1RUG2

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
molecule tags Virus
source organism Human rhinovirus 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rug200
4Q4X3 1AUYA 3VBRA 5BNOA 1PGL1 1IHMA 4FTBA 4GMP3 4CDXC 4AEDB 2ZAHA 1PO13 1BEV2 4JGYA 5C4WA 5A33A 4FTEA 4GH4B 5CFCB 1E57A 2R043 3VBUC 5C8CC 1NCRA 2PLV1 4N43B 2DF7A 4RR3B 1OOPA 1AL22 1BBT3 4CDXA 4Q4W2 4RHV3 3ZFEC 5C9AC 1RUJ2 4YVSA 4YVWB 4Q4X1 1HRV2 5BNNB 5ABJB 1RUD3 1D4M1 2HWC1 5J96B 3IDEA 3VBHB 1RB8G 3ZFGC 3LOBA 1FMD2 4CDUC 2WLPA 1NCQB 1MEC2 1AYN1 2HWB3 3J8F2 1VBA3 5K0UA 2R071 5GKAC 3TN93 2VQ0A 1V9U1 4Q4V3 4RS5A 4CEWA 3VBUA 1HQNA 3M8LA 1R093 2XBO3 1PGL2 1AL0G 1EV12 1RUD2 2RR13 1VAKA 2R073 2R041 5LK7B 2QQPA 2WZR1 4QPGA 4CDQC 1VBA1 3JB4C 1FOD2 5JZGB 1NA1B 1HRV1 2HWE2 1AYM3 5A32A 2RM22 1C8M2 4Q4Y3 1QQP1 1AR71 2RS33 5D8AB 1Z7S2 1X33A 1ND3B 5C4WC 1RUG3 1RUE1 5BNPA 3JBG1 1BBT2 1F2NA 4YVWC 2TBVA 4Q4W3 1RUJ3 1HXS3 4CDUA 5L7OA 4RQPC 5C9AA 4N53C 2GSYA 5CFDC 1TME1 3TN91 1VBB1 1TMF3 5AC92 1HXS1 1RHI1 1RUH3 4FSJA 1NA1A 1EAH3 1PO23 1K5MC 1HRI1 2HWF3 2RMU2 1RUC1 5BNNC 1V9U3 1FOD1 1RUI2 5AC91 1Z7S1 4QPGC 2RS53 5FMOL 4Q4Y1 1RHI3 2RR12 3JBG2 1COV2 4CDWC 1MQTC 4BCUA 5L7OB 1PO12 1MEC3 3VBFC 4JGZB 4RS5B 4CEWB 4GH4C 5CFCC 3VDDB 1PVC3 5JZGC 2WS92 1RVF2 1F8VA 1QJU3 1ASJ3 1B35B 1RUJ1 1ND2C 5ACA3 5D8AA 1AYM2 1BMV2 1RUF2 3JB8A 1VBE1 1ZBA2 1NCQA 5A32B 2HWD1 5DDJ2 1RMU3 1H8TA 1ZBE3 4IV1C 3VBHC 2X5IA 1QJX2 1AR92 1AYN3 2HWB1 1HRV3 2XPJA 3VBOA 4WM8C 1HX6A 1PVC2 3JD71 4Q4X2 2HWD3 4CEYB 3ZFEB 1PO21 3VBFA 4Q4Y2 1RUD1 3VBFB 4GH4A 5CFCA 2HWB2 3DPRB 3VBSC 5A33B 1EV11 1RUI1 5C4WB 4CEYA 1FPN3 1PO11 3VBOB 1PO22 2MEV2 4GMP0 1AR82 1AR62 1COV1 1VBD2 4NWWA 2R072 2WZR3 1AYN2 5ACA1 1R1A3 1EV13 3NAPB 1VRH3 1AR72 2MEV1 5K0UC 5BNNA 3JBG3 2HWF1 4CDQA 1RUC3 1B35A 1PGW1 1QJX1 3J8F3 1QJY2 1VBA2 1R1A1 2WS93 4N43A 3VDDA 2ZTNA 3DPRA 4JGZA 1PIV2 4Y4YA 1QJZA 3ZFEA 1AR91 1C8M1 5J98B 4AEDA 3ZXAC 5DDJ3 2Y26A 2WFF3 4RS5C 4CEWC 1BEV1 1NCQC 1NY72 1ZBE1 1R083 2X5IB 1HXS2 1H8TB 1TME2 1RVF3 1ASJ2 2WWSA 5ACA2 1RUH2 1CD3G 2WFF1 1C8M3 5AC93 1K5MB 1R092 1NOVA 1A6CA 2RS12 5BNOC 2MEV3 1RHI2 4RHV2 1OPOA 1EAH1 3J8F1 4CEYC 5BNPB 2IZWA 2RS52 1AYM1 1BMV1 4AEDC 2RMU1 1ND3A 1R091 4GB31 1QJU2 3VDDC 4QPIB 2RM23 1VBE2 1ZBA1 1CJDA 2GH8A 5JZGA 5CFDB 4Y5Z0 2RS32 2RR11 1ASJ1 1VB4A 1AR83 1AR63 4IV3B 1RMU2 4QPGB 1PVC1 3JD72 1RUF3 5BNPC 4PDWB 3NAPC 4GB32 5C9AB 2RMU3 4EJRA 1M06G 2BFUL 1RUI3 1RUH1 1AR73 3ZFFB 4JGZC 4NWVA 4CDUB 2WS91 4IV1A 2X5IC 1WCDJ 2HWD2 4WM8B 1AL21 2BUKA 3VBUB 1QJX3 4YVSC 4N53A 1RUG1 2BBVA 1ND2A 1POV0 1RMU1 1RUF1 5ABJC 1HRI3 1QQP2 3FBMA 1QJY3 1AR61 1AR81 1VBC3 1C8NA 1NCRC 2HWC2 2HWE3 2HWF2 1DDLA 1W39A 3VBHA 1POV3 1ND2B 1MEC1 4WM8A 1ND3C 1VRH2 4IV1B 4YVSB 4YVWA 2PLV2 1PGW2 4CDXB 5L7OC 1OOPB 1GFF2 1VBC1 1VBD1 1AR93 4PDWA 1RUE3 1FOD3 2R063 1NCRB 4IV3A 4Q4V1 4WM7C 2HWC3 5FOJB 4Z92B 1PIV1 1VRH1 3VBOC 1NG0A 1ZBA3 5K0UB 1FMD1 4FTSA 1RVF1 1RUG2 2XBO2 4LLFA 4Q4V2 5FMOS 1NY71 1ZBE2 1VBD3 2PLV3 4JGYC 4N53B 1TME3 2HWE1 5ABJA 1TMF1 5DDJ1 1QJY1 1COV3 1MQTA 1R082 3ZFFA 4N43C 1FPN1 3DPRC 3VBSB 1K5MA 1OHFA 1FMD3 4RR3A 1RUC2 2R042 3VBRC 1QQP3 3ZFGB 1SMVA 1VBC2 2RS51 1Z7S3 1VB2A 5D8AC 5CFDA 1B35C 4RHV1 4JGYB 2R061 3TN92 3ZFFC 4QPIA 2WZR2 3HAGA 4RFT0 1NA1C 5BNOB 3VBRB 2RS31 3CJIA 1D4M3 1H8TC 4PDWC 2RS13 2FZ1A 1VBB3 5C8CB 1QJU1 4CDWB 4RQPA 2XBO1 2RM21 1HRI2 1POV1 1BBT1 2ZZQA 1VBE3 2BPA2 1RUE2 4WM7B 4QPIC 3ZFGA 1BEV3 1R081 1EAH2 2RS11 4RR3C 3VBSA 1OOPC 1PIV3 4Q4W1 1TMF2 4SBVA 4GB33 1MQTB 4IV3C 4CDQB 4WM7A 4GMP1 3S6PA 1FPN2 3JD73 1D4M2 1AL23 3NAPA 2WFF2 1X36A 2FZ2A 1VBB2 1V9U2 4RQPB 4CDWA 2BFUS 5C8CA 1R1A2 3CJIC 3CJIB 2R062
chains in the Genus database with same CATH superfamily
4LHKA 3DV8A 3OTFA 1XU1A 2A3WA 4AEDB 2ZAHA 1VAVA 2WA3A 1PO13 5FYMA 2CU5A 2DTWA 4J25A 5T5OA 5A33A 1EP0A 4ZKTB 4PIZA 2WBKA 1REEA 3AYCA 1F35A 3N3HA 4GH4B 4KQ7A 1LESA 4TSVA 5JOWA 2RDNA 1ALYA 1XQNA 3B94A 4P08A 2FDKA 4L8QA 5JMOA 1PZ7A 2Y38A 4R9DA 1N3PA 2ZGOA 1JU4A 4DEQA 2G1MA 3SNMA 4HANA 1RUJ2 1W8ZA 2R0FA 3LIHA 4YVSA 4Q4X1 3KWVA 5H9QA 3WNPA 1OA3A 3KVAA 1A78A 1GANA 3MF6A 3QBQA 1DGWX 5I8SA 1RUD3 4LR4A 2VQAA 3R4UA 3O1TA 4P00B 1D4M1 2VZVA 2HWC1 3C7FA 3IDEA 3U4XA 4OUEA 4JCKA 1FV3A 1IPSA 4AI3A 1FMD2 2CDOA 1NCQB 5GZDA 4EV0A 2GP3A 2BNMA 2DDUA 2P3KA 5I8YA 1AYN1 4XVHA 5KC6A 3KHBA 2YC4A 4LHLA 3HT2A 4D6SA 2IVJA 4I3PA 4CCEA 2HH9A 1IS6A 4NPMA 4NVPA 3WY6A 2RHPA 3LEMA 4Y4RA 3P5BA 1JOPA 5JUVA 5JR7B 1ULPA 3HEIA 1Q8QA 2GALA 2R49A 4O9EA 3TN93 5GLZA 3VZKA 2WWUA 4IEXA 1W8NA 1PK6C 1TZOA 1D0HA 2VUAA 2XDVA 3KMHA 2XBO3 3POYA 2Y6LA 4GWMA 3WG2A 4Q0UA 4B4PA 5F5AA 2XG3A 2RR13 3AXDA 4KWKA 3N4MA 2R073 4LUKA 1Y43B 1ZVFA 3U11A 4HSJA 1JHJA 5JXIA 3BTYA 2D5HA 2WZR1 4D69A 4LLOA 4MGYE 4QXHA 4KWJA 4CE8A 4HL0A 1O7FA 1RYYA 1F15A 1W3XA 3SXWA 5JZGB 2HWE2 1HRV1 3NJZA 2P3YA 3WQ7A 3W58A 1AYM3 2D40A 5A3LA 2Q4SA 2RM22 3VD7A 5LBEA 4Q4Y3 3RSJA 1WD3A 4YGBA 1HV0A 1AR71 1UOFA 2IUWA 2RS33 5D8AB 3BYWA 5IFTA 5LBFA 2K9ZA 4C0HA 3FZ3A 4XZUG 3IIAA 2JG8A 4H7MA 5C4WC 3JQWA 1RUG3 2HBTA 4K20A 4PHZA 3ZSKA 5BNPA 2W95A 1FI2A 1F2NA 1CZVA 4OZXA 2TBVA 5FZAA 2Y34A 1RUJ3 4PBOA 1AX2A 2B46X 3U07A 2VVEA 4OI1A 4C0BA 3PMEA 4Y33A 2XXZA 4B29A 5JIAA 4FPHA 4Q8KA 2XHKA 4OI2A 2VULA 5LK5A 5C3PA 1H9WA 1QU0A 4N53C 2J1EA 5C9AA 4ISRA 4XDOA 2H0BA 4EZHA 5C6CA 1N1TA 1UY1A 4BMBA 4ATEA 5CA6A 4NIGA 2VOWA 3AB0A 1W2OA 5FIXA 5CFDC 2F17A 3KB5A 3LB9A 4XUQA 1HXS1 2Y0OA 5FY4A 3UGGA 4YZ3A 1Q3EA 1PO23 2ZHKA 3D82A 3KV9A 4LE3A 1JOJA 1K5MC 1HRI1 1CAWA 1LOFA 1UZZA 5GLWA 5SV5A 1VMFA 2F4PA 1JW6A 2ARBA 5HBAA 3ZPOA 5BNNC 3V0AB 1RUI2 2W08A 5L9VA 1HV1A 2V4AA 5A6QA 1U0AA 1Z7S1 2DV9A 2QQNA 3WOGA 4ZS2A 2Q1ZB 5FP3A 3WNKA 3HN3A 4QX0A 1OUSA 4QXKA 4LBLA 4OYUA 1Q8SA 3URFA 2P5BA 1C28A 3B7MA 3JBG2 3WP6A 3I2JA 1UZVA 3RMXA 5JMCA 2MNGA 1XBFA 1TQ5A 3AL6A 2C9KA 1DYOA 2ZA9A 3KF5A 4K1ZA 3TNPB 2JE7A 1DLCA 4RS5B 3AYAA 4GA9A 4QXCA 4CEWB 5CFCC 1PVC3 1UU5A 2Q8OA 3SKJE 2Y60A 3S7EA 2OVUA 4ONUA 5HCFA 3TEYA 2BWCA 1RIRA 3MDPA 2PTMA 5E89A 4HK9A 3J9SA 3T0DA 3B00A 1EPZA 2X29A 3PVEA 4LK7A 4P9IA 2XGXA 3SITA 2B42B 3WF0A 1POQA 3W9AA 2ZZJA 2HWD1 2P3IA 4LT5A 5FXVA 2ES3A 1X7NA 3HQRA 4XF1A 3HVDA 4M0NA 2D6LX 4MHUA 2Z69A 1UKRA 3VBHC 3TNQA 1PZ9A 4LBQA 5F3EA 3RZZA 4Q0PA 2AREA 4JDMA 3VBOA 4WM8C 4S2DA 4Y20A 5C71A 1W6MB 4CEYB 3KGLA 3NNFA 4R9CA 4FPEA 4WBBA 3EQEA 2XLAA 1LODA 3SH3A 2QVSB 5LY1A 4KU7A 1QH6A 3I3DA 4QQOA 3VBFB 2JG9C 3RVHA 4XETA 4B1MA 3OY8A 5L36A 4DUVA 2VW0A 4CEYA 3TRSB 4PF5A 5EJ1B 3H3LA 2OPKA 4GALA 4XFHA 2WNVA 3OBTA 1PO11 3VBOB 5I93A 4OQ8A 2YUEA 3H3UA 5HCBA 3HNMA 5FO9B 3O1SA 3L2HA 3ZXKA 2CTVA 2EAKA 3ZM8A 4AR2A 1C3HA 2QQIA 4F7ZA 4A7ZA 3OBRA 2DURA 3H42B 5DAVA 4ITCA 4HKWA 3LEGA 2C9AA 3Q8FA 1VRH3 1AR72 2BV4A 3USUA 4DXRA 4ZZ5A 4I0BA 4YW2A 5ERLA 3BKZA 3ACGA 3JBG3 3WG4A 3WF2A 2PYTA 2HWF1 4CDQA 1XE0A 4XYXA 1KD7A 2X53S 2XJVA 4A41A 2FCVA 3DUIA 4XIKA 4NHKA 1SCSA 2VD7A 3VLBB 1QJX1 3PVBB 2JDAA 3AMNA 1JZ2A 3T2OA 1YYNA 4JC1A 3TOJA 2PHDA 4XPVA 4LXLA 2ZTNA 5JSOA 3VKNA 4YM3A 5JXHA 1CQ9A 4NN0A 5I91A 4MGZE 1QOSA 1QJZA 1H1MA 4CUGA 1GZTA 2GC3A 4ISQA 5KBFA 5ANQA 4N90A 2LRPA 3POEA 2ENRA 1U5YA 1X50A 2ID4A 2Y26A 3B01A 1OSGA 1UU6A 5CVRA 4LBQB 3WT3A 5IFPA 1W6OB 1DQ1A 2G9FA 3BPSA 1VP6A 2VL4A 5T5PA 3ZVXA 1HQLA 5A6YA 2Z79A 2YB7A 3I7DA 1W6NA 2QQOA 3U75A 3R0RA 1HDKA 3H1YA 4XFGA 3OYWA 4MOAA 3RI9A 4AI0A 5EWSA 1WW6A 1C1LA 3WUCA 1O5LA 3AP7A 5C33A 1J1LA 1OURA 4M3CE 3VD5A 3VD4A 1Q8OA 4CPBD 5F39A 4NUBA 1C8M3 1ENSA 1SEFA 2GDFA 5AC93 1K5MB 4OI4A 2VBBA 5HV0A 3MW2A 1R092 5LEKA 1CIWA 4JKLA 4AHZA 2CGPA 4QKBA 4XMAA 1A6CA 2BP6A 1WGPA 3POIA 1CN1A 5DN2A 4BLIA 5KHHA 1H1AA 1RHI2 4NIIA 2OQ7A 3PUIA 2VZ3A 2FHRA 4AHXA 5A1FA 2A3XA 2CAVA 1EAH1 4ZU5A 2XWBB 1O3SA 2ZMKA 4LBKA 4HVRA 4Z82A 1ND3A 1OLMA 1S0EA 3WV6A 4AQ6A 4I2OA 1KITA 3GZUC 4BISA 4BQ2A 1L7RA 4ATFA 2NMNA 3MPBA 2QFEA 1QJU2 2K46A 3A23A 4AK3A 5EFUA 1HLCA 4Y22B 4QPIB 4AWDA 5JLVA 1C5IA 1VBE2 1ZBA1 1VPHA 5FQ0B 2OS2A 2CGOA 4CCLA 5CFDB 3JU9A 1NAEA 1AX1A 2OZ6A 2RS32 2WFPA 1UZWA 4L92A 4D7SA 3MZHA 3WW1A 2CAUA 3DCQA 2W87A 4NO4A 1WMFA 5J3UA 1RMU2 5A3UA 1IS4A 4XAAA 1O3QA 2DTYA 4FPJA 5FZGA 5T50A 3GNEA 1Q56A 1WKYA 2RMU3 3WDXA 5C9AB 2BFUL 3M70A 5KXDA 1HKDA 2W9XA 5CB7A 1OH4A 2A6YA 4KG8A 3ZXLA 1DHKB 1RUH1 2I45A 4PQQA 1MVQA 2VOVA 5FZ7A 4IV1A 4IGQA 1IQDC 2A71A 1W9TA 2XJSA 2L9LA 4QKDA 4RGGA 4W65A 3MIDA 5E1RA 1QJX3 2X05A 3HJRA 2D5FA 4YVSC 4ASKA 1GQPA 1RUG1 2D7FA 1X8MA 2W52A 1POV0 4A3ZA 3BIWE 3HNBM 4PIXA 1OUXA 5LWBA 1QQP2 3UESA 2JIJA 1XNKA 4KH9A 3VB9A 4Y3OA 3VKLA 3O1RA 2O14A 1S55A 2EXJA 1MZ6A 2HWC2 1W9FA 5CZKA 3ITQA 2E7TA 2EXKA 2KM2A 4Y1XA 2XKPA 4BK4A 2P1BA 3PIGA 3OPWA 4YG6A 4AFBA 1QXRA 1WW5A 4XF0A 3VBHA 4CP9B 2VQTA 4KWUA 2YC2A 4QHZA 1T6GC 1WBLA 4Q2FA 2VZ1A 2PQQA 3VUOA 2E26A 1SLTA 3AL5A 2JWPA 4UW5A 2XQRA 4WM8A 1LJ7A 1SFNA 1UAIA 3PNAA 5K4LA 5DUXA 1G9CA 1YWKA 4KBZA 3WQ0A 4OULA 1VJ2A 4P9XA 3DEMA 2DCJA 2VCAA 1VBC1 4JV4A 1PMJX 1AR93 4MGTA 5FY0A 5CG8A 2R063 1NCRB 1OKOA 5C5UA 2DU0A 1F4AA 1JYCA 3LDRA 5DABA 3K2OA 1VRH1 1XPWA 1ULGA 4Y1UA 2XONA 3PIJA 2WT0A 3KVBA 4FFIA 1DP0A 2P6CA 1JN2P 4XJZA 1FMD1 4FTSA 2H0VA 3A0NA 1OI6A 5HXMA 2VZOA 5FPZA 1Y4WA 4UBHA 4CVUA 3HBZA 1JHNA 3FHQA 4Q4V2 3UGHA 5CYYA 2PLV3 5FK8A 3ZYRA 4BM8A 4CCJA 2EAAA 2BRTA 5GZGA 4M4RA 4EN8B 4YM0A 1FNZA 2VUCA 2HWE1 3UJOA 4NRQA 3THCA 3ZOIA 4URAA 1RXFA 2ARCA 1QJY1 4NAMA 2AENA 2NM1A 3K3NA 3CJXA 5GZEA 5IAVA 1R082 3HMYA 1UKGA 3RWNA 3NSTA 1W6QB 1QXPA 1K5MA 4HSLA 1FMD3 1OQEA 1D7PM 4E2QA 1EUUA 4WZFA 4TYSA 1UPSA 2UURA 3AP5A 1ZZ6A 4FPOB 5I0RA 2OKXA 1GMMA 4GQ7A 1DGRA 4Z2AA 1YQ6A 2HKXA 4OHZA 4HFSA 1J3PA 5CFDA 2OZJA 2JDKA 3ENRA 3X29B 1GWKA 3SH4A 2R061 3NVCA 3M3IA 4NHMA 1F5FA 1W9YA 3KLSA 2WZEA 4KBBA 4PI0A 2D98A 1LNSA 2XJUA 4CTEA 4ZONA 2JB4A 1YXWA 1RUOA 3CJIA 5IATA 4PDWC 4LBMA 4C91A 1ENRA 1SZBA 4BQYA 3T1MA 1HJGA 3BN6A 3DKWA 2BTVC 3ZR6A 4CDWB 2A6ZA 4XJWA 1IPJA 3ZDVA 5KHJA 1RTVA 1YFUA 2XBO1 2A3YA 4XFBA 3T3YA 4CSWA 5HV4A 4EE2A 2A70A 4L2NA 5FP9A 2E7QA 3PUSA 4LO8A 2E32A 4HN1A 1ZM1A 2QQMA 1EUTA 4FXKB 1BEV3 3PVOA 2ZGQA 1S0GA 1EAH2 3HNYM 4YW5A 2A73B 2DUQA 3GJBA 2WQZC 2WYSA 3T30A 4CXWA 4SBVA 2XLGA 1URXA 1MQTB 1NLRA 4XDQA 2QQLA 4CDQB 4K8RB 4WM7A 1UQXA 4COWA 1UIKA 5IVEA 1YIPA 4LO6B 5FWEA 1SLBA 4S2FA 2YGMA 4AZZA 1VBB2 2RVAA 1V9U2 1J84A 5T3NA 2VGDA 2NYYA 1IGOA 4LNVA 2YU1A 5F5QA 3RGBA 3CJIB 1GNHA 2JDHA 1AJOA 1AUYA 2BNNA 5BNOA 5JPNB 4GMP3 1JODA 3ZSLA 3ZKUA 1GP4A 4UW6A 4JGYA 4P14A 1MACA 1YRZA 2EF6A 4TLFA 4PT6A 5T5LA 2VU9A 5DUUA 3ECQA 4XIOA 5CFCB 3RZLA 4FP2A 3T4HB 5FYZA 5DAQA 1SQ4A 1NCRA 4BXFA 2PLV1 4AGRA 3WW4A 5CKMA 4N43B 5AFBA 5FOBB 4CU9A 2DF7A 3K48A 1OOPA 3NNJA 1W0PA 4QU2A 3B5LB 4G3YC 3E6DA 3TWIA 2ZKNA 1YLLA 2BW8A 3ZKYA 1OVSA 3ZMNA 2DCTA 3E5XA 4NROA 1UYXA 4YGDA 4A42A 2ARXA 1UY4A 2V72A 4GWNA 4I01A 4IGPA 3WDUA 2YBKA 2XJRA 2DBIA 1K45A 5FP4A 4D7TA 5A6ZA 2K0GA 2FMDA 4H7LA 5AVPA 1ZZCA 3PUQA 5J96B 4O61A 3ZFGC 1RB8G 1XNCA 3C7GA 1SLLA 4CDUC 2V5DA 1P8JA 5I0TA 5A7NA 4ZU4A 3WF3A 5IAXA 2K2SA 1GICA 1G9BA 1KDMA 2ZPXA 3GHMA 2MHFA 3HQXA 3J8F2 1IS5A 1VBA3 1N3OA 3GJAA 3KM5A 5K0UA 5H9PA 2DVAA 2EIBA 2R071 1YQCA 2AACA 3ZN6B 4NRPA 1DF0A 3EO6A 3NNGA 5LBBA 4DRVA 3ORJA 4YW1A 2VQ0A 5E88A 3N9OA 4XZPA 2A6VA 1OQ1A 3VBUA 1JYTA 1HQNA 4FBFA 3UKTA 1ULOA 2Q30A 5C70A 1LGBA 4GKXA 5SV8A 1R093 2VTXJ 2YPJA 1WCSA 1PGL2 4KI5M 1NUKA 2DFBA 1BQPA 3RI8A 4Q26A 4B1LA 5EIYB 3MLLA 4D3WA 5JDBA 1Q5OA 1VAKA 4O9GA 5GZCA 2HEVF 1FV2A 3ZN5A 1OC1A 5FJKA 3H1WA 3V0AA 4QPGA 5IVYA 4CDQC 1VBA1 3MV11 1KRIA 4TXWA 3PVNA 1WMEA 4YLZA 1DQ5A 1L3JA 2BGCA 2GU9A 3J7NA 3JB4C 3M3OA 4BWOA 2PAEA 1V70A 2PAMA 4GD4A 5LRSA 3FC0A 4NPLA 2BVVA 2E7AA 2O0OA 2OA2A 1UY2A 3GYDA 4KG0A 4JHTA 3W5MA 1GZCA 3M3EA 2VZTA 5FZ6A 4QGMA 3MW3A 1VRBA 5IT6A 1K42A 1APNA 1ZZBA 3J7HA 1S1AA 1S0DA 1Z7S2 4YG3A 3DYOA 4CP1A 5FAXA 4YM1A 3KHCA 1I5ZA 3FE5A 2IXKA 3H3ZA 1IKPA 4A3XA 1LRHA 2C1FA 2IVIB 3LIGA 5LA1A 5FZ3A 1CAXA 2Y6KA 1YUDA 2JG9B 4QX1A 4K9SA 2Y6GA 4C8DA 4IEYA 4OLLA 3N7LA 4LPLA 4B3NA 3AKSA 5FZOB 2ZGRA 4FOQA 1EYBA 1G9DA 1UYZA 2OYZA 4LBOA 4Y5TA 4GULA 3T08A 2KXLA 4RQPC 4J6GA 1PGSA 2A5ZA 3NMBA 1JZ4A 1ZA7A 3N9NA 4XABA 5JSPA 1T6BX 1S4CA 2ATFA 1TME1 1CZSA 2VY0A 3MFAA 4QQLA 1VBB1 2DVGA 4UYBA 4JTOA 1TMF3 4ZS3A 3WHUA 4NIHA 4QDQA 4WVMA 2WDBA 1KFUL 1VIWB 4SLIA 3K4DA 5GALA 1JH5A 1PHMA 3I59B 2R1BA 1YFYA 1GZWB 1LR5A 4JTNA 4EQVA 2VOXA 1PMIA 2OUJA 3OEAA 2IC1A 2ZKLA 1AF9A 3WEZA 4JZRA 5AC91 2W2IA 2VZRA 3ASIA 2GMMA 2RS53 1LEDA 3I3BA 2Q0AA 5KWRA 1UOGA 5FMOL 4JVAA 3RJ2X 1RHI3 4JQTA 3ZXJA 2RR12 2PAKA 1O91A 4BQWA 4QKNA 5L7OB 1QXJA 3DGTA 4K40A 1DYPA 1MEC3 1QDCA 4FP3A 3RG0A 1J1TA 3VDDB 2E33A 3J4UH 3IDAA 2C0ZA 3OSDA 3TB0A 4XJAA 2A6WA 1RVF2 1TNRA 3OD0A 3H8XA 3DKQA 2ZGSA 3K4AA 1F8VA 4YSFA 1B35B 3ZR5A 4COVA 1TG7A 2LUWA 5FV3A 1QIQA 2ZGKA 1AYM2 3H7YA 4GWIA 3JB8A 3GCXA 4F8AA 3R6SA 4NRMA 5JPMB 2DBNA 2JIGA 1XJAA 2D6KA 1V6OA 2XJQA 3A21A 1WMXA 4DNYA 5DDJ2 4LHNA 1RMU3 2WN3A 5KR7A 3QD6A 2OUHA 1SBEA 3VKMA 4IV1C 1XE8A 2D43A 1H2MA 3ZXFA 1J58A 1W6OA 4QGLA 3KS7A 3RQ0A 3THTA 3POJA 5FUPA 2XPJA 1GSLA 5I0DA 3N35A 5FCCA 3N7MA 1MS8A 5FPBA 3MO4A 1PVC2 3JD71 2A1XA 4Q4X2 2DVBA 4ASLA 4P5HA 3KV4A 4BQ4A 2P6HA 3VDBA 2ZX3A 4A6OA 1PO21 5F5IA 3WSOA 1WCUA 1XNDA 5H9SA 3OPTA 3MIHA 2WZ8A 1BK0A 1WD4A 2HWB2 4GH4A 5D1IA 2VTFA 1E5SA 2YV8A 4UXAA 4CCOA 5A33B 3KCYA 1V6JA 2ERFA 3MW4A 2J1UA 5C4WB 2JKXA 5KXEA 5EPAA 3VL8A 4YW6A 1S0CA 4ES8A 1PO22 2MEV2 4M3CA 2D6NA 1SG3A 5LB6A 1VBD2 1D0GA 1W8WA 1DLLA 3BVCA 3E5UA 4NWWA 3RYRA 2QDRA 1N1SA 3KGZA 2VMHA 4QT6A 4YZ2A 3L2YA 2YPDA 3VKOA 1R1A3 2Z5WA 3VZMA 4MUVA 3WG1A 1BZWA 1MS1A 4NMIA 3INAA 5K0UC 5BNNA 3BTAA 3M3CA 4HMZA 2ZCWA 2BGOA 3ACIA 1JYIA 1RUC3 2D6MA 3GBFA 3NNMA 3O1UA 3ILNA 2LALA 1V6KA 4DQAA 4BMEA 4CCCA 4GAZA 3MGUA 4XBLA 2GN7A 2OT7A 3IDCB 4MGSA 1ULFA 1R1A1 4N43A 4P9WA 5APAA 4BPZA 3VDAA 3DXTA 2IWGB 2V4VA 4FAHA 1PIV2 1S2EA 3AJZA 4UOJA 1G6NA 3R4DB 2Y0IA 4FPLA 4COUA 4XUNA 4I09A 4LKSA 4W6WA 4D94A 4HETA 3ZFEA 1AR91 4Q0SA 2F4LA 4Y20B 4AEDA 3AX4A 1DQ2A 1DQ4A 3WQBA 1KS4A 3IM0A 4HPKA 5DDJ3 3USSA 2WFF3 4X8NA 1BEV1 1ZBE1 1WLCA 5IHRA 3CEWA 4AW7A 1UY0A 2B9UA 1HXS2 1H8TB 1W6PB 2W91A 4MXVA 3FWEA 4QXBA 2QZ3A 1RITA 4Z8BA 5B4NA 1ZZ9A 3I2GA 1GOFA 1CIYA 4QPWA 1OA2A 3IWZA 1ASJ2 4DUXA 2QBXA 2H6BA 4LJHA 4QX3A 1JZ6A 1OF3A 1RUH2 2DVDA 1STMA 1GR3A 3ZSEA 1XB9A 3LFIA 4DXSA 2WO2A 4OUMA 2VXRA 5FBJA 1CR7A 2R16A 4UFKA 4OMCA 2JDMA 4DXZA 1MS0A 2WINB 1XXNA 2Y6HA 4QX8A 4XMIA 2RDRA 4E4ZA 2Z42A 4AI1A 3GALA 1OFSA 2X8KA 5FY5A 2DCYA 1CJPA 1W2AX 2VVDA 5BPXA 4YYOA 3LSEA 2JB8A 2MEV3 4A2UA 4RHV2 2FDFA 3WQ1A 5FPUA 1LHVA 2I2SA 4P9YA 3UETA 4CEYC 2FD8A 5FYBA 4XBQA 1VAMA 1S0FA 1AYM1 2WAAA 2JG8B 3BTZA 2RMU1 4IE5A 1A3KA 3CMGA 1OFNA 2UY9A 3AP9A 5JXJA 2WYFA 3BU0A 4ARXA 3VDDC 3LF7A 4IEZA 4TLGA 2BOJA 1W0NA 2RM23 3VZLA 1CJDA 1H4HA 1O5UA 2HYXA 1Q43A 2ORXA 4K3UA 3UT0A 3PTRB 2W0XA 5IWFA 4EN9B 4W6XA 4Y5Z0 2A6XA 1BYHA 2RR11 1VB4A 1JZ7A 1JMUB 4AEKA 2QQWA 3AM2A 5I0SA 4W6YA 1AR63 1AR83 4IV3B 2VNOA 4QPGB 5I8TA 1PVC1 3JD72 2E53A 3Q8BA 2KR2A 2QQVA 3MLJA 4PDWB 3F2ZA 4E4DX 4D7YA 5CBLA 1MPXA 4EJRA 1S0IA 5DPNA 1W8HA 2P37A 3H50A 2FDHA 1QOTA 2D3SA 1YFWA 2MPFA 5KHIA 4OHYA 3AMMA 1RUI3 3M4FA 3VN4A 4M01A 4JGZC 5FZBA 2R7EB 3IB3A 4NWVA 3VHRA 2WS91 1WLWA 4CDUB 5DAPA 3TYJA 2HWD2 4WM8B 3VBUB 2QCSB 2VOTA 1VALA 2VMDA 3KT4A 3WCRA 2UYAA 1H1IA 4B4QA 2ARAA 2IXHA 1HB1A 1RMU1 3AMPA 3E97A 5KXBA 1E5HA 1ODMA 1JI6A 5JSRA 4B8EA 1ULEA 5IVJA 3FUOA 4Q0VA 1OVPA 4V2VA 1NCRC 2R6QA 4IE6A 1YCIA 4HG6B 5FZ9A 2HWF2 1YO8A 5LASA 1AZDA 1W39A 5L9BA 5L19A 3NWKA 4EROA 5FYUA 3AYDA 3RFRA 1DZQA 3IDBB 4OHWA 5FZCA 4KMQA 5T55A 4NHYA 4NE9A 3S7IA 4C90A 2JDUA 5B4XA 4HVOA 3O1VA 5IK8A 2DU1A 3FLRA 4MGKE 1NQDA 1BKZA 3Q8CA 2XJTA 4Y26A 4Y24A 4Q29A 1CESA 4OZOA 3WLUA 2YBSA 4IETA 1ZX5A 2EXHA 1GFF2 1WMDA 3V56A 4PDWA 2LM3A 4XTMA 1AXYA 1LECA 4Q4V1 3RJRA 4AGGA 3WVJA 4MXWA 4G4FA 1CGPA 2HWC3 3APBA 2Y33A 4ZXKA 4Z92B 3POWA 1RINA 4DMIA 1NG0A 2OPWA 3VD3A 3OJBA 2PHXA 3D4KA 5GM0A 1MS5A 2GC1A 5BYNA 5K0UB 5GLVA 1W99A 3WDTA 3ILRA 2ZMNA 1RUNA 1RUG2 2PFWA 1UOJA 1W05A 1V6MA 3D0SA 3NRUA 4AE2A 5C7GA 1RL3A 5FMOS 1K12A 1DCSA 3EMRA 5A7WB 4CPBA 2WNOA 3TEWA 3BALA 2ZABA 5FYVA 1TNFA 4L11A 1V00A 4N53B 3UKVA 1TME3 2IXIA 2JE8A 3AMQA 3IMMA 5ABJA 4CXYA 3WR0A 1JOBA 1N1VA 3ABZA 3O14A 4KNCA 5FK7A 4QB2A 5IVFA 4RFRB 4CZSA 4N43C 3UJQA 2ZEYA 3IPVA 2Y8KA 3O0WA 4IDZA 2XLFA 1W9SA 3DPRC 3VBSB 1OHFA 4RR3A 2BGPA 1PMHX 3R4SA 4CRQA 4IUGA 3JZVA 1QQP3 1AXKA 5F9TA 3O1PA 1O4TA 2ZEXA 1T2XA 2AUYA 3FFQA 3ZYJB 1NZIA 1GNZA 4LE4A 1W0OA 5FZ4A 1ACCA 1VB2A 2QQJA 4QMAA 1NKGA 3ATGA 2VUJA 3EYPA 4CCNA 1B35C 4J1WA 3WDWA 1NE4A 1Y9MA 2VBPA 3TN92 5TSWA 4QPIA 3UGFA 5JOXA 1JS9A 3AJYA 3POFA 4GJYA 4YPJA 5BNOB 3KSCA 2Y6FA 2CSGA 1WLTA 1D4M3 1PM7A 5FO8B 4AF9A 1IPKA 2YZ4A 4RQPA 4XW3A 1HRI2 1V6IA 3T4VA 4BDVB 3I2DA 1MS9A 2VAUA 5KXCA 2P17A 3GCWA 3O12A 2BPA2 2CWSA 1JUIA 3L9JT 3FLTA 4WM7B 4QPIC 4MX3A 3C2UA 2LW8A 4CYDA 1WA6X 2RS11 1AJKA 3SQOA 2Q1MA 4QDSA 1UL9A 2LROA 3IPVB 2VR4A 4Q4W1 1TMF2 3E5QA 4GB33 4IV3C 1XNAA 4MO3M 4QAWA 5EQUA 3S6PA 2WL1A 3I3MA 2EA7A 4XURA 3AC0A 2EVXA 2NMOA 1AL23 2LS6A 2NZ9A 1LHNA 2WFF2 2FCUA 1N3QA 2A75A 3B93A 5A7WA 5C8CA 3NKGA 3JUUA 5EYXA 1LOBA 4CUBA 5LEJA 3UV9A 2G4IA 1WW4A 5C3SA 3AKTA 4MADA 1IHMA 4FTBA 2VO5A 4MV2A 1LU2A 1BCXA 1BEV2 1SHWB 2RJ2A 4XOGA 2WNVC 2W1QA 4XUOA 1N47A 3LGRA 4K1YA 3T2QA 4FTEA 4H3WA 5CNAA 2W1SA 5JI7A 4YFZA 3NKTA 2VBDA 1G9AA 1XRUA 3J26N 2QQUA 2YFZA 5FZKA 1QJEA 3VBUC 5C8CC 1CVNA 1O8PA 2XWJB 1GP6A 4AFAA 1YFXA 4D6RA 1U5XA 4RR3B 4UFMA 3ETQA 4XQWA 1LHOA 1BBT3 2P34A 4CDXA 2GC0A 2BDRA 3SC7X 3FJSA 2VOKA 3P6BA 2WJSA 1Y7BA 3OPZA 3LWCA 1HRV2 1OT5A 5ABJB 5HPOA 2J1VA 1NT0A 4LUMA 3NO8A 3OUHA 4BQ1A 3KV6A 4PCRA 3D3AA 3ETPA 3VBHB 4CP9A 1EY2A 3W59A 1CX1A 4R4ZA 1OA4A 1JXNA 3V64A 3LOBA 3FL7A 2HLEA 5J7MA 5LBCA 1MEC2 1F4HA 2PHTA 4AI9A 1O6UA 5C3RA 1QKQA 3LA2A 1YQ8A 4O65A 2JE9A 3IT8A 1Z78A 2VNGA 4E9KA 2BJSA 4R8HA 4PBPA 1L7QA 1UO9A 3D5OA 5GKAC 5JXGA 2JKBA 4XFFA 5JWPA 2QNKA 3S0MA 3I49A 3PDQA 1UOBA 4RD7A 5DMYA 1PX4A 1XYPA 1ODNA 1O4ZA 1JU3A 5T5JA 3M8LA 3PJYA 5FY7A 1UW8A 3IKWA 4AI2A 1AL0G 1EV12 1SLAA 1W28A 1RUD2 2XL7A 2QZ2A 2WC2A 2XH6A 1SBFA 4F83A 2R041 1UF2C 5LK7B 2O1QA 2RV9A 1J3RA 3LOIA 4KGGA 2CL2A 4BE3A 3NL1A 1G86A 4NAOA 3AZWA 3RZGA 2VXJA 2D3RA 3TBDA 5FZ0A 3UNPA 1FXZA 3WP4A 1DBNA 1RXGA 4OI0A 2D93A 5G04L 1FOD2 3GHNA 2DCZA 2GMEA 1UY3A 2P4EA 2XQXA 4AVTA 4WVMB 5DQ0A 2Q5TA 4LKEA 4IXLA 3ZLIA 4BQ5A 4DPNA 4XF4A 5A32A 3S5AA 1BHGA 1CAUB 3CDZB 3NV1A 2I74A 4AVAA 2ZGLA 1JYVA 4EN6B 3E6CC 1ULCA 3GXUA 2BYVE 1FNYA 1ND3B 5HCHA 3WDVA 3I8TA 3RWKX 2D97A 1JZ3A 3J7MA 4JKMA 5JAXA 3UYJA 4YVWC 5CU1A 3OGGA 2VCBA 2GNMA 3PU3A 5IK5A 2JENA 2J1TA 1W8FA 5L7OA 3NJVA 3H9AA 1XYOA 3KCXA 4DRRA 4BU2A 3WNNA 4C1XA 4UF0B 2GZWA 1QNWA 1UN1A 1I9RA 4HZFA 1LGCA 3HQUA 4HLTA 3AK0A 3U4SA 2JICA 1RUH3 4KL1A 4FSJA 1EAH3 4QD2A 1XYNA 2ZX0A 3AP4A 1KQRA 1J83A 2JDZA 2HWF3 4P9GA 2RMU2 1XC6A 2ZX2A 4YNIA 2JD9A 4AXOA 4RL7A 4B7KA 4XACA 4Q0QA 4WV8A 1WUVA 3OGJA 3Q8AA 4YRDA 4ZXEA 3IIIA 3IZOA 1IZ3A 2WWJA 4CDWC 1MQTC 1R64A 2VMEA 3LQCA 3M2MA 1AX0A 4XAEA 3AVSA 5FKCA 3OUIA 4JGZB 3M1HA 4GKYA 3WCSA 5BV6A 2JG9A 4GZ9A 3LDBA 5JZGC 1IG3A 3AZVA 2WS92 1UWWA 1QJU3 1X9TA 3T0AA 1E5RA 1YI7A 1LHUA 4URTA 4COYA 5IVCA 1X8EA 5C3OA 1RUF2 3AXEA 4JQRA 4LKDA 1VBE1 1CAUA 1ZBA2 3MFCA 1NCQA 1HIXA 1KFXL 2XB6C 4META 2ZJCA 3CF6E 4LIVA 3USUB 3T0BA 5EXOA 2SLIA 1W2UA 1H8TA 1W6PA 1W9WA 2BVBA 4LITA 1UNBA 2WT1A 4QU1A 3W5NA 2X5IA 1YEWA 4OHXA 1XSRA 2WZPP 1QJX2 1V6LA 5EJZB 3ES4A 3WHTA 3S5QA 3ZMOA 1AYN3 4M00A 4QX5A 1MVEA 4H14A 2D6PA 1HJFA 1HX6A 4PLOA 4M0HA 3THPA 2HWD3 4FPYA 3OY8B 4AHYA 3VBFA 3WD5A 4AVBA 1RUD1 2WSVA 5CFCA 3ME2A 1RC6A 3ALQA 1RUI1 4AFMA 2EALA 2WT2A 4XF9A 5LCWL 3P3NA 4Q1PA 5A3WA 1FPN3 3DF0A 2YG0A 5FZ8A 1OBNA 3ZXGA 4GMP0 3VZNA 1AR82 4BH9A 4YZ1A 5M0TA 1AR62 3WF1A 5DUVA 5FXXA 3V0BA 2QUOA 2R072 2VMIA 1ZZ8A 2WZR3 5FJHA 2RJLA 1UU4A 1LOGA 3UK9A 1O3TA 2EIEA 3WDYA 3HN1A 5ACA1 3CU7A 3HIFA 5FPXA 1ZA4A 2VPVA 3NAPB 5B2GB 4AHWA 3RYKA 2IFWA 3BB6A 4LOTA 2A7AA 2GC2A 3AZYA 1QGLA 4PIYA 5FKBA 1NE6A 3ZYIB 4IE7A 4BXSV 4JDNA 3NV4A 1OLME 1JYWA 3RZJA 5LA2A 3OGVA 4NIAA 4UFHA 1LAJA 3H7JA 3FUQA 2WNVB 1SBDA 4LBQD 1GYKA 3FHIB 4TWTA 2JDYA 5FLJA 4BOWA 4BQXA 4MYEA 3DL3A 1NQJA 2DFCA 2JDPA 3J7LA 3K77A 1VBA2 1S0BA 4HONA 3VDDA 1KEXA 2HYKA 2ZOEB 5EJ3A 5A7QA 3DPRA 4TN7A 3ZX7A 5FZ1A 5GLUA 4I3GA 3AKQA 1BVP1 3HD8B 4I0AA 2ZGPA 3BU7A 3EJKA 3MIFA 5EYYA 3VZOA 4R52A 4RN5A 1GKBA 4K21A 1TEIA 4Y4YA 4DEVA 1I6XA 4NPRA 2AEYA 1C8M1 3GDBA 1IKQA 2J42A 1U5ZA 2ZBJA 3MICA 1HB4A 1UX6A 5KHGA 3P1IA 3SEEA 2E51A 3OG2A 1VLNA 4RS5C 4CEWC 2WNUA 4OUSA 4ET7A 1NY72 5DUWA 4FPFA 2X5IB 5CADA 2PHUA 3ON7A 3ZN4A 1DGLA 3TEXA 3FMGA 1YNAA 3CNAA 1FAYA 5A6XA 4E8CA 1ONAA 4XILA 5F3GA 4QX2A 5A7SA 1DYKA 1JUHA 2WWSA 5ACA2 1CD3G 3PUHA 1IQAA 4BZ4A 4COZA 4DS0A 5F6KA 5A3NA 1JBCA 1KGYA 2WFF1 3UL2A 5F7UA 4UF0A 3HPNA 3BODA 2QTWB 4QM9A 2P3JA 2WO7A 3W20A 3I4IA 3EXUA 4LA3A 3AYEA 1U12A 4XUTA 5HCAA 4XCAA 1DFQA 1KJLA 2XR4A 3AFGA 4IE4A 1QWRA 2RS12 1K5JA 3B02A 4QQHA 4XQDA 5BNOC 4K6BA 5D2AA 5EZWA 1CAXB 1OPOA 5ANNA 3LPGA 4ORFA 5BNPB 2YY1A 4AOCA 2IZWA 3W21A 3H8OA 2RS52 3O7OA 4W8JA 5F8PA 1A34A 4R4XA 3QLQA 3WF4A 5FXZA 5LATA 4ZHNA 1XOYA 2PXJA 3KCCA 2GNDA 4GB31 3K46A 4LOSA 3OBZA 3CIHA 3OOXA 2X10A 5T54A 2GNBA 5JIUA 3I59A 4FFGA 5BXXA 4UT5A 3JCIA 1WW7A 5JZGA 3RZHA 1SDDB 2IXCA 3U10A 1PK6B 2JDNA 4UI9L 1YQ5A 5JCTA 4FT8A 1ASJ1 2QJVA 3RRDA 4MXWB 4YZ5A 3BOPA 1F9KA 3VZJA 4IW3A 2KA3A 3BTXA 1MS3A 2BOIA 5EV7A 3U78A 1SPPA 2UU8A 5BNPC 1YJKA 5F32A 2Q8DA 5IK4A 1M06G 1W6QA 5C8WA 3WINE 5CIRA 2BEOA 1AR73 3ZFFB 2OXBA 5FYYA 3AKRA 3QOPA 4CCKA 1ZRIA 3NW4A 3N9QA 1JZ8A 2VMCA 1WCDJ 2X5IC 4OMDA 4PI2A 4XFCA 5A7OA 2BUKA 2ET7A 3V65A 3WNMA 2LTNA 5F37A 1OLRA 1UPIA 1PM4A 2BBVA 5ISLA 4L99A 5ABJC 1OXCA 3WNLA 2ORZA 1MR5A 3ZN6A 1QJY3 3PJQA 1VBC3 1W8TA 1CAVB 1S2KA 1US3A 4YM2A 4DY5A 1C8NA 4OCTA 3U0ZA 4A44A 5F3IA 1GWMA 5FZFA 1UXXX 1QHDA 5FYTA 3SCGA 1F5JA 2HEWF 3OGSA 2OIIA 2G9ZA 3NJYA 2WN2A 2J1RA 2ZGNA 1DDLA 4NOTA 2XVLA 3PURA 5LA0A 4AI8A 1POV3 1ND2B 2B7YA 1O4YA 3PL0A 5FPAA 5FY9A 5AVAA 2V5YA 1EPWA 1DGWA 2WQ4A 2ZGMA 2ZHLA 1GQHA 1ND3C 4HN0A 4HK8A 2BNOA 4IV1B 5GZFA 4UFJA 4YFWA 4YVWA 5FLHA 1QH7A 1PGW2 1UIJA 4LTAA 2W5FA 3SKVA 2TEPA 5L7OC 1OOPB 2TUNA 4XJ9A 1VBD1 2VG9A 4Y1YA 3ACHA 4IL7A 3VD9A 1RUE3 4IERA 2OX0A 4FQZA 2YROA 1OH3A 4N7IA 3AZXA 4DFSA 3BOWA 3A7QA 4XFIA 5DAWA 5FOJB 2PELA 4AVSA 2VH9A 2GP5A 2Q1FA 3K3OA 3N9MA 4FOYA 3VBOC 4AAPA 5J1XA 4FCAA 1WCKA 3KV5A 4GJZA 2B8MA 2ZS6B 4I0WB 1GWLA 3G7DA 4QDRA 4ZPIA 2B9VA 3A4UA 2PHFA 3I2HA 2R0HA 2XBO2 3VHPA 2DUPA 2NN8A 4PLMA 1NY71 3H1MA 4TZDA 5T52A 3GGLA 2QE3A 1QEXA 1I5PA 3NV2A 1NYWA 2B5HA 1X9PA 1KDKA 2WRAA 3PMSA 4NHLA 5FMDA 3VV1A 1W90A 1TMF1 5F5CA 1LOCA 5FZIA 5IVVA 4CU7A 1LOAA 1COV3 4XBNA 2OW4A 1MQTA 2VVFA 1A8MA 5A1LA 3ELNA 5EHDA 1HN1A 4AL9A 5FYCA 2UWBA 2WUHA 3LA3A 1SCRA 4FOVA 4XTPA 1YI9A 2R042 5FPVA 1HB2A 4AAXA 4AYUA 1SMVA 1BVVA 4QB6A 3AP6A 3ZIXA 1VBC2 2RS51 5JR2A 2ETEA 3B9IA 3LKJA 5F6LB 3VGIA 4ZU7A 5E6HA 3LSDA 1BK1A 2ZHNA 2JXAA 3IN9A 3RYPA 5LRRA 3ZXDA 4HBNA 2EXIA 3A22A 4A7KA 2HJIA 5FY8A 2WZR2 4JAAA 5A70A 4JHZA 1NA1C 4RFT0 5I0UA 3VBRB 2YXSA 3M7AA 4XQ4A 5GLTA 2WNUB 4K8FA 4ARYA 2WKKA 1GZ9A 1H8TC 1VMJA 1BLZA 1MZEA 4QQPA 4BIOA 2WLQA 3C7HA 3RDIA 2FZ1A 5FYHA 2B39A 1VBB3 2PN5A 2G19A 2XOMA 4QPYA 1QJU1 5FP8A 3ZSMA 5C8CB 4YWAA 3N9PA 1WZXA 5FMBA 1GUIA 2RM21 2P2KA 1POV1 2FDGA 2UY8A 2ZZQA 2D6OX 4PQ9A 2R32A 4RSUA 1RUE2 1JTZX 2ZGUA 3LD8A 3MEPA 3T2TA 4BHPA 2DCKA 3ZFGA 2PHLA 1IOAA 3O0VA 1LULA 1TE1B 1YJLA 1OOPC 1PIV3 3BUCA 4XHBA 1YIFA 2SBAA 4ZY9A 3SMHA 1ZYBA 1QNYA 3EB7A 3LZZA 4LULA 4CCMA 4GMP1 4N8MA 3ZYBA 3OF1A 1O3RA 3HWJA 4MSVA 5FZDA 4I30A 1FPN2 1D4M2 3OYWB 1Y9GA 1B09A 2W1UA 1Z0HA 2E6VA 2FZ2A 4FFHA 3OEBA 4CDWA 1QDOA 2BFUS 2RG4A 4BQ3A 4TTGA 1H9PA 1C5HA 1PNGA 3C7EA 1W06A 5IUQA 4LMFA 3CJIC 3NJXA 4CXXA 2R062 2WA4A 3JQXA 3KZ4C 4QHOA 4Q4X3 2ZX1A 3ROUA 3VBRA 1PGL1 4M3CB 4HPKB 4CDXC 1KXGA 4GXLA 2ADEA 1A8DA 3DXUA 4IEOA 3MI8A 1AHSA 5C4WA 1AXZA 2C4XA 1V6NA 3THDA 4AFCA 1E57A 2R043 3Q8EA 5BUVA 2QQKA 1W04A 4AFDA 5F3CA 3MF9A 3OUJA 4UWDA 1SACA 3MIGA 4M4PA 4BYYA 5A3MA 2VMFA 5FLIA 1CX4A 2CNAA 1D4VB 3FN9A 1AL22 3CLPA 4XEZA 1SFYA 2XVKA 4DIQA 2WABA 2BBAA 4Q4W2 4RHV3 3ZFEC 5C9AC 2D44A 4YVWB 5FUIA 4P02B 3CBNA 1GQGA 3POGA 1ZNPA 4YG0A 2Y6JA 1H4GA 1HW5A 5BNNB 1C57A 4E4HA 3K51A 3KQ4B 5A7PA 2VW1A 5CKNA 2VZUA 3I3QA 2AZ5A 2Q8EA 2W39A 2WLPA 3BCWA 5FPLA 5IJRA 4XDPA 3AMHA 1RJ7A 2HWB3 2WSUA 4YZ4A 5KC5A 4RGKA 1CAVA 2PHWA 4HOOA 3LEIA 4OHVA 1BXHA 5A80A 3ZSJA 3MIBA 4D8MA 1I1EA 3CZUA 2WAOA 3E1F1 4XUPA 5CKQA 2XUEA 3PUAA 4NJ4A 5JOZA 4Q27A 4MHRA 1DIWA 2WQ8A 1V9U1 2CY6A 3IAPA 4IEVA 4Q4V3 2EIGA 4RS5A 5DG2A 3WUDA 2BU9A 4QQ2A 4AVCA 4QHBA 2WR9A 3ZYFA 2W3JA 4R9BA 2QKDA 3T2PA 1OLQA 1WWYA 4BB3A 1YC61 3PU8A 1O8SA 3DECA 1SDWA 3MV01 4Q8LA 4OQ9A 5C3QA 3IBMA 3I97A 1H2NA 1CONA 5JI9A 2GNTA 1H8VA 2IFRA 3AVRA 3MHZA 3ZPYA 5DAXA 2QQPA 4FQ4A 1FT9A 4HKOA 5IW0A 1LOEA 4HKLA 4Q5OA 3CO2A 3C7OA 1GZWA 4FPCA 3WW3A 3ZXEA 1CAWB 3SISA 1PK6A 4XE9A 4EN0A 5FYSA 1C4RA 1NA1B 4O7XA 1UMZA 3BIEA 3POBA 3KD4A 5LW9A 1ZRFA 1C8M2 1RGSA 2AC1A 5KHKA 1IG0A 1U5IA 2E63A 5H9RA 1QQP1 5CISA 2YU2A 1X33A 4UFLA 1XNBA 3I2KA 5K7PA 3LCPA 5F2SA 1MZ5A 3I2OA 1Q8VA 2VZSA 1RUE1 2AEZA 3JBG1 2DVFA 1BBT2 4E4SA 1OKQA 2WNUC 4NIDA 5FZOA 4Q4W3 3RMYA 1CZTA 2ADDA 1HXS3 4CDUA 4J1XA 4HT1T 1WBFA 2RDSA 1W2NA 3K75B 3WNOA 3HBKA 4MG2A 2QDNA 2GSYA 2CGNA 3D0JA 4FAGA 5E16A 3CZJA 5HI0A 1GP5A 4XXPA 1GU3A 4AQSA 2ZEWA 1XU2A 4K7JA 2CHHA 4RGAA 1D2SA 2R1DA 3KT7A 3LEKA 4RYDA 5AC92 1RHI1 5DXDA 1G9FA 1NA1A 3O5SA 5L9RA 3HT1A 3BI3A 1QF3A 4DB5A 4JKKA 4PF1A 1OPMA 3MLKA 1RUC1 3RZKA 1V9U3 3OCPA 1FYUA 2B4KA 1FOD1 1NXD1 3KQRA 1PX3A 2EIDA 3TN91 4QPGC 3RZMA 4AQ2A 1ST8A 4Q4Y1 2VUDA 1COV2 5AFEA 2XHNA 1NXMA 4EWEA 4BCUA 4INDA 1PO12 4IE0A 3GZTB 1HN0A 3VBFC 3ZYGA 1GOGA 4Z07A 2ZEZA 4GH4C 4FO9A 1UZYA 4F3JA 4QWNA 1RJ8A 3MUZ1 1UMIA 2DUOA 1GV9A 2WIIB 4QX7A 1ASJ3 4KU8A 1OD3A 3FBYA 2PA7A 1LTEA 1RUJ1 1F31A 1ND2C 2PMWB 3VHNA 5A3PA 5ACA3 3SH5A 4Z2WA 4IESA 5D8AA 5FRAA 1BMV2 4M3CF 2Z4FA 4QM8A 4P9LA 5J48A 3ACFA 1CPNA 3GBGA 1H30A 1E5IA 5A32B 3OBAA 3BPZA 2NP0A 4YW7A 1VE0A 4CU8A 3ZIWA 2WNEA 2J1AA 1ZBE3 3WX5A 3B69A 5FY1A 3RPQA 1REDA 1JZ5A 3NV3A 1PNFA 1W8OA 2ZACA 4WVVA 4XF3A 4LORA 2VCMA 1AR92 4Y1VA 2HWB1 1MS4A 1HRV3 4QKFA 3U37A 2C24A 5D21A 5K8SA 4MH0E 4MVTA 2B45X 4H2AA 1GLHA 1H2LA 2D3PA 3T1LA 3O1OA 2RDQA 4BA6A 4B7EA 3ZFEB 2W46A 4XHXA 3LE0A 2CV6A 4IEPA 4U2AA 2NPIA 4ZZ8A 3AKPA 3E6BA 2O8QA 4Q4Y2 4ES9A 5C5TA 1ZREA 4LQRA 1H6YA 3DPRB 3VBSC 3FLPA 2J7MA 1EV11 4KGQA 3FFZA 4XC9A 2J1SA 4AGVA 3SEPA 3QH7A 1W6MA 3S57A 4UAPA 4LKFA 5CAZA 2VMGA 4Y1ZA 4DINB 1NLQA 1UXZA 2O8OA 3LDKA 5FBZA 3S30A 3CKHA 4LK6A 4HVQA 1J59A 1COV1 3AZZA 3NQHA 4GWJA 1Y9QA 4FOWA 1L7LA 5DG1A 5FTTC 5FO7B 4C1WA 2AGSA 3B9CA 2CWMA 1AYN2 1EV13 2YGLA 1S0JA 3MIEA 1QOOA 5DZGA 2VE1A 4AQTA 3CHXA 3K4ZA 2MEV1 3I2IA 2Z2SB 3OD4A 1O59A 4CCDA 5J36A 2W94A 3V0BB 1M4WA 1NLSA 3PTYA 3Q9OA 4Y5SA 1B35A 4IQPA 1LKNA 4CUAA 1PGW1 3UKNA 2YFUA 4EZ4A 3J8F3 1QJY2 2VQUA 2W92A 4FPKA 5F2WA 2WS93 1QY4A 3C3VA 2EICA 3N36A 3MYXA 4JRAA 4WVWA 3ZDSA 3EHKA 4XFAA 4JGZA 5A3TA 2H6CA 4NR1A 1US2A 1XNTA 2RE9A 1OF4A 2ZXQA 4S2HA 3KT1A 2XUMA 1CWPA 1W8UA 4MGIE 5FWJA 3QACA 1KS5A 4NHXA 5G05L 5J98B 3HR9A 2VNRA 3ZXAC 2C6SA 4QGNA 4UW3A 1LB2A 3B3QE 1UD1A 2G9GA 1PZ8A 4GIQA 4WVZA 1NCQC 5FYIA 5GJ6A 1R083 2UYBA 3BGAA 4WZCA 5FP7A 3I2FA 4PJYA 1TME2 4DY3A 4OVEA 2VECA 4MZUA 1DZRA 1QMJA 1RVF3 4BLJA 2BZDA 3RNSA 1G8WA 5FR3A 3LFMA 4UBGA 2E31A 4DO0A 2PHRA 2XL9A 1WCQA 2IXLA 4P9JA 3SCFA 2ILMA 4CP0A 2VZQA 3MUY1 4G9SB 2GMPA 2VJXA 4V1PA 4B4RA 4EWAA 1NOVA 4E8DA 4YGEA 4YGCA 3H8RA 4Q1RA 1SLCA 4E2SA 4EWDA 5IK7A 2YC0A 1REFA 4FVVA 4BIFA 4FI9A 3I3EA 2YDEA 3SLIA 3MBWA 5HXVA 5FUNA 1S2BA 1UYPA 3GM8A 2VW2A 2ET1A 2Y64A 3J8F1 2FMYA 3D8CA 1GOHA 1Y3TA 3GF6A 3SHRA 3O1MA 5FZMA 1BMV1 3VL9A 4AEDC 2JG8C 3LA7A 1DZTA 3EBRA 1AVBA 1LCLA 5FZHA 2WO1A 2FBEA 2VCCA 1R091 4IEQA 3AFKA 2VZPA 5DZEA 5FDBA 4FPGA 2BQPA 2IXJA 4OFGA 4RA0A 2VNVA 4LO7A 4L97A 3NNLA 2GH8A 2W68A 4JRLA 3CL1A 5DZFA 5L73A 3D6EA 3KF3A 3TEZA 1IS3A 2JJ6A 1H0BA 1OD5A 2VC9A 3WXPA 1C1FA 4CA9A 2NQYA 1R1ZA 1YQ2A 1VMHA 1RUF3 4CUCA 4X6RB 3O0XA 3LAGA 2CYFA 3NAPC 4GB32 2AH2A 1JYNA 3P3PA 3U1XA 4A7YA 2RJKA 4IEUA 1H2KA 4E27A 4X6QB 3FX3A 1TVGA 4S2GA 2V73A 3ILFA 4A45A 1UCXA 2FDIA 4A4AA 1G7YA 1DGRN 3WW2A 4AG4A 4CEWA 3MPPG 4XCBA 4W4ZA 1AL21 1DQ0A 1I3HA 1DQ6A 5J09A 1MZFA 2AYHA 4JX0A 4N53A 1LGNA 1ND2A 3POSA 5E8AA 1RUF1 4PLNA 1HRI3 2ZX4A 5JVVA 3FBMA 1UX7A 3R05A 4XJUA 5FZEA 4D6QA 1AR61 1AR81 1VR3A 4LO5B 2C26A 1OMIA 1GBGA 3ACLA 3ES1A 5FMCA 3N7KA 1PVXA 2HWE3 4LBNA 1FATA 4AVVA 2DYCA 1UMHA 4HXCA 1LOFC 3WNXA 2ZAAA 4CP2A 1ZRRA 4YW4A 2ZGTA 3IAQA 5F1RA 4LO4B 2FQPA 3H8UA 1MEC1 1OQDA 3HOBA 5EP9A 2GAUA 1H6XA 1KJRA 2ZMLA 4CU6A 1NX9A 1VRH2 5LZ6A 5IYYA 4YVSB 2PLV2 1JYXA 1V0AA 3N9LA 3ST7A 4W50A 4CDXB 2BERA 3VHOA 5CG9A 4JDOA 5LY2A 1ENXA 4H55A 2AR6A 3T09A 1SPPB 3U14A 1FOD3 3WP3A 1LENA 3ZO0B 2X09A 4IV3A 2OQ6A 4WM7C 4D0QA 1K3IA 3JXSA 5J37A 2W47A 2UWCA 4N9HA 1LHWA 1PIV1 5FQ0A 2E9QA 4FFFA 2FDJA 4MLOA 1ULDA 1ZBA3 4L9BA 4EYUA 4Y22A 3N7JA 1RVF1 2WO3A 3IMNA 1ZRCA 3M3QA 1BJQA 3TAYA 4L0PA 1ENQA 5BY5A 4LLFA 5FXWA 1LEMA 2DWRA 4UW4A 1ZBE2 1VBD3 2PQSA 2UWAA 3DN7A 2HBUA 4DXTA 5IVBA 2JX9A 5BNQA 4QB1A 4JGYC 4AEMA 4FXGB 4LA2A 1HB3A 5K9YA 3ZYPA 2R30A 1GNYA 5DDJ1 2YHJA 4P5YA 3RS6A 1YHFA 3I54A 4U36A 4UFIA 3ZFFA 1Q8PA 4ASMB 4Z1VA 4LEJA 1NZCA 1FPN1 2VTXA 5FREA 2YBPA 1LU1A 1D2QA 4A6SA 2N7GA 1RUC2 3VBRC 2XJPA 3ZFGB 3QCWA 5A3OA 2W1WA 4BJ0A 1Z7S3 4KWLA 4EN7B 1QJFA 5D8AC 1HQWA 4RHV1 3CQOA 1W6NB 4LBJA 2F6BA 4IEWA 1CPMA 1SFPA 4JGYB 1W3VA 4MGQA 4DZGA 3ZFFC 4DUWA 3HAGA 2V09A 2FCTA 3GZEA 2RS31 2YMZA 3GBWA 3SCHA 4R9AA 4V2WA 1DU3D 2RS13 3H0OA 4AEJA 2JECA 5CEHA 5A1AA 1ZRDA 1W2TA 2CDPA 4I02A 2XMLA 2J22A 3WP5A 3LPFA 2C5DA 4DOUA 2XVGA 3QH6A 1XSQA 2GN3A 1BBT1 4LIUA 1WA4A 1J3QA 1VBE3 1X82A 2NLRA 2KD7A 3C8XA 2JEMA 3DYPA 4YW3A 4E2GA 4N9IA 1DG6A 2HEYF 1WLDA 3WZ1A 2GH2A 1R081 4XJ8A 4X8PA 1FX5A 3A0KA 4RR3C 3GZAA 3VBSA 2YYOA 3F95A 4N7UA 1UYYA 4BK5A 3PHMA 5LA9A 1N1YA 1SLIA 2VM9A 3G6JB 3DYMA 3ZYHA 5JOYA 3VKFC 1W03A 1ZZ7A 4XXAA 2Q8CA 5FZLA 1XE7A 2BWAA 2XKOA 3FHAA 3JD73 3VDCA 2JD4A 1UZ0A 3NAPA 2ZHMA 1X36A 2TNFA 4YARA 4RQPB 3OGRA 3OB8A 5FFOC 3PLQA 3WG3A 2I07B 4LHSA 1R1A2 4IGOA
chains in the Genus database with same CATH topology
4LHKA 3DV8A 3OTFA 1XU1A 2A3WA 4AEDB 2ZAHA 1VAVA 2WA3A 1PO13 2DTWA 5T5OA 5A33A 1EP0A 4ZKTB 4PIZA 1REEA 3AYCA 3N3HA 4GH4B 4KQ7A 1LESA 4TSVA 5JOWA 1ALYA 1XQNA 3B94A 4L8QA 1PZ7A 2Y38A 4R9DA 1N3PA 2ZGOA 3SNMA 4HANA 1RUJ2 2R0FA 4YVSA 4Q4X1 5H9QA 1OA3A 1A78A 1GANA 3MF6A 3QBQA 1DGWX 5I8SA 1RUD3 4LR4A 2VQAA 3R4UA 1D4M1 2HWC1 3IDEA 3U4XA 4JCKA 1FV3A 4AI3A 1FMD2 1NCQB 5GZDA 4EV0A 2BNMA 2P3KA 5I8YA 1AYN1 5KC6A 4LHLA 3HT2A 4I3PA 1IS6A 3WY6A 4NVPA 2RHPA 5JR7B 3TN93 1Q8QA 2GALA 2R49A 4O9EA 5GLZA 3VZKA 4IEXA 1PK6C 1D0HA 2VUAA 3KMHA 2XBO3 3POYA 4GWMA 3WG2A 4Q0UA 4B4PA 2XG3A 2RR13 3AXDA 4KWKA 3N4MA 2R073 4LUKA 1Y43B 1ZVFA 3U11A 4HSJA 2D5HA 2WZR1 4D69A 4LLOA 4MGYE 4KWJA 4HL0A 1O7FA 3SXWA 5JZGB 2HWE2 1HRV1 3NJZA 3WQ7A 3W58A 1AYM3 2D40A 5A3LA 2Q4SA 2RM22 4Q4Y3 3RSJA 1WD3A 4YGBA 1HV0A 1AR71 2RS33 5D8AB 2K9ZA 4C0HA 3FZ3A 3IIAA 2JG8A 4H7MA 5C4WC 3JQWA 1RUG3 4K20A 3ZSKA 5BNPA 1FI2A 1F2NA 4OZXA 2TBVA 1RUJ3 4PBOA 1AX2A 2B46X 3U07A 2VVEA 4OI1A 4C0BA 3PMEA 4B29A 5JIAA 4FPHA 4Q8KA 2XHKA 4OI2A 2VULA 5LK5A 1H9WA 1QU0A 4N53C 5C9AA 4ISRA 2H0BA 5C6CA 1N1TA 4BMBA 5CA6A 4ATEA 2VOWA 3AB0A 5CFDC 3KB5A 3LB9A 1HXS1 2Y0OA 4YZ3A 1Q3EA 1PO23 2ZHKA 3D82A 4LE3A 1JOJA 1K5MC 1HRI1 1CAWA 1LOFA 1UZZA 5GLWA 5SV5A 2F4PA 1JW6A 2ARBA 5HBAA 5BNNC 3V0AB 1RUI2 2W08A 1HV1A 1U0AA 1Z7S1 2DV9A 3WOGA 2Q1ZB 4QXKA 4LBLA 1Q8SA 3URFA 1C28A 3B7MA 3JBG2 3WP6A 3RMXA 5JMCA 2MNGA 3ZMNA 1TQ5A 2ZA9A 3TNPB 4K1ZA 2JE7A 4RS5B 3AYAA 4GA9A 4CEWB 5CFCC 1PVC3 1UU5A 2Q8OA 3S7EA 2OVUA 4ONUA 5HCFA 2BWCA 1RIRA 3MDPA 2PTMA 5E89A 4HK9A 3J9SA 3B00A 1EPZA 2X29A 3PVEA 4P9IA 3SITA 2XGXA 2B42B 3W9AA 2ZZJA 2HWD1 2P3IA 4LT5A 2ES3A 1X7NA 4XF1A 4M0NA 2D6LX 2Z69A 1UKRA 3VBHC 3TNQA 1PZ9A 4LBQA 3RZZA 4Q0PA 2AREA 4JDMA 3VBOA 4WM8C 4S2DA 4Y20A 1W6MB 4CEYB 3KGLA 4R9CA 4FPEA 4WBBA 3EQEA 2XLAA 1LODA 3SH3A 2QVSB 4KU7A 1QH6A 4QQOA 3VBFB 2JG9C 4XETA 3OY8A 5L36A 2VW0A 4CEYA 3TRSB 4PF5A 2OPKA 4GALA 4XFHA 2WNVA 3OBTA 1PO11 3VBOB 5I93A 2YUEA 3H3UA 5HCBA 5FO9B 3L2HA 3ZXKA 2CTVA 2EAKA 1C3HA 4F7ZA 4A7ZA 3OBRA 2DURA 4ITCA 4HKWA 3USUA 2C9AA 1VRH3 1AR72 4I0BA 4YW2A 3JBG3 3WG4A 2PYTA 2HWF1 4CDQA 4XYXA 1KD7A 2X53S 2XJVA 3DUIA 4XIKA 4NHKA 1SCSA 3VLBB 1QJX1 3PVBB 3AMNA 1YYNA 4JC1A 3TOJA 2PHDA 4XPVA 2ZTNA 5JSOA 3VKNA 4YM3A 1CQ9A 4NN0A 5I91A 4MGZE 1QOSA 1QJZA 1H1MA 2GC3A 4ISQA 5KBFA 4N90A 2ENRA 1U5YA 1X50A 2Y26A 3B01A 1OSGA 1UU6A 5CVRA 4LBQB 3WT3A 1W6OB 1DQ1A 2G9FA 3ZVXA 1VP6A 5T5PA 1HQLA 2Z79A 3I7DA 1W6NA 3R0RA 1HDKA 3H1YA 4XFGA 3OYWA 3RI9A 4AI0A 5EWSA 1WW6A 1C1LA 3WUCA 1O5LA 3AP7A 5C33A 1J1LA 4M3CE 1Q8OA 1C8M3 1ENSA 1SEFA 2GDFA 5AC93 1K5MB 4OI4A 3MW2A 1R092 5LEKA 1CIWA 2CGPA 4AHZA 4XMAA 1A6CA 1WGPA 1CN1A 4BLIA 5KHHA 1H1AA 1RHI2 2FHRA 4AHXA 2A3XA 2CAVA 1EAH1 4ZU5A 2XWBB 1O3SA 2ZMKA 4LBKA 4HVRA 4Z82A 1ND3A 3WV6A 1S0EA 4I2OA 4AQ6A 1KITA 3GZUC 4ATFA 2NMNA 3MPBA 2QFEA 1QJU2 4AK3A 5EFUA 1HLCA 4Y22B 4QPIB 4AWDA 5JLVA 1C5IA 1VBE2 1ZBA1 5FQ0B 2CGOA 5CFDB 3JU9A 2WFPA 2RS32 1AX1A 2OZ6A 4D7SA 3MZHA 4L92A 3WW1A 2CAUA 4NO4A 1WMFA 5J3UA 1RMU2 1IS4A 1O3QA 2DTYA 4FPJA 5T50A 3GNEA 1Q56A 2RMU3 3WDXA 5C9AB 2BFUL 3M70A 5KXDA 1HKDA 5CB7A 2A6YA 3ZXLA 4KG8A 1DHKB 1RUH1 2I45A 1MVQA 2VOVA 4IV1A 2A71A 2XJSA 4RGGA 4W65A 5E1RA 3MIDA 1QJX3 2D5FA 4YVSC 1RUG1 1X8MA 2D7FA 2W52A 1POV0 3BIWE 4PIXA 1QQP2 1XNKA 4KH9A 3VKLA 1S55A 2EXJA 1MZ6A 2HWC2 2E7TA 2EXKA 2KM2A 4Y1XA 2XKPA 4YG6A 4AFBA 1QXRA 1WW5A 4XF0A 3VBHA 1T6GC 1WBLA 4Q2FA 2PQQA 3VUOA 1SLTA 4UW5A 4WM8A 1LJ7A 1SFNA 1UAIA 3PNAA 1G9CA 5DUXA 1YWKA 3WQ0A 4OULA 1VJ2A 4P9XA 2DCJA 1VBC1 4JV4A 1AR93 5CG8A 2R063 1NCRB 2DU0A 1JYCA 1VRH1 4Y1UA 1ULGA 2WT0A 1JN2P 4XJZA 1FMD1 4FTSA 2H0VA 3A0NA 1OI6A 5FPZA 4UBHA 3HBZA 1JHNA 4Q4V2 2PLV3 4BM8A 3ZYRA 2EAAA 5GZGA 4EN8B 4YM0A 1FNZA 3UJOA 2HWE1 1QJY1 2AENA 2NM1A 3CJXA 5GZEA 1R082 3HMYA 1UKGA 3RWNA 3NSTA 1W6QB 1QXPA 1K5MA 4HSLA 1FMD3 1OQEA 4E2QA 4WZFA 4TYSA 1UPSA 2UURA 3AP5A 1ZZ6A 4FPOB 5I0RA 4GQ7A 1DGRA 2HKXA 4OHZA 4HFSA 1J3PA 5CFDA 2OZJA 3ENRA 3X29B 3SH4A 2R061 3NVCA 3M3IA 4NHMA 1F5FA 3KLSA 4KBBA 2D98A 2XJUA 4CTEA 1YXWA 1RUOA 3CJIA 4PDWC 4LBMA 4C91A 1ENRA 3T1MA 3DKWA 2BTVC 4CDWB 2A6ZA 4XJWA 1IPJA 5KHJA 1RTVA 1YFUA 2XBO1 2A3YA 4XFBA 2A70A 4L2NA 2E7QA 4LO8A 4HN1A 1ZM1A 4FXKB 1BEV3 3PVOA 2ZGQA 1S0GA 1EAH2 4YW5A 2A73B 2DUQA 2WQZC 4SBVA 2XLGA 1URXA 1MQTB 1NLRA 4XDQA 4CDQB 4WM7A 4COWA 1UIKA 1YIPA 4LO6B 1SLBA 4S2FA 2YGMA 1VBB2 1V9U2 5T3NA 2VGDA 2NYYA 1IGOA 4LNVA 5F5QA 3CJIB 1GNHA 1AJOA 1AUYA 2BNNA 5BNOA 5JPNB 4GMP3 3ZSLA 4UW6A 4JGYA 4P14A 1MACA 1YRZA 2EF6A 4TLFA 5T5LA 2VU9A 5DUUA 3ECQA 4XIOA 5CFCB 4FP2A 1SQ4A 1NCRA 2PLV1 4AGRA 3WW4A 4N43B 5AFBA 5FOBB 2DF7A 3K48A 1OOPA 1W0PA 4QU2A 3B5LB 4G3YC 3E6DA 3TWIA 2ZKNA 1YLLA 2BW8A 2DCTA 3E5XA 4YGDA 2ARXA 4GWNA 3WDUA 4I01A 2XJRA 4D7TA 2K0GA 2FMDA 4H7LA 5AVPA 1ZZCA 5J96B 1RB8G 3ZFGC 1XNCA 1SLLA 4CDUC 5I0TA 4ZU4A 2K2SA 1GICA 1G9BA 1KDMA 2ZPXA 3GHMA 2MHFA 3HQXA 3J8F2 1IS5A 1VBA3 1N3OA 5K0UA 3KM5A 5H9PA 2DVAA 3ZN6B 2R071 1DF0A 3EO6A 4DRVA 4YW1A 2VQ0A 5E88A 4XZPA 2A6VA 1OQ1A 3VBUA 1HQNA 4FBFA 3UKTA 2Q30A 1LGBA 4GKXA 5SV8A 1R093 2YPJA 1WCSA 1PGL2 2DFBA 1BQPA 3RI8A 4Q26A 3MLLA 4D3WA 5JDBA 1Q5OA 1VAKA 4O9GA 5GZCA 2HEVF 1FV2A 3ZN5A 3H1WA 3V0AA 4QPGA 4CDQC 1VBA1 1KRIA 3PVNA 1WMEA 4YLZA 1DQ5A 1L3JA 2BGCA 2GU9A 3JB4C 3M3OA 4BWOA 1V70A 2PAEA 2PAMA 5LRSA 3FC0A 2BVVA 2E7AA 2O0OA 2OA2A 3GYDA 4KG0A 1GZCA 3M3EA 4QGMA 3MW3A 5IT6A 1APNA 1ZZBA 1S1AA 1S0DA 1Z7S2 4YG3A 4CP1A 5FAXA 4YM1A 1I5ZA 3FE5A 2IXKA 3H3ZA 1IKPA 4A3XA 1LRHA 2C1FA 1CAXA 1YUDA 2JG9B 4K9SA 4IEYA 4OLLA 3N7LA 4B3NA 3AKSA 2ZGRA 4FOQA 1EYBA 1G9DA 2OYZA 4LBOA 4GULA 2KXLA 4RQPC 4J6GA 1PGSA 2A5ZA 5JSPA 2ATFA 1TME1 2VY0A 3MFAA 3TN91 4QQLA 1VBB1 2DVGA 4JTOA 1TMF3 3WHUA 4WVMA 1KFUL 1VIWB 4SLIA 5GALA 1JH5A 1PHMA 3I59B 2R1BA 1YFYA 1GZWB 1LR5A 4JTNA 2VOXA 1PMIA 2OUJA 2IC1A 2ZKLA 1AF9A 5AC91 3ASIA 2GMMA 2RS53 1LEDA 2Q0AA 5KWRA 5FMOL 3RJ2X 4JVAA 1RHI3 3ZXJA 2RR12 2PAKA 1O91A 5L7OB 1QXJA 3DGTA 4K40A 1DYPA 1MEC3 1QDCA 4FP3A 3RG0A 1J1TA 3VDDB 3J4UH 2C0ZA 3TB0A 4XJAA 2A6WA 1RVF2 1TNRA 3OD0A 1F8VA 2ZGSA 4YSFA 1B35B 4COVA 2LUWA 2ZGKA 1AYM2 3H7YA 3JB8A 4F8AA 3R6SA 5JPMB 2D6KA 1V6OA 2XJQA 4DNYA 5DDJ2 4LHNA 1RMU3 3QD6A 2OUHA 1SBEA 3VKMA 4IV1C 1XE8A 2D43A 1H2MA 3ZXFA 1J58A 1W6OA 4QGLA 3KS7A 3RQ0A 3THTA 2XPJA 1GSLA 3N35A 5FCCA 3N7MA 1MS8A 1PVC2 3JD71 4Q4X2 2DVBA 4ASLA 4P5HA 2ZX3A 1PO21 1XNDA 5H9SA 3MIHA 4GH4A 1WD4A 2HWB2 5D1IA 2YV8A 4UXAA 5A33B 3KCYA 1V6JA 2ERFA 3MW4A 5C4WB 5KXEA 3VL8A 1S0CA 4ES8A 1PO22 2MEV2 4M3CA 2D6NA 1VBD2 1D0GA 1DLLA 3E5UA 4NWWA 3RYRA 2QDRA 1N1SA 3KGZA 2VMHA 4QT6A 4YZ2A 3L2YA 3VKOA 1R1A3 2Z5WA 3VZMA 4MUVA 3WG1A 1BZWA 1MS1A 3INAA 5K0UC 5BNNA 3BTAA 3M3CA 4HMZA 2ZCWA 1JYIA 1RUC3 2D6MA 3GBFA 3ILNA 2LALA 1V6KA 4DQAA 4BMEA 3MGUA 4XBLA 2GN7A 3IDCB 1ULFA 1R1A1 4N43A 4P9WA 4BPZA 2IWGB 4FAHA 1PIV2 3AJZA 1G6NA 3R4DB 2Y0IA 4FPLA 4COUA 4I09A 4W6WA 4D94A 4HETA 3ZFEA 1AR91 4Q0SA 4Y20B 4AEDA 3AX4A 1DQ2A 1DQ4A 1KS4A 3IM0A 4HPKA 5DDJ3 3USSA 2WFF3 4X8NA 1BEV1 1ZBE1 1WLCA 3CEWA 4AW7A 2B9UA 1HXS2 1H8TB 1W6PB 4MXVA 3FWEA 2QZ3A 1RITA 4Z8BA 1ZZ9A 1OA2A 3IWZA 1ASJ2 2H6BA 1RUH2 2DVDA 1GR3A 3ZSEA 4OUMA 2VXRA 1CR7A 2R16A 4DXZA 1MS0A 2WINB 1XXNA 4XMIA 4E4ZA 2Z42A 4AI1A 3GALA 1OFSA 2X8KA 2DCYA 2VVDA 1CJPA 5BPXA 4YYOA 3LSEA 2MEV3 4A2UA 4RHV2 3WQ1A 1LHVA 2I2SA 4P9YA 4CEYC 4XBQA 1VAMA 1S0FA 1AYM1 2JG8B 2RMU1 1A3KA 1OFNA 2UY9A 3AP9A 3VDDC 4IEZA 2RM23 3VZLA 1CJDA 1H4HA 1O5UA 1Q43A 4K3UA 2W0XA 4EN9B 4W6XA 4Y5Z0 2A6XA 2RR11 1BYHA 1VB4A 4AEKA 3AM2A 5I0SA 4W6YA 1AR63 1AR83 4IV3B 2VNOA 4QPGB 5I8TA 1PVC1 3JD72 2E53A 4PDWB 3MLJA 4E4DX 4D7YA 5CBLA 4EJRA 1S0IA 2P37A 3H50A 1QOTA 2D3SA 1YFWA 2MPFA 5KHIA 4OHYA 3AMMA 1RUI3 3M4FA 3VN4A 4M01A 4JGZC 4NWVA 3VHRA 2WS91 1WLWA 4CDUB 3TYJA 2HWD2 4WM8B 3VBUB 2QCSB 3KT4A 1VALA 3WCRA 2UYAA 1H1IA 4B4QA 2IXHA 1RMU1 3AMPA 3E97A 5KXBA 5JSRA 4B8EA 1ULEA 3FUOA 4Q0VA 1NCRC 2R6QA 1YCIA 2HWF2 1YO8A 1AZDA 1W39A 5L19A 3NWKA 4EROA 3AYDA 1DZQA 3IDBB 4OHWA 5T55A 4C90A 4HVOA 5IK8A 2DU1A 3FLRA 4MGKE 1NQDA 1BKZA 2XJTA 4Y26A 4Y24A 4Q29A 1CESA 3WLUA 4IETA 1ZX5A 2EXHA 1GFF2 1WMDA 3V56A 4PDWA 2LM3A 4XTMA 1AXYA 1LECA 4Q4V1 3RJRA 4AGGA 3WVJA 4MXWA 4G4FA 1CGPA 2HWC3 3APBA 4ZXKA 4Z92B 3POWA 1RINA 4DMIA 1NG0A 3OJBA 2PHXA 3D4KA 5GM0A 1MS5A 2GC1A 5BYNA 5K0UB 5GLVA 3WDTA 3ILRA 2ZMNA 1RUNA 1RUG2 2PFWA 1V6MA 3D0SA 4AE2A 1RL3A 5FMOS 3BALA 2ZABA 1TNFA 4L11A 1V00A 4N53B 3UKVA 1TME3 2IXIA 3AMQA 5ABJA 3WR0A 1N1VA 3O14A 4KNCA 4CZSA 4N43C 3UJQA 3IPVA 3O0WA 2XLFA 3DPRC 3VBSB 1OHFA 4RR3A 3R4SA 4CRQA 3JZVA 1QQP3 1AXKA 5F9TA 1O4TA 3FFQA 2AUYA 3ZYJB 1GNZA 4LE4A 1W0OA 1VB2A 4QMAA 3ATGA 2VUJA 1B35C 4J1WA 3WDWA 1NE4A 3TN92 5TSWA 4QPIA 5JOXA 3AJYA 5BNOB 3KSCA 1WLTA 1D4M3 1PM7A 5FO8B 4AF9A 1IPKA 2YZ4A 4RQPA 4XW3A 1HRI2 1V6IA 3I2DA 1MS9A 5KXCA 2P17A 3O12A 2BPA2 2CWSA 1JUIA 3L9JT 3FLTA 4WM7B 4QPIC 4MX3A 3C2UA 4CYDA 2RS11 1AJKA 2Q1MA 1UL9A 3IPVB 4Q4W1 1TMF2 3E5QA 4GB33 4IV3C 3S6PA 2WL1A 2EA7A 2EVXA 2NMOA 1AL23 2NZ9A 1LHNA 2WFF2 1N3QA 2A75A 3B93A 5C8CA 3NKGA 3JUUA 5EYXA 1LOBA 5LEJA 3UV9A 2G4IA 1WW4A 3AKTA 1IHMA 4FTBA 4MV2A 1LU2A 1BCXA 1BEV2 4XOGA 2WNVC 1N47A 3LGRA 4K1YA 4FTEA 4H3WA 5CNAA 4YFZA 5JI7A 3NKTA 1G9AA 1XRUA 3J26N 3VBUC 5C8CC 1CVNA 2XWJB 4AFAA 1YFXA 1U5XA 4RR3B 3ETQA 4XQWA 1LHOA 1BBT3 2P34A 4CDXA 2GC0A 3FJSA 2VOKA 2WJSA 1Y7BA 3OPZA 3LWCA 1HRV2 5ABJB 4LUMA 3NO8A 4BQ1A 4PCRA 3VBHB 1EY2A 3W59A 4R4ZA 1OA4A 1JXNA 3V64A 3LOBA 5J7MA 1MEC2 2PHTA 1QKQA 3LA2A 2JE9A 3IT8A 1Z78A 2VNGA 4E9KA 4R8HA 4PBPA 3D5OA 5GKAC 2JKBA 4XFFA 5JWPA 2QNKA 3S0MA 4RD7A 1XYPA 1O4ZA 5T5JA 3M8LA 3PJYA 1UW8A 3IKWA 4AI2A 1AL0G 1EV12 1SLAA 1RUD2 2XL7A 2QZ2A 2WC2A 2XH6A 1SBFA 4F83A 2R041 1UF2C 5LK7B 2O1QA 1J3RA 3LOIA 4KGGA 2CL2A 4BE3A 3NL1A 1G86A 3AZWA 2D3RA 3TBDA 1FXZA 3WP4A 1DBNA 4OI0A 2D93A 1FOD2 3GHNA 2DCZA 2GMEA 4AVTA 4WVMB 2Q5TA 4IXLA 4DPNA 5A32A 4XF4A 1CAUB 3NV1A 2I74A 4AVAA 2ZGLA 4EN6B 3E6CC 1ULCA 2BYVE 1FNYA 1ND3B 3WDVA 3I8TA 2D97A 5JAXA 4YVWC 5CU1A 3OGGA 2GNMA 5IK5A 2JENA 5L7OA 3H9AA 1XYOA 3KCXA 4DRRA 4C1XA 2GZWA 1QNWA 1UN1A 1I9RA 4HZFA 1LGCA 4HLTA 3AK0A 2JICA 1RUH3 4KL1A 4FSJA 1EAH3 4QD2A 1XYNA 2ZX0A 3AP4A 1KQRA 2JDZA 2HWF3 4P9GA 2RMU2 2ZX2A 4AXOA 4RL7A 4B7KA 4Q0QA 4WV8A 1WUVA 3OGJA 4YRDA 1IZ3A 4CDWC 1MQTC 3M2MA 1AX0A 4JGZB 3M1HA 4GKYA 3WCSA 5BV6A 2JG9A 5JZGC 3AZVA 2WS92 1QJU3 1YI7A 1LHUA 4URTA 4COYA 1X8EA 1RUF2 3AXEA 4JQRA 1VBE1 1CAUA 1ZBA2 3MFCA 1NCQA 1HIXA 1KFXL 2XB6C 4META 2ZJCA 3CF6E 3USUB 5EXOA 2SLIA 1W2UA 1H8TA 1W6PA 2BVBA