1RUG2

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rug200
1F8VA 3ZXAC 4RFT0 3VBRA 2HWD3 5C8CC 1PVC2 1B35B 4QPIA 1HX6A 4PDWC 4IV1A 4AEDC 5CFCA 5ABJB 1AR73 1QJU3 5C9AB 1RUC2 5K0UC 1SMVA 4WM7C 4GB32 3TN92 5BNPC 3JBG2 1FOD2 1NCQC 3ZFGA 1VBC1 1OPOA 1VAKA 1RUE1 1AL22 2HWF1 3JD71 4Q4V2 2R061 1R092 1R1A1 1HRI2 4Z92B 1TME3 5BNNC 1BMV1 4YVWA 5BNOB 1VBA3 5D8AC 1PO23 1PIV1 1ND2C 1PVC3 2RS32 3VBOA 4Q4W1 4JGYA 5CFCB 1VBE1 1ZBE2 2BBVA 5L7OA 4GH4A 3ZFEC 4QPGC 1D4M2 1CD3G 2ZZQA 1BBT3 2MEV1 4GB33 3TN93 3ZFGB 3IDEA 1ND3C 1HXS1 1AYN1 2XBO1 1RUI2 4CDXC 2R042 4IV3C 1X36A 4RQPC 2ZAHA 4YVWB 3VBHC 1RUJ1 4RS5A 1EAH1 1K5MA 2RS33 1FMD2 3CJIA 5L7OB 4JGZA 1VBB1 5JZGC 1EV11 1PGL2 3ZFFC 1FPN1 1AYM1 1RMU1 4Q4Y2 2R072 1COV2 5C4WC 2X5IA 1VBD2 3JB4C 4CDWA 1QQP2 4CEYA 5AC91 2RS52 1RMU3 1M06G 1POV0 2HWB2 2HWE1 1VRH1 1PGW2 3VBSB 1R081 1VRH3 2WFF2 1OOPA 2RS12 2QQPA 3VBUA 4N53C 4WM8C 5A32A 4Q4Y3 2BFUS 2R073 1RUH2 1VB4A 1VBD3 4CDQC 4Q4X2 2WWSA 1NCRC 1QQP3 2RS53 1B35A 2WS91 5ACA1 5ABJA 4BCUA 1WCDJ 1HRV1 1RVF1 2WZR1 3NAPC 1VB2A 3J8F3 3LOBA 5FMOS 3JB8A 5C8CA 5CFDB 1POV1 3VBUB 4FTBA 2WFF3 2RS13 5A32B 1HQNA 1VBC2 1QJX1 2HWF2 1NA1C 1RUE2 1VBA2 1PO22 3DPRC 1RUH3 3JD72 3FBMA 1NY71 2RR11 5BNOA 1R1A2 4Q4X3 1NOVA 1QJX3 3VDDC 1AL0G 1PIV2 2RM21 4Q4W2 4RHV1 1VBE2 1BBT2 5BNNA 5C8CB 1Z7S1 5D8AA 1RUG1 1IHMA 4RR3C 2VQ0A 4PDWB 2MEV2 4AEDB 1AYN2 2XBO2 1VBC3 4QPIC 2HWF3 1RUE3 1QJY1 4WM7B 5BNPB 3JD73 2R063 1R1A3 3VBRC 1NCQB 1ND3A 1PIV3 1RHI1 1GFF2 4IV1C 3VBFC 4Q4W3 5BNNB 1VBE3 2GSYA 1QJZA 5D8AB 1F2NA 1ND2B 1ASJ1 1VBB2 1EV12 3VBHA 1FPN2 2PLV1 1RMU2 2MEV3 1HXS3 3ZFEB 1RUD1 4QPGB 1AYN3 1RUC1 2XBO3 5JZGA 1RUF1 5AC92 1ND3B 1FOD1 1C8M1 4EJRA 1DDLA 4CDXB 1AR61 3VBOC 3VBSA 4Q4V1 4JGYC 4Y5Z0 1RUJ3 2HWE2 1R091 4IV3B 1VRH2 1HRI1 2RMU1 1EAH3 5A33A 4RQPB 4CDUC 1AR91 1MEC1 4GH4C 1OHFA 1AR63 3VBHB 4LLFA 1R082 1PO11 1ZBA1 1VBB3 1EV13 2FZ1A 1FPN3 1ZBE1 1AYM3 4GMP0 5JZGB 1CJDA 3ZFFB 5AC93 4FSJA 3J8F2 5C4WB 2WS92 1BEV1 4RS5C 1RUI1 1H8TC 2Y26A 1K5MC 5A33B 2R041 1HRV2 1RVF2 2HWE3 4YVSC 1AR81 1NCRA 3CJIC 5CFDA 4JGZC 1V9U1 1TMF1 1R083 4CEWC 4N43C 2DF7A 2X5IC 3S6PA 1FMD1 1QJX2 4CDWC 4Y4YA 4CEYC 1RB8G 2RR12 5FOJB 4N53B 4WM8B 4SBVA 2HWC1 2WS93 1MQTC 4CDQB 5ACA3 2RM22 1HRV3 1NCRB 1RVF3 4GMP1 2WZR3 4PDWA 4AEDA 1RUG2 1OOPC 2HWB1 2BUKA 1POV3 3NAPB 2R062 5K0UA 5GKAC 4WM7A 5BNPA 1BMV2 1NCQA 1NG0A 1QJY2 5LK7B 4RR3A 5DDJ1 1B35C 2RR13 2IZWA 2HWD1 5ABJC 1NA1B 3DPRB 3M8LA 5C9AC 1RHI2 5DDJ3 1ND2A 2RM23 4RHV3 3VDDB 1AR71 1QJU1 1HXS2 1Z7S3 1ASJ2 1RUG3 4NWWA 3ZFEA 4QPGA 5K0UB 2PLV2 3VBFA 1RUD2 2XPJA 5BNOC 4RR3B 5J98B 1RUF2 1RUJ2 4CDXA 1QJY3 1EAH2 1TME1 1C8M2 5CFCC 4IV3A 1VBA1 4RQPA 1PO21 4QPIB 1AR62 1PVC1 2BPA2 2RMU2 1RHI3 3VBRB 1AR92 1MEC2 4NWVA 1X33A 1AYM2 3ZFGC 2BFUL 1PO12 1ZBA2 4IV1B 1ASJ3 3VBFB 1BBT1 4GB31 3TN91 4CDUA 2WLPA 3ZFFA 2PLV3 3JBG1 4YVWC 1RUD3 5C4WA 1AL21 1RUC3 4FTEA 1RUF3 3JBG3 1FOD3 1C8M3 1BEV2 5FMOL 5L7OC 1AL23 4Q4V3 2RS31 1R093 2RMU3 1AR82 1HRI3 1AR93 1MEC3 3VBOB 4JGYB 1V9U2 1H8TA 1TMF2 1PO13 1ZBA3 1C8NA 1D4M1 1E57A 4CDUB 4YVSA 4GH4B 1ZBE3 4N53A 4WM8A 1W39A 5ACA2 1D4M3 4CEWA 2GH8A 4N43A 4CDQA 2WZR2 2HWC2 3VBSC 1BEV3 2FZ2A 1RUI3 2R043 2ZTNA 1AR83 4RS5B 3NAPA 2TBVA 1H8TB 1K5MB 1MQTA 5J96B 1V9U3 1TMF3 4YVSB 1PGL1 3CJIB 1NY72 4JGZB 4Q4Y1 1A6CA 1FMD3 2R071 1COV1 1AUYA 4CEWB 1VBD1 3HAGA 1NA1A 4N43B 1QQP1 5DDJ2 2X5IB 3DPRA 2RS51 4FTSA 4RHV2 1COV3 2HWD2 4CDWB 2HWC3 4CEYB 1Z7S2 3VDDA 5CFDC 3VBUC 3J8F1 4GMP3 1AR72 1PGW1 1QJU2 1MQTB 2HWB3 5C9AA 2WFF1 2RS11 1OOPB 1RUH1 4Q4X1 1TME2
chains in the Genus database with same CATH superfamily
2VZUA 4B1LA 2DUQA 3ZXAC 1SHWB 2XL9A 3AP7A 4IUGA 1CR7A 3AC0A 3K2OA 5C8CC 4C1XA 1PVC2 2G9GA 2PXJA 4XMIA 5LBFA 1QOSA 1B35B 1MACA 2ENRA 2IXLA 1C3HA 3UGHA 3WDTA 4BQ4A 4WBBA 1PGSA 4AF9A 3N9QA 3M3QA 1XBFA 5CFCA 5ABJB 3N36A 4QDSA 2ZGKA 4AFCA 5C9AB 3BALA 3UETA 4L99A 1G9BA 2ZGOA 5K0UC 1STMA 3OPZA 2XB6C 4IE5A 4UW3A 4EQVA 1SBEA 1UY1A 1FOD2 3SISA 5LRRA 3ZFGA 2R0HA 4A42A 4A7YA 5GZGA 3E6CC 2VMHA 5I0RA 3JD71 2A3YA 1QH6A 4Q4V2 5EYXA 4D0QA 3V0AA 2AEZA 3BU7A 2K0GA 3BPSA 4LBLA 5FUNA 3UNPA 1OT5A 3Q8CA 3I2JA 2W1UA 1VBA3 3GJBA 1PO23 3GALA 3HR9A 3OJBA 1GQHA 1PIV1 1SG3A 1UPIA 2P17A 2W1WA 1LOAA 3AVSA 3LF7A 4XFGA 5EP9A 5LA1A 2D5FA 4IEVA 2F17A 3M3CA 1UN1A 4RGKA 1JI6A 2C24A 1SLTA 4BMEA 2XG3A 2BBVA 5FPUA 3MICA 3SITA 3PL0A 4BK4A 2JE8A 2WC2A 1HKDA 3T4VA 2WNUA 3H8XA 1JHNA 1K45A 2DDUA 2XHNA 2ZHKA 4OCTA 1C5HA 3ZYRA 2WA4A 2XLGA 1U5XA 4B7EA 1W2TA 1GWKA 4JZRA 2VZ3A 4JDOA 1QY4A 1Z0HA 5CKQA 3FBYA 2ADEA 2WR9A 3MV11 3FFQA 1ZRCA 1CX4A 5LBCA 5CG8A 3QCWA 3AXEA 3ZLIA 3FC0A 4AOCA 2VNVA 3VBHC 4KU7A 5C3RA 4OFGA 1JZ2A 4GULA 2VZ1A 3WCRA 1K5MA 3LEKA 1SQ4A 2RS33 1W6PA 4ASLA 4IERA 3CKHA 3DUIA 1OLQA 1UYZA 4TXWA 2OPWA 1LENA 4CA9A 1ZRDA 1VBB1 4UXAA 3CO2A 3PUSA 3N9NA 1XE8A 2ARBA 2ZA9A 2WABA 4LO5B 4BWOA 1G9CA 1RMU1 4KGGA 4Q4Y2 1UY2A 3SCGA 1COV2 3VD7A 1CAUA 3AMPA 2AENA 3ZOIA 5BY5A 5G04L 1ODMA 5AC91 3BTZA 1W6MA 2RS52 3RI9A 1IPSA 3KD4A 1ACCA 1W6QA 2VUAA 1POV0 3GM8A 4S2GA 2VW1A 1S1AA 4N90A 4AZZA 4CU7A 3BOPA 1UU5A 3ZYIB 2HWB2 2VTXA 4XDOA 4ASKA 2VXJA 5J1XA 4OI2A 5T5LA 4JKLA 3I49A 4XUNA 2D7FA 4V2WA 3RMXA 3D82A 4YZ3A 4R4ZA 4E4DX 2YY1A 4LKEA 2XKOA 4H55A 4K40A 3ROUA 4N53C 1OUSA 1OF4A 1FV3A 3BPZA 4B4PA 4R8HA 4XJAA 1ULGA 3Q8BA 1MS0A 1VAMA 3FL7A 5A32A 2R073 2FDHA 2RDRA 4V1PA 1GZCA 2WT0A 1VB4A 1VBD3 2VZRA 1CIWA 4Q4X2 2WWSA 3RZZA 1NCRC 3J7HA 2VMEA 5HBAA 1CAXB 4MZUA 1B35A 3PMEA 1RL3A 4G9SB 4A7ZA 4P9GA 1KDMA 4HOOA 3KS7A 1GWLA 4KWKA 5ABJA 1HRV1 1WMDA 5H9SA 1RVF1 4QT6A 4CYDA 2WZR1 4YM0A 1LB2A 2JECA 5KHIA 3J8F3 4YPJA 3QBQA 3OOXA 3VKLA 5FMOS 2EF6A 3ZDVA 3KM5A 2OA2A 4FPJA 4H14A 5C8CA 3APBA 1W8UA 1XRUA 1FAYA 1ZZ8A 1G8WA 2CGNA 4O61A 2G1MA 1SZBA 1GICA 1X9TA 4XJ8A 2WFF3 3CDZB 4EZ4A 3U11A 5KC5A 3V0BB 3D5OA 1HJGA 4JQRA 2LALA 5FZ8A 4NJ4A 4DEVA 4KI5M 3LIGA 3O1MA 1O3SA 3DPRC 4GWNA 3JD72 4I01A 5FY8A 5CADA 1NY71 2RR11 5DZEA 2ZGQA 3WINE 1OA2A 3O14A 5LA2A 4AQ2A 1ULDA 1H1IA 1RUOA 3KHBA 3POWA 3OGGA 1QJX3 3PTYA 5AFBA 1AL0G 3K4ZA 3WNLA 1DU3D 1PIV2 2JXAA 2UYAA 4CCKA 2VMIA 1KXGA 2HYXA 1Q8OA 4LO4B 1PK6B 1BBT2 1LOGA 2Y8KA 1LULA 1FATA 3S30A 4EYUA 1DQ1A 2BQPA 2BZDA 2XMLA 4YZ1A 4CRQA 1T6GC 3NNLA 2GN3A 1RUG1 1KJRA 4QX2A 2FD8A 4M00A 2VQ0A 1BKZA 2YPJA 3WNXA 1ENQA 5AVPA 4L2NA 4NE9A 1OQDA 2HKXA 1ZRRA 4JKMA 2P37A 5BNQA 1QJY1 5BNPB 3M7AA 1YFYA 2QBXA 5A6QA 1LESA 3JQWA 1FNYA 4LIVA 5F32A 1AJOA 5FO7B 3NKGA 2BERA 2EVXA 3WW2A 4D94A 5JSRA 3SKVA 1KGYA 4ZU7A 2DFBA 5JPNB 2RJLA 2WZ8A 4ZU5A 2RDNA 5FY5A 2GMMA 3VBFC 1J1TA 4OHXA 2YYOA 2YG0A 1JZ8A 3B93A 3OG2A 5D8AB 3MW2A 1F2NA 4M3CF 5FPZA 4NRQA 3RMYA 3VZJA 4AVSA 1VBB2 3VBHA 5ANNA 5L36A 1KRIA 1SPPB 2XLAA 2PLV1 2B9VA 1RMU2 3QLQA 3P1IA 4P9XA 2MEV3 2PHWA 2WFPA 2LTNA 3RI8A 4QX7A 1ZZCA 1RUC1 1WD3A 2FDIA 3ZSEA 5AC92 1O8SA 1ZNPA 2EA7A 1WKYA 2P3IA 3VLBB 4I0BA 2IVJA 3G6JB 2WDBA 1AX1A 5JMOA 2A5ZA 2JIGA 5DZFA 3LFMA 4CDXB 1DDLA 1EPWA 3DEMA 3ZXGA 4JGYC 1MS4A 1RUJ3 5A33A 3T0DA 1W8HA 3A4UA 4RQPB 1UKRA 1WW7A 1MEC1 2GC2A 1U5ZA 3WZ1A 4UYBA 4PHZA 4XEZA 4MXVA 1GZWB 4B4QA 1ALYA 4P9YA 4D6QA 1J58A 5JXJA 3MF9A 1UX7A 4QGNA 5TSWA 2FZ1A 3WP5A 3VHOA 3O1VA 1FPN3 4Q8LA 4LT5A 2ERFA 1V6NA 3L9JT 4XJ9A 3WDVA 3NNFA 5KXBA 1S55A 4Z07A 4IE0A 2VOTA 1CAXA 5DG2A 5H9QA 4CPBA 2A1XA 3NVCA 2QQIA 2BGOA 3DECA 4QX1A 5F5QA 5C4WB 1BEV1 4A41A 1RUI1 1OD5A 3FLTA 3AB0A 1H8TC 1HRV2 1NAEA 1RVF2 1SFPA 1UYYA 2KXLA 3BOWA 3ZMOA 1QNWA 3DKQA 5A3OA 1NCRA 3ST7A 4A7KA 4RGGA 3QH6A 1B09A 4TZDA 3IZOA 3V0BA 1R083 4CEWC 4QXBA 2VZOA 5JUVA 4N43C 2DF7A 1GP6A 2VM9A 1AXZA 2YB7A 2EXIA 2LRPA 3H3ZA 4QHOA 1RXFA 2PA7A 5KHKA 4KH9A 1YIPA 2JKXA 5ANQA 1WMXA 5I8SA 1XE7A 2DBIA 4DXTA 4AL9A 4YW6A 2VAUA 5FPXA 2RR12 1WCQA 4KBBA 1DZRA 3MUY1 3PVNA 4HKOA 4YG3A 1RC6A 5CKNA 3QD6A 4IE4A 4Q27A 2ZZJA 3NMBA 3OBZA 2HWC1 1PK6A 4MO3M 4XVHA 2WS93 2D43A 3RZLA 4JC1A 4GJZA 2VC9A 4IEOA 4DQAA 3POSA 4GMP1 4H7MA 4QQOA 1RJ7A 4JAAA 5T54A 4FT8A 5JVVA 3ETQA 3RJRA 4X8PA 4LBJA 1RUG2 5FY1A 2YHJA 1QJFA 3ZYPA 5E1RA 2ET1A 2R062 5EPAA 1UO9A 5BNPA 3WW4A 3ON7A 2JEMA 2RDSA 4FPFA 4LQRA 5A3MA 3K77A 4OI1A 5CA6A 1W3XA 1QJY2 4LKSA 4TSVA 3HPNA 4K7JA 5J09A 1UU6A 2ET7A 1OMIA 1LHWA 2BVBA 3J26N 5CAZA 3EJKA 3D6EA 1W2OA 1WCUA 5I91A 5F3CA 3M8LA 3LPGA 2XOMA 3OBAA 1H6XA 1K12A 5DDJ3 1I6XA 5IVVA 5LY2A 2OQ6A 3OUHA 4RHV3 1VLNA 1US2A 1T2XA 1UAIA 2DCKA 1GP5A 1SPPA 3T4HB 3ES4A 1JYXA 1HXS2 1J59A 4LHLA 1WW6A 3PUIA 4UBHA 4JV4A 4OHWA 2P3KA 3B01A 4YW1A 2PLV2 5FRAA 3VBFA 3LSDA 4AI9A 3ACGA 2DUOA 1DLLA 1YIFA 2PELA 2JG9B 4N9HA 3WW1A 1UWWA 3WP4A 1URXA 4PI2A 3HBKA 4BLIA 3KGLA 3FFZA 4FAHA 1NQJA 1R1ZA 4CDXA 4B1MA 1EAH2 1KJLA 1E5RA 1LAJA 2CWMA 5FZOB 4DOUA 1XE0A 2DVDA 2ZKLA 4W6WA 2QZ3A 4RQPA 3NNJA 4QPIB 1UD1A 4O9EA 1W0OA 1RYYA 2BGPA 4XQWA 2W2IA 3IDBB 2K46A 1RHI3 2VOWA 4Z8BA 2J42A 2VBPA 3VBRB 3MEPA 1MEC2 1GZWA 5GZEA 1AYM2 2A6XA 3KQRA 3I59B 4K20A 3WEZA 4IEQA 4XYXA 1LOEA 4IEPA 2JDPA 2EXKA 3H42B 4LO6B 1C5IA 2Z79A 2ZGMA 4A3ZA 4MLOA 3TN91 1JYTA 1GZTA 4ZS3A 4YVWC 5D2AA 4MV2A 5FYZA 5C4WA 4FTEA 5F6KA 4YFZA 4LOTA 1RUF3 3PTRB 2NMNA 1FOD3 2P6CA 1BEV2 1GOGA 2DV9A 1RIRA 4XHXA 4JCKA 3RZMA 4Q4V3 4QPYA 1H30A 4GZ9A 3R4UA 2FDFA 4EZHA 3A22A 4GA9A 3BUCA 2J22A 3JQXA 5JIUA 3OPWA 1JBCA 5FPVA 3FUOA 3AK0A 3E5UA 1DCSA 3ACFA 4AGGA 4CSWA 1H8TA 3WF2A 3PMSA 1Q43A 2UWCA 1ZBA3 3ZR6A 2FBEA 1C8NA 2D6PA 3O1PA 2W94A 2PHTA 3PVEA 3SQOA 2P34A 1DQ4A 1Y7BA 2XVGA 3MYXA 3LEMA 4KBZA 4D7TA 2GNDA 5L73A 4BPZA 4P9IA 1W39A 4J1WA 5C6CA 4CEWA 3ZYBA 5JI9A 2PFWA 4N43A 5CISA 4DO0A 2AREA 2HWC2 2XWJB 1VPHA 2Y6GA 3VBSC 2OUHA 1DQ6A 3L2HA 1H4GA 2FZ2A 4MYEA 3GGLA 4HVRA 4COWA 3KT7A 4Y1VA 1REFA 2QDRA 2QQOA 3B9IA 2ZTNA 3I3BA 1GYKA 3AMMA 4KL1A 5F3GA 4LKFA 4WZFA 5FO9B 3T09A 4DZGA 1XYOA 2Y6FA 5JOZA 4DINB 3LAGA 4XACA 5IFPA 2IXCA 5J96B 3LQCA 1V9U3 4PIXA 2VNRA 1G6NA 3POFA 4LK6A 3CJIB 3OYWB 1NLQA 4XHBA 1LOCA 2VUJA 4AI2A 4JGZB 4UFKA 3H1WA 3S5QA 3N7MA 1OKQA 3RG0A 1Y4WA 1UMHA 2B45X 4HK8A 5IAVA 2BNOA 2Y0OA 5CEHA 2X5IB 3VHRA 3V65A 3B69A 1LJ7A 3OBRA 1COV3 5JLVA 4CDWB 2W46A 1LRHA 3EBRA 2W95A 3ZXKA 3IAPA 1Z7S2 3FZ3A 1VE0A 2BVVA 2CU5A 5FP9A 4FO9A 2VE1A 3VBUC 5IUQA 1GBGA 1ODNA 1V6MA 5JOYA 3FMGA 3ZKUA 4IL7A 5E89A 5GALA 1UMIA 3WHTA 5L9BA 5DPNA 3T2TA 4BQ5A 2IXJA 2HWB3 1GNYA 2JG9A 2R6QA 1WLWA 3AKQA 2QVSB 4S2FA 2EIGA 5I0UA 5EIYB 2RS11 5EWSA 1QIQA 1UY4A 2FCVA 2VCMA 3NNMA 2WAAA 3T1MA 2PAEA 3W5MA 1OOPB 2XR4A 4BE3A 4P02B 1DLCA 1RUH1 4LJHA 1DIWA 5FZOA 2WT2A 4QPIA 3BIWE 1QKQA 1O8PA 1WD4A 2DVGA 2ZACA 2JWPA 3VDCA 3VBRA 2HWD3 3MPBA 2RJKA 4QX8A 3UL2A 5EXOA 3IIAA 3WCSA 1DYKA 4HZFA 3BYWA 2VQAA 2ZJCA 2TEPA 1BYHA 1LKNA 1ZA4A 3C2UA 4MGYE 3IT8A 2WO7A 5T55A 5ISLA 1HX6A 5IATA 4PDWC 4AEDC 3T1LA 3AM2A 4HSLA 1QJU3 4LHKA 1DG6A 3ZIXA 1NQDA 1S0GA 4XMAA 4Y20B 2ZEZA 2XJQA 4NOTA 3RDIA 3TN92 2VJXA 1XNBA 2DWRA 4AEJA 4LA3A 2X09A 3DCQA 4CU6A 1CZTA 1NCQC 5FZEA 5B4XA 2Q1ZB 4HT1T 3KV6A 1U5YA 1VBC1 1OPOA 1FV2A 1SBDA 1RUE1 2HWF1 4E4SA 4BLJA 3HN3A 4A2UA 1D7PM 4G3YC 2O1QA 1R092 2D97A 1R1A1 1HRI2 2GU9A 2JD4A 3OF1A 5BNNC 3UGFA 1BMV1 3I2OA 2VCAA 4YVWA 1N3OA 4OI4A 4UFJA 4AEKA 2PHLA 2UYBA 4I3PA 4NIIA 4Q4W1 5CFCB 1VBE1 3T2OA 2IXHA 3MW3A 2VY0A 3AMHA 4MXWA 4G4FA 4BA6A 4ZHNA 1S2KA 1UXXX 2OZJA 3I7DA 1F4AA 3DGTA 2LM3A 3GZTB 1BVP1 3MIGA 4LTAA 4RA0A 3UYJA 3ZFEC 4PF5A 1W05A 2E7TA 3ENRA 4IEWA 4EV0A 1BBT3 3HNBM 4GB33 4OMCA 3ZFGB 2JDZA 4Z82A 1ND3C 1OFSA 5A3NA 3LKJA 1GWMA 2AEYA 3C8XA 1LHUA 1JZ5A 4BZ4A 4CXYA 2I2SA 1ZM1A 1LTEA 3M4FA 4IV3C 1C1LA 1X36A 2DCZA 4CCJA 4LLOA 4BU2A 1WUVA 2ZAHA 1PZ9A 3TAYA 4UW5A 4EN0A 1JXNA 5DABA 3Q8EA 3D3AA 1GUIA 4E2GA 1SDWA 5IW0A 3Q9OA 2C4XA 5FY4A 3FHAA 4Y22B 1LOFC 1FMD2 3CJIA 2XUMA 3MI8A 3OYWA 5FZKA 1LECA 4JGZA 1CIYA 1IQDC 1GV9A 2D6LX 4DS0A 1EV11 5JZGC 3ZFFC 5IVYA 3A23A 4E27A 1W90A 1Q8QA 4OZXA 4CXWA 5DUUA 2E9QA 2B8MA 2X5IA 4XW3A 2JG8C 3AKTA 1RJ8A 1W0PA 3JB4C 2IFWA 4HK9A 5FDBA 4CDWA 4L11A 5FP4A 1DGWX 3LOIA 3WR0A 1UQXA 1RMU3 2YFZA 3DN7A 4PIYA 4BOWA 4EN8B 4LORA 4A4AA 2VG9A 2J1UA 1VRH1 5J3UA 1UOFA 4XDQA 5FK8A 3POJA 5FY9A 1A3KA 2V5YA 3O0WA 4OULA 5SV8A 3NL1A 5FKCA 2GNTA 2Q1FA 1MZEA 2PHDA 4FCAA 2XVKA 1OA3A 3ORJA 4IGQA 3IBMA 4HVOA 1GP4A 4AHXA 1HW5A 1OOPA 2RS12 4LHSA 3VBUA 2QQPA 1TQ5A 1KFXL 3RSJA 1R64A 5I0SA 3ABZA 1I9RA 2BFUS 2EICA 2MNGA 2JB8A 1RUH2 4LA2A 5A1LA 2E7AA 1D0GA 1V70A 4CDQC 1W6MB 5LZ6A 1MZ5A 2BP6A 2LROA 1QQP3 3D8CA 1W6QB 3IPVB 1QXPA 4R9CA 3WD5A 4XJWA 4R9BA 5ACA1 4P9JA 3H7YA 1WCDJ 5FXXA 4BCUA 2AYHA 4HN1A 2PHUA 3INAA 3NAPC 4BYYA 4CCEA 3CZJA 4Y20A 3FUQA 1LGCA 1UYPA 3U1XA 4Z2AA 5KHJA 4KWLA 4BH9A 1W8OA 3JB8A 1PNFA 3WNKA 3ILNA 1POV1 4BIFA 2E7QA 5A32B 3PUQA 1VBC2 3KCYA 4NHMA 2HWF2 1NA1C 1RUE2 1ST8A 3MUZ1 4CUBA 4GWJA 2BGCA 2WT1A 5DAVA 3FBMA 3O1UA 2ARAA 4EN9B 1HQLA 4ZS2A 1R1A2 2E51A 4MGIE 2ZGTA 3SMHA 1VR3A 2EXHA 4I02A 4LHNA 1NOVA 3VDDC 5FREA 5FAXA 2X05A 1OBNA 1X50A 1RINA 2GC0A 2ARXA 4LNVA 3KV4A 4BK5A 3QOPA 2RM21 3PNAA 4Q4W2 5C3OA 1VBE2 4MUVA 5FY0A 2ZKNA 4CP2A 5KXEA 5BNNA 5C8CB 2WYSA 4AFMA 2Q1MA 4QB1A 4DY3A 3S57A 4Y1YA 1OC1A 4RR3C 3M1HA 1S0JA 4QDRA 5IVCA 2JJ6A 2O14A 4FOQA 3X29B 4WVWA 2QQNA 2W3JA 4XF9A 2WSUA 4AG4A 2QCSB 5FLJA 1L7LA 3WG4A 3HNMA 5IK4A 5IT6A 1PZ8A 3AZYA 4YGBA 3O1TA 4TLFA 4XQDA 2HBTA 3RPQA 4IQPA 3WDUA 2VVDA 2R063 3TNPB 3CJXA 5BYNA 2DYCA 4GIQA 1ND3A 4R9DA 3WUDA 3VKMA 4WVVA 4AVAA 3IM0A 4Y22A 3JZVA 3AKRA 3ZO0B 3F95A 2VULA 3HVDA 4IV1C 4QB6A 5FYHA 4TN7A 1HB3A 2A6ZA 1QJZA 4NAOA 3U07A 5FIXA 2MPFA 3D0SA 3OBTA 3VUOA 4K1YA 3W9AA 1W2UA 5L9RA 2HBUA 4BQ2A 1EV12 4OMDA 3NV1A 2W5FA 3NNGA 2VL4A 2WZPP 1NE6A 1S2EA 2VUDA 4I3GA 2D6KA 1HXS3 2G9ZA 3GHMA 1AYN3 2QQVA 2XDVA 2Z5WA 2WN3A 2XBO3 3N9PA 3PIGA 4M3CE 1SEFA 4MGKE 5FZ9A 5JZGA 1WMEA 4FOWA 4QM8A 2RE9A 4XJUA 1DYOA 2ATFA 3ZSLA 2E6VA 3VBOC 2PAMA 4N7IA 1VRH2 3ACLA 4NMIA 1EAH3 2GC3A 4X6QB 4XFAA 2B5HA 3O12A 1JU3A 2ZAAA 1AR91 1OF3A 4CDUC 3ITQA 1XYPA 2W08A 4GH4C 2VZPA 3S7EA 5LEJA 4JRLA 3VBHB 3DXTA 5KXCA 4PI0A 1DFQA 4H3WA 4HBNA 2EALA 2XVLA 3POBA 1RUNA 4FFHA 1S4CA 1ZVFA 3M3OA 1ZBE1 1AYM3 1GMMA 4LO8A 2A71A 3U37A 2IVIB 1ULPA 3E1F1 1X8MA 3IPVA 4DPNA 4UAPA 5E88A 3GYDA 1CJDA 2Z4FA 5FOBB 2NPIA 4QX3A 1QWRA 5FYMA 4XXAA 3OUIA 2QQJA 1BVVA 3NJZA 4Y1UA 4YNIA 1H2MA 1W04A 2AC1A 3I3QA 2X29A 2B4KA 1KD7A 1YQ5A 2XKPA 4R4XA 4RS5C 5FKBA 4PCRA 3J7MA 5A33B 1NLSA 1IQAA 2CHHA 2R041 4FOVA 4S2DA 1XNCA 1VALA 3USSA 1UZ0A 2BWAA 2HWE3 4YVSC 5A6XA 5FZ4A 1JW6A 1NXMA 2D44A 3KLSA 3BIEA 1QGLA 3IIIA 1UMZA 4B29A 2VXRA 2OPKA 4YARA 1RTVA 1PVXA 2BOIA 2BTVC 5HI0A 2D6MA 5DUWA 4AVTA 1OLME 3FHQA 4WVMA 4Y1XA 4QX5A 2OS2A 5DZGA 2WNVC 4Y4YA 4CEYC 1KS5A 1WGPA 2A7AA 5F5CA 4N53B 5FV3A 1IKPA 2WO3A 2GMEA 3BTXA 3VHPA 2K9ZA 2XQRA 1KQRA 3R0RA 3VDAA 2LW8A 4DXZA 2OKXA 1CVNA 3I2HA 1MQTC 5FPBA 4AAPA 2VNOA 3WNPA 4NIGA 2KM2A 2P3YA 1NCRB 2RM22 4META 4DEQA 3H0OA 4W65A 2V4VA 4UT5A 4FP2A 4P9WA 3WNNA 3DKWA 1DZTA 1NKGA 2B39A 4XUPA 3THTA 1GOHA 1TG7A 1XB9A 1YRZA 2N7GA 2IXIA 2UY8A 4DB5A 1W8TA 5K0UA 3NWKA 4W8JA 4AE2A 3AZVA 2VZVA 1YLLA 4QXHA 2VTXJ 4CUGA 3LEIA 1HB4A 2XWBB 2AACA 4AQ6A 4AVBA 2C0ZA 4X6RB 4RR3A 1SLCA 2R30A 5KHHA 1UZVA 4I09A 1JOBA 1ULFA 5C5TA 3HBZA 5LW9A 3WT3A 3MDPA 2ZOEB 1S0EA 3DF0A 4UFMA 3ME2A 2VU9A 3DPRB 1JU4A 4QQPA 3E5XA 2YC4A 4MOAA 5E16A 3VZOA 2QQMA 3ZPOA 4E2SA 5AFEA 4YW5A 4OHVA 4HFSA 3W21A 1O3RA 2FDKA 3N7KA 4ARYA 1W06A 2VMGA 4YYOA 1W8NA 1Z7S3 2YV8A 5C3QA 2DBNA 4MGZE 1XOYA 4FFIA 1PNGA 4M4PA 1LR5A 1JUHA 2ZGPA 2CY6A 4XOGA 1JOJA 3WF4A 1X9PA 1Q8SA 1OH4A 2WBKA 3KGZA 4DUVA 5DMYA 5F3IA 5T50A 2JENA 3C7FA 3BN6A 4AAXA 1GR3A 2WRAA 1W3VA 3NV4A 2XPJA 1IOAA 5BNOC 4J6GA 4AI0A 2C9KA 2NYYA 2JDUA 2YROA 4IGPA 5FCCA 2K2SA 2WQZC 2Y6JA 2NQYA 2DVFA 4C1WA 4YFWA 3VD5A 1VBA1 1PO21 1KS4A 4K9SA 5IK7A 4MVTA 3I3MA 3MIBA 4AFDA 4IEZA 1CWPA 4UFIA 2ZEWA 4YGDA 5A6YA 1AR92 3D0JA 4YM3A 2PQSA 2WQ8A 2IC1A 3LIHA 2D3RA 3NQHA 2PMWB 1Z78A 1ASJ3 3VBFB 4FBFA 3T2QA 1MS8A 2AUYA 4LUMA 1V6LA 1VMHA 3ZM8A 4BQXA 5LY1A 4M3CB 4CDUA 1JS9A 2Y33A 4IE7A 2EIEA 3AP9A 3JBG1 3FJSA 4IW3A 4XTPA 4A44A 1CPNA 4N9IA 1FT9A 1RUD3 3O1SA 1VMFA 2DU1A 1EPZA 1QMJA 1YO8A 5FK7A 1V6OA 1F4HA 2NP0A 5FMOL 1C8M3 5FZDA 5FP8A 5FMCA 2QNKA 5L7OC 3HOBA 4ZZ8A 3T3YA 2ZEYA 1Y43B 1R093 2RS31 1HRI3 2RMU3 2BJSA 1XSRA 2HLEA 1O7FA 4LXLA 4LKDA 1UY0A 3A0KA 1IGOA 4NRPA 2CSGA 4QQHA 3TNQA 1JYIA 1O5UA 4FQ4A 4QB2A 4NAMA 3GDBA 4JGYB 4LBOA 1TVGA 1PO13 4QU2A 1O4TA 3OCPA 3VD9A 1SLLA 4YVSA 2CAUA 5ERLA 1UPSA 4GWIA 4N53A 3B00A 3USUB 1IS3A 5F2WA 2R16A 3CLPA 4FP3A 1AX2A 2GH8A 4GJYA 4LE4A 1WBLA 2W92A 2WZR2 3J9SA 4M0HA 4XCAA 2Q4SA 3PJQA 5FP7A 3AFGA 3T08A 1IPJA 2CDOA 5IVFA 3E5QA 4BM8A 3ZXLA 3KMHA 1V6KA 1IZ3A 1KFUL 4XFBA 1JMUB 4ATEA 1AR83 3PVOA 4FXGB 1YFUA 5D21A 1H8TB 1AX0A 4DIQA 1MQTA 3IB3A 3O5SA 4P08A 3GBFA 5C71A 4XJZA 1KDKA 1RITA 1TMF3 5A3LA 2ZGUA 1PGL1 1HIXA 2J1SA 4W6XA 1UY3A 1NY72 3OEAA 3ZVXA 1LHOA 2VVEA 2WWJA 4O65A 5FZ1A 1FMD3 2R071 5BXXA 2CTVA 1AUYA 3PHMA 1VBD1 2Q8EA 4CEWB 3DYPA 3EO6A 4N43B 2I07B 3DPRA 4NPLA 2ZHLA 4FTSA 1N1TA 3RWKX 2OQ7A 4S2HA 2WO2A 4XXPA 5EJ3A 2DVAA 3C7HA 2IWGB 2VUCA 4PLMA 2DCTA 3FN9A 3S7IA 5CFDC 4CUAA 2EXJA 3EXUA 2JDAA 3J8F1 5CVRA 3AXDA 2JDNA 3IWZA 4XBNA 1TE1B 1MS5A 2Q8DA 2RJ2A 5JSOA 4HPKA 4QXCA 1NZCA 3SEEA 1HN0A 2WFF1 3AVRA 2YGLA 1UXZA 3AKPA 1GANA 2YFUA 3RS6A 5EFUA 2R1DA 3ZYJB 4FFFA 4URTA 4E2QA 4JHTA 4TTGA 3GCXA 1YFWA 2WJSA 3GBWA 3LCPA 1KEXA 2FMDA 1YQ2A 2VZQA 2XH6A 3GZEA 4MX3A 4Y33A 3E6BA 5CU1A 1F8VA 3VL8A 3MBWA 3OGVA 4YZ2A 1IPKA 2A6VA 3FLPA 1W8ZA 1FNZA 4QX0A 4FI9A 1A8DA 2ZX0A 3K46A 5A7PA 3UESA 2CGPA 1AR73 3O7OA 1UF2C 4N8MA 3WV6A 4M3CA 1W2AX 5E6HA 2GP3A 2ZEXA 1W03A 1RUC2 2KD7A 2A73B 2OVUA 2XL7A 4RFRB 2WKKA 1A78A 4WM7C 3GZUC 3AJZA 3NSTA 4K3UA 3JBG2 4F8AA 2ZGRA 4U36A 1CAVA 1G86A 2W91A 4NHKA 3TEZA 3GCWA 4BQWA 2WZEA 2UWBA 3IDCB 2DUPA 5CKMA 3ZR5A 2OUJA 4E8DA 5FJKA 4EN7B 1TME3 3WY6A 3I97A 4WV8A 4E8CA 3GJAA 5HCHA 2W0XA 2ZHMA 5IWFA 4IDZA 1NUKA 3RYRA 1ND2C 1PVC3 2E32A 4LMFA 2RS32 3BKZA 4JGYA 3OD0A 4BMBA 2ARCA 3RZGA 4NVPA 3POYA 1WW4A 2JDMA 1WMFA 2Y34A 5LK5A 3S5AA 2F6BA 1BCXA 2P1BA 3GZAA 2PHXA 1OH3A 4QPGC 5L7OA 4FFGA 3MZHA 3FLRA 3K75B 3WX5A 3USUA 1CD3G 4FPYA 2L9LA 2MEV1 1V0AA 1PX3A 1DP0A 2J7MA 3NJXA 5A3WA 4QXKA 2ETEA 1UIKA 1DGRA 3RVHA 1RUI2 3V64A 4BQ3A 2EIBA 1UW8A 5T5JA 4TLGA 3DYMA 3MIHA 5JR7B 1O3QA 5JOXA 2BBAA 4D7SA 1H0BA 3W58A 1WLTA 2EIDA 3AP5A 4YVWB 4BIOA 2DTWA 5FBJA 2WIIB 3MFAA 2A75A 2W68A 3SH5A 1YI9A 1RUJ1 5F1RA 1G7YA 2VTFA 2QDNA 4F3JA 1D2QA 3U14A 2WN2A 4MXWB 1OLMA 3TRSB 2FCTA 1GZ9A 5FJHA 3H7JA 1GQGA 1US3A 4XFFA 4XFIA 4YW4A 3MO4A 4EE2A 1NYWA 5EHDA 5I0DA 1PGL2 3AKSA 1IS5A 2ZPXA 3B9CA 3TEXA 3VL9A 4HVQA 1FPN1 1WLDA 1E5IA 4E4ZA 1GU3A 2R072 2R0FA 5GLZA 4AGRA 3ELNA 1H1AA 1VBD2 1VP6A 5FMBA 1CONA 2V73A 4F83A 5AVAA 3AZWA 3WXPA 1X82A 1MPXA 2QE3A 4BDVB 3H8OA 1M06G 4QD2A 3VZLA 3E97A 1V6IA 1OKOA 4QGMA 2XJVA 1HB2A 1N47A 4O7XA 3WF1A 4XETA 1BK0A 5I93A 1W28A 3R4SA 5KWRA 4JVAA 3I4IA 4ISQA 3VKNA 3S0MA 3VBSB 3H8UA 1UNBA 1QH7A 4EWDA 5FYTA 1R081 2V72A 3ZSKA 1KITA 1VRH3 1DF0A 3KVAA 4PBPA 2WFF2 3THPA 4BXSV 3ZMNA 2WA3A 4YW2A 1WBFA 2JDYA 1FI2A 4L0PA 4WM8C 3H50A 3EB7A 1EY2A 4Q4Y3 3ZSMA 3T2PA 1H9PA 3ALQA 2V4AA 2QQKA 3FHIB 3BU0A 1S0BA 5LA9A 3OPTA 3TOJA 1UOBA 1W8WA 4H2AA 2RS53 3ZYHA 2P3JA 2WS91 1HV0A 4CXXA 2ZMNA 2CAVA 5IVBA 2FHRA 1EUUA 2ILMA 3CEWA 3MIDA 1LCLA 2D5HA 4H7LA 1NLRA 2RV9A 2D3SA 1UIJA 4ONUA 5SV5A 1YC61 2OYZA 4DY5A 3POEA 3AZZA 5DAWA 1ENSA 2Q8OA 1J83A 3LGRA 3VBUB 4COVA 4FTBA 2W87A 2B42B 5GLWA 3J4UH 1DGLA 2QQWA 3GHNA 2Z69A 2ZGLA 2YMZA 4QM9A 1PHMA 1JN2P 2ZABA 1S0IA 4HKWA 3UJQA 2C5DA 4DRRA 4AR2A 4MHUA 1H2NA 2V09A 1SFYA 4Q4X3 3RNSA 2OX0A 1MR5A 1HLCA 1XPWA 1CAWB 3KV5A 2HEWF 1OXCA 5DAXA 2GMPA 1A8MA 1QEXA 5FZ0A 3BGAA 2QZ2A 4RHV1 5FYCA 2WL1A 2YZ4A 3NV2A 4ZXEA 1SLBA 5FZMA 2GZWA 4YW3A 5GZFA 3IKWA 1O4YA 3N9MA 1H4HA 1UL9A 3IAQA 3LA7A 2YUEA 4UI9L 5HPOA 5FFOC 4Q0UA 1IHMA 1XNTA 2W1SA 1CPMA 1LGNA 1OFNA 2F4PA 3POGA 4XC9A 5T52A 5F9TA 4PDWB 2MEV2 5JOWA 4AEDB 2A70A 2YU2A 4CCCA 3UGGA 3PLQA 1MVQA 1RGSA 3L2YA 4QKNA 1O5LA 4YZ4A 3JD73 1J3QA 3RYPA 1PM7A 2RVAA 2O0OA 3SLIA 1NCQB 4V2VA 5FLHA 3HMYA 4OZOA 3K4AA 5FTTC 3IDAA 3I2IA 4XCBA 3QACA 1PIV3 1RHI1 2VNGA 3WDWA 1I5ZA 1U0AA 2YGMA 2RG4A 3KB5A 4FQZA 5BNNB 1QF3A 2HYKA 1VAVA 2JE9A 4KG8A 3I8TA 4GKXA 2BWCA 1REEA 5JI7A 3W5NA 4D6RA 1QHDA 2RDQA 1W6NB 2PHRA 2ZCWA 4HSJA 4R9AA 3WNMA 2UWAA 2VMDA 1FPN2 4P5HA 2QJVA 4Y5SA 3ZXDA 2YPDA 1H9WA 4QPWA 3SH3A 4AGVA 5M0TA 4LBNA 1V00A 2J1RA 3ZFEB 1EP0A 2VPVA 1ZYBA 1SCSA 2I74A 5EZWA 1RUF1 2R32A 1ND3B 4QKDA 1FOD1 3ETPA 4LO7A 4OLLA 4ZONA 5IYYA 5A3UA 4EJRA 3VD3A 3HD8B 2E26A 5GM0A 1AR61 1DGRN 2J1VA 3C3VA 4Q4V1 5DAPA 3VBSA 4Y5Z0 4URAA 4IV3B 2SLIA 3LZZA 1MZ6A 2DURA 3RQ0A 3ZSJA 1LGBA 1O6UA 4YW7A 4XDPA 3VN4A 1JUIA 5F2SA 1O3TA 5GLUA 1DGWA 4LLFA 1R082 1ZBA1 2D98A 2WNUC 5K8SA 1ULCA 1VBB3 1AF9A 4KG0A 5A7SA 5FR3A 5C3SA 1G9FA 5HV0A 4YGCA 1FYUA 1K3IA 3DYOA 1JYWA 2JKBA 3Q8FA 2VR4A 2B46X 5LRSA 5JZGB 3NW4A 3ZFFB 3SXWA 4XZPA 4JTNA 2V5DA 3I3EA 4KNCA 4B4RA 5AC93 3KF5A 4FSJA 1CESA 1DQ5A 2WS92 4A3XA 2JG8B 2Y26A 1K5MC 5FMDA 4XUQA 4FPOB 3PUAA 3I2GA 4DRVA 4OHYA 2D40A 3H9AA 4I0WB 1NT0A 1VIWB 3URFA 3N35A 4QQ2A 4OUMA 2BV4A 2XJPA 2Y60A 1FXZA 3D4KA 1V9U1 4DUWA 3WP3A 5A7WB 2Z2SB 1QU0A 2W9XA 1UOGA 5FZHA 5IK8A 4DNYA 1SLIA 3OGRA 1E5HA 1PMHX 1CAWA 1IG3A 5FZ6A 2YXSA 1HJFA 3AZXA 4Y24A 4QMAA 4SBVA 2GH2A 3MHZA 4JDNA 4XBLA 1Q8VA 1NX9A 1XSQA 5HCFA 5CBLA 4IEXA 4YZ5A 1FX5A 4CDQB 4CTEA 3K51A 1QJEA 1HRV3 3UK9A 5KR7A 1RVF3 1L7QA 5FP3A 1QXJA 1J3PA 2VGDA 1XNAA 1WWYA 2WZR3 3DXUA 4LUKA 3ACHA 1H1MA 3DL3A 4W4ZA 2ZGNA 4PDWA 2A6YA 4AEDA 2HWB1 3SC7X 4BQYA 2JDHA 1LEDA 1CJPA 3B7MA 3NAPB 4K1ZA 4C0BA 1X7NA 3R6SA 1MS1A 4WVMB 2Q5TA 3HQUA 1F9KA 1LHVA 1BMV2 1NCQA 3H1MA 1NG0A 1W9SA 1YUDA 3LFIA 1B35C 3UKVA 2RR13 4XF1A 5G05L 4CCLA 2HWD1 5ABJC 1NA1B 2PHFA 5JPMB 3LWCA 3C7EA 5C9AC 1J84A 1RHI2 4UW6A 5F5AA 4HONA 1L7RA 2PYTA 1W6NA 4AHZA 3CF6E 3VDDB 2VQUA 1QJU1 1DHKB 3OUJA 5C8WA 2WNEA 4NHXA 3P5BA 1OVPA 4K8RB 1LODA 4M01A 4CCMA 5BPXA 1RUG3 1DQ0A 2VECA 1GNZA 4LEJA 4NWWA 4QDQA 5I0TA 3WF3A 3ZFEA 5K0UB 3CZUA 1JZ6A 1JYVA 1XNDA 1SBFA 3EQEA 3WLUA 2C6SA 5FZ3A 3SKJE 3EMRA 4RR3B 4ZU4A 3THDA 1P8JA 1RUF2 1QJY3 4SLIA 1NXD1 5FZ7A 3AP6A 4IV3A 3O1RA 2CDPA 4RGAA 2WLQA 4D69A 1AR62 4XIOA 2VOVA 5H9RA 2BPA2 2A3WA 2ID4A 2ORZA 1YFXA 4AI8A 1F35A 2B9UA 1QNYA 2VO5A 3PDQA 5B4NA 3K4DA 5T3NA 3MF6A 2BFUL 4YM1A 1U5IA 2F4LA 2D93A 1ZBA2 1LOFA 1O91A 3LD8A 3LSEA 2FDJA 4IV1B 3U4SA 1BBT1 2Y64A 4GB31 2Y38A 3RGBA 2WLPA 3ZFFA 1YEWA 2PLV3 4TWTA 4AFAA 1H8VA 5C33A 5A3TA 3LDRA 2FDGA 2UURA 2P5BA 4ASMB 1BHGA 5I8TA 4RL7A 1LHNA 1AL21 1RUC3 4AHWA 2JG8A 4U2AA 5FZGA 2JICA 3CQOA 5DAQA 3AX4A 4IESA 4XF0A 1YQ6A 3SNMA 2BEOA 3JBG3 1YQCA 1UX6A 1W9YA 3K3OA 4XUOA 4HMZA 4GQ7A 3KV9A 3KCCA 4CP9B 1YCIA 5IAXA 4LITA 3WQ0A 5F39A 3P6BA 1SACA 1QXRA 4XF3A 1MEC3 2C9AA 2J1EA 3WVJA 5A7WA 1HB1A 1QDOA 4JQTA 3VBOB 1IG0A 3PVBB 1V9U2 2WYFA 3LA3A 4GKYA 1XQNA 3IMNA 4XAAA 1D4M1 4OQ8A 3PJYA 4CDUB 4COUA 1G9AA 4GH4B 3WG2A 4XE9A 1OUXA 5DN2A 4GALA 4LIUA 1UZZA 3HNYM 2XGXA 4FPGA 3F2ZA 4CU8A 4UOJA 4MGTA 2RHPA 2GALA 4OVEA 3FWEA 3ZIWA 5ACA2 2BU9A 2VVFA 4CDQA 1CZSA 3C7OA 4MG2A 5F5IA 1BLZA 1BZWA 1YNAA 1N3QA 5GLTA 1BEV3 4AI3A 1RUI3 1LNSA 5F8PA 1JH5A 3NJYA 1YHFA 2W1QA 2VCCA 4I30A 2GP5A 4JDMA 5DXDA 3ZX7A 5FXZA 3B5LB 1W9TA 4AK3A 2Y0IA 5J37A 4PQQA 4RS5B 1F5JA 3NAPA 1DQ2A 3KCXA 4A45A 4LBQD 5DUXA 5FQ0A 1YYNA 4YVSB 3TEWA 3VZNA 4NN0A 5LB6A 5KC6A 3PUHA 2QQLA 4MGSA 4AEMA 4Y3OA 3VKFC 3AYCA 2BYVE 4HXCA 1A6CA 2AH2A 1ZZ7A 2R1BA 4JKKA 4LBKA 4QU1A 3VKOA 3VZKA 1NA1A 4FPKA 1QQP1 4PF1A 4Q5OA 3J7NA 3UJOA 3U78A 4CCDA 2X10A 3WDXA 3A0NA 3HT2A 2HWD2 5I8YA 1O59A 2JE7A 3HT1A 2HWC3 2WNVB 4CEYB 1APNA 5IHRA 3SHRA 4P00B 1W99A 3VDDA 4K6BA 3I3DA 2GC1A 3ZN5A 3ZYFA 1TZOA 1UZYA 5K9YA 5APAA 2YBPA 2ZBJA 4GMP3 5HCBA 4D7YA 4AQTA 1PGW1 2OZ6A 1QJU2 4CUCA 1MQTB 4IETA 3ECQA 5C70A 3RRDA 3WP6A 5JR2A 5C9AA 1C1FA 4ORFA 3W20A 5FZFA 1LU1A 2KA3A 2VBBA 4ISRA 2O8OA 4PQ9A 2ZS6B 3I2KA 2WSVA 3RFRA 3P3PA 3THCA 4AVCA 1O4ZA 3LB9A 1QOOA 5EQUA 3B3QE 3N4MA 4AQSA 1PK6C 2HH9A 2ES3A 3FX3A 4RFT0 1C28A 1W6OB 2ZXQA 1CGPA 3HEIA 1M4WA 3MV01 5EJZB 5HXVA 3WQBA 3LE0A 4E9KA 5IVEA 4IV1A 1OURA 5CZKA 4AFBA 2ZX3A 1W8FA 1N1YA 4HPKB 3T30A 5FZCA 5FPAA 4NUBA 4MSVA 1XC6A 2ZX1A 1SMVA 3AFKA 4GB32 4QWNA 5BNPC 5CYYA 3ZYGA 1Y9MA 1BXHA 2WQ4A 2XONA 1YQ8A 2NZ9A 4ZY9A 1MZFA 2JB4A 1VAKA 1AL22 4XF4A 1VJ2A 3WQ7A 5JXHA 1PMIA 1S0CA 4C91A 2R061 4Y1ZA 4Z1VA 5IJRA 4Q26A 4Z92B 4XTMA 3H8RA 4CP9A 3R05A 1I5PA 3WG1A 2CGOA 2IUWA 5BNOB 3G7DA 5D8AC 5T5PA 5FYUA 3MIEA 3PU8A 3VBOA 5LA0A 2H6CA 3BCWA 3GF6A 4LOSA 4NR1A 4NHLA 4PJYA 4ZKTB 1ZBE2 3PU3A 1ENXA 4GH4A 2Y6KA 5D1IA 1D4M2 3EYPA 5BV6A 4NIDA 2ZZQA 5EJ1B 3TN93 4QHBA 1D0HA 1CAVB 1YJKA 3IDEA 4Q1RA 1HXS1 3GBGA 5FYIA 5GZCA 5FYBA 1AYN1 1GNHA 1ZZ6A 1OA4A 3PIJA 2XBO1 4CCOA 4CDXC 2YBSA 4ES9A 2DCJA 4F7ZA 2R042 2CNAA 2ZX2A 3U10A 3JXSA 3KHCA 1K42A 4RQPC 1JYNA 2GNBA 5J36A 2VD7A 3VZMA 3VV1A 1ULEA 4RS5A 1EAH1 3WG3A 4N7UA 1LOBA 5FYSA 4YRDA 2UU8A 4UFLA 4QGLA 4IGOA 1AVBA 3OTFA 5L7OB 4NPMA 4B3NA 5CB7A 4IEYA 1L3JA 5FYVA 1ZRFA 2CV6A 1JZ4A 2G4IA 1AYM1 5EYYA 3I2DA 4KWUA 3WF0A 1Y9QA 5T5OA 4CP0A 5C4WC 3RZHA 4E4HA 5FZLA 1YWKA 2IXKA 3WDYA 1H6YA 1QQP2 5FXVA 2WNVA 3N7JA 4CEYA 5LBEA 1UOJA 3KF3A 2DU0A 2WINB 3KZ4C 3FE5A 4Q0PA 2VOXA 3TWIA 3I2FA 4DUXA 2GN7A 1PX4A 1HDKA 1W9FA 3IN9A 4C90A 2HWE1 1GLHA 5CNAA 4MH0E 5EV7A 4OYUA 4EWAA 4FVVA 1PGW2 2I45A 2XQXA 4LPLA 3U0ZA 3ASIA 2R7EB 1J1LA 1JZ7A 5LEKA 2IFRA 1QDCA 1DZQA 1W2NA 3GXUA 2WWUA 4PT6A 2B7YA 5FZAA 3WUCA 2J1TA 4JTOA 5FZIA 2VZSA 1Q3EA 4QQLA 1AZDA 1CQ9A 1W6OA 3K48A 1WA6X 1AHSA 2NMOA 2DVBA 2E53A 3ACIA 3W59A 4GWMA 5FLIA 2VZTA 2SBAA 3CBNA 1H2LA 4CVUA 3OEBA 2FMYA 2E31A 3AYAA 3M2MA 1AXKA 2VW2A 3AL5A 3NJVA 4JRAA 3CL1A 3MW4A 3ZXEA 1VB2A 3LOBA 1WA4A 1BJQA 4K21A 3OY8B 1OSGA 3POIA 3HJRA 5FYYA 3ZN6B 4DMIA 4XFHA 4XUTA 5CFDB 3KQ4B 2YU1A 1OQEA 3N9OA 2VCBA 3N9LA 4GXLA 2RS13 4NRMA 2GDFA 3SEPA 1D2SA 1HQNA 4D8MA 1QJX1 1Q5OA 2H0BA 1VBA2 1SDDB 1PO22 3HQXA 1MS3A 1RUH3 4Q1PA 1TEIA 2VBDA 4QAWA 1UYXA 4L97A 4Y5TA 4D6SA 2JX9A 5BNOA 3C7GA 5J7MA 3U75A 3OB8A 3NKTA 3KT4A 2XJRA 2ZX4A 4HL0A 5H9PA 5FO8B 2JD9A 1YJLA 2R49A 3JUUA 4XABA 4XURA 3BVCA 3NRUA 3DV8A 1TNRA 3SCFA 3AL6A 4HKLA 5C3PA 4Q0QA 4P5YA 5GZDA 4YM2A 3ZN4A 3KT1A 4FPCA 2JG9C 1Z7S1 2W39A 2DTYA 2QQUA 5D8AA 4YG6A 1NE4A 2A6WA 4IE6A 3MGUA 4MHRA 3U4XA 2P6HA 1J3RA 4CCNA 2BDRA 4XZUG 5FPLA 2VQTA 3WNOA 5B2GB 4FPEA 4AXOA 3H3UA 1AYN2 1ZZ9A 2WO1A 2BOJA 1VMJA 2XBO2 1H2KA 2UY9A 4PLNA 2QFEA 1VBC3 4QPIC 1QOTA 1RUE3 2HWF3 4WM7B 3AYEA 1I3HA 2G19A 4COZA 3TEYA 3CMGA 1R1A3 3VBRC 2H6BA 5FZBA 5FUIA 1S2BA 4YG0A 3H1YA 4KU8A 1HQWA 4BISA 2W52A 1D4VB 2D3PA 4GAZA 4BHPA 1GFF2 1N1SA 4COYA 3NV3A 4Q4W3 1VBE3 2GSYA 4TYSA 1TNFA 1XU2A 4OQ9A 1E5SA 1XXNA 1ND2B 4NIAA 1ASJ1 1JYCA 1CZVA 4PLOA 5KBFA 1OVSA 1ZX5A 5A1FA 3EHKA 1EUTA 4Q0SA 3BTYA 3OSDA 4RN5A 1T6BX 2QKDA 3M3IA 3MPPG 5A1AA 2VMCA 1RUD1 4QPGB 4CPBD 2EAAA 4UFHA 3WOGA 4DXRA 2PN5A 4IXLA 1C8M1 3MLKA 2BRTA 3T0AA 3AMNA 4NO4A 1POQA 2AZ5A 4W50A 1GOFA 2YC2A 2HWE2 4UBGA 1R091 3CIHA 3R4DB 1HRI1 1LU2A 1N1VA 1ZZBA 2RMU1 3N3HA 5A80A 5F37A 3OGSA 3VDBA 2FQPA 2J1AA 2LS6A 4DXSA 3UT0A 1OHFA 1AR63 3KVBA 4K8FA 1PO11 1PMJX 2TNFA 4BJ0A 4XQ4A 3B02A 1UZWA 1EV13 1OLRA 2FCUA 2WAOA 1JZ3A 1MVEA 2CYFA 5FWJA 1WCSA 4X8NA 3M3EA 2X8KA 4GMP0 4OUSA 3E6DA 4PBOA 2ORXA 1PM4A 4C8DA 3WQ1A 5GLVA 1SFNA 1UKGA 5JDBA 4IEUA 1JODA 4UF0B 2NM1A 3J8F2 3N7LA 4M4RA 4A6OA 1WW5A 1SLAA 4J25A 1W9WA 2XJUA 4LK7A 4WZCA 5A7QA 3VD4A 5BUVA 3OY8A 1Q56A 1PZ7A 4AWDA 2XJSA 3ZN6A 5L9VA 1AR81 1RXGA 3CJIC 5CFDA 5JSPA 4AYUA 2OXBA 3UKTA 4JGZC 2AGSA 3ILRA 1XNKA 3OGJA 1TMF1 2W47A 4P14A 4ZXKA 2ADDA 3OD4A 2X5IC 2D6NA 3S6PA 1FMD1 1BQPA 5LCWL 1QJX2 3VHNA 2XLFA 4CDWC 4CU9A 5A6ZA 4OUEA 1RB8G 2XUEA 5DQ0A 4HLTA 4RD7A 3ZXJA 5FOJB 1X8EA 4WM8B 4XPVA 1JHJA 4AW7A 2XXZA 4BXFA 4MGQA 3CU7A 5ACA3 5DG1A 1UCXA 5A3PA 3CNAA 2VOKA 1F15A 2YDEA 2QTWB 1V6JA 2WNOA 3CHXA 4W6YA 3TB0A 2YC0A 1OOPC 3RYKA 2BUKA 1JOPA 1NZIA 1POV3 5LWBA 3M70A 3Q8AA 2ZMKA 3MLJA 4HANA 4C0HA 5GKAC 1OI6A 4WM7A 1ZA7A 2VW0A 4Q29A 4GD4A 4Q8KA 3HIFA 1ZRIA 4LR4A 1C57A 4Q2FA 4ZZ5A 4WVZA 3AJYA 3IMMA 3ES1A 5JWPA 2XJTA 2Y6LA 1Q8PA 4CZSA 2GNMA 5LK7B 1OPMA 4NHYA 5DDJ1 4OHZA 5FXWA 3ZXFA 5J48A 2XHKA 2IZWA 4OI0A 2MHFA 5F6LB 1ENRA 5E8AA 5LASA 3K3NA 3LA2A 4O9GA 3MLLA 5GJ6A 4PIZA 3TYJA 5F7UA 1ND2A 2RM23 5FY7A 3UV9A 4NIHA 1AR71 1ULOA 5JAXA 3VGIA 2CL2A 3LEGA 1GKBA 3NO8A 4HN0A 2ZGSA 1ASJ2 3I59A 4FPHA 3MFCA 3KSCA 5IVJA 4CE8A 1ZREA 1WLCA 4QPGA 3PURA 4CP1A 5IK5A 4DFSA 2NN8A 3H3LA 1A34A 4LBQB 4UW4A 4AHYA 1REDA 1GQPA 3LPFA 4XIKA 3SH4A 1RUD2 3AMQA 4JHZA 4RYDA 2X53S 5J98B 5K7PA 1RUJ2 4R52A 4ES8A 3V56A 1TME1 1C8M2 4RSUA 4QKFA 3LDKA 5CFCC 3BI3A 4D3WA 2Q0AA 5IFTA 3WHUA 3MIFA 4ZPIA 1DYPA 3RZJA 1SCRA 1PVC1 2BNNA 2EAKA 2AR6A 2VH9A 4YLZA 2RMU2 2DFCA 1MS9A 2C26A 1VRBA 3WW3A 1DBNA 1XYNA 3A21A 1AJKA 3BB6A 4NWVA 1X33A 4HETA 3ZFGC 5FBZA 4AI1A 4B8EA 3HN1A 2HEYF 2Z42A 4ET7A 1GSLA 1PO12 4UWDA 5CIRA 5KHGA 4Y4RA 4YGEA 3RWNA 4ATFA 1YXWA 1Y3TA 4L8QA 4KMQA 4XBQA 2PTMA 4MADA 2WUHA 4BQ1A 4UF0A 3AYDA 2VMFA 5HXMA 2C1FA 3I54A 3KWVA 4J1XA 2KR2A 4KGQA 2HJIA 4L92A 5F3EA 2Y6HA 3V0AB 1XJAA 4LULA 3P3NA 1AL23 3ZKYA 2GAUA 5A7OA 4LBMA 1BK1A 2DCYA 2BW8A 2OW4A 1AR82 1S0FA 1S0DA 1XU1A 5DUVA 4A6SA 1WZXA 4EROA 1YI7A 1AR93 1EYBA 4YSFA 3O0VA 5HCAA 1HV1A 4QHZA 5C5UA 3HQRA 1TMF2 2E33A 1F31A 1E57A 3SCHA 3O1OA 1ZBE3 4WM8A 2NLRA 4NROA 3ZDSA 2WNUB 4L9BA 1I1EA 1D4M3 3JU9A 3JCIA 2A3XA 2JIJA 5JIAA 1AXYA 2G9FA 3ZPYA 2CWSA 5HV4A 5L19A 3ILFA 5CG9A 4XFCA 2ZHNA 3GNEA 1IS4A 2OT7A 2D6OX 4QKBA 4FOYA 2E63A 1OD3A 1Y9GA 5KXDA 5C7GA 2OIIA 3WSOA 4B7KA 4I2OA 2PQQA 2R043 3QH7A 4KQ7A 4I0AA 4EN6B 5A70A 4XILA 4Y26A 3BTAA 2TBVA 2ZMLA 1K5MB 3VB9A 5LATA 4AVVA 3B94A 1C4RA 1W6PB 1W0NA 1F5FA 3BODA 4ARXA 5JCTA 1UU4A 3ATGA 5JXGA 3LDBA 1CN1A 3AP4A 1CX1A 1LEMA 2YBKA 2O8QA 4Q4Y1 4EWEA 1COV1 1ONAA 2P4EA 4Q0VA 5FUPA 4BB3A 1OQ1A 3T0BA 3HAGA 3J7LA 4JX0A 4NPRA 3RZKA 2Q8CA 2Q30A 1U12A 5DDJ2 4P9LA 1CAUB 3RJ2X 2RS51 2P2KA 4RHV2 4M0NA 2JDKA 4FXKB 3A7QA 4FPLA 2BNMA 4HG6B 4INDA 4Z2WA 4KWJA 1HN1A 4ITCA 5A7NA 1N3PA 1AR72 2PAKA 1K5JA 1IKQA 5FQ0B 1WCKA 4LBQA 3O0XA 3TBDA 1JTZX 5JMCA 2H0VA 2LUWA 5K4LA 3HWJA 4LE3A 4XAEA 1G9DA 1IS6A 5FWEA 5LBBA 2TUNA 4YWAA 2QUOA 5JXIA 3UKNA 4Q4X1 4FAGA 2HEVF 1TME2
chains in the Genus database with same CATH topology
2DUQA 3ZXAC 2XL9A 3AP7A 1CR7A 5C8CC 4C1XA 1PVC2 2G9GA 4XMIA 1QOSA 1B35B 1MACA 2ENRA 2IXLA 1C3HA 3WDTA 4WBBA 1PGSA 4AF9A 3M3QA 5CFCA 5ABJB 3N36A 2ZGKA 4AFCA 5C9AB 3BALA 4L99A 1G9BA 2ZGOA 5K0UC 3OPZA 4UW3A 2XB6C 1SBEA 1FOD2 3SISA 5LRRA 3ZFGA 2R0HA 4A7YA 3E6CC 5GZGA 2VMHA 5I0RA 3JD71 2A3YA 1QH6A 4Q4V2 5EYXA 3V0AA 3BU7A 2K0GA 4LBLA 1VBA3 1PO23 3GALA 3HR9A 3OJBA 1GQHA 1PIV1 1UPIA 4XFGA 2P17A 1LOAA 2D5FA 4IEVA 3M3CA 1UN1A 1SLTA 4BMEA 2XG3A 2BBVA 3MICA 3SITA 2WC2A 1HKDA 2WNUA 1JHNA 2ZHKA 1C5HA 3ZYRA 2WA4A 2XLGA 1U5XA 4B7EA 4JDOA 1QY4A 1Z0HA 3FBYA 3FFQA 1ZRCA 1CX4A 5CG8A 3QCWA 3AXEA 3FC0A 3VBHC 4KU7A 4OFGA 4GULA 3WCRA 1K5MA 1SQ4A 2RS33 1W6PA 4ASLA 4IERA 3DUIA 1OLQA 1LENA 1ZRDA 1VBB1 4UXAA 3CO2A 1XE8A 2ARBA 2ZA9A 4LO5B 4BWOA 1G9CA 1RMU1 4KGGA 4Q4Y2 3SCGA 1COV2 1CAUA 3AMPA 2AENA 5BY5A 5AC91 1W6MA 2RS52 3RI9A 3KD4A 1W6QA 2VUAA 1POV0 4S2GA 2VW1A 1S1AA 4N90A 3BOPA 1UU5A 3ZYIB 2HWB2 4OI2A 5T5LA 2D7FA 3RMXA 3D82A 4YZ3A 4R4ZA 4E4DX 2YY1A 2XKOA 4H55A 4K40A 3ROUA 4N53C 1FV3A 3BPZA 4B4PA 4R8HA 4XJAA 1ULGA 5A32A 1MS0A 1VAMA 2R073 4V1PA 1GZCA 2WT0A 1VB4A 1VBD3 1CIWA 4Q4X2 2WWSA 3RZZA 1NCRC 5HBAA 1CAXB 4MZUA 1B35A 3PMEA 1RL3A 4G9SB 4A7ZA 4P9GA 1KDMA 3KS7A 4KWKA 5ABJA 1HRV1 1WMDA 5H9SA 1RVF1 4QT6A 4CYDA 2WZR1 4YM0A 1LB2A 2JECA 5KHIA 3J8F3 3QBQA 3VKLA 5FMOS 2EF6A 3KM5A 2OA2A 4FPJA 4H14A 5C8CA 3APBA 1XRUA 1FAYA 1ZZ8A 1G8WA 2CGNA 1GICA 4XJ8A 2WFF3 3U11A 5KC5A 3V0BB 3D5OA 4JQRA 2LALA 1O3SA 3DPRC 4GWNA 3JD72 4I01A 5CADA 1NY71 2RR11 5DZEA 2ZGQA 3WINE 1OA2A 3O14A 4AQ2A 1ULDA 1H1IA 1RUOA 3POWA 3OGGA 1QJX3 3PTYA 5AFBA 1AL0G 1DU3D 1PIV2 2JXAA 2UYAA 2VMIA 1KXGA 1Q8OA 4LO4B 1PK6B 1BBT2 1LOGA 1LULA 1FATA 3S30A 4YZ1A 1DQ1A 2BQPA 4CRQA 1T6GC 2GN3A 1RUG1 1KJRA 4M00A 2VQ0A 1BKZA 2YPJA 3WNXA 1ENQA 5AVPA 4L2NA 1OQDA 2HKXA 1ZRRA 2P37A 5BNQA 1QJY1 5BNPB 3M7AA 1YFYA 1LESA 3JQWA 1FNYA 1AJOA 5FO7B 3NKGA 2EVXA 3WW2A 4D94A 5JSRA 4ZU7A 2DFBA 5JPNB 2RJLA 4ZU5A 3VBFC 2GMMA 1J1TA 4OHXA 2YYOA 3B93A 5D8AB 3MW2A 1F2NA 4M3CF 5FPZA 3RMYA 3VZJA 4AVSA 1VBB2 3VBHA 5L36A 1KRIA 2XLAA 2PLV1 3QLQA 1RMU2 4P9XA 2MEV3 2PHWA 2WFPA 2LTNA 3RI8A 1ZZCA 1RUC1 1WD3A 3ZSEA 5AC92 2EA7A 1ZNPA 2P3IA 3VLBB 4I0BA 3G6JB 1AX1A 1DDLA 2A5ZA 5DZFA 4CDXB 1EPWA 3ZXGA 4JGYC 1MS4A 1RUJ3 5A33A 3A4UA 4RQPB 1UKRA 1WW7A 1MEC1 2GC2A 1U5ZA 3WZ1A 4XEZA 4MXVA 1GZWB 4B4QA 1ALYA 4P9YA 1J58A 3MF9A 4QGNA 5TSWA 2FZ1A 3WP5A 3VHOA 4LT5A 1FPN3 4Q8LA 2ERFA 1V6NA 3L9JT 4XJ9A 3WDVA 5KXBA 1S55A 4Z07A 1CAXA 5DG2A 5H9QA 3NVCA 5F5QA 5C4WB 1BEV1 1RUI1 1OD5A 3FLTA 3AB0A 1H8TC 1HRV2 1RVF2 2KXLA 3BOWA 3ZMOA 1QNWA 1NCRA 3ST7A 4A7KA 4RGGA 3QH6A 1B09A 4TZDA 3V0BA 1R083 4CEWC 4N43C 2DF7A 3H3ZA 1AXZA 2EXIA 2PA7A 5KHKA 4KH9A 1YIPA 5I8SA 1XE7A 5FPXA 2RR12 4KBBA 1DZRA 3PVNA 4HKOA 4YG3A 1RC6A 3QD6A 4Q27A 2ZZJA 2HWC1 1PK6A 2WS93 2D43A 4JC1A 4IEOA 4DQAA 3POSA 4GMP1 4H7MA 4QQOA 1RJ7A 4JAAA 5T54A 4FT8A 5JVVA 3ETQA 3RJRA 4X8PA 4LBJA 1RUG2 2YHJA 3ZYPA 5E1RA 2ET1A 2R062 5BNPA 3WW4A 2JEMA 4FPFA 5A3MA 4OI1A 5CA6A 1QJY2 4TSVA 4K7JA 5J09A 1UU6A 2ET7A 1OMIA 1LHWA 2BVBA 3J26N 5CAZA 3EJKA 3D6EA 5I91A 3M8LA 5DDJ3 1I6XA 4RHV3 1VLNA 1UAIA 2DCKA 3ES4A 1HXS2 1J59A 4LHLA 1WW6A 4UBHA 4JV4A 4OHWA 2P3KA 3B01A 4YW1A 2PLV2 5FRAA 3VBFA 3LSDA 2DUOA 1DLLA 1YIFA 2PELA 2JG9B 4N9HA 3WW1A 3WP4A 1URXA 4BLIA 3KGLA 3FFZA 4FAHA 1NQJA 1R1ZA 4CDXA 1EAH2 1KJLA 2CWMA 4DOUA 2ZKLA 2DVDA 4W6WA 2QZ3A 4RQPA 4QPIB 1UD1A 4O9EA 1W0OA 4XQWA 3IDBB 4Z8BA 1RHI3 2VOWA 3VBRB 3MEPA 1MEC2 1GZWA 5GZEA 1AYM2 2A6XA 3KQRA 3I59B 4K20A 4IEQA 4XYXA 1LOEA 4IEPA 2EXKA 4LO6B 1C5IA 2Z79A 2ZGMA 4MLOA 3TN91 4YVWC 4MV2A 5C4WA 4FTEA 5F6KA 4YFZA 1RUF3 2NMNA 1FOD3 1BEV2 2DV9A 1RIRA 4XHXA 4JCKA 4Q4V3 4QPYA 1H30A 3R4UA 4GA9A 3JQXA 5JIUA 1JBCA 3FUOA 3AK0A 3E5UA 4AGGA 5FDBA 1H8TA 3PMSA 1Q43A 2UWCA 1ZBA3 2FBEA 1C8NA 2D6PA 2PHTA 3PVEA 2P34A 1DQ4A 1Y7BA 2XVGA 3MYXA 4D7TA 2GNDA 5L73A 4BPZA 4P9IA 1W39A 4J1WA 5C6CA 4CEWA 5JI9A 2PFWA 4N43A 2AREA 2HWC2 2XWJB 3VBSC 2OUHA 1DQ6A 3L2HA 1H4GA 2FZ2A 4MYEA 4HVRA 4COWA 3KT7A 4Y1VA 1REFA 2QDRA 3B9IA 4KL1A 2ZTNA 1GYKA 3AMMA 4WZFA 5FO9B 4DZGA 1XYOA 5JOZA 4DINB 3LAGA 2IXCA 5J96B 1V9U3 4PIXA 2VNRA 1G6NA 3CJIB 3OYWB 4XHBA 4AI2A 1LOCA 2VUJA 4JGZB 3H1WA 3N7MA 1OKQA 3RG0A 2B45X 4HK8A 2BNOA 2Y0OA 2X5IB 3VHRA 3V65A 3B69A 1LJ7A 3OBRA 1COV3 5JLVA 4CDWB 1LRHA 3EBRA 3ZXKA 1Z7S2 3FZ3A 2BVVA 4FO9A 3VBUC 5IUQA 1GBGA 1V6MA 5JOYA 3FMGA 4IL7A 5E89A 5GALA 3WHTA 3T2TA 2IXJA 2HWB3 2JG9A 5I0UA 2R6QA 1WLWA 3AKQA 2QVSB 4S2FA 2EIGA 2RS11 5EWSA 3T1MA 2PAEA 1OOPB 4BE3A 1RUH1 1DIWA 2WT2A 4QPIA 3BIWE 1QKQA 1WD4A 2DVGA 2ZACA 3VBRA 2HWD3 3MPBA 2RJKA 3UL2A 5EXOA 3IIAA 3WCSA 1DYKA 4HZFA 2VQAA 2ZJCA 2TEPA 1BYHA 1LKNA 1ZA4A 3C2UA 4MGYE 3IT8A 5T55A 1HX6A 4PDWC 4AEDC 3T1LA 3AM2A 4HSLA 1QJU3 4LHKA 1DG6A 3ZIXA 1NQDA 1S0GA 4XMAA 4Y20B 2XJQA 4NOTA 3RDIA 3TN92 1XNBA 2DWRA 4AEJA 4LA3A 1NCQC 2Q1ZB 4HT1T 1U5YA 1VBC1 1OPOA 1FV2A 1SBDA 1RUE1 2HWF1 4E4SA 4BLJA 4A2UA 4G3YC 2O1QA 1R092 2D97A 1R1A1 1HRI2 2GU9A 2JD4A 3OF1A 5BNNC 1BMV1 4YVWA 1N3OA 4OI4A 4AEKA 2PHLA 2UYBA 4I3PA 4Q4W1 5CFCB 1VBE1 2IXHA 3MW3A 2VY0A 3AMHA 4MXWA 4G4FA 4BA6A 1S2KA 2OZJA 3I7DA 3DGTA 2LM3A 3GZTB 1BVP1 3MIGA 4LTAA 4RA0A 3ZFEC 4PF5A 2E7TA 3ENRA 4IEWA 4EV0A 1BBT3 4GB33 3ZFGB 2JDZA 4Z82A 1ND3C 1OFSA 3LKJA 1LHUA 4BZ4A 2I2SA 1ZM1A 1LTEA 3M4FA 4IV3C 1C1LA 1X36A 2DCZA 4LLOA 1WUVA 2ZAHA 1PZ9A 3TAYA 4UW5A 4EN0A 1JXNA 4E2GA 1SDWA 3Q9OA 4Y22B 1LOFC 1FMD2 3CJIA 2XUMA 3MI8A 3OYWA 1LECA 4JGZA 1GV9A 2D6LX 4DS0A 5JZGC 1EV11 3ZFFC 4E27A 1Q8QA 4OZXA 5DUUA 2E9QA 2B8MA 2X5IA 4XW3A 2JG8C 3AKTA 1RJ8A 1W0PA 3JB4C 2IFWA 4HK9A 4CDWA 4L11A 1DGWX 3LOIA 3WR0A 1RMU3 3DN7A 4PIYA 4BOWA 4EN8B 2VG9A 1VRH1 5J3UA 4XDQA 1A3KA 2V5YA 3O0WA 4OULA 5SV8A 3NL1A 2GNTA 4FCAA 1MZEA 2PHDA 2XVKA 1OA3A 3IBMA 4HVOA 4AHXA 1HW5A 1OOPA 2RS12 2QQPA 3VBUA 1TQ5A 1KFXL 3RSJA 1I9RA 2BFUS 2MNGA 1RUH2 4LA2A 2E7AA 1D0GA 1V70A 4CDQC 1W6MB 1MZ5A 1QQP3 3D8CA 1W6QB 3IPVB 1QXPA 4R9CA 3WD5A 4XJWA 4R9BA 5ACA1 4P9JA 3H7YA 1WCDJ 4BCUA 2AYHA 4HN1A 2PHUA 3INAA 3NAPC 4BYYA 4Y20A 3FUQA 1LGCA 5KHJA 4KWLA 4BH9A 3JB8A 1PNFA 3ILNA 1POV1 4BIFA 2E7QA 5A32B 1VBC2 3KCYA 4NHMA 2HWF2 1NA1C 1RUE2 2BGCA 2WT1A 3FBMA 4EN9B 1HQLA 1R1A2 2E51A 4MGIE 2ZGTA 3SMHA 1VR3A 2EXHA 4I02A 4LHNA 1NOVA 3VDDC 5FREA 5FAXA 1X50A 1RINA 2GC0A 2ARXA 4LNVA 3QOPA 2RM21 3PNAA 4Q4W2 1VBE2 4MUVA 2ZKNA 4CP2A 5KXEA 5BNNA 5C8CB 4AFMA 2Q1MA 4DY3A 4Y1YA 4RR3C 3M1HA 1S0JA 2JJ6A 4FOQA 3X29B 4WVWA 4XF9A 2WSUA 4AG4A 2QCSB 5FLJA 5IK4A 3WG4A 5IT6A 1PZ8A 3AZYA 4YGBA 4TLFA 4XQDA 3RPQA 4IQPA 3WDUA 2VVDA 2R063 3TNPB 3CJXA 5BYNA 2DYCA 4GIQA 1ND3A 4R9DA 3WUDA 3VKMA 4WVVA 4AVAA 3IM0A 4Y22A 3JZVA 3AKRA 3ZO0B 2VULA 4IV1C 2A6ZA 1QJZA 3U07A 2MPFA 3D0SA 3OBTA 3VUOA 4K1YA 3W9AA 1W2UA 1EV12 3NV1A 2WZPP 1NE6A 4I3GA 2D6KA 1HXS3 3GHMA 1AYN3 2Z5WA 4M3CE 4MGKE 1ZREA 2XBO3 1SEFA 5JZGA 1WMEA 4FOWA 4QM8A 2RE9A 4XJUA 2ATFA 3ZSLA 2E6VA 3VBOC 2PAMA 4N7IA 1VRH2 3ACLA 4XFAA 1EAH3 2GC3A 4X6QB 2B5HA 3O12A 4CDUC 2ZAAA 1AR91 1XYPA 2W08A 4GH4C 3S7EA 5LEJA 4JRLA 3VBHB 5KXCA 1DFQA 4H3WA 4HBNA 2EALA 2XVLA 1RUNA 1ZVFA 3M3OA 1ZBE1 1AYM3 4LO8A 2A71A 1X8MA 3IPVA 4DPNA 5E88A 3GYDA 1CJDA 5FOBB 2NPIA 1QWRA 4XXAA 1BVVA 3NJZA 4Y1UA 4YNIA 1H2MA 2X29A 1KD7A 2XKPA 4RS5C 4R4XA 4PCRA 5A33B 1NLSA 1IQAA 2R041 4FOVA 4S2DA 1XNCA 1VALA 3USSA 2BWAA 2HWE3 4YVSC 1JW6A 1NXMA 2D44A 3KLSA 1QGLA 1UMZA 4B29A 2VXRA 2OPKA 4YARA 1RTVA 1PVXA 2BTVC 5HI0A 2D6MA 5DUWA 4AVTA 4WVMA 4Y1XA 4QX5A 5DZGA 2WNVC 4Y4YA 4CEYC 1KS5A 1WGPA 2A7AA 4N53B 1IKPA 2GMEA 3VHPA 2K9ZA 1KQRA 3R0RA 4DXZA 1CVNA 1MQTC 2VNOA 2KM2A 2RM22 1NCRB 4META 3H0OA 4W65A 4FP2A 4P9WA 3DKWA 1DZTA 2B39A 3THTA 2N7GA 2UY8A 1YRZA 4DB5A 2IXIA 5K0UA 3NWKA 4AE2A 3AZVA 1YLLA 2XWBB 4AQ6A 4AVBA 2C0ZA 4X6RB 4RR3A 1SLCA 2R30A 5KHHA 4I09A 1ULFA 3HBZA 3WT3A 3MDPA 2ZOEB 1S0EA 3DF0A 3ME2A 2VU9A 3DPRB 4QQPA 3E5XA 5E16A 3VZOA 4E2SA 5AFEA 4YW5A 4OHVA 4HFSA 1O3RA 3N7KA 2VMGA 4YYOA 1Z7S3 2YV8A 4MGZE 4XOGA 1PNGA 1LR5A 1JUHA 2ZGPA 2CY6A 1JOJA 1Q8SA 3KGZA 5T50A 2JENA 1GR3A 3NV4A 2XPJA 1IOAA 5BNOC 4J6GA 4AI0A 2NYYA 2YROA 5FCCA 2K2SA 2WQZC 2NQYA 2DVFA 4C1WA 4YFWA 1VBA1 1PO21 1KS4A 4K9SA 5IK7A 4MVTA 3MIBA 4AFDA 4IEZA 4YGDA 1AR92 3D0JA 4YM3A 2IC1A 2D3RA 1Z78A 1ASJ3 3VBFB 4FBFA 1MS8A 2AUYA 4LUMA 1V6LA 4M3CB 4CDUA 3AP9A 3JBG1 4XTPA 3FJSA 1CPNA 4N9IA 1FT9A 1RUD3 2DU1A 1EPZA 1QMJA 1YO8A 1V6OA 2NP0A 5FMOL 1C8M3 2QNKA 5L7OC 2RS31 1R093 1Y43B 2RMU3 1HRI3 1O7FA 3A0KA 4QQHA 1IGOA 3TNQA 1JYIA 1O5UA 4FQ4A 4JGYB 4LBOA 1PO13 4QU2A 1O4TA 3OCPA 1SLLA 4YVSA 2CAUA 1UPSA 4N53A 3B00A 3USUB 1IS3A 2R16A 3CLPA 4FP3A 1AX2A 2GH8A 4LE4A 1WBLA 3J9SA 2WZR2 4M0HA 2Q4SA 3PJQA 3AFGA 1IPJA 3E5QA 4BM8A 3ZXLA 3KMHA 1V6KA 1IZ3A 1KFUL 4XFBA 4ATEA 1AR83 3PVOA 4FXGB 1YFUA 1H8TB 1AX0A 1MQTA 3O5SA 3GBFA 4XJZA 1KDKA 1RITA 1TMF3 5A3LA 2ZGUA 1PGL1 1HIXA 4W6XA 3ZVXA 1NY72 1LHOA 2VVEA 1FMD3 2R071 5BXXA 2CTVA 1AUYA 3PHMA 1VBD1 4CEWB 3EO6A 4N43B 2I07B 3DPRA 2ZHLA 4FTSA 1N1TA 4S2HA 4XXPA 5EJ3A 2DVAA 2IWGB 4PLMA 2DCTA 3S7IA 5CFDC 2EXJA 3EXUA 3J8F1 5CVRA 3AXDA 3IWZA 4XBNA 1TE1B 1MS5A 5JSOA 4HPKA 1NZCA 2WFF1 2YGLA 3AKPA 1GANA 3RS6A 5EFUA 2R1DA 3ZYJB 4URTA 4E2QA 1YFWA 2WJSA 3GBWA 3LCPA 2FMDA 2XH6A 4MX3A 5CU1A 1F8VA 3E6BA 3VL8A 4YZ2A 1IPKA 2A6VA 3FLPA 1FNZA 1A8DA 2ZX0A 2CGPA 1AR73 3O7OA 1UF2C 3WV6A 4M3CA 5I0SA 1RUC2 2XL7A 2A73B 2OVUA 2WKKA 1A78A 4WM7C 3GZUC 3AJZA 3NSTA 4K3UA 3JBG2 4F8AA 2ZGRA 4U36A 1CAVA 1G86A 4NHKA 2UWBA 3IDCB 2DUPA 2OUJA 4EN7B 1TME3 3WY6A 4WV8A 2W0XA 2ZHMA 3RYRA 1ND2C 1PVC3 2RS32 4JGYA 3OD0A 4BMBA 4NVPA 3POYA 1WW4A 1WMFA 5LK5A 2F6BA 1BCXA 5L7OA 3GZAA 2PHXA 4QPGC 3MZHA 3FLRA 3WX5A 3USUA 1CD3G 4FPYA 2MEV1 4QXKA 2ETEA 1UIKA 1DGRA 3V64A 1RUI2 1UW8A 5T5JA 1O3QA 3MIHA 5JR7B 5JOXA 4D7SA 1H0BA 3W58A 1WLTA 3AP5A 4YVWB 4BIOA 2DTWA 2WIIB 3MFAA 2A75A 2W68A 3SH5A 1YI9A 1RUJ1 5F1RA 1G7YA 2QDNA 4F3JA 1D2QA 4MXWB 3TRSB 1GZ9A 3H7JA 1GQGA 4XFFA 4XFIA 4YW4A 1NYWA 1PGL2 3AKSA 1IS5A 2ZPXA 3B9CA 3VL9A 4HVQA 1FPN1 1WLDA 4E4ZA 2R072 2R0FA 5GLZA 4AGRA 3ELNA 1H1AA 1VBD2 1VP6A 1CONA 2V73A 4F83A 5AVAA 3AZWA 3WXPA 1X82A 2QE3A 1M06G 4QD2A 3VZLA 3E97A 1V6IA 4QGMA 2XJVA 1N47A 4XETA 5I93A 3R4SA 5KWRA 4JVAA 3I4IA 4ISQA 3VKNA 3S0MA 3VBSB 3H8UA 1QH7A 4EWDA 1R081 3ZSKA 1KITA 1VRH3 1DF0A 4PBPA 3THPA 2WFF2 3ZMNA 2WA3A 4YW2A 1WBFA 4WM8C 1FI2A 3H50A 1EY2A 4Q4Y3 3ZSMA 1H9PA 3ALQA 3FHIB 1S0BA 3TOJA 2RS53 2P3JA 2WS91 1HV0A 2ZMNA 2CAVA 2FHRA 2ILMA 3CEWA 3MIDA 1LCLA 2D5HA 4H7LA 1NLRA 2D3SA 1UIJA 4ONUA 5SV5A 2OYZA 4DY5A 3AZZA 1ENSA 2Q8OA