1RUG1

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLSHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
molecule tags Virus
source organism Human rhinovirus 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rug100
1ASJ2 3VDDB 2R043 1NCRB 3DPRB 4GH4C 3ZFGA 4NWWA 5C4WA 2HWD2 1VRH2 5C8CB 4FSJA 1WCDJ 3JBG2 5C9AA 4Q4W2 4GB32 2BFUS 5L7OA 1ND3A 4JGYA 1HXS1 2GSYA 5FOJB 2HWE3 2RM21 4CDQA 4YVSC 5A33A 1QJX2 1RUC2 1EAH2 5D8AC 3JD72 3JBG1 4Q4Y1 1MQTB 2IZWA 1VBD3 2RS53 1EV13 4Q4X2 2RS31 1RHI1 1R081 1POV1 1AR93 1ZBA3 2R061 1RUI1 1AR91 5A32B 3VBFC 1AR82 1GFF2 5AC91 1H8TB 2XBO1 3J8F1 4YVSA 2BFUL 2X5IC 3VBOA 1FPN1 1FMD3 1ZBE3 5FMOL 2PLV1 1VBA3 5ABJC 5BNOA 2MEV2 3FBMA 2WZR1 1VBA2 3CJIB 3JBG3 4Y5Z0 1PGL1 4CDUA 1POV3 3VBHC 2WS93 1EV11 5C4WC 1ND2B 1PO13 1VBE1 4N53A 4CEWB 2RR12 3ZFEB 1FOD2 1RUH3 1HRV3 3CJIA 5CFCC 2MEV1 4CDXA 4WM7C 3VBHA 5FMOS 2RMU3 3J8F3 1QJU3 2WZR2 1PO11 1RUJ2 4RR3C 3VBUB 5J98B 5BNNA 4N43C 1AR62 1E57A 3HAGA 2Y26A 4Q4V2 1EV12 2BPA2 1VBE2 2ZTNA 1K5MC 1D4M2 5BNNB 2HWF1 1R1A3 5DDJ3 1AR71 1RUH2 1ZBE1 4Q4Y3 1C8NA 1Z7S3 5JZGC 1PO12 1W39A 5C9AC 4YVWC 1RUE1 3ZFEA 4AEDA 2FZ1A 2RMU1 2HWB2 1AL0G 1B35C 1TMF1 1Z7S1 3ZFGC 4AEDB 1BMV1 2HWF2 3TN91 1POV0 5ACA1 1AYM2 3VDDC 1RUF2 4CDUC 3DPRC 1OHFA 5D8AA 2BUKA 2HWC2 4GB31 1MEC3 1Z7S2 4N43B 1M06G 5C8CA 5A32A 1V9U3 1QJY1 3DPRA 3JB8A 5BNNC 1VBE3 2QQPA 1PO21 1SMVA 1HRV1 2ZAHA 1V9U2 4CEWA 1MQTA 2WLPA 1F2NA 4GMP0 4Q4X1 1AYN3 3TN93 5CFDC 1COV2 2HWC3 1B35B 1QJU1 2WS92 4CEYB 4EJRA 1RUI2 1OOPC 1C8M3 1PIV1 4RHV1 3VBFB 4PDWC 2HWF3 4CDQC 5K0UA 2PLV3 2XBO2 1HXS2 2X5IB 1V9U1 4QPIC 4YVSB 1VBC2 4JGYC 2PLV2 4N43A 1R1A1 1VB4A 4RR3A 3ZFFA 4Q4Y2 1TME2 2RS13 4RS5B 4WM7A 3VBHB 1RHI3 5ACA3 2WWSA 5DDJ2 4CEYA 1B35A 1PVC2 1AUYA 4Z92B 1QQP2 1VBC1 3ZFEC 1VBD2 1R092 3JB4C 2WFF2 1F8VA 5AC92 3ZFFC 2RS33 1TME1 3J8F2 4YVWA 1QJX3 1FPN2 1RUC1 1EAH1 4Q4V1 2RS12 1C8M1 5DDJ1 1K5MB 1QQP1 1TME3 4BCUA 2FZ2A 1ND3C 1VBA1 3VBSB 5JZGB 2WFF1 5C4WB 1QJZA 1ND2C 1VAKA 5K0UB 3VDDA 1RUE2 2RR11 4YVWB 1A6CA 5CFCB 4GH4A 2HWB1 1OPOA 2R042 2MEV3 4RS5C 1AR81 1BEV2 2HWD3 4RQPC 4FTSA 1VBB3 1AR83 5J96B 1ASJ3 1RUJ1 4WM8B 1RUD1 4CDUB 4IV3C 1AL22 1AYN2 2HWE1 1VBB1 3M8LA 1HX6A 1ZBA2 1AR61 1HRI2 3ZFFB 5AC93 1X36A 4LLFA 4RFT0 5L7OB 3NAPB 2RM23 4IV1C 5C9AB 3JD73 1IHMA 1QJY2 3ZXAC 1NG0A 3ZFGB 1BBT2 3VBSC 2RR13 3VBFA 1VBB2 1CJDA 1RVF1 1VB2A 1ZBA1 1X33A 1VBC3 5CFDB 2ZZQA 1QJX1 4JGZB 1RMU3 1ND2A 4N53B 1NCQB 4GB33 1OOPB 1VRH3 1RUH1 1HXS3 1ZBE2 1PIV2 4RHV2 4WM8C 4CDWA 4QPIB 5ABJA 5BNOC 5GKAC 3LOBA 4CDQB 4QPGA 1NY71 1R082 2XPJA 4Q4W1 5C8CC 1CD3G 3VBOC 4Y4YA 4QPGC 4IV1A 1R1A2 1TMF2 4JGYB 1PO23 1RVF3 4CDWC 1RUG1 5L7OC 3NAPC 4JGZA 3VBRB 1H8TA 2RM22 1D4M3 1AYM1 2TBVA 5LK7B 1NA1A 3VBUA 4CDXC 1R093 1AR73 5D8AB 1NY72 2HWC1 3IDEA 4CEYC 1RUD3 2VQ0A 1QJU2 2WS91 1NA1B 1RMU1 1ASJ1 1RUJ3 1VBD1 1MQTC 4PDWB 1RHI2 2HWD1 1VRH1 1RUC3 1TMF3 1R083 1FOD3 1DDLA 1NCQC 1PIV3 2GH8A 4RHV3 1FOD1 1RUF3 4QPIA 1AYM3 2XBO3 5BNOB 1RMU2 1RUE3 4Q4W3 1ND3B 3VBOB 5K0UC 1COV1 3JD71 1COV3 1PVC1 3VBRC 1D4M1 5CFCA 4GMP3 2R041 1RB8G 5BNPC 1BBT3 1R091 2RS32 4CDXB 4RQPB 4CEWC 3VBRA 5JZGA 2R062 1RUD2 3VBSA 1AR92 4NWVA 1NA1C 2R073 1AL21 4Q4X3 1H8TC 2DF7A 4IV3B 1K5MA 2R063 1EAH3 5A33B 5ACA2 5ABJB 1RUF1 1AL23 1MEC2 1OOPA 1FMD1 1BEV3 1NCQA 4SBVA 4WM8A 4PDWA 1BBT1 3CJIC 1PGL2 4GMP1 1PGW2 1NCRC 4GH4B 1NCRA 1C8M2 2RS11 4RS5A 4WM7B 4N53C 2HWB3 5BNPB 1AYN1 1BMV2 1MEC1 4RR3B 4AEDC 1FMD2 4JGZC 3VBUC 1RUI3 1NOVA 3TN92 1AR63 1FPN3 3NAPA 4IV1B 2BBVA 2X5IA 1PGW1 4QPGB 1QJY3 1RUG3 2R072 2RS52 3S6PA 2WFF3 4CDWB 4FTEA 1BEV1 1AR72 4Q4V3 1RUG2 2WZR3 1HRI3 1RVF2 4IV3A 1QQP3 1PVC3 5CFDA 2RMU2 1PO22 1HQNA 2HWE2 1HRV2 5BNPA 4RQPA 4FTBA 1HRI1 2R071 2RS51
chains in the Genus database with same CATH superfamily
2PAEA 4E2SA 1NCRB 4QDSA 4R4XA 3PMEA 3WNKA 4NWWA 2C9KA 5JXJA 5LBCA 1UU6A 3TEYA 1WGPA 2Q5TA 4NHMA 2E51A 4YGEA 1LESA 1VIWB 1MZ6A 2GNDA 2VUAA 2ZGMA 5C8CB 3K3OA 4FSJA 3WHTA 5C9AA 2AH2A 1HB3A 1PVXA 4GB32 3FBYA 3RRDA 1QJEA 4A7ZA 1XPWA 1H6XA 2YBKA 5FYZA 5KC6A 1UMIA 1RYYA 3FWEA 1FT9A 3FHAA 2H0VA 2JE7A 5FXWA 5FZLA 1AX1A 4QHBA 2F4PA 1HN0A 4LEJA 4Q0VA 3VZOA 4AEJA 2WQZC 3LD8A 5A70A 2ZEWA 1RUC2 1EAH2 3ZN4A 3AK0A 3M3CA 1BVP1 4H7MA 2BGOA 1WW5A 4BQ3A 1L3JA 1S0FA 2CAVA 5CVRA 1KJRA 4HPKB 4NVPA 1SPPA 2RS53 1DQ6A 4Q4X2 3P3PA 2VZTA 1DQ4A 1R081 1POV1 2ZPXA 4YZ1A 3P1IA 2VMDA 1D2SA 1W8OA 2P3YA 3O0XA 5B2GB 2W87A 1WW4A 1O8SA 2ADDA 2XWBB 4HSLA 3OD0A 3HEIA 1W6MB 1BJQA 1FNYA 1GNZA 2ZEXA 5FPLA 5AC91 5GZEA 1H8TB 2C1FA 2Y34A 5A3NA 4M00A 4WVVA 4ISQA 2E7TA 1WUVA 1JOPA 1SZBA 4XUQA 2KM2A 4X8NA 1WW7A 1V6IA 5FMOL 3MZHA 4GZ9A 1IOAA 5EQUA 3FBMA 4AFMA 1JHNA 4OULA 1J58A 2ZGSA 3ES1A 4FP2A 5E88A 1H2LA 1YFUA 4A6OA 4ZS3A 5FV3A 1VBA2 3JBG3 4LBLA 1JZ2A 5EJ1B 2GH2A 1OA3A 4Z2WA 1POV3 4IE0A 3VBHC 3U78A 3LA3A 3D8CA 3KF5A 2GU9A 4JQRA 4XBNA 1X8EA 5EFUA 3MUY1 4CEWB 2K0GA 1DQ2A 3DYOA 4D6SA 4A44A 2XR4A 3JQWA 1HRV3 3CJIA 2NLRA 3AP5A 3KCYA 3SC7X 2MEV1 4B4QA 2H0BA 4FPCA 3A0KA 4WM7C 4Y22A 5FMOS 2RMU3 3VBHA 3O1SA 1QJU3 4NROA 1LOFC 3H8UA 2OUHA 3HT1A 3KF3A 3MF6A 2XDVA 4I0WB 2UWAA 2VQAA 2B45X 4JC1A 3W58A 2K46A 1A78A 3MI8A 3WF0A 3WXPA 1W3XA 4B7KA 3VUOA 3Q8AA 4N43C 1E57A 1V0AA 1UY2A 3ZXLA 2Y26A 4ZXEA 2WNUA 2XJRA 1EV12 4HVRA 2AREA 3BIWE 4K8FA 1PNGA 2VW2A 2HWF1 4OCTA 3PVBB 1SLAA 1DGRN 2VNRA 2Q1FA 4V1PA 5JI9A 5EZWA 1Z7S3 2HJIA 3U4XA 5A3TA 1PO12 1PK6A 3AYCA 2XONA 2UY9A 3R4SA 2G9GA 3KD4A 4Q1RA 4OUMA 1ULEA 2GNTA 4ZONA 3K46A 4DINB 1OH4A 1RUE1 4MH0E 2JE9A 2RMU1 2JDPA 2HWB2 4AEDA 5BV6A 2Z4FA 1TMF1 3KVBA 3U1XA 2OPKA 2WO2A 3WDUA 3ZFGC 1BMV1 4LK6A 1OURA 4KU7A 1NZIA 4X8PA 1N3PA 2QQLA 2UWBA 5FZ1A 3KQRA 4UF0A 5FYBA 1AYM2 1O4ZA 1RUF2 5F5IA 1OHFA 1YQ8A 1KJLA 5GZDA 3VL8A 1PHMA 1WMEA 2D6KA 1FATA 1QH7A 1O7FA 1PZ7A 2V5YA 3HT2A 4P02B 5EV7A 1XYNA 4FPFA 4HOOA 3KQ4B 2W3JA 2O1QA 3MFAA 4AW7A 1Q5OA 3FLPA 1H1MA 3KHBA 4D0QA 5KXEA 4M3CE 4JCKA 5KHGA 5FK8A 2WR9A 4N43B 2IFWA 3BN6A 3O1VA 4R9DA 4CP9B 4DEQA 2ZGPA 4E4SA 3UNPA 4FT8A 2Y6KA 5FPBA 3LEGA 4XXAA 2QFEA 1IKPA 1OVPA 2BNMA 4BWOA 4GWJA 3AYEA 1ZRIA 1QOOA 1GANA 3GHMA 2ZMNA 1SMVA 3IMNA 5A3LA 1O6UA 3U4SA 3LIGA 3MYXA 4FP3A 5FZCA 1MQTA 4HETA 1WCUA 3U11A 1OMIA 4P9LA 4MOAA 4CA9A 2VVEA 4W65A 4KL1A 2HWC3 3FFZA 1QJU1 3BUCA 2CY6A 4CEYB 4AVVA 1D7PM 4EJRA 2XUMA 3G6JB 4PIXA 5FZ0A 3Q9OA 1W6PA 1Q3EA 5GZFA 5IATA 1XU1A 5FP7A 3VBFB 1XE7A 5K0UA 1CGPA 2DVAA 3WUCA 3APBA 4Z2AA 4CP9A 5FYYA 4NRMA 2PLV2 4N43A 4NRPA 1GOFA 2DDUA 1FXZA 2WLQA 4JRAA 4LKEA 4URTA 3L2HA 2VBDA 3LAGA 3MW3A 2VZRA 1KITA 3ZFFA 1KD7A 1UWWA 4JZRA 4OZOA 4P9XA 1PM7A 2RS13 3DGTA 4WM7A 3OF1A 4Y22B 5HXVA 3VBHB 3ZSKA 4BYYA 3S0MA 1LKNA 2D40A 2P3KA 3THDA 4IXLA 4XHBA 5FY8A 1UAIA 4DUVA 2X8KA 3N36A 3T0AA 3S5AA 3SLIA 4XFBA 1B35A 4MX3A 5DG1A 3RNSA 4Z92B 2RHPA 2A73B 3H1MA 1VBC1 3AKRA 2WJSA 3GALA 2VCBA 3CEWA 5C3QA 3ZXJA 3EJKA 4OHWA 4HBNA 4CU9A 5FYVA 3POBA 2GZWA 1F8VA 5AC92 1A3KA 2DBIA 4GA9A 1TME1 4RA0A 3ACHA 1MS8A 1UX6A 1WMDA 1QJX3 3AVRA 2XH6A 5CKMA 1MS3A 5HV4A 5JDBA 2QQIA 2XMLA 4EZHA 1C8M1 5FYIA 5G04L 5DDJ1 2EAKA 1NXMA 1XE8A 5KXBA 1G6NA 1QJFA 2B46X 2EALA 3DXTA 4GXLA 2OYZA 1QQP1 2R6QA 3ACIA 4YM2A 2KR2A 4NAOA 1ND3C 1QOTA 4XTPA 1W8WA 3I3QA 1VBA1 3VBSB 4KMQA 1OH3A 1DCSA 2GNMA 2VJXA 3O1MA 3I3MA 2WFF1 1UZYA 4XBLA 1QJZA 1ND2C 4UFMA 4PT6A 1ZRDA 4Q26A 3ZKUA 3VDDA 5LW9A 2JDUA 2RJKA 4YM3A 1Q56A 3I3DA 4AXOA 1VPHA 1WMXA 4AG4A 5CKNA 1LOFA 5IJRA 1JUIA 5FYSA 1AR81 1H9PA 1QXRA 1W8UA 4AFAA 4BLJA 1JZ8A 1ODMA 2JE8A 3B7MA 3H0OA 1BYHA 4CCLA 1H6YA 3N9NA 4WM8B 3V56A 1V6NA 1C28A 2ZHLA 4UOJA 3ZDSA 1W8NA 3LSDA 4ET7A 4AHXA 2YU2A 1AL22 1AYN2 1JYCA 2ES3A 2GP5A 3FUQA 4XQWA 1D0GA 2WQ4A 1AR61 1HIXA 1HRI2 1YHFA 2JICA 2ORXA 5T50A 5AC93 3CF6E 3ZXGA 4FPEA 4IETA 4YNIA 4AK3A 5C9AB 2LRPA 5HCHA 1WWYA 5FO8B 4META 5KHKA 2E7QA 4F3JA 2VMEA 1AJKA 4WBBA 3ZKYA 2QQUA 3AMMA 4PI0A 2OZ6A 1JMUB 4I02A 3ZFGB 2B7YA 2VZUA 1C1LA 3ZYRA 3O5SA 1ZBA1 4D3WA 2EF6A 2X09A 5DABA 1J84A 4D6RA 1X33A 5CYYA 1VBC3 2G9FA 4FFFA 4OI1A 3DUIA 4A6SA 5IK8A 4PIYA 4JGZB 1I3HA 3QH7A 5I91A 3CZUA 4N53B 4NIAA 5JSRA 1SFPA 4GB33 2XL7A 1RUH1 1HXS3 1YQ5A 1ZBE2 2VOWA 2ZGNA 3DXUA 5FBZA 1GSLA 3LEMA 2YC4A 3BOWA 1LENA 1OSGA 1PK6B 1WKYA 5GKAC 1LAJA 4BDVB 4QPGA 2Y6LA 4Q4W1 1H30A 4XFGA 3VBOC 1J83A 3E6CC 4Y4YA 1QNYA 3S7IA 4Y1YA 3ON7A 2R32A 2VMCA 4YG6A 1JOBA 2DTYA 2VMHA 5E1RA 5FUNA 3IPVA 3THPA 3A0NA 4CXWA 4DS0A 2NYYA 2XB6C 4K1ZA 5ERLA 3VBRB 3OGSA 4ASMB 3RZGA 1UZVA 3ILRA 4BQXA 2XKOA 2CNAA 2JWPA 4DXZA 3C7GA 1OD5A 5CZKA 5DZGA 3RZJA 4KWJA 1N47A 4BOWA 4N7IA 1QXJA 3B00A 2WN2A 3RI9A 2WDBA 4QQ2A 4HVQA 1QJU2 2KD7A 3UESA 4XEZA 5C6CA 1A34A 1RMU1 5DUVA 3I2JA 1S2KA 2AYHA 4P14A 3RMXA 1YYNA 1RHI2 4NN0A 1RUC3 1UPIA 4HANA 4XC9A 1UOJA 1I1EA 3S30A 2WSUA 4CU8A 3AZZA 1VMHA 4EN8B 3I97A 3ZR6A 5HCFA 2A3WA 1PIV3 3ZSLA 3NNJA 1FOD1 1RUF3 4LOTA 4AVAA 1H8VA 4Y26A 1LB2A 3RYKA 2XWJB 1AXYA 4LOSA 3DKWA 4QPIA 2VMFA 3MPBA 1QY4A 4OMDA 3A7QA 2HKXA 4OQ8A 1WCKA 2ZAAA 4IE4A 4PHZA 1Y4WA 2Y0OA 4IGQA 1NAEA 5EJZB 1NX9A 2D6PA 3HN1A 3N9MA 1O5LA 2D6OX 2G19A 1QWRA 5CFCC 4Y5SA 3MLKA 1D4M1 3VBRC 3D4KA 2DVGA 4LBQA 5CFCA 3PIGA 5ANQA 2DUOA 2J22A 1DQ0A 3WP6A 1SFYA 4KU8A 2CGPA 2B9VA 4HG6B 4QGNA 4AFCA 4CDXB 1AX2A 4ZKTB 1SBDA 3M1HA 4RQPB 3RWNA 2VNOA 3V0BB 3VBRA 3BPZA 2JDAA 3VBSA 1NA1C 2CHHA 2GALA 4XCAA 4HZFA 4YW5A 1Y9QA 2R073 3AYDA 3AJYA 1FV3A 2Y0IA 3I8TA 3K51A 4Q4X3 4ZU4A 4DXRA 5LK5A 3FLRA 1WA4A 2LS6A 1LHUA 2R063 3SKJE 1A8DA 1O91A 1QOSA 2WYFA 2OVUA 2CYFA 2ZEZA 5ACA2 1BK1A 2R0HA 3OJBA 5FLJA 4AI2A 1J3RA 3BPSA 5F2SA 2JX9A 1V6OA 3K2OA 3A23A 1MEC2 3RQ0A 4XF0A 2PHFA 2IXLA 3N9QA 4GKXA 4AI8A 4AHYA 1WLDA 4GMP1 5FY9A 1UIKA 4CP0A 2WABA 3BI3A 1Y9MA 4CP2A 3FL7A 1UKRA 2BGCA 4GH4B 4FOQA 3B94A 2ZX2A 4K9SA 4XPVA 3SCHA 4DRVA 1NZCA 3LQCA 1UO9A 1NCRA 1UU4A 1UY3A 4WM7B 2A6XA 4LO6B 3VHRA 3MV11 2Z5WA 2E32A 2VW0A 4MGIE 4A45A 2E63A 1WW6A 3J26N 1AYN1 5CKQA 4RR3B 1FMD2 1QEXA 1G9DA 5HBAA 3WF2A 3TN92 2OUJA 5AFBA 1W2UA 1I6XA 1EUUA 1FPN3 3AXDA 4V2VA 3EXUA 2VR4A 4TTGA 2X5IA 4Q0QA 1JH5A 2BBAA 1RUG3 4NHLA 1ZZ9A 1W6PB 4J25A 2RS52 3S6PA 4EN6B 4ATFA 2VCAA 2WFF3 4FQ4A 1N1YA 4CDWB 1BEV1 4HONA 3BIEA 2DV9A 3OYWA 1JHJA 2DFBA 4RL7A 1LULA 1N1VA 2X05A 5FY1A 3VKNA 3N9PA 1XOYA 4AOCA 4DY3A 2WZR3 3H3UA 4OVEA 4EWAA 1U0AA 1E5IA 4WZCA 5FZDA 1FV2A 2ZEYA 4UFIA 3IAQA 3IIIA 5CFDA 2RMU2 4EN7B 4IE5A 2ET7A 5DAWA 1HQNA 2FBEA 3ZVXA 4A3XA 3UGHA 2WYSA 2P34A 4FTBA 2PQSA 3ZLIA 4KWKA 1IQDC 3LZZA 4LNVA 1POV0 4P5HA 5LRRA 1ZA4A 3VDDB 5C3SA 5IYYA 3RWKX 3NKGA 4YRDA 5A1AA 2HWD2 3BB6A 1UY4A 3POGA 3WOGA 2BOIA 1GWLA 2JDZA 3J7LA 1VMFA 1FAYA 1WCDJ 2R49A 1O5UA 3JBG2 5FQ0B 3UGGA 4Q4W2 4AVBA 4YSFA 2BQPA 3DL3A 3WLUA 4QDRA 4JGYA 2LW8A 2ZBJA 1GP5A 1LHVA 1UPSA 2BNNA 3OG2A 3POJA 3CL1A 4DIQA 2QQMA 4BMBA 2ZHNA 5K9YA 4LA3A 4OI0A 2XJTA 3KV5A 1UX7A 3KB5A 3N7KA 4XJ8A 1GZCA 1TNFA 3FMGA 4M0NA 4YVSC 4UF0B 1SG3A 4ARYA 4COUA 2Q8CA 3SH5A 2YHJA 2A75A 3VDBA 4DMIA 2VC9A 3JD72 5AVAA 2A3XA 5I0DA 2Y6FA 5GLWA 4ZHNA 4KBBA 5FWEA 4IEUA 3WQBA 4BQ2A 1EV13 1AVBA 1XSQA 2GN7A 1W2AX 1W6NB 2RS31 1RHI1 2C0ZA 3AP9A 5J48A 2JDYA 1AR93 1PNFA 3MW2A 4HK8A 5FZGA 3WF4A 1CJPA 5IVEA 4IEWA 3GCWA 2DU0A 4MGZE 3B9IA 5A32B 1UIJA 2EIBA 4IEYA 1MZEA 1KDKA 2PHDA 1TG7A 3PHMA 2C24A 4S2HA 1XXNA 3J8F1 1H1AA 2BFUL 5FYUA 1GZWB 5GZGA 4CUGA 5DG2A 3ZSJA 1FPN1 1FMD3 2TEPA 3N9OA 1ZBE3 5FKBA 2PLV1 1RC6A 3THCA 5ABJC 5FXVA 2QQNA 1H2KA 5CISA 1KGYA 2LTNA 2W47A 3M3QA 2WZR1 2VGDA 3HQUA 4R8HA 3WP4A 4AHZA 2BEOA 4K7JA 4NR1A 1QIQA 3TOJA 5D21A 4C1WA 4CDUA 5H9PA 4AI0A 2GMPA 4L97A 3JZVA 2XJQA 4IEOA 4QKFA 4BU2A 5C4WC 4N53A 3RJRA 5KBFA 3NJZA 3GBFA 3ZFEB 5KHIA 4IEPA 1TZOA 4OHYA 1LHOA 4FXGB 5BY5A 5KWRA 1UD1A 3FFQA 3J8F3 3IT8A 5CU1A 1RUJ2 4YFWA 3M2MA 5K4LA 3D0JA 3W21A 5F3EA 3ACFA 3IIAA 4YGCA 5BNNA 4MXVA 4LQRA 1YNAA 3J7HA 5KXCA 2V4VA 3VD4A 4D8MA 1UZ0A 1CR7A 3AKQA 3JCIA 1VBE2 5L9RA 4LA2A 1QMJA 1US2A 1XYPA 4A7YA 5BNNB 1W8HA 4QX3A 2YROA 1A8MA 5LWBA 1V6JA 1C8NA 2HEWF 5JAXA 5JZGC 3URFA 3POWA 2WFPA 5IAVA 3GXUA 5A7PA 4XHXA 3O1OA 4CYDA 1J3QA 4OHZA 4E4ZA 1WCQA 4KQ7A 3KVAA 1ZRRA 3ZFEA 3DCQA 4QU1A 1O3QA 5I0SA 4ASLA 1ENSA 1XNBA 3OBZA 4LPLA 5DAQA 1ZZ8A 1LCLA 3RPQA 1LU2A 2EXJA 1JS9A 3TN91 2LUWA 4YW1A 5FUIA 1W6OA 1OF4A 3SNMA 3R4DB 2W95A 2WNVB 2K9ZA 5I0RA 3EBRA 3WCRA 4YW2A 4XF9A 2D6NA 3UL2A 2VG9A 1MEC3 5HCAA 2OS2A 3KSCA 2IUWA 1E5HA 1IQAA 1AF9A 2WO3A 2WT1A 1Z7S2 1DG6A 2QUOA 2EAAA 1M06G 2X10A 3LDRA 4RGKA 4TLGA 3Q8FA 2ADEA 4CCKA 5I0UA 3INAA 5EYXA 3DPRA 1CESA 1SEFA 3E5XA 3JB8A 4XQDA 5BNNC 5FZIA 3GBWA 2R1BA 3H42B 4K6BA 3DECA 3PUHA 1W0NA 4XUPA 1IG0A 4E9KA 2XG3A 2R30A 4FVVA 4I2OA 4R52A 2VO5A 1ODNA 3LFMA 1V9U2 1SFNA 5C8WA 2BERA 4MG2A 1QU0A 4QB6A 4IUGA 5FREA 1OFSA 1REEA 3GNEA 3HBZA 3NV4A 3NV3A 3POYA 1AYN3 1JW6A 4MZUA 3VLBB 3NNGA 1MACA 3B9CA 2GNBA 1COV2 1W8TA 3HNYM 4LKSA 3IKWA 4DB5A 4SLIA 4OQ9A 3WVJA 1RUI2 1W8FA 4YWAA 5FZOB 4RGGA 4L11A 4LBMA 3HWJA 1LEDA 1LGBA 2ZX0A 1PK6C 3VZNA 4CDQC 3RZZA 3FLTA 2PQQA 4QPIC 1QDOA 1B09A 3M4FA 2E7AA 2W39A 2WC2A 5T5OA 3VD7A 4YVSB 2J42A 3FHQA 3O0VA 4P9WA 4Q8KA 2VTFA 4A2UA 3BOPA 2D3SA 2ID4A 1VB4A 2A70A 3KMHA 4D94A 2YYOA 2NM1A 1K5JA 2ZACA 5JOWA 5DZFA 2WUHA 3ECQA 3I2KA 2YPDA 3ZN6B 1LOGA 1EP0A 1OLQA 1T6GC 4YW3A 5DXDA 1GP4A 3LFIA 1W9SA 4INDA 1LJ7A 2BWAA 3I2IA 4M4PA 3TEZA 4XTMA 1ZVFA 2Y33A 4D69A 1S0DA 3NVCA 1AUYA 1GQGA 2AEYA 3D82A 4XFFA 4AFBA 2D3RA 4LLOA 4NHXA 1N1SA 4XJAA 4DPNA 4TYSA 5IHRA 2JG8C 2I45A 1PZ8A 3WV6A 3WF1A 1XNDA 2MHFA 1MZFA 3JB4C 5LBFA 2FMYA 5JMOA 4QM9A 4URAA 2BW8A 1JU3A 3HNBM 3J8F2 4JHTA 1POQA 4M01A 1PMIA 2IXIA 5DAPA 5T55A 2XQRA 4RYDA 5LZ6A 1I9RA 1C5HA 1FPN2 2UURA 3MIBA 2ET1A 4XE9A 4Q4V1 3ILFA 3IZOA 4LO7A 4JDOA 1UYXA 4N8MA 3KLSA 3ZM8A 4Q0PA 1GWKA 1GNYA 1RIRA 3RG0A 1VRBA 4HFSA 3WW1A 5FPAA 2W1UA 2FZ2A 1RTVA 4I0BA 4JDNA 1OF3A 4QX1A 4QQHA 2GC2A 3DYPA 5IW0A 1N3QA 3T09A 4YW7A 1GYKA 3LOIA 5JR7B 5A6QA 1XU2A 3IDCB 3O0WA 4D7YA 2BVBA 3VDCA 3N4MA 2WNEA 5FZEA 3SQOA 3AXEA 4O7XA 3WDTA 3K4AA 4KGQA 3HJRA 5I93A 4YVWB 2UYAA 2YFUA 3ORJA 3Q8CA 4XUTA 3WP3A 4CPBA 2MEV3 3ROUA 1JOJA 2HWD3 3ZXDA 4MGTA 2VH9A 3H1WA 5GJ6A 5JXHA 5APAA 4HMZA 5I0TA 1CAVB 1RUJ1 2EICA 1CIWA 4N90A 2VZVA 4UW4A 5T54A 3WNPA 2PHUA 2VQUA 3FE5A 5BXXA 5A6YA 2VE1A 3MGUA 1G9AA 1GICA 2P2KA 3K77A 4L9BA 1YJKA 2HWE1 1VBB1 2RG4A 4QGMA 3BTXA 2K2SA 4QKNA 3FN9A 5A7QA 3ZFFB 1X36A 4LLFA 4I01A 4RFT0 2G9ZA 2WRAA 2RM23 1BKZA 2VMGA 4LORA 4RGAA 3JD73 2WZ8A 3IDBB 1QJY2 2ZX3A 1ENXA 2WQ8A 4MGYE 4R9AA 5BNQA 1W0OA 3PUSA 1NT0A 1ZZ7A 1JYVA 2ILMA 3T3YA 1YIPA 3VBFA 3VB9A 1F4HA 1CJDA 1RVF1 1VB2A 2LM3A 2G1MA 1IKQA 2HEYF 3HNMA 3VD9A 4KWUA 4QXBA 4AGVA 1OBNA 1HV1A 3WQ7A 5CFDB 1WD4A 4MADA 3ST7A 1RINA 2ZZQA 4WVZA 5H9RA 3GM8A 4HN1A 4XACA 2P17A 4Y20A 4ATEA 1ND2A 1O59A 2B39A 4XMAA 1NCQB 4BQ4A 4E8DA 5FWJA 2D6LX 1OOPB 1JI6A 4YW6A 3UKNA 4O9GA 3RYPA 2W9XA 5SV8A 3AYAA 2QJVA 4RHV2 4M3CB 2JKBA 1WMFA 4CDWA 2CWSA 4BH9A 1L7LA 2BGPA 4YG3A 5ABJA 1W8ZA 4Z8BA 3QBQA 4ZXKA 4B3NA 1R082 1KXGA 2YXSA 5FP8A 3X29B 5C8CC 2XPJA 1W05A 4XUNA 3D0SA 4BA6A 4C90A 1R1A2 2WNUC 1IPJA 5ANNA 5EP9A 3M7AA 1RVF3 4DXTA 1VP6A 3AKTA 4Y20B 2VUDA 3LIHA 5L7OC 4YZ5A 2XQXA 2OKXA 2RM22 5DPNA 5C3PA 1EYBA 3RZMA 5LK7B 1NA1A 5FXXA 4AHWA 5FZ3A 2KA3A 3VBUA 4AFDA 1UYYA 1KS5A 1R093 2QNKA 1RUNA 5D8AB 1NY72 1ULGA 1MZ5A 2HWC1 1CZSA 2A7AA 3C7HA 4E4HA 2ARXA 3NNLA 3WQ1A 1RUJ3 5F6LB 5BYNA 1VBD1 2ZXQA 1LOBA 2WINB 4XVHA 2ZZJA 1SCSA 2HWD1 2JDNA 4UWDA 3ZYHA 4Y1XA 1TMF3 2E33A 5JVVA 4YZ2A 3CHXA 3EHKA 4JQTA 2JG9C 1NCQC 1CONA 2CDPA 3K4ZA 4IE7A 3WZ1A 4EZ4A 5EYYA 3AP6A 1X7NA 1UMHA 3KV9A 4Z82A 3UGFA 4TWTA 5F5QA 3RZHA 4RN5A 2FDGA 3SH3A 3SHRA 2XBO3 3DYMA 5BNOB 3MIGA 3JU9A 4Q4W3 4Y1ZA 4D7SA 4CU7A 1ND3B 3ES4A 2D5HA 3MUZ1 2YPJA 1W0PA 3WNLA 5IK4A 2EVXA 4LTAA 3JD71 4C1XA 1AXKA 3I59B 3WUDA 1COV3 4XDOA 2PTMA 2BYVE 3VKOA 2VCMA 5J37A 1YXWA 3CU7A 2J1UA 3WP5A 4AVSA 2NMNA 3VZKA 1VE0A 4XFIA 5LB6A 2RS32 1RXFA 3N7MA 1XJAA 4ARXA 5A3WA 4OHVA 1BK0A 4JVAA 1OFNA 4FCAA 1ZNPA 3ZXFA 2JDMA 2XLAA 5JZGA 3QD6A 2CAUA 5IK7A 2CGOA 3ILNA 4BZ4A 5JSPA 3TRSB 2EXHA 3U37A 1RJ8A 2DF7A 1D2QA 2FMDA 3T2TA 5JOYA 5C7GA 3GF6A 4PI2A 2QQWA 4GIQA 3KS7A 1K42A 1U12A 1KQRA 5A33B 4FO9A 5IUQA 3ZMNA 3AMHA 5ABJB 1RUF1 2JG9B 4MGQA 2ZS6B 5C5UA 4XCBA 2ZMKA 1KFUL 1X9PA 3RJ2X 3MPPG 1IPSA 4XZPA 5KR7A 2ARBA 4QHOA 4BHPA 1OOPA 4COVA 5FYMA 5FPZA 1VAVA 3OEBA 3LA7A 3HQXA 1U5ZA 1V00A 2RDRA 3OY8A 4QWNA 3WD5A 2JECA 4P5YA 1W2OA 5DN2A 1OA2A 2YC0A 4L92A 2ZKNA 1UW8A 1NCRC 1Y9GA 4HSJA 1C57A 3WY6A 4DQAA 4F83A 1OQEA 2EIEA 4MXWB 4N7UA 2IVJA 2RS11 2DCJA 4OUSA 5T3NA 2P5BA 1MVQA 3D5OA 3PTYA 2PHLA 4ZS2A 5LBEA 5CA6A 1CX1A 2HWB3 5BNPB 1IGOA 1VJ2A 3GJBA 4JGZC 4QMAA 1SACA 4IEQA 2MPFA 3WNMA 1RUI3 3E1F1 4KBZA 5DAXA 3CZJA 1AR63 5I8SA 1BLZA 1MVEA 2E53A 3I7DA 2P3JA 3OY8B 1YRZA 3AMNA 4AEKA 4FPHA 3NAPA 4GALA 4AQSA 3O1UA 1PGW1 5E16A 3I2DA 4QPGB 5C5TA 1CAUA 2VNVA 1KDMA 3ITQA 3AKSA 3TWIA 2R072 2JG9A 4FXKB 4FTEA 5FXZA 3PMSA 1LODA 1KRIA 3KM5A 3NJVA 1IS6A 1RUG2 2V5DA 3BTAA 5FZMA 3D6EA 3BGAA 4Y4RA 1X9TA 1RVF2 1QQP3 3T2OA 4BB3A 2JEMA 1UQXA 1F5JA 1T6BX 3DV8A 1W9FA 1PO22 2UY8A 1TVGA 5IK5A 4FPKA 2IXCA 5LA2A 4IEVA 3UJQA 3DN7A 4ORFA 4XJWA 5CADA 4LIVA 3POEA 4W4ZA 5LA9A 4D7TA 3MIDA 1G9BA 1ASJ2 3BYWA 3DPRB 4UFJA 1H4GA 5E89A 2DVDA 5C4WA 3ZFGA 1F35A 1BHGA 1H2MA 5FZBA 1G86A 1CZTA 3C7OA 4GJZA 3PUAA 5J3UA 3I59A 2Z79A 3U75A 3HIFA 2B4KA 4WV8A 4XETA 4NIHA 2BFUS 1ZZCA 5J09A 4DZGA 1ND3A 1LOEA 1UXZA 2RJLA 2RDNA 3USSA 3WINE 4NAMA 2GSYA 4QPWA 4M3CF 2GAUA 4W6WA 4E2GA 2RM21 1ZM1A 4CDQA 1CAUB 3O14A 5GZCA 3N35A 1QJX2 2J1AA 2YY1A 5D8AC 2WZPP 3AC0A 3PIJA 4BQ5A 3HBKA 4UYBA 3WG3A 1Q43A 4XILA 2BDRA 2LROA 2VZ1A 2ZGQA 4BJ0A 1MQTB 4P00B 1DZQA 2IZWA 3HPNA 3ZX7A 2OPWA 4KWLA 4BK5A 1XRUA 3PUIA 3OB8A 4KH9A 3ZYFA 3A4UA 5FPVA 3R4UA 4FPLA 4Y24A 4FFIA 5CG9A 2WN3A 1ZBA3 3GZEA 1RUI1 2VW1A 5FBJA 1DQ1A 4AL9A 3UV9A 4FFGA 3SMHA 4A4AA 3J7MA 1YWKA 3OSDA 1AR82 1GFF2 4YVSA 3RGBA 2X5IC 3PU3A 2WO1A 3VBOA 3G7DA 4QDQA 2DURA 1RXGA 1NE6A 3WNXA 1VAMA 2WA3A 3BU7A 5GLZA 2MEV2 2C26A 1GZTA 2XXZA 1JXNA 4EWDA 5A1FA 2V09A 4CCEA 2JDKA 3T2QA 2X29A 3I2OA 4LKFA 2VMIA 4GAZA 4M3CA 1PGL1 1SHWB 2FQPA 2QQJA 3SCFA 2GDFA 3ETQA 4UBGA 5FP4A 1Q8OA 2QCSB 1EV11 1ND2B 4KNCA 2QTWB 2P6CA 3OBTA 2RR12 2RJ2A 3W9AA 3ZR5A 4AE2A 4MV2A 4GWNA 1LR5A 5IT6A 1ZYBA 3E5QA 4ISRA 4KI5M 3T4HB 2A6ZA 2IXJA 2VL4A 1CVNA 3ENRA 2D44A 2WAAA 2AUYA 3GHNA 2IVIB 5A7NA 4B4RA 1BZWA 2GMMA 1PO11 2E9QA 4ZZ8A 1OXCA 4Q0UA 4RR3C 5F8PA 4CP1A 1ZZ6A 4PIZA 5C3OA 1QXPA 3QACA 4BQWA 2NZ9A 5T5PA 1YFXA 3MW4A 2ZGKA 5AFEA 2YU1A 2EIGA 2F17A 2VQTA 4Q4V2 3V64A 5JPMB 2DYCA 3CBNA 1H4HA 1PX3A 2WSVA 3IBMA 4G3YC 4PLNA 2BPA2 2JXAA 2W5FA 2SBAA 2ZTNA 3HOBA 5DAVA 1SBEA 1HQWA 5L36A 2Y38A 1R1A3 4UAPA 5DDJ3 3MBWA 3ZMOA 2RDQA 1AR71 1RUH2 1ZBE1 2WNVA 3L2YA 4Q4Y3 1DQ5A 4Y1VA 4E2QA 2JB8A 2PHTA 2VOKA 4XFCA 4Q5OA 1Q8QA 2A3YA 2WA4A 2YMZA 5C9AC 4YVWC 3MIHA 3CO2A 1X82A 3MICA 3M70A 2FZ1A 1APNA 1AL0G 2XVKA 2NN8A 1SLIA 5IWFA 2BJSA 1DGRA 2HBTA 4HT1T 1OPMA 1HB2A 1WBLA 2HWF2 4JAAA 1CWPA 4W6YA 1ALYA 2J1SA 1UOGA 1OKQA 2JB4A 3VDDC 3H8OA 1F15A 1UMZA 3SKVA 4CDUC 5FY7A 3SCGA 5FK7A 3USUB 5D8AA 1W6QA 3SISA 3AL6A 5CAZA 1CQ9A 1F4AA 4AI3A 1OQDA 3H8RA 4FFHA 1FNZA 1LGCA 3CKHA 4O9EA 1F31A 3MO4A 4NHYA 1IPKA 4XUOA 5EJ3A 3M3EA 5F3IA 3H50A 1NLQA 1E5SA 1JZ5A 3ZYPA 3QH6A 1R1ZA 5EIYB 1C5IA 5J7MA 3PVOA 1BCXA 4QPYA 1QJY1 3KCXA 1OT5A 2PAKA 3PJQA 1CAWB 1VBE3 2QQPA 3RZLA 3N7LA 1LNSA 3J4UH 1ONAA 2A6VA 1PO21 1ULDA 1MS9A 3MLJA 4QKBA 5L73A 5T5LA 1JZ4A 4JV4A 3VD3A 2DTWA 3SEEA 2OZJA 2W1SA 3UYJA 2R0FA 1K3IA 2ZAHA 4K20A 4B4PA 1D4VB 2YGMA 2TNFA 4ITCA 1DIWA 1QKQA 1S0JA 3OUJA 3TN93 1J59A 2WS92 4Z07A 1V6MA 1TNRA 5FPUA 4MYEA 2BZDA 4XZUG 3TBDA 5FAXA 1JTZX 3B3QE 4RHV1 2ATFA 1RJ7A 4ZY9A 2XBO2 1JYWA 2X5IB 4XF4A 4QXHA 1FYUA 2E26A 2WNOA 5FP3A 4ZPIA 4AVTA 4ES9A 5F1RA 2SLIA 1VBC2 3DF0A 2DBNA 4JGYC 2BWCA 1R1A1 1PX4A 3BU0A 5FCCA 1JYTA 3H3LA 4XIKA 4XJZA 4RR3A 3EQEA 1O4TA 3ZPOA 4D6QA 1Q8SA 5A3PA 5IVYA 4RFRB 1TME2 1JUHA 3F2ZA 3K4DA 1RL3A 1UYZA 2PHRA 2Y60A 4F8AA 2ZGUA 3USUA 3PTRB 1RHI3 3ZSMA 4CUCA 3NQHA 3ZIWA 5ACA3 2WWSA 5DDJ2 3TEWA 4NIDA 2AZ5A 1RITA 1OLRA 1MPXA 1YEWA 3P3NA 4H3WA 5HV0A 4G9SB 4CUBA 1QQP2 1U5XA 5A7WB 4XAAA 4PLMA 2XGXA 3AP4A 3ZFEC 1VBD2 4NIGA 4FPYA 4F7ZA 3NW4A 1R092 3I4IA 4EV0A 4QT6A 2GC0A 2WFF2 1N3OA 2DWRA 4JKKA 3FZ3A 1N1TA 4YVWA 1O3RA 4YPJA 2ZKLA 4B1MA 4NPRA 2VXRA 3M3IA 4O65A 5CG8A 3NMBA 1RUC1 1EAH1 3W5MA 4XJ9A 1YFWA 3LPGA 2ERFA 4FQZA 1O4YA 3ME2A 4LBNA 1US3A 4P08A 1YI9A 1AJOA 4K40A 3GCXA 4FAGA 4N9HA 3UKVA 2NP0A 2ORZA 2Y6HA 3IAPA 4ZZ5A 3BKZA 3N9LA 3LA2A 2VZSA 4I09A 4LK7A 5FYCA 3LEKA 1VAKA 5JI7A 3V0AA 5K0UB 3LSEA 2V73A 3T2PA 3OUHA 4MVTA 5FRAA 3ELNA 1G7YA 2RR11 5CFCB 3ZFFC 3B69A 5FMDA 4LO4B 1OPOA 4WVWA 5T5JA 3WHUA 4PQQA 4EN0A 1BEV2 4XXPA 5F2WA 2VZPA 4L0PA 2DUQA 3HN3A 4FTSA 1VBB3 1AR83 1QH6A 4EWEA 2AACA 1ASJ3 3OBAA 4IW3A 3WW2A 1DFQA 4IL7A 3OYWB 2UYBA 5BPXA 5IVBA 4G4FA 1MS5A 4E27A 4LUKA 2D5FA 3VZJA 3M8LA 1HDKA 1ZX5A 3LF7A 1HX6A 5F5AA 1ZBA2 1CAWA 3WG4A 5IAXA 5LRSA 2WAOA 5LBBA 3RYRA 3ZXEA 1URXA 4QB1A 4YG0A 2ARCA 4XFHA 2QBXA 3O1RA 4QX2A 3JXSA 3MEPA 2PXJA 5FLIA 2VBBA 4M0HA 3ZXAC 4E4DX 1UKGA 3B93A 4AZZA 4HXCA 5A7SA 3VBSC 2HBUA 1WD3A 5EPAA 5H9QA 2OA2A 4HLTA 4COWA 4RSUA 1SQ4A 4GWIA 4NIIA 4X6RB 1T2XA 1YUDA 3OGJA 2EIDA 3H1YA 2D6MA 1NKGA 3ZYGA 4Z1VA 3GZUC 3AZWA 2JJ6A 4CXYA 4OUEA 2AC1A 1GOHA 3RDIA 1JZ3A 4OI4A 4XQ4A 1ULOA 1F5FA 2E31A 3DKQA 1VRH3 4I0AA 4DXSA 3WX5A 2CL2A 4LO5B 3NNMA 1PIV2 4WM8C 2CTVA 1MS4A 2XLFA 5B4XA 3OOXA 2J1VA 1IZ3A 3AMQA 4C0HA 5JR2A 4ZU7A 2YC2A 3B5LB 4CCMA 4IQPA 3LOBA 4FAHA 4CDQB 1XE0A 2W08A 3CLPA 4BIOA 2ZCWA 1GMMA 4Y5TA 1CD3G 2ARAA 2ZGTA 4JDMA 3F95A 3B02A 4IV1A 2EA7A 4P9JA 3OEAA 5FZ8A 1TMF2 3QCWA 1ZRFA 4AYUA 5F7UA 1CPMA 1W9YA 3KZ4C 5AVPA 2D7FA 4CDWC 1RUG1 5CIRA 4JGZA 2C6SA 4LBJA 2JDHA 3V0BA 3RI8A 1AYM1 3IB3A 5A3OA 1XQNA 3KWVA 1CX4A 4YW4A 3VN4A 1W04A 4CDXC 4DUXA 2DVFA 4NUBA 5FMBA 4MO3M 3GZTB 1S0EA 4CEYC 4C8DA 1RUD3 5F9TA 2CWMA 2HYXA 2FDJA 2WS91 1JODA 2F6BA 1NA1B 2HH9A 2ZMLA 3MLLA 3C7EA 4FPJA 1ASJ1 5DQ0A 1W2TA 3AFGA 3VGIA 5CEHA 3W5NA 3ALQA 2XUEA 2I07B 4XW3A 3TAYA 5A3MA 2QDRA 1K12A 1DGWX 2VU9A 4AI9A 2BU9A 1R083 2VVDA 4PF5A 5A6XA 3WW3A 1FOD3 2JIJA 4PJYA 1WZXA 1GUIA 2VOVA 3KT4A 1GV9A 4QQLA 4UI9L 4YGBA 4U36A 3FX3A 3BTZA 2RDSA 1YLLA 3ZOIA 4K21A 4LT5A 2W92A 1AYM3 3AMPA 4C91A 2Q8EA 1RMU2 4MSVA 1RUE3 4CCDA 5F3CA 3MIFA 2GC1A 4EYUA 2FCTA 2W1WA 4L99A 3VBOB 3Q8BA 2Q1ZB 4QGLA 5K0UC 2YB7A 1W9TA 4B1LA 3P5BA 3RFRA 3EYPA 1WA6X 2L9LA 3HMYA 4AGRA 1J1TA 1S0BA 1V70A 4XAEA 5JLVA 2ZHKA 3NNFA 4FBFA 1CPNA 1W06A 4QX0A 1Y3TA 2G4IA 2R041 3VHNA 1NLSA 1BBT3 1R091 3MHZA 3FJSA 4ASKA 4MLOA 1O8PA 1C4RA 3VL9A 2J1EA 1L7QA 5JOZA 3JUUA 2XL9A 4HPKA 1TE1B 1HV0A 4Q0SA 1RUD2 2YGLA 4NWVA 2XHNA 3LB9A 5FLHA 4NPMA 2R1DA 3B01A 1H8TC 1DF0A 4IV3B 1CIYA 2N7GA 4QX5A 1OLME 4JKMA 5JCTA 3VHPA 4P9IA 3SEPA 4OZXA 3AZXA 4PBPA 2FD8A 3L9JT 4YM0A 1JYNA 2O14A 2Y8KA 1AL23 2VNGA 1PMJX 1GLHA 1RUOA 3POIA 1AX0A 4AEMA 1OLMA 1FMD1 1FI2A 1HKDA 1UXXX 4PDWA 3AJZA 4AF9A 1BBT1 2PHXA 2QKDA 2CGNA 3CJIC 2DCYA 1PGL2 3WT3A 5A1LA 3GYDA 1GBGA 4H14A 1Z0HA 2XOMA 4FOWA 5KHJA 1VLNA 3V65A 2GN3A 3H7YA 3J9SA 4E8CA 1S4CA 1HB4A 1V6LA 4NHKA 2P3IA 3RVHA 4J6GA 3ACGA 1C8M2 1SDWA 4DEVA 2W2IA 4P9GA 4N53C 5C70A 1ENQA 1I5PA 1IG3A 1W6NA 1ULCA 3PVNA 1MEC1 4AEDC 4LULA 1QDCA 4XOGA 5GLTA 4WZFA 3FUOA 2ZGLA 5FKCA 2FDIA 2AENA 5FY4A 3ZO0B 3O1PA 1SLCA 2YZ4A 1OA4A 1DBNA 2YUEA 2JD9A 3GZAA 5FOBB 1UY0A 3H9AA 5FJHA 1H2NA 5FZ4A 4I30A 4J1WA 2C4XA 3WEZA 3U07A 4M4RA 4R9BA 2ZGRA 4UFKA 1XC6A 4ES8A 3VHOA 3S57A 1AR72 4Q4V3 2QQKA 3AP7A 3OTFA 4XMIA 4XBQA 4IV3A 1FX5A 3IWZA 3E6BA 1H9WA 4UW6A 4FI9A 1Q8VA 2BOJA 1WLTA 1Q8PA 2IC1A 4MUVA 3OPWA 5DUXA 1GP6A 5FFOC 3TYJA 5F37A 5FY0A 4Y33A 3KV6A 3MF9A 2O0OA 3KV4A 2EXIA 5DUWA 1HRV2 5BNPA 4RQPA 1HJGA 1HRI1 4IESA 3CDZB 1AR62 2RS51 1YFYA 1XYOA 3PJYA 4COYA 3PU8A 2R043 3VKMA 3AFKA 4GH4C 5K7PA 5LY2A 4LBQB 4LHSA 1VRH2 4Q2FA 3TEXA 1HW5A 4UW3A 4W50A 5D1IA 2FCVA 2V72A 2RE9A 3LDKA 2JKXA 3WG2A 4LBQD 1UZWA 2ZA9A 3THTA 1YI7A 2GC3A 1DYOA 4PCRA 3ZIXA 3LE0A 5L7OA 5GALA 1YO8A 2Q0AA 4UBHA 4GWMA 3OGGA 2Y6JA 1HXS1 2P1BA 3OCPA 2XKPA 5FOJB 1YCIA 4UT5A 2HWE3 2JENA 4DFSA 3BALA 3U14A 1KS4A 3T30A 4K1YA 5A33A 3LEIA 2YDEA 4QX8A 2FDKA 4QQOA 3WF3A 1R64A 4AQ2A 3WNNA 4C0BA 1VR3A 1ZZBA 5HPOA 1YQCA 3JBG1 5A7WA 4BM8A 5A3UA 4Q4Y1 2B9UA 2QQOA 3HR9A 3ASIA 1VBD3 2P4EA 4GULA 4EQVA 5M0TA 3T1LA 4Q1PA 3EO6A 4EROA 2PA7A 3VD5A 4QXCA 1U5IA 2VZQA 2D98A 2R061 3R05A 1AR91 4FOYA 4XIOA 2DU1A 4DRRA 3VBFC 2OXBA 1HLCA 3AM2A 4CCOA 1UU5A 4CCJA 1HJFA 1L7RA 1YQ6A 2IXKA 1GZ9A 2VECA 1OC1A 2QQVA 2XBO1 1JBCA 2WWUA 5HCBA 4I3PA 4CSWA 4QD2A 5A80A 1EY2A 2A6WA 3OBRA 5J1XA 1VBA3 2ETEA 3OGRA 5BNOA 1GOGA 4J1XA 2RV9A 3PVEA 2B42B 2QE3A 4BQ1A 2UWCA 3IM0A 1KEXA 2DFCA 2IWGB 3CJIB 3NSTA 4Y5Z0 2O8OA 1DLLA 3O7OA 1UOBA 2VBPA 1SBFA 2JG8A 4V2WA 5E8AA 5FO7B 1GNHA 4MGSA 5FMCA 1JN2P 3NJYA 2WKKA 3DEMA 5DMYA 2WS93 4LBKA 2P6HA 3I3BA 1VBE1 1PO13 2IFRA 1CAVA 3LCPA 4JX0A 1LGNA 2BV4A 4HKOA 4AI1A 1RGSA 1FOD2 1RUH3 1WLWA 2E6VA 2V4AA 4W8JA 4DNYA 2CU5A 3CIHA 5KC5A 2A6YA 5FP9A 4MHUA 4CDXA 5FZKA 3LDBA 2WZR2 4H2AA 4EE2A 2AR6A 5JIAA 4OLLA 2A71A 4I3GA 3RZKA 3PURA 1DHKB 3VBUB 5J98B 2D97A 3HAGA 1UZZA 4A3ZA 4BE3A 4Q27A 5HI0A 4GD4A 2WT2A 2VZOA 5LEKA 3WR0A 4UXAA 1W99A 5FUPA 4A7KA 4S2GA 5ISLA 3ZSEA 3I2GA 5CNAA 4IDZA 1XSRA 1K5MC 1SLLA 2VUCA 1D4M2 2XHKA 2IXHA 1DP0A 3T1MA 2Q4SA 4OHXA 5FJKA 4AWDA 5FPXA 1W6QB 4WVMA 3WDXA 1CZVA 2BNOA 2J1RA 4XDQA 3T0BA 4CU6A 3KGLA 4LE3A 3IMMA 1W39A 3P6BA 4JRLA 5G05L 2C5DA 4OI2A 5B4NA 2HEVF 3O1TA 4HL0A 3U0ZA 1EUTA 3GBGA 3K75B 1B35C 4BK4A 2KXLA 1Z7S1 4AEDB 4BQYA 5GLVA 2DCZA 3WSOA 1Z78A 1UY1A 3PL0A 2FDHA 4IEZA 2CV6A 2PN5A 5ACA1 1QNWA 2VZ3A 3DPRC 3AX4A 4KGGA 4AGGA 3VZMA 2BUKA 4Q8LA 3VZLA 3QLQA 2HWC2 2WIIB 3Q8EA 4GB31 5F6KA 4BIFA 1W2NA 2YBSA 3C3VA 3N7JA 2Q8DA 1GKBA 1OI6A 1U5YA 3HQRA 3OD4A 1OVSA 4AQ6A 3E97A 1PMHX 3IDAA 3IPVB 3TNPB 3HD8B 1D0HA 1XNKA 3NRUA 5C8CA 3SXWA 2D43A 3UJOA 5A32A 4LE4A 1V9U3 3BODA 2VAUA 2VOXA 4HK9A 4LHNA 1W3VA 3H3ZA 2OIIA 4QKDA 4QXKA 5K8SA 1S55A 1W9WA 5F32A 5I8YA 1LEMA 5JXGA 4P9YA 3IN9A 1WLCA 1HRV1 2XVGA 1W28A 4CEWA 1DZTA 2A5ZA 2XJVA 2Q30A 2WLPA 1F2NA 4GMP0 5C71A 5CBLA 4Q4X1 5JIUA 5CFDC 1O3TA 2ZJCA 4CUAA 3RSJA 3C8XA 3FC0A 2GMEA 1B35B 2Z2SB 1IS3A 3WG1A 2VXJA 1XB9A 4LMFA 5A7OA 3KHCA 3LWCA 4TN7A 3LKJA 1LECA 4BPZA 1OOPC 1C8M3 4OFGA 3T08A 1PIV1 5JSOA 4TSVA 4NJ4A 4PDWC 2HWF3 1LTEA 2PLV3 2J7MA 3PDQA 1HXS2 3CJXA 1G9CA 1V9U1 2WNVC 1DZRA 2RVAA 2W52A 1SDDB 1XNCA 3H7JA 3OGVA 4L2NA 3RS6A 4COZA 1C1FA 2I2SA 3ATGA 5F5CA 4IGOA 1PZ9A 1O3SA 1MS1A 2PMWB 4L8QA 4K3UA 2VOTA 3PNAA 3QOPA 4XABA 3MDPA 1BQPA 3NV2A 2W0XA 2WBKA 2C9AA 4Q4Y2 5DUUA 4RS5B 1ACCA 5FZAA 2VM9A 3E5UA 2BP6A 1NUKA 1DYKA 4HVOA 4Q29A 5H9SA 1SPPB 1W6OB 3TNQA 4BXSV 2BVVA 1HN1A 4CEYA 4CZSA 1PVC2 4DOUA 4AVCA 5LA1A 1UF2C 4A42A 1EPZA 5EWSA 3WCSA 1NE4A 2YG0A 1UOFA 3MIEA 3ZN5A 1S2EA 3SITA 1I5ZA 2FHRA 2XVLA 4XDPA 2RS33 1S2BA 1X8MA 3AVSA 3C7FA 4S2FA 1VMJA 3ZN6A 2WT0A 2ZX4A 3WDWA 5JUVA 1AXZA 4LBOA 3A22A 2RS12 3ACLA 4QU2A 2W68A 4WVMB 4JTOA 3A21A 1K5MB 5TSWA 3UETA 4YARA 2TUNA 1TEIA 4XURA 1S0IA 2VCCA 1MS0A 4OMCA 1TME3 1OUXA 4BCUA 1ZREA 3N3HA 2XJPA 3R0RA 3ZPYA 5GLUA 4ZU5A 2XJSA 3I54A 3OUIA 4HKWA 1YQ2A 4LIUA 1Y7BA 5JZGB 1ZRCA 3NWKA 5C4WB 3CMGA 4PQ9A 5FIXA 2OQ7A 3C2UA 3S7EA 2HYKA 5JPNB 1RUE2 4GKYA 3NL1A 1A6CA 2VTXA 4H7LA 1GQPA 4GH4A 2HWB1 4QAWA 4Y3OA 5FZOA 4YYOA 3R6SA 2R042 4XJUA 4RS5C 2EXKA 2VUJA 4LR4A 1GR3A 4JHZA 1UNBA 5IVVA 4RQPC 1QHDA 3PUQA 4ONUA 3O12A 1REFA 3VDAA 5J96B 1LU1A 4FPGA 1OUSA 4FOVA 5HXMA 4TZDA 4IERA 3NKTA 2OX0A 1F9KA 1RUD1 3FHIB 4CDUB 4IV3C 3AZVA 2JG8B 4K8RB 2Z69A 1OQ1A 5L9BA 5IFTA 1ZA7A 2AGSA 5FZFA 2CSGA 1YIFA 4NRQA 1S0GA 3EMRA 5D2AA 2DCKA 4B8EA 5L7OB 3NAPB 1JYIA 2R7EB 4KG8A 4IEXA 1J1LA 2MNGA 1OKOA 2Z42A 3D3AA 4IV1C 4BLIA 1JYXA 1PM4A 1GQHA 5CB7A 1GZWA 3I49A 4XF3A 1IHMA 1CAXB 2PFWA 2VVFA 3MFCA 3E6DA 1J3PA 5LATA 5IVCA 2BRTA 1NG0A 1NYWA 4O61A 3H8XA 1BBT2 4FPOB 3I3EA 2RR13 4AAXA 4LKDA 1VBB2 4NMIA 4R9CA 2Q1MA 5JWPA 1PGSA 3EB7A 1ST8A 5F39A 4A41A 1WBFA 1LOAA 2AEZA 4B29A 1LRHA 5L19A 1UCXA 5FYTA 5JXIA 1SLTA 2ZHMA 3POSA 1QF3A 1NQJA 1QJX1 2OW4A 1RMU3 3POFA 4MHRA 3ZDVA 1MR5A 1IS5A 1JZ6A 1W90A 2HLEA 3WDVA 3ZYIB 4AQTA 1NQDA 4GQ7A 5FZ9A 4QPIB 2VTXJ 4YM1A 2PYTA 2NMOA 3ZXKA 5BNOC 3W20A 4LXLA 1NY71 4BXFA 1LHNA 1KFXL 5IVJA 2WL1A 1DU3D 1XNAA 2CDOA 4YFZA 4QPGC 1SLBA 5A6ZA 2YV8A 5I8TA 4YZ3A 4YZ4A 2ZABA 4HKLA 4JGYB 1NLRA 1PO23 3VKLA 3WQ0A 1G9FA 3NAPC 1H8TA 2ZX1A 1WCSA 5EXOA 3AL5A 4AR2A 1K45A 1D4M3 5FQ0A 5JMCA 4KG0A 2O8QA 2TBVA 5C33A 3GJAA 1QGLA 1M4WA 2ENRA 2LALA 4Y1UA 3PLQA 1AR73 2W91A 1AZDA 1TQ5A 3IDEA 3M3OA 1YJLA 4IE6A 4W6XA 3S5QA 2VQ0A 4NPLA 3AZYA 1MQTC 4LITA 2QDNA 3JQXA 1REDA 1CAXA 4PDWB 2ZOEB 2X53S 5LEJA 1VRH1 2QZ2A 3KGZA 4B7EA 2PELA 4PF1A 1W03A 4LUMA 3VKFC 1UN1A 1OD3A 3AB0A 3UKTA 2WO7A 3KT1A 1DDLA 3ABZA 2Y6GA 3ETPA 2GH8A 4RHV3 5FR3A 1IS4A 4QM8A 4X6QB 3J7NA 1LOCA 1BXHA 1XNTA 3BCWA 2YFZA 5FO9B 4NE9A 5T52A 5LY1A 4XFAA 5L9VA 1BVVA 5DZEA 4S2DA 4N9IA 4DUWA 5LCWL 5BUVA 2QZ3A 3W59A 3K3NA 1COV1 4IGPA 2OT7A 1S0CA 2WNUB 1EPWA 2A1XA 4QQPA 4TXWA 3UT0A 2FDFA 1LHWA 2B5HA 5FYHA 3UK9A 4CRQA 2D93A 1PVC1 1STMA 5FZHA 4GMP3 1RB8G 1GWMA 1HQLA 2JIGA 3KCCA 4PLOA 3NV1A 5BNPC 4CVUA 4UW5A 5F3GA 4H55A 3GGLA 5FTTC 2WZEA 4XF1A 4CEWC 4OYUA 2WWJA 2R062 1AR92 2UU8A 3T0DA 5FY5A 1UL9A 2BTVC 2DUPA 2Q8OA 5C3RA 1AL21 1DGLA 3LGRA 3WDYA 4CTEA 1K5MA 1H1IA 4XYXA 4PBOA 4LHKA 1X50A 1EAH3 1S1AA 2H6CA 1JZ7A 3BVCA 2ZGOA 3RMYA 3I2FA 3OPZA 2XLGA 4JKLA 5FZ6A 1C3HA 4QHZA 5FDBA 5IFPA 1DLCA 2DCTA 2XJUA 3TB0A 2QVSB 2W94A 1BEV3 2PHWA 1NCQA 4SBVA 4WM8A 4U2AA 3K48A 3CNAA 4YGDA 3AKPA 2VULA 4DO0A 2FCUA 3NO8A 4CCCA 1Y43B 2Y64A 1GU3A 5LASA 1H0BA 3CQOA 1W6MA 4JTNA 5KHHA 5JOXA 1PGW2 3HVDA 5E6HA 3ZYBA 2OQ6A 3U10A 4GJYA 4CCNA 4TLFA 2JD4A 4RS5A 2YBPA 4LHLA 1HB1A 4MXWA 4HN0A 1G8WA 5SV5A 3V0AB 4DY5A 1ULFA 2D3PA 2NQYA 3T4VA 1BMV2 4BMEA 3BTYA 2I74A 1XBFA 3MV01 3VBUC 1NOVA 1CN1A 5EHDA 5LA0A 3GDBA 1ENRA 4RD7A 3I2HA 3NJXA 2B8MA 4NO4A 4IV1B 2BBVA 1YC61 5KXDA 1SCRA 1V6KA 3SH4A 2R16A 1P8JA 1QJY3 3WW4A 2H6BA 5FZ7A 4UFLA 4UFHA 3KT7A 5J36A 5IVFA 3VV1A 2J1TA 1ULPA 5GM0A 2PAMA 4LJHA 1VALA 2W46A 4CXXA 1E5RA 3ZYJB 4EN9B 4BISA 4NOTA 1AHSA 1HRI3 2P37A 3LPFA 4AAPA 2F4LA 4YLZA 1PVC3 4CPBD 1NXD1 3OPTA 2DVBA 4QX7A 2GP3A 1DGWA 1DYPA 2VY0A 3WNOA 2VD7A 4R4ZA 4MGKE 2HWE2 2W1QA 4LO8A 4QB2A 1UYPA 2VPVA 2NPIA 4CE8A 1JU4A 2R071
chains in the Genus database with same CATH topology
2PAEA 4E2SA 1NCRB 4R4XA 3PMEA 4NWWA 1UU6A 1WGPA 2Q5TA 4NHMA 2E51A 4YGEA 1LESA 1VIWB 1MZ6A 2GNDA 2VUAA 2ZGMA 5C8CB 4FSJA 3WHTA 5C9AA 2AH2A 1PVXA 4GB32 3FBYA 3RRDA 4A7ZA 5KC6A 3FWEA 1FT9A 2H0VA 2JE7A 1AX1A 4QHBA 2F4PA 4LEJA 4Q0VA 3VZOA 4AEJA 2WQZC 1RUC2 1EAH2 3ZN4A 3AK0A 3M3CA 1BVP1 4H7MA 1WW5A 1L3JA 1S0FA 2CAVA 5CVRA 1KJRA 4HPKB 4NVPA 2RS53 1DQ6A 4Q4X2 3P3PA 1DQ4A 1R081 1POV1 2ZPXA 4YZ1A 1D2SA 3O0XA 5B2GB 1WW4A 2XWBB 4HSLA 3OD0A 1W6MB 1BJQA 1FNYA 1GNZA 5AC91 5GZEA 1H8TB 2C1FA 4M00A 4WVVA 4ISQA 2E7TA 1WUVA 2KM2A 4X8NA 1WW7A 1V6IA 5FMOL 3MZHA 1IOAA 4CZSA 3FBMA 4AFMA 1JHNA 4OULA 1J58A 2ZGSA 3ES1A 4FP2A 5E88A 1H2LA 1YFUA 1VBA2 3JBG3 4LBLA 2GH2A 1OA3A 4Z2WA 1POV3 3VBHC 3LA3A 3D8CA 4JQRA 2GU9A 4XBNA 5EFUA 1X8EA 4CEWB 2K0GA 1DQ2A 3JQWA 1HRV3 3CJIA 2NLRA 3AP5A 3KCYA 4B4QA 2MEV1 5CFCC 2H0BA 4FPCA 3A0KA 4WM7C 4Y22A 5FMOS 2RMU3 3VBHA 1QJU3 1LOFC 3H8UA 2OUHA 3HT1A 3MF6A 4I0WB 4OHXA 3W58A 2UWAA 2VQAA 2B45X 4JC1A 3WXPA 4B7KA 1A78A 3MI8A 3VUOA 4N43C 1E57A 3ZXLA 2Y26A 2WNUA 2XJRA 1EV12 4HVRA 2AREA 3BIWE 4K8FA 1PNGA 2VW2A 2HWF1 3PVBB 1SLAA 1DGRN 2VNRA 4V1PA 5JI9A 5EZWA 1Z7S3 2HJIA 3U4XA 1PO12 1PK6A 3AYCA 2UY9A 3R4SA 2G9GA 3KD4A 4Q1RA 4OUMA 1ULEA 2GNTA 4DINB 1RUE1 4MH0E 2JE9A 2RMU1 4AEDA 2HWB2 5BV6A 1TMF1 3ZFGC 2OPKA 3WDUA 1BMV1 4KU7A 4X8PA 1N3PA 2UWBA 3KQRA 1AYM2 1O4ZA 1RUF2 1OHFA 1KJLA 5GZDA 3VL8A 1PHMA 1WMEA 2D6KA 1FATA 1QH7A 1O7FA 1PZ7A 2V5YA 3HT2A 5EV7A 1XYNA 4FPFA 4AW7A 2O1QA 3MFAA 1Q5OA 3FLPA 1H1MA 5KXEA 4M3CE 4JCKA 5KHGA 4N43B 2IFWA 4R9DA 2ZGPA 4E4SA 4FT8A 4XXAA 2QFEA 1IKPA 2BNMA 4BWOA 3AYEA 1QOOA 1GANA 3GHMA 2ZMNA 1SMVA 3IMNA 5A3LA 3MYXA 4FP3A 1MQTA 4HETA 3U11A 1OMIA 4P9LA 2VVEA 4W65A 4KL1A 2HWC3 3FFZA 1QJU1 2CY6A 4CEYB 4AVVA 4EJRA 2XUMA 3G6JB 4PIXA 3Q9OA 1W6PA 1Q3EA 5GZFA 1XU1A 3VBFB 1XE7A 5K0UA 2DVAA 3WUCA 3APBA 2PLV2 4N43A 2WLQA 4JRAA 1FXZA 4URTA 3L2HA 3LAGA 3MW3A 1KITA 3ZFFA 1KD7A 4P9XA 1PM7A 2RS13 3DGTA 4WM7A 3OF1A 4Y22B 5HXVA 3VBHB 3ZSKA 4BYYA 3S0MA 1LKNA 2D40A 2P3KA 4IXLA 4XHBA 1UAIA 2X8KA 3N36A 3SLIA 4XFBA 1B35A 4MX3A 5DG1A 3RNSA 4Z92B 2RHPA 2A73B 3H1MA 1VBC1 3AKRA 2WJSA 3GALA 3CEWA 3ZXJA 3EJKA 4OHWA 4HBNA 1F8VA 2GZWA 5AC92 1A3KA 4GA9A 1TME1 4RA0A 1MS8A 1UX6A 1WMDA 1QJX3 2XH6A 5JDBA 1MS3A 1C8M1 5DDJ1 2EAKA 1NXMA 1XE8A 5KXBA 1G6NA 2B46X 2EALA 4GXLA 2OYZA 1QQP1 2R6QA 4YM2A 1ND3C 1QOTA 4XTPA 1VBA1 3VBSB 2GNMA 2WFF1 1UZYA 4XBLA 1QJZA 1ND2C 1ZRDA 4Q26A 3VDDA 2RJKA 4YM3A 1Q56A 4AXOA 4AG4A 1LOFA 1JUIA 1AR81 1H9PA 1QXRA 4AFAA 4BLJA 3H0OA 3B7MA 1BYHA 4WM8B 3V56A 1V6NA 1C28A 2ZHLA 3ZDSA 3LSDA 4AHXA 1AL22 1AYN2 1JYCA 2ES3A 3FUQA 4XQWA 1D0GA 2WQ4A 1AR61 1HIXA 1HRI2 1YHFA 2JICA 5T50A 5AC93 3CF6E 3ZXGA 4FPEA 4IETA 4YNIA 4AK3A 5C9AB 5FO8B 4META 5KHKA 2E7QA 4F3JA 1AJKA 4WBBA 3AMMA 2OZ6A 4I02A 3ZFGB 2B7YA 1C1LA 3ZYRA 3O5SA 1ZBA1 4D3WA 2EF6A 1X33A 1VBC3 2G9FA 4OI1A 3DUIA 5IK8A 4PIYA 4JGZB 1I3HA 3QH7A 5I91A 4N53B 5JSRA 4GB33 2XL7A 1RUH1 1HXS3 1ZBE2 2VOWA 2ZGNA 5FBZA 1GSLA 3BOWA 1LENA 1OSGA 1PK6B 5GKAC 4QPGA 4Q4W1 1H30A 4XFGA 3VBOC 3E6CC 4Y4YA 1QNYA 3S7IA 4Y1YA 2R32A 4YG6A 2DTYA 2VMHA 5E1RA 3THPA 4DS0A 3IPVA 3A0NA 2NYYA 2XB6C 4K1ZA 4ASMB 3VBRB 3ILRA 2XKOA 2CNAA 4DXZA 1OD5A 5DZGA 4KWJA 1N47A 4BOWA 4N7IA 1QXJA 3B00A 3RI9A 4HVQA 4QQ2A 1QJU2 5C6CA 4XEZA 1RMU1 5DUVA 1S2KA 2AYHA 4P14A 3RMXA 1YYNA 1RHI2 4NN0A 1RUC3 1UPIA 4HANA 1I1EA 3S30A 2WSUA 3AZZA 4EN8B 5HCFA 2A3WA 1PIV3 3ZSLA 4AVAA 1FOD1 1RUF3 1LB2A 1H8VA 4Y26A 3RYKA 2XWJB 1AXYA 3DKWA 4QPIA 3MPBA 1QY4A 2HKXA 1WCKA 2ZAAA 2Y0OA 2D6PA 3HN1A 1O5LA 2D6OX 1QWRA 3VBRC 3MLKA 1D4M1 3D4KA 2DVGA 4LBQA 5CFCA 2DUOA 3WP6A 1DQ0A 1SFYA 4KU8A 2CGPA 4AFCA 4QGNA 4CDXB 1AX2A 4ZKTB 1SBDA 3M1HA 4RQPB 3RWNA 2VNOA 3V0BB 3VBRA 3BPZA 3VBSA 1NA1C 2GALA 4YW5A 4HZFA 1Y9QA 2R073 3AYDA 3AJYA 1FV3A 2Y0IA 3I8TA 3K51A 4Q4X3 4ZU4A 5LK5A 3FLRA 1WA4A 1LHUA 2R063 1A8DA 1O91A 1QOSA 2OVUA 2CYFA 5ACA2 1BK1A 2R0HA 3OJBA 5FLJA 4AI2A 1J3RA 2JX9A 1V6OA 1MEC2 3RQ0A 4XF0A 2PHFA 2IXLA 4GKXA 4AI8A 4AHYA 1WLDA 4GMP1 1UIKA 4CP0A 4CP2A 1UKRA 2BGCA 4GH4B 4FOQA 3B94A 2ZX2A 4K9SA 4XPVA 3SCHA 4DRVA 1NZCA 1NCRA 1UU4A 4WM7B 2A6XA 4LO6B 3VHRA 2Z5WA 4MGIE 2VW0A 2E63A 1WW6A 3J26N 1AYN1 4RR3B 1FMD2 1G9DA 5HBAA 3TN92 2OUJA 5AFBA 1W2UA 1I6XA 1FPN3 3AXDA 3EXUA 2X5IA 4Q0QA 1JH5A 1RUG3 4NHLA 1ZZ9A 1W6PB 2RS52 3S6PA 4EN6B 4ATFA 4FQ4A 2WFF3 4CDWB 1N1YA 1BEV1 2DV9A 3OYWA 2DFBA 4RL7A 1LULA 1N1VA 3VKNA 4DY3A 2WZR3 3H3UA 4OVEA 4EWAA 1U0AA 4WZCA 1FV2A 5CFDA 2RMU2 4EN7B 2ET7A 1HQNA 2FBEA 3ZVXA 4A3XA 2P34A 4FTBA 1CGPA 4KWKA 4LNVA 3LZZA 1POV0 4P5HA 5LRRA 1ZA4A 3VDDB 3NKGA 4YRDA 2HWD2 3BB6A 3WOGA 2JDZA 1FAYA 1WCDJ 2R49A 1O5UA 3JBG2 5FQ0B 4YSFA 4Q4W2 4AVBA 2BQPA 3DL3A 3WLUA 4JGYA 2ZBJA 2BNNA 1LHVA 1UPSA 3CL1A 4BMBA 2ZHNA 5K9YA 4LA3A 4OI0A 2XJTA 3KB5A 3N7KA 4XJ8A 1GZCA 1TNFA 3FMGA 4M0NA 4YVSC 4COUA 3SH5A 2YHJA 2A75A 4DMIA 3JD72 5AVAA 2A3XA 5GLWA 4KBBA 4IEUA 1EV13 1AVBA 2GN7A 1W6NB 2RS31 1RHI1 2C0ZA 3AP9A 5J48A 1AR93 1PNFA 3MW2A 4HK8A 1CJPA 4IEWA 2DU0A 4MGZE 3B9IA 5A32B 1UIJA 4IEYA 1MZEA 1KDKA 2PHDA 3PHMA 4S2HA 1XXNA 3J8F1 1H1AA 2BFUL 1GZWB 5GZGA 5DG2A 3ZSJA 1FPN1 1FMD3 2TEPA 1ZBE3 2PLV1 1RC6A 5ABJC 1H2KA 2LTNA 3M3QA 2WZR1 2VGDA 4R8HA 3WP4A 4AHZA 2BEOA 4K7JA 4NR1A 3TOJA 4C1WA 4CDUA 5H9PA 4AI0A 2GMPA 4L97A 3JZVA 2XJQA 4IEOA 5C4WC 4N53A 3RJRA 5KBFA 3NJZA 3GBFA 3ZFEB 5KHIA 4IEPA 4OHYA 1LHOA 4FXGB 5BY5A 5KWRA 1UD1A 3FFQA 3J8F3 3IT8A 5CU1A 1RUJ2 4YFWA 3M2MA 3D0JA 3IIAA 4YGCA 5BNNA 4MXVA 5KXCA 1YNAA 1CR7A 3AKQA 3JCIA 1VBE2 4LA2A 1QMJA 1XYPA 4A7YA 5BNNB 2YROA 1A8MA 1V6JA 1C8NA 2HEWF 5JAXA 5JZGC 3URFA 3POWA 2WFPA 4XHXA 4CYDA 1J3QA 4OHZA 4E4ZA 4KQ7A 3ZFEA 1ZRRA 1O3QA 5I0SA 4ASLA 1ENSA 1XNBA 1ZZ8A 1LCLA 3RPQA 1LU2A 2EXJA 3TN91 2LUWA 4YW1A 1W6OA 3SNMA 3R4DB 2WNVB 2K9ZA 5I0RA 3EBRA 3WCRA 4YW2A 4XF9A 2D6NA 3UL2A 2VG9A 1MEC3 5HCAA 3KSCA 1IQAA 1AF9A 2WT1A 1Z7S2 1DG6A 2QUOA 2EAAA 1M06G 5I0UA 3INAA 5EYXA 3DPRA 1CESA 1SEFA 3E5XA 3JB8A 4XQDA 5BNNC 3GBWA 2R1BA 4K6BA 4E9KA 2XG3A 2R30A 4FVVA 4I2OA 4R52A 1V9U2 1SFNA 5C8WA 1QU0A 5FREA 1OFSA 1REEA 3GNEA 3HBZA 3NV4A 3NV3A 3POYA 1AYN3 1JW6A 4MZUA 3VLBB 1MACA 3B9CA 2GNBA 1COV2 3IKWA 4DB5A 4SLIA 3WVJA 1RUI2 4RGGA 4L11A 4LBMA 3HWJA 1LEDA 1LGBA 2ZX0A 1PK6C 3VZNA 4CDQC 3RZZA 3FLTA 2PQQA 4QPIC 1QDOA 1B09A 3M4FA 2E7AA 2W39A 2WC2A 5T5OA 4YVSB 3O0VA 4P9WA 4Q8KA 4A2UA 3BOPA 2D3SA 1VB4A 2A70A 3KMHA 4D94A 2YYOA 2NM1A 2ZACA 5JOWA 5DZFA 3ECQA 3ZN6B 1LOGA 1EP0A 1OLQA 1T6GC 4YW3A 5DXDA 4INDA 1LJ7A 2BWAA 4XTMA 1ZVFA 4D69A 1S0DA 3NVCA 1AUYA 1GQGA 4XFFA 3D82A 4AFBA 2D3RA 4LLOA 1N1SA 4XJAA 4DPNA 4TYSA 2JG8C 2I45A 1PZ8A 3WV6A 1XNDA 2MHFA 1MZFA 3JB4C 2FMYA 4QM9A 2BW8A 3ZFFC 5F1RA 3J8F2 4M01A 1PMIA 2IXIA 5T55A 1I9RA 1C5HA 1FPN2 2UURA 3MIBA 2ET1A 4XE9A 4Q4V1 3ILFA 4LO7A 4JDOA 3KLSA 4Q0PA 1RIRA 3RG0A 3WW1A 4HFSA 2FZ2A 1RTVA 4I0BA 4JDNA 4QQHA 2GC2A 1N3QA 1GYKA 3LOIA 5JR7B 1XU2A 3IDCB 3O0WA 4D7YA 2BVBA 3N4MA 2WNEA 3AXEA 3WDTA 4KGQA 5I93A 4YVWB 2UYAA 3WP3A 2MEV3 3ROUA 1JOJA 2HWD3 3ZXDA 2VH9A 3H1WA 5GJ6A 4HMZA 5I0TA 1CAVB 1RUJ1 4N90A 1CIWA 5T54A 4UW4A 2PHUA 3FE5A 5BXXA 3MGUA 1G9AA 1GICA 2P2KA 4L9BA 1YJKA 2HWE1 1VBB1 4QGMA 2K2SA 3ZFFB 1X36A 4LLFA 4I01A 4RFT0 2RM23 1BKZA 2VMGA 4RGAA 3JD73 3IDBB 1QJY2 2ZX3A 1ENXA 4MGYE 4R9AA 5BNQA 1W0OA 1ZZ7A 2ILMA 3VBFA 1YIPA 1CJDA 1RVF1 1VB2A 2LM3A 1IKQA 2HEYF 4AGVA 1HV1A 3WQ7A 5CFDB 1WD4A 3ST7A 1RINA 2ZZQA 4WVZA 5H9RA 4HN1A 4Y20A 2P17A 4ATEA 1ND2A 2B39A 4XMAA 1NCQB 2D6LX 1OOPB 3UKNA 4O9GA 3RYPA 5SV8A 3AYAA 2QJVA 4RHV2 4M3CB 2JKBA 1WMFA 4CDWA 2CWSA 4BH9A 5ABJA 4YG3A 4Z8BA 3QBQA 4ZXKA 4B3NA 1R082 1KXGA 2YXSA 3X29B 5C8CC 2XPJA 4BA6A 3D0SA 4C90A 1R1A2 2WNUC 1IPJA 3M7AA 1RVF3 1VP6A 3AKTA 4Y20B 5L7OC 4YZ5A 2RM22 1EYBA 5LK7B 1NA1A 4AHWA 3VBUA 2KA3A 4AFDA 1KS5A 1R093 2QNKA 1RUNA 5D8AB 1NY72 1ULGA 1MZ5A 2HWC1 2A7AA 2ARXA 3WQ1A 1RUJ3 5F6LB 5BYNA 1VBD1 1LOBA 2WINB 2ZZJA 1SCSA 2HWD1 4Y1XA 1TMF3 5JVVA 4YZ2A 3EHKA 2JG9C 1NCQC 1CONA 3WZ1A 5EYYA 3AP6A 1X7NA 4Z82A 4TWTA 5F5QA 3SH3A 3SHRA 2XBO3 5BNOB 3MIGA 3JU9A 4Q4W3 4Y1ZA 4D7SA 1ND3B 3ES4A 2D5HA 2YPJA 1W0PA 5IK4A 2EVXA 4LTAA 3JD71 4C1XA 1AXKA 3I59B 3WUDA 1COV3 2PTMA 2BYVE 3VKOA 5J37A 1YXWA 3CU7A 3WP5A 4AVSA 2NMNA 3VZKA 4XFIA 2RS32 3N7MA 4OHVA 4JVAA 1OFNA 4FCAA 1ZNPA 3ZXFA 2XLAA 5JZGA 3QD6A 2CAUA 5IK7A 2CGOA 3ILNA 4BZ4A 5JSPA 3TRSB 2EXHA 1RJ8A 2DF7A 1D2QA 2FMDA 3T2TA 5JOYA 3GF6A 4GIQA 3KS7A 1U12A 1KQRA 5A33B 4FO9A 5IUQA 3ZMNA 3AMHA 5ABJB 1RUF1 2JG9B 2ZS6B 2ZMKA 1KFUL 3RJ2X 3MPPG 4XZPA 2ARBA 4BHPA 1OOPA 4COVA 5FPZA 1VAVA 3LA7A 3HQXA 1U5ZA 1V00A 3OY8A 3WD5A 2JECA 4AVTA 1OA2A 2YC0A 4L92A 2ZKNA 1UW8A 1NCRC 4DQAA 4HSJA 1C57A 3WY6A 4F83A 1OQEA 4MXWB 4N7UA 2RS11 2DCJA 4OUSA 5T3NA 3PTYA 3D5OA 1MVQA 5CA6A 2PHLA 2HWB3 5BNPB 1IGOA 1VJ2A 4JGZC 4QMAA 1SACA 4IEQA 2MPFA 4BIFA 1RUI3 1AR63 5I8SA 1MVEA 2E53A 3I7DA 2P3JA 3OY8B 1YRZA 3AMNA 4AEKA 4FPHA 3NAPA 4GALA 4AQSA 1PGW1 5E16A 3I2DA 4QPGB 1CAUA 1KDMA 3AKSA 3TWIA 2R072 2JG9A 4FXKB 4FTEA 3PMSA 1LODA 1KRIA 3KM5A 1IS6A 1RUG2 3BTAA 3D6EA 1RVF2 1QQP3 2JEMA 1F5JA 3DV8A 1PO22 2UY8A 5IK5A 4FPKA 2IXCA 4IEVA 3UJQA 3DN7A 4ORFA 4XJWA 5CADA 4D7TA 1G9BA 3MIDA 1ASJ2 3DPRB 1H4GA 5E89A 2DVDA 5C4WA 3ZFGA 1H2MA 1G86A 5J3UA 3I59A 2Z79A 3HIFA 4WV8A 4XETA 2BFUS 1ZZCA 5J09A 4DZGA 1ND3A 1LOEA 3USSA 2RJLA 3WINE 2GSYA 4M3CF 2GAUA 4W6WA 4E2GA 2RM21 1ZM1A 4CDQA 1CAUB 3O14A 5GZCA 3N35A 1QJX2 2YY1A 5D8AC 2WZPP 3WG3A 1Q43A 4XILA 2ZGQA 1MQTB 1DZQA 2IZWA 3ZX7A 4KWLA 1XRUA 4KH9A 3A4UA 3R4UA 4FPLA 4Y24A 5CG9A 1ZBA3 1RUI1 2VW1A 1DQ1A 3UV9A 3SMHA 1YWKA 1AR82 1GFF2 4YVSA 2X5IC 3VBOA 3G7DA 2DURA 1NE6A 3WNXA 1VAMA 2WA3A 3BU7A 5GLZA 2MEV2 1JXNA 4EWDA 2V09A 2X29A 2VMIA 4M3CA 1PGL1 2FQPA 3SCFA 2GDFA 3ETQA 4UBGA 1Q8OA 2QCSB 1EV11 1ND2B 4KNCA 3OBTA 2RR12 3W9AA 4AE2A 4MV2A 4GWNA 1LR5A 5IT6A 1ZYBA 3E5QA 4ISRA 2A6ZA 2IXJA 1CVNA 3ENRA 2D44A 2AUYA 3GHNA 4B4RA 1BZWA 2GMMA 1PO11 2E9QA 4Q0UA 4RR3C 4CP1A 1ZZ6A 4PIZA 1QXPA 3QACA 2NZ9A 5T5PA 1YFXA 3MW4A 2ZGKA 5AFEA 2EIGA 4Q4V2 3V64A 5JPMB 2DYCA 4G3YC 1H4HA 3IBMA 2WSVA 4PLNA 2BPA2 2JXAA 2ZTNA 2SBAA 1SBEA 1HQWA 5L36A 2Y38A 1R1A3 5DDJ3 3ZMOA 2WNVA 1AR71 1RUH2 1ZBE1 3L2YA 4Q4Y3 4Y1VA 1DQ5A 4E2QA 2PHTA 2VOKA 4XFCA 1Q8QA 2A3YA 2WA4A 2YMZA 5C9AC 4YVWC 3MIHA 3CO2A 1X82A 3MICA 3M70A 2FZ1A 1APNA 1AL0G 2XVKA 2NN8A 1SLIA 1DGRA 4HT1T 1OPMA 1WBLA 2HWF2 4JAAA 4W6YA 1ALYA 1OKQA 3VDDC 1UMZA 4CDUC 3SCGA 3USUB 5D8AA 1W6QA 3SISA 5CAZA 1CQ9A 4AI3A 1OQDA 1FNZA 1LGCA 4O9EA 5EJ3A 1F31A 1IPKA 3M3EA 3H50A 3ZYPA 3QH6A 1R1ZA 1C5IA 5J7MA 3PVOA 1BCXA