA 3ZYFA 1YQ2A 4Q0UA 1DYKA 4LKDA 4Q4W2 4DUWA 2D3PA 1RUE1 4FFFA 1SEFA 2B7YA 4Y1ZA 3SKVA 1G9FA 5H9RA 4QDSA 3D0SA 3FLTA 4EE2A 2RS32 1H30A 1D7PM 1ZNPA 3ZDSA 1CVNA 5KR7A 2BWAA 3GYDA 4XAEA 3HBZA 5JDBA 2E7AA 2XR4A 4IEPA 5IVCA 1GNZA 5SV8A 2BTVC 2XJRA 4MSVA 2X5IA 4LBLA 2YC0A 4CP9B 3DCQA 2QQNA 1BQPA 1SLBA 3N4MA 2Y6JA 1LODA 2JDAA 3IWZA 2WAOA 3DYMA 3TN93 1KGYA 5L36A 1ZA7A 4BK5A 4BA6A 2FHRA 2WL1A 4A42A 4EN8B 1C3HA 1QJX1 1JYXA 5LY1A 5FZGA 4UFLA 3AJZA 1BZWA 5FP4A 2Z69A 2ZEYA 1G8WA 4LBKA 4KWLA 1QXRA 3ORJA 3UETA 2PQSA 1IGOA 1VMHA 4AXOA 2OQ7A 4CDXB 1PHMA 3VBRA 5JZGA 1S2KA 1DHKB 1G9CA 3JBG3 3KS7A 3PUHA 4HONA 4Q26A 3FFQA 3SEPA 3OPWA 4GALA 1BHGA 3JXSA 1U5ZA 2VZOA 1AX1A 2D6OX 2ZMLA 1UNBA 4RS5A 2WNEA 3SITA 2XQXA 4XDOA 5FQ0A 2G9FA 4YW1A 4QPIC 4XUPA 4E8CA 2NP0A 2RDQA 4UXAA 2BRTA 4AI1A 1YFYA 4S2GA 1OKOA 3B3QE 4ASLA 3POYA 4AYUA 2ZX2A 2ZGSA 2DVBA 2VNGA 5FY0A 1APNA 1W90A 5FZ8A 1OH4A 3GBFA 1ALYA 1TME1 2HEYF 4QXHA 1MEC2 1Z78A 1WLWA 2RDNA 2ZKLA 5F5IA 3WNNA 5FOBB 1FMD3 4MGTA 2YROA 4RR3B 5CKMA 1SLAA 4YLZA 4I30A 4IV3A 1FPN3 1PO22 3S5QA 2W39A 2JE7A 1JOPA 3ZYRA 2AH2A 4BIOA 1W39A 4CDQB 4Q4Y3 1NCQC 1F15A 4NIGA 1IG0A 4Y22B 2A6YA 2OPWA 2E7QA 4B3NA 3PJYA 1JXNA 5L9VA 1QJY2 1JS9A 1UMIA 3VBHB 1QU0A 1HV0A 3NV4A 2XVGA 3NQHA 1JHNA 3MEPA 5JXHA 1YRZA 4JAAA 5A1LA 1JYVA 4Y4RA 2DVAA 1CN1A 3VZOA 2RVAA 4BDVB 4LBQB 1NCRB 3KV4A 2LS6A 1JHJA 1J83A 3C2UA 3KV6A 2XWJB 3TEWA 1WWYA 3HD8B 2R062 2Z2SB 2QQMA 2E53A 4LIVA 2BNOA 4ASKA 1F35A 1LNSA 2JG9B 3FMGA 3O0VA 4AI9A 3VDBA 3MYXA 2ADEA 1X8MA 5DUWA 1HXS1 3FHIB 3O7OA 4GH4B 4RHV3 5EYYA 4OQ8A 1SLTA 4CCEA 2HWD1 4IE5A 3PVOA 4ZZ8A 3RSJA 4OZXA 1FOD3 3AL5A 4LBQD 5AFBA 1XQNA 1GQGA 1ZZ8A 2HLEA 2CTVA 1XB9A 1E5IA 1OA4A 1ZBA2 2WAAA 3MIFA 1W04A 3PUAA 4NE9A 1Q8PA 2YC4A 3GJBA 4IEZA 3RYPA 3SMHA 3VDDA 1YFUA 3VHOA 1EPWA 1RUF2 4IDZA 3U10A 2P17A 1F9KA 1VBD2 3AP5A 4PLOA 2JJ6A 2R041 4GMP3 3MIDA 1UYXA 4QKDA 2BZDA 2W47A 3T2OA 2RDSA 3O12A 4TLGA 2J7MA 2VZTA 1DG6A 1PVC3 3DPRB 3OJBA 3LFIA 3WP6A 1LHUA 2K2SA 4E27A 4UFJA 4QGNA 2WRAA 4KGGA 4DO0A 3VZLA 2HWE1 4AVVA 4M4PA 4DUVA 5C9AB 4JRLA 1R083 2C6SA 3RS6A 5EXOA 4E4DX 4MV2A 1S0JA 2ZMKA 1ZX5A 2ZX0A 1XYPA 4FPGA 3ZOIA 5JSOA 3MHZA 4PDWB 1Y7BA 2RDRA 1WA6X 4XF0A 2B9VA 2C1FA 3PU3A 2WUHA 1QIQA 3BYWA 5ACA3 1QY4A 2YXSA 4Q1PA 1YI9A 4ZU4A 5GZCA 3U0ZA 3HVDA 1V6JA 4CEYA 2QQJA 5FLIA 1PK6B 2WA3A 4AEKA 4FPCA 1GZ9A 2VGDA 3IKWA 3CIHA 1CZVA 1PMJX 2A3WA 3VBSC 1J3RA 2WS92 1SCSA 1WMEA 3D6EA 2EICA 2HWF3 5DN2A 4R52A 3PJQA 3QLQA 4AGRA 1JYNA 2XB6C 3ZFGA 3SQOA 5IUQA 1UU5A 3ZXFA 2BBVA 3ZIWA 5JMOA 1G7YA 4RN5A 1UKGA 5JIAA 1VAVA 3SC7X 3NNFA 1BMV1 3FN9A 1US3A 3KF3A 5CA6A 2ZGRA 1DP0A 4YW7A 2ZGPA 2CGNA 4LE3A 1TMF3 1NUKA 5JUVA 2YB7A 4UW5A 4CUBA 2WINB 1OUSA 3ZO0B 2UURA 2VMIA 2PAMA 5HCHA 4XZUG 3UL2A 3WDTA 1ZZ6A 1OQDA 1RUJ1 4MXWB 2GH2A 2K46A 3BTAA 2A6VA 1VBB2 4N8MA 4A44A 5IVBA 1EAH1 4YM0A 5FZKA 1ZRRA 4WVMB 3WF1A 2ZGLA 2VQUA 4UOJA 2AEYA 3MBWA 1CR7A 4LOTA 3W21A 1IPSA 2V5YA 2XUEA 4CTEA 1OPMA 3D5OA 5DAWA 1SBDA 1AR93 2XQRA 5ERLA 3RJ2X 5AC92 4XPVA 3N9NA 4IV1B 5F32A 4NIAA 3K51A 3O1VA 1CJPA 1L7RA 1V9U2 1XRUA 1TVGA 3GZTB 5T3NA 2DUPA 4AFCA 3V0BB 1FATA 1W0NA 3FZ3A 4HL0A 5FPZA 5FWEA 3DEMA 1MS0A 2E32A 3H1MA 1FAYA 3PVBB 2D98A 3PIGA 1DFQA 1GOHA 3I3BA 1GR3A 4W65A 1NE6A 2RMU3 2TEPA 4QQOA 3CJIB 2ZEXA 1B35B 4RSUA 3IT8A 3M3IA 4INDA 3MV11 1MQTB 4Y1UA 1XYNA 4QHZA 5D1IA 5HXVA 4LBJA 4CDWB 1A6CA 4MVTA 4QX7A 5LRRA 4LORA 3QBQA 3WDXA 3HT1A 1O6UA 4I0BA 2HWC3 1U5YA 3AXDA 1K5MC 1KD7A 1N3OA 2RS53 1GOFA 3L2YA 4HBNA 2YU2A 1I5ZA 3PU8A 1UAIA 5A3MA 2LROA 1POV0 5GZFA 2E31A 2UY9A 3KD4A 3R6SA 5F6KA 3WV6A 5CIRA 4K6BA 1OXCA 2ZAHA 3AFKA 4DZGA 4BH9A 1AYM1 1N1YA 3EMRA 4Y24A 5FCCA 1PMHX 1HX6A 5F5CA 2FDKA 3PHMA 5JMCA 4JGYC 3UGFA 2X29A 2AEZA 2B45X 3MFAA 1EY2A 2BW8A 4R8HA 1YYNA 3BTXA 4C1WA 1WW5A 5F2WA 2EVXA 2X53S 3AKTA 1OPOA 3MW2A 4GWIA 1BCXA 4NPRA 4QAWA 1SFYA 5FO9B 5HPOA 1MACA 2ZJCA 2XLFA 2ZHMA 1URXA 2YG0A 3S7IA 2A70A 1RUE3 4H14A 4A41A 2BU9A 2P1BA 2WSUA 5T5JA 4XUNA 2WFPA 5FPUA 1LULA 3GZUC 4N53A 2R072 3AMMA 4PQ9A 1IS3A 1U5IA 3I2JA 1UQXA 3K3NA 1JH5A 4QT6A 3H9AA 1DQ1A 2R6QA 4R4ZA 1XC6A 2JG8A 1LOFA 4CCMA 3NAPA 5HCAA 3H7YA 2NMOA 4JTNA 4DXZA 1ZA4A 1BVVA 4LNVA 3AP4A 1QJX3 1JOBA 2ET7A 2VNOA 5EFUA 2PTMA 2OZ6A 1ENQA 2EAAA 4OHZA 3HNMA 4IE7A 4AGVA 1BLZA 1REDA 2JDMA 3HWJA 3VZMA 3I4IA 5LA9A 4CUAA 3UKNA 4ES9A 4QHBA 4YVSC 3T0BA 2BOJA 3MGUA 3UV9A 1YIPA 4D7YA 2ADDA 4XJ9A 2XMLA 5E6HA 5JSRA 1GLHA 2EXKA 1W8UA 5A3OA 4XF1A 3VDCA 3GJAA 1BYHA 5KXEA 2D43A 2VBPA 1A3KA 2GMEA 1KS5A 1R1A2 2IXJA 1VRH2 5F3GA 4UBHA 1LAJA 1LHNA 2Z42A 3VV1A 4BOWA 4DRVA 5J7MA 1LU2A 4XMAA 4BLJA 3OEAA 5BNNC 1V0AA 2PQQA 3EJKA 1N1SA 1UPIA 4Y4YA 4DNYA 1HQWA 5C7GA 4NIHA 1YFWA 3T0DA 2W1UA 2VU9A 1H2LA 1ZYBA 2R16A 4XFIA 1PO11 4Z07A 4OVEA 4BB3A 3ALQA 4BZ4A 3MIEA 4QKBA 1TME3 5BYNA 5LK5A 4CSWA 5LK7B 4QPGC 5I91A 1KS4A 1CAXB 2NLRA 3OSDA 4DY3A 3NNGA 1SPPB 4AVSA 3BIWE 5BNOB 3Q8CA 5DAQA 4OI0A 1J1LA 1HQLA 5FYUA 3K77A 1DGWA 2E51A 5FZDA 1ULCA 3WDYA 3KQ4B 4UW3A 4ORFA 4YGEA 5FXVA 3PMEA 4JGZB 2EA7A 2ZS6B 2JD9A 2Q0AA 4AQTA 3KQRA 2VZQA 1ZRCA 2VJXA 4NVPA 4XYXA 2Q8OA 3J8F1 3VZKA 2WYFA 3ZYIB 2DWRA 1HJFA 1VB4A 2JDHA 1LENA 1DGWX 2PYTA 4HK8A 4Y20A 5JI7A 4JDNA 2JKBA 4XDQA 4JKLA 4AVTA 3QCWA 1O4YA 3UESA 3ETPA 4JC1A 1JZ5A 3J7NA 4C90A 4KNCA 5A3LA 4EQVA 3M3CA 2UWAA 2Y6LA 1BEV2 2ZHLA 3GM8A 4XFAA 5EQUA 4OI1A 4META 4LLOA 1UOFA 2X5IB 5FPAA 1BJQA 2CWMA 4J25A 2RS11 3M8LA 5BNPC 4IGOA 1DGLA 2WJSA 5IVYA 4DMIA 2R49A 4XFBA 5FUNA 4CEWC 1HXS3 1B09A 2P4EA 2XBO3 4LO7A 3CLPA 1KJRA 5C5UA 2GNBA 4FT8A 2HWD3 4H55A 2D6LX 1K5JA 1RUI1 2XL7A 4XFFA 2CDOA 2ILMA 1VBE1 1UZYA 1YJLA 1R091 4ZHNA 2PAEA 5GLWA 4EZ4A 3VHRA 3VBRB 5JZGB 2NZ9A 4Z2WA 1JI6A 1IZ3A 1JTZX 4FPYA 4ONUA 3JBG2 4URAA 4FPEA 1UMZA 2D93A 4AI3A 3FL7A 2R043 1AZDA 1CZSA 1DZQA 4W6XA 1H2KA 3VBUA 2PFWA 1AYN1 1JYCA 3KV9A 5T52A 2BPA2 4OLLA 3VKLA 4FSJA 1OOPA 2ZOEB 3KMHA 1PX4A 5BPXA 3W5NA 4BXSV 3VD5A 4E9KA 1TNRA 1S0GA 5FYIA 3RZHA 2MHFA 5K0UB 1N1VA 2H6BA 2HWE3 1PX3A 4YPJA 2X10A 4RQPA 3KLSA 1J58A 2WYSA 2VO5A 4AEDC 1UZWA 4ZKTB 1FMD2 1GWLA 5I8TA 1W05A 4Q4X1 3GGLA 2D97A 2ZGTA 1FPN2 4AHWA 3S57A 4WM7C 3AJYA 3PLQA 1H4GA 1SCRA 3NWKA 2R30A 1UOBA 5HV4A 2J1AA 1ZRFA 1NZCA 4Q4Y2 1LOCA 4NO4A 2RJKA 4CCCA 1REFA 5LBFA 4EYUA 4QU1A 2EIDA 2ENRA 5F7UA 1P8JA 3RI9A 2QDRA 2IXCA 2HWB1 4I3PA 1WCQA 4LA2A 5FYMA 1NLQA 5JOYA 4HN1A 4M3CE 5DXDA 4AI2A 5JWPA 4A6SA 3NJXA 1OLQA 1ONAA 4P9JA 3SH4A 1U5XA 4JV4A 1HQNA 1WGPA 1S0FA 4CP0A 5FY9A 2Y6HA 5LWBA 3U78A 2IUWA 3H1YA 5FPVA 3NKGA 4X6RB 2HYXA 1HJGA 3OBTA 1VBA1 1ZVFA 2QTWB 2VM9A 4EWDA 2K0GA 1NKGA 1RUJ3 1W6NA 4IEYA 4P02B 2X8KA 4MX3A 3SEEA 5CNAA 2WNOA 1W0PA 4GKXA 1EAH3 4JQRA 1MZ5A 4RHV2 2BYVE 1FOD1 2Y38A 5C8WA 1OHFA 4YM1A 5DAVA 3T1LA 2CAUA 3HNBM 3RZGA 1XU2A 3WNLA 4A3ZA 4XF4A 4AE2A 1DZRA 3LA3A 3VDDB 4BK4A 1VJ2A 2VZPA 1IHMA 4B4RA 2VNVA 1YQ6A 1S1AA 2W08A 2ZHNA 4OUSA 5DABA 3WD5A 1I3HA 2QQOA 1IQAA 2P6CA 4WZCA 5JIUA 2K9ZA 4LPLA 2OKXA 2ZGKA 3ZFFA 4IESA 3THPA 1HB1A 2JDKA 2EF6A 3AYDA 5E88A 1ND2A 1EUTA 3POSA 5FAXA 4ZONA 2IVJA 1LGCA 4W50A 4XETA 5FMDA 4FTEA 3W20A 3IM0A 5LBCA 4S2HA 1RUNA 5FK7A 4NIDA 1PVC2 3OY8A 3J7LA 1REEA 1HRI1 3Q8AA 2QQPA 3CF6E 2VPVA 4MGIE 1NZIA 4PQQA 1DQ0A 2FD8A 3O1MA 1R082 2Y6KA 5FBZA 4CP2A 4IEWA 4OZOA 1ASJ2 1H6YA 3ZN6A 5KHJA 2E9QA 1AR71 2BWCA 2BEOA 1ZZ7A 2CGOA 2XVLA 3M3QA 3OPZA 3Q8FA 4MO3M 3K4AA 3WG2A 4OCTA 5FYSA 5A7WB 4B29A 5ACA2 2XONA 4FPOB 4QDRA 2G19A 4CEYB 2V09A 4GJYA 5D8AA 1GANA 5FO8B 4Q27A 4NHXA 1H8TC 3MIBA 1RUOA 3M4FA 1AYM3 3P3NA 3V56A 1DDLA 3TNQA 1VPHA 3ZFGC 4CU6A 4C8DA 2HWF2 3SCGA 4CU8A 3AZXA 1BXHA 3H7JA 3MZHA 2BP6A 1TE1B 2JDPA 2QBXA 3VD3A 4NRQA 1CD3G 4P9GA 2W95A 2CDPA 3U1XA 1RTVA 1A78A 2SBAA 2XH6A 3QD6A 1TMF2 3BGAA 2KM2A 4LKEA 4QX1A 4YVWA 3I2HA 1K3IA 2YYOA 2GU9A 4LBOA 4HKLA 5FZEA 5E89A 3RGBA 3H3UA 3J4UH 5FZCA 2RE9A 3VB9A 5K0UC 4UW6A 3LZZA 2D3SA 4ITCA 2XWBB 4I09A 3JCIA 2C4XA 2WC2A 4P5HA 4QMAA 5FYZA 3RPQA 2FCUA 2XLGA 5EHDA 4DY5A 3MI8A 5SV5A 1OVSA 5CKNA 1PIV2 1O91A 1QF3A 2BDRA 2Y64A 3KGLA 3NV2A 2JE9A 3KHCA 4FI9A 3BALA 1OF3A 5IK7A 1I6XA 3WG3A 3B94A 5L7OC 1V6KA 4XUOA 3RG0A 2DVDA 1AR92 4COYA 2ORZA 2WZPP 4XCAA 5FYTA 1RVF1 2C9KA 5G05L 1UX6A 3NNJA 5IYYA 2B46X 5DUVA 3O1UA 5T5OA 3LDKA 3AP7A 4F8AA 4KL1A 3M2MA 2O0OA 1F4AA 2D6MA 2HEWF 3ZXKA 4GJZA 1D4M1 4XFGA 4B7EA 3HR9A 5K4LA 1OLME 2RMU2 4YZ5A 3T30A 2ZTNA 3I2DA 3KV5A 1FNYA 1UIJA 1WCDJ 4NN0A 2AREA 5FZ1A 5FZ7A 3AKRA 4Q0SA 1VMFA 1NA1C 2Y0OA 4FOQA 5FZ6A 1UX7A 1H2MA 2LRPA 2HWC2 1SACA 1Z0HA 5CFDA 3FUQA 4R4XA 2RS52 2VMEA 2IZWA 3A21A 4XJ8A 1J59A 1PO13 1UD1A 1PMIA 4KWJA 4JRAA 4MGYE 3SXWA 3O1TA 4MLOA 5C6CA 5ABJA 1AR81 3WDWA 1FNZA 2QZ3A 5A7PA 2Q8DA 3AP6A 1PGW1 4TWTA 1KDMA 4CXXA 3GHNA 3WDVA 2PHLA 4Y1XA 4Q2FA 5C3PA 5C8CC 2I45A 5FP8A 5F39A 4DS0A 2ZCWA 1UZZA 2RJ2A 4WVWA 5GZEA 5FMOL 5FV3A 3NJYA 2H0VA 2BGCA 4F7ZA 5CAZA 5LY2A 2IXIA 4BYYA 1Y9QA 1WA4A 1PGSA 3FE5A 3VBOC 4AI0A 3J8F3 3IMNA 4BHPA 3OUIA 4PT6A 2PHWA 1YIFA 1U0AA 2CGPA 5GKAC 3EO6A 4AFMA 1GFF2 2HJIA 4N53B 5C4WA 3APBA 4PLNA 3P1IA 4Y5Z0 1YQ8A 2VY0A 3H1WA 4XACA 2QVSB 3UT0A 4O65A 2GMMA 4XC9A 1PGL2 1FI2A 5CB7A 2JG8B 3A22A 2OS2A 3NAPB 4I02A 2RS13 5FJKA 2DFBA 4XQWA 4GWJA 3HMYA 5FZLA 3RWNA 3FJSA 3O5SA 4CCNA 5FYYA 1LOEA 2VW1A 5BNPA 4LBNA 3CL1A 1QJX2 1UU4A 2G1MA 2OXBA 5IT6A 2IFWA 3AB0A 3BPSA 1RUI3 2W1QA 2WNUB 3BB6A 2VTXJ 2QQIA 1VBE3 3UNPA 1R093 1XE0A 1GNHA 2BUKA 3WEZA 2EXIA 5I0SA 2IFRA 3FX3A 1GZCA 2WZR1 4MOAA 3VKOA 4W4ZA 4D0QA 4GWMA 2CV6A 3WHUA 1UY3A 2ZGQA 3KHBA 2N7GA 2KR2A 2XLAA 3TEXA 2P37A 2ZX3A 1W8ZA 1LGBA 1WW6A 4CDXC 4Q8KA 2JB8A 2AZ5A 4X6QB 5FPBA 5FK8A 4OHWA 4E2QA 4I0WB 1AYN3 3LEIA 1GBGA 2Y8KA 2EXJA 1OH3A 4LBMA 3WY6A 5AFEA 3KVBA 4QQHA 4YGBA 4C1XA 1UYZA 5IAXA 2FBEA 3C7GA 3PNAA 4COUA 4IW3A 3ITQA 3LEGA 3WF0A 1UXXX 1BBT1 4MXVA 3NNLA 1TME2 4OFGA 1ULOA 3VN4A 5FDBA 2MEV1 1CX1A 2YUEA 3LCPA 4LK6A 4CDUA 4PI2A 4Q4X3 4Z92B 4TXWA 2B9UA 4IUGA 4N43B 3MIGA 1LHWA 2GP3A 2C9AA 4FTBA 3PVEA 4COZA 2Z5WA 1LHOA 4RR3C 1COV1 4DPNA 5IFTA 5JPNB 1PZ7A 1MS3A 2DCJA 5A7OA 4UF0B 2ZHKA 4FPHA 2PMWB 3J9SA 4HSLA 1DQ2A 4NWWA 2YC2A 4XBQA 1W2AX 2HWB3 5CG9A 4CDQC 2V5DA 2VG9A 5DDJ1 4LA3A 5A3TA 1ZRDA 2VUDA 2VUCA 4QKFA 3HT2A 4Y20B 1JZ3A 3HN1A 1DZTA 3BOWA 2Q5TA 3M70A 1Q56A 4AAPA 3VBHC 1TNFA 5EJ3A 3HNYM 3NJVA 4NPLA 1N3QA 1ZZ9A 1W2TA 2WIIB 5A6QA 3KCYA 3UGHA 2ZA9A 1VBA3 2VZ3A 5J09A 4CUGA 1NCRC 4YW5A 4NHKA 2XBO1 4OHVA 3GHMA 3K75B 3AXEA 5CU1A 1NE4A 1JU3A 3F2ZA 1HXS2 3I2KA 5J3UA 4XILA 1JZ2A 2A6ZA 2WFF1 1WKYA 4GIQA 1W0OA 2JG9C 1RUC1 2GC0A 1JOJA 2HWD2 5CYYA 4XQDA 3OGVA 2DCZA 4GH4C 2XJVA 2VBDA 5DUUA 3AMNA 5FYHA 4U2AA 3Q9OA 3ZVXA 4XMIA 3ZFEA 3BIEA 1YEWA 1OFNA 3NV1A 5JCTA 3I49A 2FZ1A 5FLHA 2GDFA 4FOWA 1V6OA 5JVVA 3KB5A 2WNVA 1BKZA 2R042 1HLCA 3VBUB 2VCBA 4NWVA 4PF1A 2RV9A 3KT1A 3LQCA 1XNAA 1DYOA 4NJ4A 1OOPB 2L9LA 2XXZA 5DAPA 3J26N 3N9LA 3HBKA 1WLCA 5FZ0A 5FZBA 2DVFA 1HRI3 1RITA 2A3YA 1XSQA 3OEBA 2VXRA 4RQPB 2HWE2 4TZDA 5FPXA 3IAQA 3IDCB 1H1MA 4GWNA 3UJQA 3W59A 4Y3OA 4OHXA 5JXGA 3DPRC 1AR73 4LKFA 4NHLA 5A33A 5C9AC 1LEDA 1SDWA 5A1AA 3BPZA 3I59A 3OGJA 3P5BA 2YDEA 3B01A 3POFA 5K8SA 2ZZJA 1Q3EA 5FKCA 5HBAA 3KWVA 4PDWC 3ZXEA 5IW0A 5JLVA 5A7QA 2DFCA 2VQTA 3R4DB 4H7LA 3RZKA 4DQAA 2JDUA 3SH3A 4GA9A 4K9SA 1OF4A 2JEMA 4QX0A 1T6GC 4QB6A 5I0DA 2PLV1 1QJU1 1PK6C 1CAUA 3TBDA 3T0AA 3EYPA 1VP6A 1NXD1 2V72A 1GNYA 3ACHA 4FPJA 2Q1FA 5HI0A 2VZVA 4KWKA 1LCLA 2WKKA 1J1TA 1BMV2 4RGKA 1GZWB 4H7MA 3VD9A 3AZVA 1PNFA 4WM8A 1EP0A 1HV1A 4D6QA 4QXBA 4R9DA 1V00A 3WNKA
chains in the Genus database with same CATH topology
1IKQA 1NOVA 1W6OB 4Q29A 4L11A 2OA2A 1RUJ2 3VL9A 1F5FA 2D40A 3X29B 4FP3A 1GSLA 5J98B 1GV9A 1HRV1 5KHKA 2YHJA 1QH7A 3W9AA 5LRSA 5L7OA 3WLUA 4PBOA 3ZPYA 1RVF3 1CESA 3MLLA 5IK4A 4X8NA 4C0HA 4IV1C 1AR61 5IK8A 2JXAA 2VVEA 3IPVA 2VOXA 2XVKA 3ZFFB 4FTSA 1UIKA 1ND2B 4XJZA 1D4M3 4YW2A 3R05A 2YGMA 1X33A 4TYSA 3ATGA 2VOWA 3KT7A 3OY8B 2RM21 4QPYA 3DUIA 3LWCA 3A4UA 4ATFA 1QXPA 5T5LA 4LLFA 1O7FA 3CJIC 3ZN6B 3GF6A 1B35C 2WT0A 1QOSA 1W6MA 2YZ4A 1LECA 1MQTC 1WLTA 4BWOA 2RR11 4CDWC 1QDCA 1ZBE1 1AR83 1FV3A 1RUH1 2OW4A 5D8AB 1LB2A 1QGLA 1ND3B 1NG0A 1JUIA 1UF2C 1AYM2 2UWCA 4M3CF 3ZXLA 1RHI1 3VBFA 2DYCA 3ME2A 4J6GA 4COWA 4EV0A 5AVAA 2QZ2A 5CFCA 4WVVA 3MLKA 2ZGMA 2HKXA 4Z82A 1NLSA 1YI7A 2TNFA 4IEQA 4L97A 3M3EA 1UW8A 1VR3A 2D5HA 4L99A 2LUWA 4G9SB 3G7DA 1ZM1A 4YVWB 1YLLA 1IKPA 1AHSA 3AKPA 2SLIA 3G6JB 2FQPA 3L9JT 1W6PB 2WSVA 2I2SA 5C33A 3ZMNA 1OA2A 2ATFA 4P9IA 1WCSA 5JPMB 3AM2A 2JDZA 2QUOA 4HANA 3ZXJA 3ZXAC 4EN9B 1VB2A 1Q5OA 5EV7A 4GB31 4EN7B 2AR6A 1UKRA 4AHXA 2WZR3 3WP3A 1WUVA 4FAHA 1VBC1 1FT9A 2E6VA 5T55A 2XJTA 2NN8A 1O5LA 4DB5A 3LSDA 2DUOA 4QPIA 2XKOA 3TAYA 2XPJA 4CDXA 4N7UA 1CAVA 4HPKA 5LEJA 3MPBA 4FQZA 3WG4A 2OUJA 2UYBA 1BK1A 1RMU1 3CJXA 1VRH1 1YHFA 2A73B 3GZAA 3D4KA 2BQPA 3KZ4C 4N7IA 5BNQA 4Y1YA 3H8UA 3M3OA 3HAGA 1BBT3 1PO12 4PBPA 5ABJB 1W2UA 3DGTA 2D5FA 5FREA 2PELA 4XJWA 3WW1A 1RUD1 2MEV3 3GBGA 4N9HA 1AJOA 4L2NA 1NYWA 3MW3A 3WNXA 1NCQA 1COV3 1RINA 2XUMA 4C91A 5BNOC 4IEOA 3AKQA 4K8FA 5DDJ3 2PHDA 3J8F2 2VH9A 4L9BA 4QGLA 4XF9A 3VL8A 2GN7A 4CDQA 4JGZC 5F5QA 1CGPA 2ZGNA 4ATEA 1S0IA 1HDKA 5C4WB 3WR0A 1QJY3 4AEMA 1DIWA 3RNSA 3ILNA 4BM8A 5CG8A 3WUCA 4CYDA 1Z7S1 1CPNA 1ULFA 1YNAA 2PHFA 4LUMA 3TN92 1DF0A 2JD4A 4Q8LA 3WP5A 2RS12 1KFUL 4XOGA 4NHMA 3B7MA 4LBQA 4L8QA 4BCUA 2P3JA 1C57A 2X5IC 3E6DA 3WW3A 2WFF3 1XNBA 1RUC3 4Q4V1 2ZKNA 4JDOA 2DTWA 2YY1A 3ELNA 1RUI2 2O1QA 5I93A 1VBE2 3D8CA 1R092 1XNDA 3E5UA 1LOGA 1S0BA 3TRSB 4QGMA 2PAKA 1C8NA 2PHTA 3PTYA 5J36A 4GH4A 1QQP1 4RS5B 3H3ZA 4YFZA 5FQ0B 1NQDA 1JYIA 1S0DA 1C5IA 2Q1MA 3VBRC 1QWRA 5JZGC 5FTTC 2DCYA 3UKTA 5EZWA 1AYN2 1AXYA 3JB4C 3KGZA 4W6YA 4ES8A 5JAXA 4D69A 5KC5A 4CP1A 4EJRA 3ASIA 4A7YA 4JDMA 4IV3B 2PHUA 1D2QA 4CDUB 1CQ9A 1DQ5A 2DF7A 3AMPA 4Q4X2 2VUAA 3KCXA 3DPRA 3ES4A 1RL3A 3O0XA 5C9AA 1I9RA 3ZN5A 1KFXL 1L3JA 2ET1A 2BVBA 3JD71 1POV1 3VBSA 1WD3A 1UN1A 2DCKA 4HLTA 1AL21 1D4VB 3FUOA 3PVNA 4LO8A 4FAGA 3SCFA 2PLV3 1QJU3 2D7FA 2HWB2 3FLRA 3ZXDA 3AZZA 1H0BA 2HYKA 5A32A 4FVVA 2XGXA 1RGSA 2YGLA 4HSJA 5F1RA 4GQ7A 1VBA2 1X36A 3GNEA 4P9LA 1G9AA 4QQ2A 2CNAA 1FXZA 2GC3A 1Q8OA 2D6KA 1C8M1 4RGAA 1FOD2 3UK9A 4TLFA 3NSTA 1AX2A 4LULA 5KXCA 1HRV3 3WDUA 1DGRN 1U12A 3VKFC 1QOTA 1X82A 2R0HA 1OSGA 1JN2P 1NQJA 5GZDA 3ZFEB 4F3JA 1EV11 2AENA 5GLUA 2QJVA 4AFDA 2WNVB 5J48A 1LESA 1AR63 1Q8VA 3VDDC 1H9WA 1LHVA 2R32A 2ARXA 4GULA 1M4WA 4Q0VA 4A7ZA 5I0RA 1YFXA 3S7EA 2LALA 2RM23 3MDPA 1HRI2 1IS4A 2XJPA 3IDBB 3FFZA 2D44A 1C1LA 1K5MA 3LB9A 3PMSA 3VUOA 3CJIA 2RR13 3I59B 4XJAA 3USUA 1ZBE3 1DQ6A 1NY71 1RUH3 3T2TA 4CDWA 4AFBA 4LO4B 2XJQA 5H9SA 1QH6A 4B4PA 1MS5A 1HKDA 1ASJ1 1OA3A 4EWAA 4P14A 3ZFGB 1RHI3 1SBEA 4CEYC 5BV6A 4JGYA 1H1IA 1OMIA 5H9QA 1CAUB 4WZFA 4YZ2A 1Q8SA 4HETA 4FXGB 2GN3A 4AEJA 2WT2A 3S30A 4AQSA 4BIFA 4WM8B 5BXXA 3ACLA 3JB8A 3U11A 1PZ8A 3OD0A 3I8TA 3B5LB 3TB0A 2IC1A 4EN0A 2AYHA 2GZWA 4HMZA 3E6BA 5GALA 1OQ1A 4GXLA 5J96B 4XIOA 2OVUA 3SNMA 5KWRA 3AK0A 4D7SA 2AUYA 3WW2A 2UYAA 1VAKA 1IPJA 3E5QA 1DGRA 1FYUA 3RYRA 3TNPB 1QNWA 2CWSA 2OUHA 1PVXA 4IL7A 2RJLA 4XBLA 1DU3D 1KITA 1RUG1 3ZYGA 3MF9A 3M1HA 1PIV1 4GB33 1MR5A 4YVSA 1CJDA 3CNAA 4XZPA 3UKVA 1IPKA 3MPPG 3SH5A 4DFSA 1QOOA 3TOJA 3IPVB 1DLLA 1V6MA 1LR5A 1VBC3 1NLRA 1OLRA 4ZXKA 4FO9A 1D4M2 4AF9A 3OYWA 1SLLA 3CO2A 4FPFA 2V73A 5GLVA 1LKNA 5BNNA 3ETQA 5GZGA 2LTNA 2A3XA 4RL7A 1GQHA 1PNGA 4QD2A 4UBGA 3WW4A 1RMU3 3D82A 1VRH3 2ZPXA 3KSCA 4UW4A 3QOPA 1SBFA 3B93A 2GAUA 2JICA 4B4QA 1IOAA 3DF0A 2PN5A 3ILFA 3AMHA 4OHYA 2CAVA 1AR82 3NKTA 4QPGA 1UU6A 4MGKE 1C5HA 1RUD3 1H4HA 4IERA 1PGW2 4SBVA 1CIWA 3LAGA 2E63A 1CX4A 1AVBA 3VBFB 2VW0A 5GLZA 4IQPA 3DL3A 4NOTA 4AVCA 1MZEA 4YARA 4M3CA 3RRDA 1CAXA 5EYXA 1RUE2 5DZEA 3AMQA 1SMVA 5BNOA 1WBFA 3M7AA 1XE7A 2ARBA 1RIRA 4LHNA 1XNCA 5KHHA 1TQ5A 1D0GA 2PHXA 3L2HA 4Q4W1 2PHRA 4YGCA 1HIXA 2DTYA 1G9DA 1Z7S3 1E57A 2RS31 3ZSLA 3H50A 5GLTA 2VQAA 3FWEA 2EALA 4N53C 4WBBA 1SLCA 4AHYA 2YMZA 5E8AA 4ASMB 4CEWA 2BVVA 1AXZA 4J1WA 4XIKA 1BEV3 1LOFC 2JG8C 3NAPC 4XQ4A 3AX4A 1LEMA 2GNDA 3JU9A 3D0JA 3MIHA 3N36A 4Q4V3 4NR1A 3SLIA 3R4UA 2KA3A 4XXPA 4LO5B 2GNMA 3ZSMA 1X8EA 2TUNA 2WZR2 5T54A 4AK3A 1QQP3 2WNUC 1O4ZA 3NV3A 5HCBA 2R0FA 2NQYA 4BMEA 5FOJB 1YCIA 5HCFA 1S2BA 4QPIB 3V65A 4AG4A 4XEZA 1CAVB 2DURA 4HPKB 4E2SA 1VIWB 1SLIA 2E7TA 1DBNA 1UCXA 4A2UA 4P9WA 1KDKA 1C28A 2A75A 2ZGUA 1MS8A 5GM0A 2WLPA 1BBT2 4AEDA 2MNGA 5AVPA 2VVDA 2VMGA 2MEV2 3OBRA 3JUUA 2BNMA 5I8SA 1MEC1 4WM7A 1F2NA 4FXKB 1MVEA 2B42B 5DG2A 4Y26A 4R9CA 1MVQA 3JD73 1POV3 1NCQB 1PO21 4XTMA 3DN7A 1COV2 3FBYA 4N43C 1AL23 4S2DA 2HEVF 4S2FA 1O3TA 4QQPA 5DDJ2 1Q8QA 1PZ9A 3E6CC 4O9GA 4K40A 1QJY1 3I54A 4OI2A 4AW7A 1OQEA 3P3PA 1R1ZA 2ZBJA 2IXHA 3A0NA 5CADA 3RQ0A 5K7PA 2LM3A 2R061 2XBO2 4BPZA 4D7TA 3JQXA 1ULGA 1KQRA 2G4IA 1C8M3 4FPLA 5DZGA 1X50A 4XBNA 3RZZA 2WFF2 1RUC2 2FZ2A 4U36A 1XU1A 2CYFA 2BFUS 4P9YA 3ILRA 3LA2A 5KC6A 4I01A 1C1FA 1EV13 2VNRA 5FO7B 3MLJA 3LA7A 3MICA 4LHKA 3ZIXA 1ZBA1 4AQ6A 1PGL1 1YO8A 1RUF1 4MUVA 1MZ6A 1VBD1 3BCWA 4OULA 2G9GA 3AZYA 4FQ4A 1C4RA 1JW6A 4HFSA 4BE3A 2Q30A 3N3HA 4J1XA 3VBUC 5E1RA 4FOYA 4RD7A 3WINE 1D2SA 1J3QA 2NM1A 2OIIA 5FFOC 1OOPC 4TSVA 4PF5A 2O8QA 4WVZA 1YUDA 1KJLA 4PIYA 1ENRA 4RQPC 2PA7A 4MH0E 1A8DA 4MZUA 5F6LB 3WZ1A 5E16A 1ASJ3 1H8TA 3VBSB 4BLIA 1CAWA 1O5UA 1V6IA 2ES3A 1FX5A 4QQLA 2PLV2 1QJU2 2F6BA 1ENXA 2P3IA 3VKNA 2WS91 3V64A 4WV8A 4CRQA 4A7KA 1WD4A 5KHGA 3RMXA 5A32B 3LSEA 3WHTA 5JI9A 2YV8A 2ETEA 4PLMA 4EN6B 3SISA 2WWSA 1W6NB 4D94A 4AWDA 5K0UA 1AXKA 4JVAA 3U07A 1AL0G 2WA4A 5JOXA 1EAH2 4FCAA 2GSYA 4IETA 4E4ZA 4LUKA 3EBRA 3WVJA 1JBCA 4KG8A 2WQZC 3V0AA 1VBB1 1HRV2 3ZN4A 2FMDA 1RUG3 3KM5A 1UL9A 1MZFA 1PIV3 5CVRA 4Q0QA 5AC91 1AX0A 4XXAA 5FLJA 1SQ4A 1AR62 1V9U1 2IWGB 2W52A 3POWA 2VECA 5DUXA 2H6CA 5JOZA 4YZ1A 1F8VA 2DCTA 3ZFFC 4Z8BA 4FP2A 2RM22 1ND2C 4DRRA 2FMYA 1NA1A 3IIAA 2DU0A 4AGGA 1W6QA 1K5MB 4YFWA 2GH8A 4COVA 2I74A 1OD5A 3USUB 4E4SA 4YYOA 2RR12 3TWIA 2DV9A 1ZBE2 3KT4A 1RUH2 4YZ4A 3WQ7A 1WW7A 2ZZQA 1SFNA 4URTA 3MF6A 2DVGA 3K48A 5C8CA 3ECQA 4JGYB 1RHI2 4N90A 5D8AC 2UWBA 4M0HA 4AHZA 4R9AA 1ND3C 2WLQA 2A6WA 3OCPA 3THTA 3VBOA 3URFA 4HVOA 5H9PA 2B5HA 3ENRA 3OD4A 4AVAA 3T1MA 2XKPA 1LRHA 4B7KA 2MPFA 2D6NA 4L92A 1O4TA 1N47A 4Q4W3 2JECA 5GJ6A 4W6WA 4YVWC 1VALA 2RS33 4IEVA 2R071 3R4SA 4M0NA 3ZYJB 1QKQA 1Y43B 2ZX4A 3OF1A 1QNYA 1V6LA 4LTAA 2VW2A 1ENSA 1XNKA 4YNIA 3VKMA 4EROA 1M06G 1UPSA 2W68A 4YVSB 5LEKA 1A8MA 4YM2A 4GB32 3AP9A 1RJ7A 4GMP0 1ULDA 1AF9A 4GKYA 2QFEA 1VBC2 2OZJA 3RYKA 3KCCA 1OFSA 4XFHA 3OYWB 2WNUA 2Y26A 1YWKA 3A0KA 3B9CA 1WW4A 5KXBA 5BNNB 2Q4SA 3B9IA 3LKJA 3CU7A 1R1A1 4F83A 1G6NA 1Y3TA 1WMFA 4MYEA 1AUYA 2OPKA 1RMU2 2EXHA 4X8PA 3S6PA 3AKSA 2EAKA 3WUDA 4QPGB 4Y1VA 2DU1A 5CFDC 1RUD2 1GYKA 3IN9A 2IXKA 2OYZA 5I0UA 3INAA 1MEC3 1S0EA 1WCKA 5ABJC 1ZREA 2D6PA 3RJRA 2CY6A 5IK5A 1F5JA 2R1BA 4LHLA 2P2KA 4PJYA 4RR3A 1PO23 5TSWA 4M3CB 1JUHA 1DYPA 4YW3A 4ZU5A 4OI4A 5FMOS 4N43A 1FV2A 1QXJA 3RI8A 4Y22A 1GICA 2VUJA 3AFGA 4SLIA 4K1ZA 4FOVA 3VBHA 4ISRA 3QH7A 1QHDA 3HQXA 4KH9A 3GALA 4N9IA 2GNTA 1AJKA 3FBMA 3QH6A 1Z7S2 2P34A 1H9PA 1NCRA 5BNPB 2VULA 5C4WC 2R063 2CL2A 5IK7A 3E5XA 1BEV1 4AI8A 3WP4A 4CEWB 2AGSA 4XHBA 5DG1A 2ZX1A 3VHNA 4HKWA 2JG9A 3B02A 4XFCA 3TN91 4Q4V2 3W58A 1J3PA 1CPMA 3QACA 2WT1A 4Q0PA 3BU7A 5FRAA 1TEIA 4XE9A 4QX5A 1MS4A 2A6XA 3NW4A 3IDEA 2BFUL 1ULEA 2ERFA 1QQP2 5JOWA 1WLDA 4M00A 1ZBA3 1HW5A 1LTEA 4I0AA 1O3RA 5L19A 3N7LA 2EIGA 1RUF3 1IS6A 3HIFA 3N7MA 4XJUA 3JBG1 3MFCA 1VBD3 1EYBA 4RS5C 4M01A 4XTPA 3WQ1A 2C5DA 1DQ4A 5JSPA 3N35A 4C0BA 5CBLA 2UY8A 1S0CA 4KBBA 3ZMOA 1ZZBA 1QJZA 4AEDB 3VLBB 2ZGOA 2VVFA 1IS5A 3ZXGA 4K3UA 3WG1A 1S55A 2IXLA 2KXLA 4WM7B 2B39A 4IV3C 4AVBA 5J37A 3OGGA 4PDWA 1FMD1 3MW4A 4YRDA 4CDUC 3LOBA 3JD72 1FPN1 1WBLA 3WT3A 5KHIA 4JCKA 2Q1ZB 1AL22 1CONA 4YZ3A 3WCSA 1NXMA 1PK6A 3I7DA 4Q4Y1 2WS93 4G4FA 5CFDB 3ZYPA 2RHPA 4ZU7A 2XJSA 5KBFA 2DUQA 1YXWA 1LJ7A 2QDNA 4K1YA 4CZSA 1N1TA 1LOBA 1XXNA 1V70A 1RJ8A 4I3GA 1BVP1 1ZZCA 2P3KA 4YW4A 4KQ7A 4XF3A 3ROUA 2NPIA 1RB8G 2GMPA 1GZWA 2QE3A 4G3YC 5KXDA 5B2GB 3LGRA 3C3VA 1C8M2 4MXWA 1VBB3 4KG0A 1W6OA 1EPZA 4RHV1 3NVCA 4XHXA 4EWEA 1VLNA 3VGIA 4E2GA 4WVMA 1EV12 3OTFA 3B69A 5AC93 1X7NA 5EWSA 5BY5A 3B00A 5K9YA 4IV1A 3H0OA 2VMHA 1V9U3 2QKDA 2R1DA 3NL1A 3ZFEC 5BUVA 4KU7A 3ZSKA 3DV8A 3FLPA 3SHRA 1QDOA 3V0BA 4BMBA 2WNVC 2ZMNA 4GMP1 3RMYA 3ZX7A 4HKOA 4LT5A 4PCRA 3CEWA 4HT1T 4IEUA 1AR72 1VAMA 5A33B 2WQ4A 1PVC1 1B35A 1YJKA 3JZVA 3ST7A 3VHPA 2ZAAA 4DINB 5F9TA 1MQTA 1XYOA 3AYCA 1R081 3EQEA 1MS9A 4LEJA 3E97A 1NY72 2B8MA 1G9BA 1LGNA 4B8EA 1H8TB 5ACA1 1KRIA 4RA0A 4K21A 1CAWB 2GALA 2JX9A 1KXGA 5I0TA 4LO6B 5DZFA 2ZABA 4IXLA 4HVRA 4LR4A 2H0BA 5I8YA 2VOVA 4DOUA 2VOKA 4V1PA 2XJUA 3ZFGC 1H2NA 1N3PA 1ND3A 2XHKA 2HWF1 1F31A 4XW3A 5T50A 1XE8A 2BNNA 3WOGA 1PM7A 2O8OA 2XG3A 3WX5A 3LOIA 2UU8A 4PIZA 2JENA 3ZSJA 4A3XA 5K0UB 2NMNA 4WM8C 4IEXA 4HZFA 3R0RA 1TMF1 1OI6A 1WMDA 3NO8A 3WXPA 2ZACA 3RDIA 4YG3A 2GC1A 1LOAA 3AYEA 3O14A 4K7JA 2R073 4YG0A 3BODA 3SCHA 3V0AB 1GKBA 4HN0A 3N7KA 4Q1RA 3N7JA 3S0MA 5L7OB 1MS1A 3AYAA 3NJZA 4KGQA 1RVF2 2F4PA 2I07B 3BOPA 1RUG2 1W6PA 1H8VA 3JQWA 4O9EA 2A5ZA 3TYJA 4D3WA 4KU8A 1AR91 4PIXA 3O0WA 5JR7B 2QNKA 2XL9A 3GBWA 3WCRA 4QM8A 1I1EA 3ZSEA 3UJOA 1V6NA 3FC0A 4HK9A 4YG6A 2GC2A 4HVQA 4I2OA 3VZNA 4LE4A 1R1A3 4P9XA 5T5PA 1H1AA 1G86A 1W6MB 1NA1B 2RMU1 3VZJA 1W6QB 4FPKA 2A71A 4R9BA 4K20A 1D0HA 2A7AA 4MGZE 4YGDA 3U4XA 2HWC1 4QXKA 2YPJA 2TBVA 2RS51 3AZWA 4RFT0 4BQ1A 1Q43A 4RGGA 2C0ZA 1RC6A 5C8CB 4FBFA 4H3WA 3IBMA 4AFAA 5CFCB 4OUMA 2Y0IA 3WQ0A 4QU2A 1O3QA 4AQ2A 3USSA 2Z79A 1O3SA 4YSFA 1OKQA 3VBFC 4JTOA 3VBOB 4YM3A 1QMJA 2W0XA 3EHKA 3DKWA 4ISQA 1LU1A 2D3RA 2QCSB 5L73A 3EXUA 5CFCC 2NYYA 2VQ0A 4JGZA 4QM9A 3ES1A 4Q0UA 1DYKA 4Q4W2 2D3PA 1RUE1 1SEFA 2B7YA 4Y1ZA 1G9FA 5H9RA 3D0SA 3FLTA 2RS32 1H30A 1ZNPA 3ZDSA 1CVNA 2BWAA 3GYDA 3HBZA 5JDBA 2E7AA 4IEPA 1GNZA 5SV8A 2BTVC 2XJRA 4MSVA 2X5IA 4LBLA 2YC0A 3N4MA 1BQPA 1SLBA 1LODA 3IWZA 3TN93 5L36A 4BA6A 2FHRA 2WL1A 4EN8B 1C3HA 1QJX1 3AJZA 1BZWA 2Z69A 1G8WA 4LBKA 4KWLA 1QXRA 1IGOA